4MAYC

Crystal structure of an immune complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
191
structure length
191
Chain Sequence
b'ENVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKRPQLIIDIRSNVGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCAASSFGNEKLTFGTGTRLTIIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Crossreactivity of a human autoimmune TCR is dominated by a single TCR loop.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2013-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mayC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mayC02
5JIKA 2BVQA 2VXVH 4FFWD 1W72H 1HHHA 4Q97A 4YHYC 1OGAA 3N1GC 3KPQB 1H0DB 4DFIA 5C6WH 5AAWA 5T5NF 5F8RC 1XH3B 1T6WA 1NGPH 4PJ5A 1JNHA 4YAQB 2H2PC 4YC2C 5GGTL 1SJEB 4MDIB 4KHTL 4KRPD 2XPGA 2BVPA 1BBDL 5D7LE 3QI9B 3K81A 2QEJA 4HHAA 5C0RH 1UZ6E 4O00A 2MWCA 5A43C 3LMJH 2EC8A 4BM7A 1RURH 2NXYC 4Q7DA 4HUMB 4KQ4L 5GSRB 4KVCH 2CDFB 2CKBL 4U31A 5TE6H 5GS0L 4FQ1H 1GGCL 1D5BB 4N8VG 1I85A 2VC2L 2PW2B 5I16A 5ENWB 1JGLL 2ICCA 2APTA 1IAOB 4KUZL 5I66B 3TYGH 1RZGA 2VDRL 5MHSE 1FG2A 1WWBX 1KB9J 5J06A 1UA6L 2VQ1A 2I9TB 5B3JF 5JA8B 4Z18A 2IANB 5IFAL 2EIDA 1QFUH 4DQOL 4HC1A 3TZVA 4L3CB 2DQFB 1L0QA 3EOAA 5DJCA 3V6ZA 1WZ1H 3VFGH 4LPCA 3KJ4C 4I3SL 5HGDB 5KTEL 2J8UB 1A7RL 4M7ZB 4I3RH 1EO8H 3AC0A 3SQOL 2MCG1 2WNGA 3GSVA 3MFFB 3KJ6L 4WIQA 5GJTL 3V6FB 2DWEA 3WJJA 4EI5A 4U7KA 4NYLA 4D9LH 2R23A 1ZSDB 2XA3A 2AJUL 5IB5B 3MLWL 1QSEA 3TA3C 2JJSA 1NMCB 1R5VA 5DEGA 4NPYA 3T4AA 5EN2A 3HZKA 3G6DH 1MCWW 5F1NB 1KPVB 5EBLB 2MKWA 2FX7H 3PP3H 5D72H 4PBVC 1G6RB 3MYJB 3VFRA 4JB9H 4ZTOH 1JZ3A 3VGAC 4Z7WF 2I5YH 2BOBB 3ULUD 4JQXA 3D87B 2AQ2A 4L3EA 4XNUL 1KG0B 3UAJD 1PX4A 3DROA 4MAUH 1EEUA 3KGRA 4G3YL 1WC7A 3QDAA 4RGMC 4GLRH 2X41A 4N5UA 3VXNA 1A7NH 1BPVA 4ODSL 2PYEE 1M05A 3QPQC 1GPOL 1WCBA 4XP4H 5FHBL 4FNLL 2E3VA 5TF0A 3SGEH 1FLRH 3VRIB 5CEZH 1MHHB 4PRHE 1FO0H 1C16A 5BMFH 3D39E 5IQ7H 2Y9RT 3PHQA 2V2TB 1GCFA 4EN3A 3MBXL 4CADA 4FQCL 1WTLA 1WWWX 4LSVH 2XN9E 3QDJE 4MSWB 1BVLB 4MX7B 2GJ6E 5IBUG 3IJYB 2P44B 3S34H 2DYPB 2OL3H 1MWAB 2A9MH 3D3VE 4O4YL 1KLGA 3LN5B 3SDCA 4UIMA 3MRPB 1WLHA 4Y4FA 4KJPD 1UWEH 3PWUB 4P2RB 4J2XA 3ARDC 2KPNA 1NEUA 1A1MB 4GRMB 4LSPH 3T8XB 4PS4L 1A6WL 5CJQH 3DRTB 3KS0H 5MEQB 1JHKH 1N7MH 3CFKA 4DVBB 1BQSA 1VSCA 3OKMB 4BQ8A 4ELMB 3BN9D 3GSNB 3QIWD 4J8RB 2P46B 4POUB 3GBNL 1A3RL 3DI2B 4J3VA 3C6LC 2ADIA 1A0QL 2VLRE 1IGYB 2Z31C 3B8SA 4DGVH 4E0RB 3UBXG 4K71B 3T65A 1EX0A 3REVB 4UUJB 2FHBA 1NCDH 2F74A 3G6JB 4WHTA 3RL1B 2ARWA 2EKSB 4WTWA 1QD0A 1N6QL 2VDOL 3ULUF 1NC2B 4E9LA 1CQKA 3IFNH 1Z2KA 1CFSB 1ZHLB 3RWEA 4F7TA 1VPOH 3U30C 1NDMA 2FJFA 4PREA 1EAPA 1M7IB 1U8KA 1MHPL 3DSNA 2HTLD 4PP1C 1IVLA 1INEL 5I1IH 3VD3A 4PJAA 1AKJD 2Y72A 4PJ9A 2EDQA 4R97B 2GITB 4ZPTA 5T3XH 4J1UB 2IPUK 3CVHA 1RU9H 1HIMH 1BVKA 4KKLC 4XAKD 5GXBB 3EKCA 3V6OE 4RAUA 5I30L 4TNVK 5KS9A 2NY4C 2NY3D 5HDQL 3T0VA 4Y8AA 5TFSL 1AGFB 3V9FA 3N50A 4M4RA 2IH3A 4UILH 5HYJD 3MV8A 4I13B 3S88L 3V4VL 2ZKHH 1J8HE 4EVNA 5DR5L 3C5ZB 3RKPA 1JI1A 1IC5L 4UAOC 5IBUB 1U3HA 1I1AC 1R3KB 2CRMA 2AVGA 1JWUA 2R0KL 3D2UA 4TUKH 4CJ1A 5JHLH 3U1SH 4O02H 3QXUA 3B9EA 3BXNA 1TITA 2X70A 5A40E 2VDQL 3H9SA 3R8QA 5FUCC 4UT6H 5FO9A 5J13C 1UB6B 2WIIB 1MLCB 4O2CB 4L8BA 2W59A 4D0CA 2QR0B 3VI4E 1DBML 2COQA 1ITBB 4ZUWA 1KEGH 4OCYH 3F7QA 5D7LD 1IC1A 4Y2DC 5E99H 5ACZB 2XICA 4J4PA 1IAKB 3GI9H 4DAGL 1NLDL 5CJXC 4D3CL 2GW5A 3WYRA 1WF5A 1S7WA 3VXRD 4PTTB 1NDGA 1BQLL 5F1IA 2HP4A 5DQJA 3HPLA 5C0DB 3UBXB 2YD4A 4WCYL 3BKYL 4NO0D 3RGVB 3FT4A 2QQKH 3WFCH 4XP6H 1IJ9A 5HI3C 1WV7T 2N1KA 4QHUA 3LHPL 4HCRA 3PQYA 3E3QE 1MFBL 5D1XB 4BH8B 3T0ED 5EC1B 3BYTA 5BVJA 4HC1L 3QB7C 2FHCA 1A6UL 4HG4J 1MY7A 3G5YB 5LGHH 2NZ9C 3ZE0E 2ADJB 3O8XC 3NFNB 3EJYD 4JHZA 1UB5A 5BXFA 4BZ1L 3VDAA 4JANA 3NGBB 3NZ8B 4K3EL 1UCBL 2MMXA 3FONA 5EU5B 3FO0H 4RIRA 4PRIB 4U0RC 1HWHB 3MRLA 4JY4A 5TPWL 5AD0B 3O2DA 3MRGB 3MLUL 1KIRB 3DHJA 2NLJA 3BHBB 3VFUB 4XNMA 4N1HB 3GMMB 3D5OF 4IIQA 3BO8A 1J05B 5J56B 2FIKA 4FXKA 3L7FB 1U41A 1OAQL 2BC4B 3DMMA 4S1RH 2ZSWB 3ILQD 3UJTL 2HTKD 3CLEL 2J4WH 5ECJE 5IB3A 2YMXL 4UOJA 1O7SA 4UV7H 3O3EA 4KDTC 2EXYC 2CQVA 3MNZB 4Y5YA 4JRYA 3PWPB 2XACC 4JO4H 3HG1A 1BOGA 3RU8L 2Z91A 1EVUA 4G9DA 1X7QB 1B6DA 3QI9D 1RZ7H 2EDWA 2HVKA 1TQCC 1Z9LA 2H1PH 1RIHL 5C2BH 3BQUC 5HVFB 2DMBA 2FCBA 1YPZA 3LKPB 4U1MB 2FJGA 1IKNC 2Q76A 3U4EB 5E6ZA 4PP2A 3EYOA 4X4ME 2WQ8A 1EMTH 1KN4H 5TQ0L 2PYED 3IDGA 1NCTA 3KPPA 1A9EB 4G7YH 1I8KB 5DRWA 2HKFL 3HA0A 4ZYKA 3I9GL 3CFCH 4AIXA 1HH9A 4I18C 2BVTA 3DUSA 4G6ML 25C8H 1T1WB 2IAND 3BP5B 4I2XB 4PRHD 4GQ9H 3MOAL 4LVHB 2YXFA 2GJJA 3WIHA 4PTUA 2AEQL 1N5AA 1CGUA 3L6FB 2H26B 2JJTA 5EZIL 3NACL 1R24A 3OKOA 4OD1L 4HJGA 4GRLA 4H1LG 2FX8L 2B2XL 3BWAB 1DLFL 4XWGH 4N0FB 1XF3B 4LKXB 4IMKA 4MXVF 4XP1H 1OAUL 3L3GA 2IALA 3E1F1 5CCKH 2A74B 2CIKA 4MWFA 1RZJL 3FQUB 3DGCR 2V7HA 3F5WB 3EYUL 4XI5D 1KTLA 2GJ6D 3QIBB 1HZHL 1BM3H 1T1XB 3MRIA 2DDQH 1UM4H 3D3VD 3PGDB 5FUZL 1RVFL 4R96B 2WUCH 4TSAL 4G80B 5D5MA 1MHCA 5DRXB 4YNYB 4O2FA 4W4NA 3O6FA 2EYTA 2Y36H 5KJRL 3LRSB 3CX5K 1J0JA 4Y19E 1T1YB 4X99A 3UPAA 3VFOB 3GSXB 4YEEA 1ZV5A 4F2MA 1TQBC 4KMTL 4OCLC 4P9HL 1JN6B 2DQEH 4FQIH 3HS0B 1Q9LB 5DGQA 5GZOC 2HYMA 3LKNA 3M8OH 5C6TL 2ARJQ 2WK2A 3RVUC 2QADB 1UKQA 5HHVH 3QXTA 5IM7B 1V7NH 3W2DH 5KVDH 4LEOA 2BSRB 1FYTA 4IRJC 4R9HA 2VLRD 4ONFL 2GJZA 4HUWB 2BRRH 2AJZA 4FQHB 3RQ3A 4D9QE 5D1ZA 4U6YB 1JWSA 3O3BB 5EUOA 3HRZB 1HH6A 3FT2B 3OAZK 3LRGA 1TETL 3FFDA 2H3NA 4LLWA 2D3VA 3RWJA 5BZDA 3LSOB 3DX7B 1Y0LA 2F58H 3DUHA 2VTFA 4N0CD 1J1XH 4XPBH 1QBLL 2R9HC 2HJLA 3C87A 3LN4B 4WO4C 3BGAA 4CVXA 3EJJX 3RL2B 1AGEB 2UY6A 4LARL 1U8HB 5H37H 2DQIH 2R29L 2FO1A 4QRRA 4P57B 3RTQC 5CEXB 3MLTB 1P1ZB 1ZTXH 5FO7B 3ULVD 1UJ3A 1NSNL 1QFWI 2DL9A 2WINB 3GSRB 4WV1C 2YRZA 4HPOL 3LEXB 5C09B 2DYPD 3ORJA 3DUUB 3WLBA 1F02I 1T3FA 5D2NC 4J6RH 2J6EA 2J8UF 3BZ4B 4NP4H 4TVPE 4YR6A 3ULSA 1CE1L 3NIDE 4P0DA 4JM2C 5JXEC 2P5WB 3HPJB 1YNTB 4QNPE 3CVIH 1ONQB 3SOBL 1CFQA 5BRZA 4MS8C 4OLVL 1P5UA 3CK0L 1LO4L 1U3JA 5I1HL 5EIIB 3TH2T 2VLJA 4Z5RA 2V2WA 5DK2A 1J1PH 4YC2B 2FX9H 3MA7A 5FFLA 5IEKA 1F58H 3U6RA 5HYFA 4PY7A 2P42B 1PKQA 1U8QB 3P77A 4NM4H 3UZVB 2OJZH 2H9GB 4S1SH 4S0SD 2NXYB 4XX1G 3QRFM 1ZEAH 4XC3L 1FHGA 5I2IB 3O3AB 4OZFA 5E1HB 1ORQB 2BSED 5GGQH 3AAZA 5D7JA 3GKWH 3MFGB 1G7PA 1CG9A 1NGYB 1DEEA 5D8JH 1S8DA 3U82B 1YMMB 3WE6A 4LSDA 1KIPB 4UOW1 3F7VB 2OX5A 3MZGB 4JY5H 1NC2D 3PL6B 1OVZA 4IMLA 3L3OA 3TN0A 2JLLA 4KY1L 4GOSA 1KPUA 5GHWH 1F11B 3ARGC 3IRPX 1PQZB 4FFZL 2PTTB 3TCLB 2HN7A 5I1DA 3KJ4B 1OL0A 2NX5E 2Z93B 3FN0L 1G7MA 1X4XA 1MFDH 4MD5B 1TCRB 4YDLB 1P6FA 3FO2A 4G43B 3KPSA 4RA0C 3BJLA 2BVOA 4TSCH 5CGYD 1QRNA 1G7HB 3H2WA 4X6EA 1VKXB 3QNYB 3BH8B 3CCHB 3ARYA 2XKNA 3Q2CA 2A1WH 1FO0A 3DPBA 5DJYA 4GW4B 3STZA 3O2DL 2M2DA 2APXA 1ZA6A 3EO1A 3GMPB 4ZOEA 3C5ZD 3LQZA 5DJ2A 3TA3B 3ULVF 5DMJB 4NKIL 1G7IA 2ITDB 5FK9A 5AYUL 4XVUD 3IU3B 3FQWA 5C0EA 5BV7L 1MFNA 3IJHA 3QQ3A 4R7NA 4X7TA 2WBWB 4XP5L 1ZT4B 2ID5A 2PYFA 3MRDB 5JDSA 4A2LA 5E94B 3F7YB 1NFDE 2YZ1A 4R3SA 5ADPH 4GRWE 3QXWA 3S36X 1H5BC 4JPKL 5FM5O 3VGAB 3HAEA 1IC7H 4EOWH 5C86A 2ICEB 3SE4C 5D93C 2CIIB 3WUZA 5KSBA 1W0VA 5GGRY 5TDNA 3CU1A 5FYJL 3VXME 1T0MA 4OLZH 4JJ5B 4LCUB 1QO3A 3BISA 5IUSA 2V5YA 4OV5A 1QYGL 5JPMB 2R0LL 4N8PA 1AI1H 4ELMF 4XP9L 1B4JL 3ARRA 3BUTA 5E08H 5DI8B 1YEDA 1HINL 3EGSB 1KJ2L 4KFZC 3VI4F 4AT6A 4KRLB 1CLYL 5CJ8A 1ADQH 4UINH 3SKMB 3UTTB 5CIPA 3OAYK 3CFEB 1QQDA 5IVNA 3QEHA 1ETZB 3BDXA 3G6JF 4X6FA 3FB8A 4DCQB 1L7IH 5HGHB 1CD1A 4RMVA 1AGCA 4RZCA 5D1QA 5DD6B 1ACYH 4QYOA 4GXUN 2CUHA 4JO1H 4OZGB 3KHOA 1BOYA 1RZFL 4JAMB 4G6KH 5JW3H 1YA5A 3DJ9A 2DJSA 3LD8C 3TESA 1FN4B 3PWNA 4M6AA 4NHCL 5CP3A 4PRID 4NGHL 4PJAE 4RRPG 3EZJB 2PR4H 4R8WL 5HHOE 3ZE0F 3ARDB 4E5XA 4YIQA 5DQ9A 3VJ6B 3P0YH 1WSST 4XWOC 5IMMB 1JPST 1MEXH 4W81A 4KZEL 4HLZH 5E00A 2NNAB 3BH9B 4QHMB 4M03A 3JXAA 4LRIC 1AIFB 1HYSD 4Z7UB 3VFTA 3EOTH 2DIBA 4LP4A 3V8CA 4K8RD 4Z0XA 3MODL 5J9PA 1N59A 1OP5K 3U7YH 3QR2A 3QCTH 3PWPD 5CD5D 2Z31B 2YD5A 1X5KA 1N6VA 3SY0A 5KSUA 2VKWA 3BPOC 2AEPH 2CLZB 1ZGLB 1NFIB 4RMQA 3BKML 3O4OC 1YEIL 3RJQB 4I48A 3T4YA 2ZWLT 1A2YA 1BFVH 5C7XL 3UO1L 1DE4B 2CLRA 3GIZH 4BFEA 5ESVA 1G7LB 1VDGA 3U30B 3GMLB 2K9UA 4NN6C 2IQAB 4HH9B 1FVCA 2EH8H 4TTDD 5GIRB 2VXTL 3B9KA 1FNFA 5LCVL 1CT8B 4ODXA 4PJFE 1IGCH 2QQNH 2VE6A 5TH2B 1FC2D 4D8PB 4PLJC 2DI7A 3T2NH 5C0CA 1EV2E 4NQSA 2DD8L 3CDCA 5DD5H 4A6YL 1Q9KB 3THML 3X13A 3S36L 4PG2A 3FTGA 4IRSD 2A6DB 4U1LA 3REWA 2DWDB 2NY4B 5CD3B 3PNWA 1N8ZA 1Q9OA 2UUDK 4XVSL 3VFWB 2E27L 1EPFA 1DUYB 3VMPA 1LO2H 2YKLH 3SPVA 2ICWJ 2AABL 2JB6A 5E2VL 1NBYA 2C3XA 3ZTNH 2C3VA 3DYMA 3WD5L 5B8CB 2J6EL 1FIGH 5DT1H 1I1AB 2HKHH 3BRFA 4TVPD 3RZCC 1BZ7A 4GBXC 4AEHL 3OX8B 4NHUA 4UOW0 5GGRA 2Z4QA 4YDIH 5T1MB 3D25A 1A6ZA 5J13B 2CR3A 3WEXB 3TJHD 4QTHB 1A6PA 4P3CH 4Y5VC 2FEDC 3X3FL 3U9PH 1DBBL 2VXQH 1FJ1B 1X4ZA 2MTPA 5CWSB 1UCTA 2QADD 4Y2DB 1AXTH 4HUVA 1ZWIA 3QNZB 1LGVA 4M6OL 3TFKD 2AK4B 4YQXH 2ZPKL 5GRVL 4KROC 1AC0A 4OCWL 3SDYL 4OI8A 3Q6GH 2MPAH 5E8DL 1QHPA 4LCWA 5JW4Q 5FYJE 3J7HA 3STBA 1M1SA 4U6VH 1U8NB 3IKCB 1KENH 1MWAH 5HGAA 1UADC 4ZFOA 3FRUA 3ZDXF 3ARBC 3ZHLA 5CMAB 3RWFA 3H3KA 3KLHD 1XGRA 1YPZE 3MA9L 5JXAH 3RWIA 1A1NB 2XFXB 3EDJA 1GIGL 2VDMH 3O8XB 2N7AA 2LU7A 2NX5D 3UYRH 4I77L 1E4XL 3BSZL 1I3RB 1G9MC 4AM0B 2XRAL 4WFFD 3L9RB 4EQ2A 2HT2D 3T77A 2F19H 4U0RB 5J6HB 4M43L 4FFYH 5SWZA 1U36A 5LAXA 2CMRL 1HXMA 5C09D 4QHLA 4TQEL 1D5ZA 2ORBL 1B0RA 1I85C 2W0FA 3O6LH 2OK0H 5BW7C 5FA3A 1GAFH 3QRGH 2W38A 2R0ZL 4I0KA 2Z35B 4HEME 4Q6IA 2P5WD 1MCSA 4UIKH 5IROA 4DGYH 1U8MA 3TM6A 4M7LH 3GHEL 1QLFA 4RBPH 5ADOH 1G7JB 1PX3A 3WDJA 3TZVC 4LGSB 4LCIL 1WAAA 4MJ5A 2H2PD 4XCNB 3U48A 1UJTA 5DJ6B 1RUKH 3CC5B 1KV3A 1UVQB 5D5ME 2R2BA 4M1DL 1TQCB 5E6IA 4JO2H 1NEZA 5C6PB 1F6AA 1VFAA 4JFQB 5I9QC 3V4PH 2NXYD 4GG8A 3VXMD 4XPHL 1EERB 1INQA 2X4TA 4Z7QF 2FJHB 1TVDA 4Y1AB 5F9JA 4FA8A 4H88H 5MENE 3S8WA 3WJJC 2BNRE 3BD3A 2BNQA 4PB0H 4ZDHB 3RWGB 1S9XA 3I2CH 1PG7X 4NJAH 1JPTH 2YPLB 3KVQA 3H3BC 5DURB 3TBYB 3QO0B 3MTRA 1KOAA 5E1AB 4I18B 4H8WL 2HLAB 1KJMA 3VW3H 1JZ6A 4JFHE 4QOKE 4DWHA 2KQMA 3C2AH 2R15A 1CGXA 5I71C 3LPGA 1NGWB 4KDVA 2NW2A 4PD4K 3TPKA 3MUZ1 3ARTA 5IHLB 5IFHL 2ADGA 4YWGL 4J23A 4MB4A 1YEKH 4M6NH 1A6VL 5DVNA 4MA3A 3VG9B 5SWQA 1YY8A 4JQXC 3W9EB 3FQXA 1S9WA 3ZL4L 4YEFA 3MV9A 2I07A 4WUUE 1BP3B 4Y2OA 4Z77A 1NPUA 4KU1A 3L95A 5EOCJ 3CFDB 1KCKA 4QGTA 1J0HA 4C57C 5K9OA 3P4NB 1MLBB 1WGOA 5HHOD 1U8PB 4MQ7A 4YDKH 3ZTJG 3TA3D 4FTVB 1BAFL 5E8EA 3T1FB 1RUMH 3SCMC 1TQBB 3W0WA 4FFVC 2X4UA 1OARH 1YDPB 4EIGB 5FKAB 4HQQL 1SYVB 2F53B 4WY7L 4KKBC 4WU7A 2UWEE 4U1IB 1H15B 4EN3C 4NC1E 3JV0A 1F4YH 3G6AA 4BZ2H 1S9VB 5KN5A 3H7BA 2K7PA 4OLYL 2CO7B 5BQ7A 1F45A 4LRNH 4TRPH 4NQCE 2UZXB 3L3HA 4GKNA 1BMGA 1M71B 4WWID 1CLOH 1OCWH 3RIFF 5A2LH 3U46B 4XNXH 1MFEH 5C08B 3QPQD 1E6JL 1A6AA 1MJ7H 2X6MA 4KMLB 4UV4H 4Y4FC 5HD8C 4P59H 4ZO8A 1PKQE 3CUPA 1QRKA 3UTTD 1RK1A 2NW3A 5TF1L 2DRUA 1JVKA 3D0LB 5E8NB 4JN1H 4XB7A 4AENB 3RVTC 1BD2A 4JFOB 1FZKA 4V1DA 4WO4B 1OSPL 5C07E 3V5DB 5LBSL 4X80L 1T89A 4UQ3A 4U7SA 2DAVA 1S9YA 4GMSL 4G8IA 2P8LA 3DTXB 1MJUL 3RTQB 1C1EH 4OCXL 5FM5M 1HE7A 1XGTA 2VL5B 4OLWL 5DHXB 5HSFA 3NZHH 1FL6A 1KT2B 4XBPB 4WV1B 4KKNA 4XNQB 1LHZA 1RSFA 1HWGB 4PUBL 5HHNB 4TUOA 4LSRH 4AK1A 3MV7E 5D2NB 5DDHB 5E2JA 4PJ8A 4DEPC 5T1KA 3CZFA 4FOMA 3HE6C 1D5XA 3QUMB 1AQKL 1DVFA 4P48A 5HHMB 2G9HB 5CINH 4JM2B 1A7QH 4Z0BL 1D5MB 3ARDD 4V2CB 4ORGB 2IBZY 4CVZA 3VWKC 3KPSE 1QFWL 2YUWA 1PG7L 5GGUA 5KSVB 4RX4A 1T2XA 5L0QC 2NY5C 3X12A 4M6MH 1AFVL 2FATL 2APFA 2XTJE 1D9KB 1OTTC 3RUGB 3MUGA 1G9NH 1CDYA 4M3JA 3VE0A 4PJ9C 2NZIA 5F97E 1BZ9A 5IP4A 3C6LD 1IBGH 1P2CA 4HFUH 1YN6A 2Z31D 5H2BA 5L2JA 4KTYA 2PCPA 4C83A 4FQXC 4P5TA 4OM0L 2DLTA 5EPMA 4RSVA 5ESAB 1UM6L 4U6XB 2F54E 1JGEB 3V5KB 4Z95H 3K4AA 4QRQB 3UDWA 4MCZA 4U3HA 4LFHG 5B39B 4R6UA 3S96A 4GXUM 4YPJA 4YHKH 4OFYD 4L4TA 3ARGB 3OF6A 5IBLC 3OR7A 4PP1D 1FFOB 4POZC 3OHXB 2HVJB 4ZFOL 5EA0L 5IVXB 3BPNC 2X10A 3QEQE 3TIEA 3U9UB 1T20A 1ZVYA 4FMFA 5BS0E 3SE9H 4TTGA 1QTYT 2JKXA 3L3KB 3B3IB 4NZRL 1BFSA 1MUJB 4GKZA 3PP4L 5AZ2H 4KKLD 3V5HB 1U95A 3JTTA 3GSUB 3MRHB 4KRMB 2ICES 1EAJA 4FRWA 2CKBB 3KAAA 2NY4D 4LLVA 3L3JA 3V6BR 2VZUA 4X8JB 4NRXB 1F3DJ 2GTWB 4J4PC 4L8DA 4HK0A 5HHME 4UU9B 1DBAL 4XB8A 1MCKA 4OZGF 1WBXB 2V2XB 1I1AD 1J1OL 4ZTPL 1T21B 3OGCA 4ZFZA 4PJIA 2C3GA 2NMSA 4CVUA 1PYWB 2PW1B 2Z9TA 3PIQB 4I5BA 2R69H 4G6JH 1MHEA 2GUOA 4KI5C 2VAJA 3FB7B 1N0XL 4PJEA 1JGDA 5IWLC 1JGVL 5DTFB 3TT3L 5D93B 1X5XA 2LAAA 5I18H 4MAYA 1QR1B 2P4AB 4Y0GA 4DN3L 4PJGB 1FVEA 1X3DA 4HWZA 3W11D 4L29A 1LP9E 4Y2DD 2E9JA 2L7JA 2LVEA 1ZANL 2WUBL 5FYKH 1TZHB 3ET9F 2PXYC 5ID0A 1MJ8H 1RZKH 4Z7UF 3OKEA 1T7XA 1H3PL 5FDYA 5FB8B 2DQGL 1QFOA 5E9DE 2FZ3A 3AREC 3BP4A 1FE8H 3D0VA 3O4LB 4OCRH 4LLMA 2H32B 1PVHA 4IIQC 4HKJB 4JFEB 1IM3A 4FXGA 5E2WL 3L3DB 4YHLL 5I17A 5I1EL 4H25A 4TULL 2Q20A 3FO9B 2R1WA 5F88A 4LLQA 4IHOB 4O5LH 1KCSH 1N4XH 4KAQL 4JFFB 4M8QA 4GAJL 4QOKD 4X9IA 1UEYA 3HI1A 2NZ9D 3MUY1 2H41A 4Y5YC 3O8XD 4ZUTB 1L7TL 5BCAA 4XCFH 5L6YH 4G6FB 4GW1A 5CSZB 1JZ5A 4G6AC 3B83A 5TE4H 3OXSA 4X4YB 4OM1L 1T2QH 3QDMB 1JZ4A 3QH3B 5GRXG 4HV8A 5I8KL 3EZ8A 5I8OL 1QLEL 4JO3L 2B5IB 3BIKA 1Q72L 5EWIH 2FB4L 4ISVB 5HHQB 2D31A 2XIDA 4YBLC 4WTZA 3BI9X 5CZVL 5C3LD 4Y89A 5FCUL 1S7RB 1UACL 2A0LC 1YJDL 4OF0A 3S4SA 4C56A 1I1YA 5EZJA 4WUKL 4HMDA 1E28B 5L2KA 1MIEH 2EXYD 4K94C 1H9VA 5KSAA 3TBWA 3QUZC 4K3HA 3NCEB 3SBWA 2L7UA 3WFBH 3ZT6A 1YC7A 2OCFD 3IETA 5L9DH 5SV3A 4BFIA 4XZUB 4GRLC 3P4MA 3BPOB 3QPXL 1CLZH 5IV2A 3BQUD 1F4AA 1LEKB 4IMKC 4WEBH 5E2TH 3SDXB 5GS2H 1NMAH 4ODHH 3QG7L 1DQDL 4JLRB 4OQTA 1QSZA 1RZ8A 4AMKH 1VACA 1VEPA 4NO5B 4HX1A 4Y1AD 3EFFB 3ARWA 1DR9A 5D7SH 4UTAL 1RZIA 2VITA 1TZIB 1G9ML 1PGRB 1KB5H 2N56A 5FGCB 3P73A 1GGBL 1EH9A 4I4WB 4RMSA 2YPLD 5CZKA 1W0WA 3QIUA 3VXQA 32C2B 4LLYA 4Y4HA 3BZFB 2BERA 3SKJL 1D6VL 3QUKB 3BEWA 3MLSH 2W07A 4HBCH 4HIHB 2APBA 4UDTA 5CLTA 3TLRA 1LK3H 3BE1H 4GLRI 4XBGB 4FXLA 2ZOKA 4PRPB 4LCWE 1IFHL 4DTGH 3T0DA 2OZ4A 1AHWA 1T4KA 1J7VR 3HMXH 2OQJB 3GJFB 3EUUA 3HI6L 4JFYB 4JM4H 4LSSL 4LAJH 3Q1SH 5E4EC 4M7JL 3U4AA 1JTTA 3LZFL 4MDJB 1N3NA 1DUZA 3H9HA 2HFGL 4CKVX 3NFPB 1C7TA 5FA4A 4PB9L 5DUPH 4D0DB 1BIIB 3CSYA 1Y6KR 5HYQA 3W81A 4QXWA 3RZCB 3KPRB 4GBXB 4LIQL 5F9AC 1XIWA 1FAIL 3TNMA 4ZO7A 2DTSA 3D85B 2FR4A 1MCLA 2GFBB 4PYGA 4RMWA 2WANA 4YX2L 1GC1L 4FMKA 2W9EL 3KS0J 3MRMB 2CD0A 1A5FH 1ACZA 3WIFA 3MLPA 2E9WA 3WSQH 3QG6A 4Y5VB 4NC0B 5GZOD 2NYYC 5D2LA 4H20L 3BZDA 4H26B 5IR1B 3OTTA 1CN4A 5EO9A 2VABA 3RVUD 1YEHH 5ACLA 3WS3A 2B7DT 4D94A 4IRJD 2IBZX 2HRPL 4W68A 1UJ3C 4AYFA 2O93L 1YUHA 4KROB 4WRLA 7CGTA 5IMOB 1ZGLP 1JNLH 4RDQG 5HYSA 5D96B 2BDNH 4XNYH 2VUYA 3EYFB 1U3YA 5EU7C 2EE2A 3NCJH 3AVEA 1U58A 3O6KH 1WAAE 2QSQA 5ETUB 5IW6B 3U2SB 2P7TA 1WZMA 3UTZA 1CGYA 4MJIA 5C08D 1MREH 3MLRH 2Y07L 5E95B 1NCCH 5KANI 3ARBB 4OZHE 2VH5H 4HS8H 4L5FH 2BVQB 3CFBA 1HHHB 1I9RL 4JE4B 1OGAB 4M48L 1UT9A 1BJ1H 4PJ5B 5C9JB 1JNHB 3RIAF 1EO7A 3CGTA 1XCQA 1OP9A 2BVPB 2BNQE 5BVPL 3RTQD 4ZNCD 3B5GA 3C8KA 5BS0D 3HC0A 4S11A 1ZLWH 3R1GH 1KCUL 2R4RL 4PGJA 3MCKA 4FQ2H 2IGFL 3TO2B 3NA9L 2DKSA 3VMNA 2YD9A 4JFXA 5D7JC 3IKKA 2Y6SC 1FZOA 1A3LL 1MI5A 1ZMYA 5HHMD 5MERB 3FQTA 1RZGB 4JM2D 5JXED 3P2TA 4HMCA 1L4IA 1ZLSH 3BVNA 4MS8D 3DXAA 2HG5A 2VUOA 1HSAB 3TN0C 1TZGL 3OAUH 5F1OB 4N68A 2CPCA 1MNUL 3MV9E 4JHWH 4F7CA 5B4MC 5EULV 3TZVB 4YDJA 4R26H 3V6ZB 1CDUA 1XF4A 3T3PE 3FHQA 4NZUL 1R3IL 4WDIB 3VDCA 4M5YH 1HQRA 1JMXA 5DMIH 1I9IL 3WKML 2XZZA 5I9QB 5IHUL 2W91A 1EJ6A 1JHLH 3JVGC 1C5BH 1NANI 2YPVL 3W0WE 2P24A 3A6BL 2XZCL 5IMKA 3PGCB 2BMKA 5GSVA 1ZGLM 1O7VA 4X98B 2GI7A 3KYKH 1MCCA 4NZDA 5DJDA 3ILPB 5E9DD 5IGXL 3WDIA 3QFJA 1CK0L 3UTQB 1NJ9A 3QQ4A 1QSEB 1A9BA 2W60A 1TTUA 2W65A 4L4VE 4M7KL 1R5VB 3ARGD 4Z9KB 1DCLA 3S6CA 3T4AB 2V9QA 5EN2B 1A7PL 5I71B 4LLDA 4LPVA 4P4RB 1H3WM 2XWBB 4WFHE 5B38G 2YHGA 3DARA 5FXCH 2VDNL 3CMOL 2ICWB 2W9DH 4ODTL 1CLCA 4LOUC 5TGBA 1AO7A 3V8OA 2V6HA 3QFDA 4RMUA 4L3EB 1DSFH 3SE3A 3VG0H 3IFLH 1WC7B 1EFXA 4CMMA 1X44A 3DIFA 4YE4L 1OT1A 2QQQA 5LKNA 4XVJH 2ZNWA 1KCVH 3VXNB 4NUGH 3V4UL 1R3HA 4QLRA 4N0YL 4QO1A 1WCBB 2B0SH 1EHAA 3SCMB 5SV4A 2GYSA 1HNFA 4XPAH 4QRPA 1C16B 5JHDA 1I8MA 3IXTA 3HE7A 3PHQB 3O2WH 4I8DA 4Q0XH 3MCLL 4JM2F 4EN3B 1NCWL 1HDMA 1F8TL 1WK0A 3MOBH 4NQEE 3A67H 4LIQE 4CADB 4S1QH 2DBJA 5D1QC 5MP6H 2NY0C 5F7DB 4BJLA 1AP2A 4BQBA 4R4NC 1I7RB 1ZE3C 5D7IA 3W5NA 2E8ZA 3BMWA 4WHYG 1CFVH 3DETC 1OW0A 2CDEA 3OJVC 3RUGF 1O0VA 4OQTL 2R39A 4UIMB 1R5WA 3CH8A 2X1PA 4OZ4A 4Y4FB 4WWKC 4LCCC 3O4LD 2BX5A 3LAFA 3MXVH 4P4KC 3MRQB 5I19H 1Q0YL 4WI4A 2B1AL 1YEEL 5DHYA 1Z3GH 2A77L 4LFHD 4WFGD 4HF5L 3TVMA 3BAEH 4U49A 3VFSA 2JJWA 1MCBA 1SHMA 4ZUUB 2QSTA 3MRJA 1SEBA 4ZXBC 3FRPG 1PW3A 1MIMH 3OSKA 3IS0X 4G9FA 3H3PL 4L4TE 2JIXB 4JY6A 3UC0L 3MLZL 3DVFA 5LGJA 1FBIH 2AI0H 5IVXF 4F7MA 2OSLA 5B38B 3Q0HA 1EBAA 3HE6B 5DVLA 3ROOA 3KWWA 3QDMD 4TYUA 2O5XL 3M45A 4JPIA 3ARFA 4JRXE 2AJXH 2O61A 2X4RA 5DEZA 4XWOD 2VIRA 1IE5A 3VWKB 4F7TB 4XPGH 5DUML 3Q5OA 1NDMB 2V9RA 5C8JA 2FJFB 4PREB 5L0QB 1EAPB 1U8KB 1CR9L 2BY1A 1ND0A 1PSKL 3B9KC 1OHQA 2EKJA 4UT9H 5FYLL 4PJ9B 2JB5H 1IGFH 3MGAA 2BVUA 3BT2H 4ZPTB 3CVHB 1BVKB 1JWMA 3LRHA 4PG2C 1AJ7L 2B4CH 2R1YB 4FQXB 1RI8A 4RAUB 1JF1A 5ICZA 5K9JH 3MJ8A 3HC3L 2Q8AH 5KS9B 5E03A 1PBYA 3AM8C 2E7CA 3B2VH 2IH3B 3MV8B 1R0AH 1QSFB 4PJEE 4EUPG 1FDLH 5C9KA 2ZUSA 5CILH 4PJGF 4RGNE 5EORH 1CICA 5TDOB 5DF0A 4HIJA 1TVBA 2FECI 5C0AE 4LCYA 3QBTB 1CU4H 1JWUB 3D2UB 3S5LA 2DQCH 2NY1C 5HPMA 3BW9A 5T3ZD 1F13A 2J2ZA 1RFDH 3LEYH 1MAML 2F5AH 3BXNB 1F4WL 2X70B 5I75C 3H9SB 2A6KA 4PLJD 3JV5A 5FO9B 3T09A 4FZ8L 2MOVA 3VXOB 1V5JA 1BLNA 1CL7I 3LPWA 3LS4H 4GSDL 2P5EA 1IC4H 1MQKH 1TVHA 3MJ6A 4L8BB 4D0CB 4ZUWB 3QCUH 3MLXH 3MC0A 4N90E 4PRPD 1BF2A 2MSPA 1JJUA 4X5WA 1REIA 4MA8H 1D6EA 1CE6A 4QXTB 2AJ3A 4ZNEA 2BP3A 2VDKL 4RWYL 1P84J 1K8IA 3MACL 4W4OA 2ZJSL 2R0WL 3N06B 2DLHA 4NCC1 4UB0H 4XPFH 3HPLB 1OOAA 5DHVB 3RZCD 3GGWA 3KPRD 4MB3A 4GBXD 5F9OL 3FT4B 5A2JH 5DUBA 4OT1H 4D9RD 3D85D 1F6FB 4QXUL 3OR6A 3TNNA 3VMOA 5ANMA 4PRDA 3I6LE 3PQYB 5F89A 5HJ3A 1HI6A 3WHXA 3U7WL 4Y4KD 5EFIA 1L6ZA 3VWJC 1T83C 5BVJB 4ZOAA 3IAGC 2FEDD 4PJ7B 1TJIL 2VZTA 4ZSOA 2X09A 3LQAH 1YNLH 4FG6C 3SDDA 3SDAA 5BXFB 2ED7A 3QZWA 3QUXA 4JANB 4FQJH 4GW5B 3FONB 4RIRB 3CJJA 3MRLB 4JY4B 1C08A 35C8H 4KROD 1KACB 2NLJB 1FV1B 1JF6A 4M1GL 4OIIH 4IIQB 4P3DA 3VXSA 3BO8B 5KG9B 4HUXA 4QRTA 3EOBA 3FB6A 4I1NB 4XNZC 3K2UH 5BV7B 3QWRD 3WUWA 4PV8A 3SDXF 3A6CL 1G7QA 4NZTH 3ARBD 5IROC 4MJ4A 4EUPB 3QWQB 2YWYA 4JFDE 3O6MH 5IB3B 1CBVL 4DUVA 1ZT1B 4X6DE 4P23C 4XC1H 4OGYH 3R4DA 4R2GD 3RPKA 5D70H 4Y5YB 4JRYB 1E6OL 2YD7A 3HG1B 2Z91B 2HFEA 3V52H 3UP1A 3W5MA 3CH1A 1VGKA 2Q86A 3GZKA 3GMNA 3I50L 4L1DA 3EO9L 4XT1C 1AXIB 2YBRA 3E6FA 3IFPA 4CN4A 3R06A 1BBJA 3RGHA 3M17B 3E2HC 2FJGB 2Q76B 4NO3A 3ZKMC 5TE6L 4F9LA 1CIUA 3NIGE 4CMHC 2VAAA 2C7UA 4YBLB 2X7LA 1TFHA 2MFNA 3GBMH 3KPPB 3QHTC 1WBZA 2IC2A 2OR9L 4ZYKB 5JA9A 1I1CA 5HVHB 1NGXA 3LPFA 1IAIH 1Z0MA 3ZSTA 4NQVB 1WITA 1N5AB 4LF3B 5H35B 1WZ1L 4PJXB 3VFGL 1R24B 3OKOB 3PDDA 1PJ9A 3I75A 4M02A 4HJGB 4GRLB 5I0ZA 4U3CA 3RBSA 3RHWF 4NQUA 4I3RL 3L3GB 1SQ2N 5GS1A 1BBDH 3WO4C 3TT1H 4YFDB 2V7HB 3BGFC 5FYLE 1KTLB 3WN5C 1C7SA 5H94A 5D2LE 2ADFL 2GK2A 1MHCB 3LCYA 4KQ4H 4O2FB 2CKBH 2Q8BL 8FABA 1R3JB 3JWOH 4JDTH 1QSED 5D7KE 2VC2H 2WZPD 5DJ0A 4RFOL 4X99B 4Z8FL 1OF2A 5D6CA 4KUZH 1EO5A 2LE9A 2DBLL 2VDRH 5IHZB 1KXQE 3B8YA 3SKOA 3NA4A 3PABB 4X9BA 3UPRB 3G6DL 5KVFL 5IFAH 4MA7H 4DQOH 3OQ3B 5C0IB 1GRWA 3CDYA 4P99A 1UWGL 4I3SH 3PUCA 1FYTB 5FM4A 2I5YL 1A7RH 3RIFK 5MEOA 1ITCA 4MD4A 1W72B 2GJZB 4ZOCA 4MAUL 3FOLA 4OZIE 1JUFB 3QISA 5IFJA 4P2QA 3SQOH 1DANU 5F7YC 4NJ9L 4HUUB 3DRQA 5EUOB 1IGTA 3KJ6H 1A7NL 4PR5A 4JRXD 5GJTH 2X1QA 2PUQT 3FFDB 2VNCA 1T0PB 3SCMD 3RWJB 4F7EA 2DICA 1YYLL 2AJUH 5BZDB 3L7EB 3MLWH 2BY0A 3VXUA 4FFVD 3TJEL 5CEZL 1Y0LB 5DC9B 2KQNA 2IG2L 2IBGA 4JQVC 5BMFL 1ED3A 4KKBD 2RHEA 5IQ7L 4PV9A 4EN3D 2I26N 2VDLL 4QRRB 5FGBA 4AH2A 3ZE2F 3U0PA 2CUIA 1YY9C 5HI5C 3OJDB 2BHZA 5IT2L 4QHNA 3ZKXC 1UJ3B 4BZYA 4TVSa 5C0GA 1S78C 1T03H 1EHLL 1DFBL 4NWTL 1WWAX 4PLOB 3WLBB 1T3FB 3S34L 3IYLW 4PJ8C 2J5LC 1G84A 5DWUL 2NY6C 4YR6B 4Y4FD 5DXWA 5HD8D 3ULSB 3ZYOA 2A6IA 4AEFA 1UYWL 1P4BL 4ENEC 5AWNL 1CFQB 5CP7A 5BRZB 3HUJA 2E6PA 5EBGA 2AJVH 5C0AD 4ODSH 2YZ8A 4DOHB 1MCFA 4DZBB 1F4XL 1GSMA 1GPOH 1LO0L 4LSPL 3MGTB 4HKZA 5CJQL 3RVTD 1ZAGA 3RY6A 1I9JH 3MA7B 2DN7A 1QPPA 4PY7B 4OV6F 4M3KB 1MPAL 5DS8A 5AUMB 2X4OB 2VWEE 1FL5A 4FN0A 2YK1L 4N90D 3WMSA 2JIXD 1IGIL 1P7KB 1DBJL 4OZFB 4P5TC 3BP6A 2KZWA 1K5NB 4FQCH 3AAZB 5D7JB 1EGJA 4XHJC 4OUOA 3HE6D 1G7PB 1CG9B 3NABH 2JCCA 1HHKA 4Q9CA 1DEEB 3MZTA 1S8DB 1NCDL 5C0BB 2EXWC 3G9AB 4F57L 2AXGB 4NQDA 4EDXA 5JOFB 3VWKD 2KUTA 4IMLB 3IFNL 3TN0B 3VU2A 1VPOL 1KPUB 3IFOB 3K2MC 4GKSA 5I1LB 1DN2A 2HN7B 4WFED 1OTTD 3CXHJ 5I1IL 4PS4H 2RCSL 4PJ9D 1G7MB 1VHPA 2HRLA 1MJJA 3CDFA 4ZS6C 3I3DA 3NFSL 5BOPA 2IBBA 5ESQA 5T5NG 4UNTA 5ICXA 1MCOL 3RVWC 4IJ3C 1KNOB 4LQ1A 4JPWH 2BVOB 5EZLA 1QRNB 4F9PC 3AS3A 4FQXD 3QIWA 4R4FH 3H42L 1A3RH 3WFEL 4BFGA 5EU7E 1CDCA 1FO0B 4OB5L 2XOTA 2EH7H 5DJYB 3PHOA 3STZB 4YHIB 1ZA6B 1O5DT 3EO1B 1QSFD 4UILL 3RI5K 5J6GA 1UWXH 4L9DA 3GJFH 3LQZB 4LPYA 5DJ2B 1JK8A 5CGMA 1S5HA 3FFCE 1X5YA 3FQWB 5IBLD 3IJHB 2RQ8A 3QQ3B 4R7NB 4X7TB 3D2UD 1N6QH 4POZD 1OTUC 5JDSB 4M1CC 3WS6C 3SKNA 4R3SB 3H9SD 3WIIL 2OL3B 1MHPH 4WU5A 4NT6A 4UT6L 3HAEB 3ZE1E 4G8GA 5KSBB 1INEH 5TDNB 3QO1A 4L8CA 1AKJA 2KKQA 4BSWB 1CFTA 1QO3B 4OV5B 3IRZA 3F58L 3D1MC 1FYHB 4KJYA 1IGJA 3I02B 4J4PD 1U6AL 1KPRA 4L9LA 2FGWL 2IJ0C 4JCLA 3VGFA 1ES0A 2HT3C 3DLQR 3WCYA 1YEDB 5I30H 3BPLB 3CD4A 5EG6C 1KB9K 2X4QA 4AT6B 5HDQH 3UTPD 5TFSH 4PY8J 3FOMA 4OI9A 4MJ6A 1T04B 4RCAA 3S88H 3V4VH 5HYJA 2VDPH 3BRDA 5CIPB 5DR5H 3VFNB 1U93A 3GSQA 3OPZL 4QHKI 1IC5H 1JZ7A 1QQDB 3NCBB 5GPRA 3QEHB 4GJTB 3L3IA 4GT7A 3PQYD 4KI5D 1VGEH 3F7RA 4X6FB 3FB8B 2R0KH 1OAKH 1CD1B 2D7PA 1GGYA 4LHUA 1AGCB 4RZCB 5D1QB 4M7ZC 2NY0B 5IKCA 3ALXA 4QYOB 2VDQH 4HAGA 2PXYD 2FL5B 5CEZE 3TH3T 5E2UL 5IJKA 3SGDI 1DBMH 5SX5H 3PWNB 5FKPA 3SEPA 5JUEL 3ARED 5D7LA 4WWKB 4LCCB 3JV4B 5GRJL 4E5XB 3HZMA 4YIQB 4DAGH 1NLDH 1MCPL 2CUMA 2LU3A 3MCG1 4D3CH 3I3EA 2R1XA 4ODBD 4YO0A 2GCYB 4HS6A 1AXSA 5KS9F 5E00B 3BJ91 3JBG7 1BQLH 1NKOA 4S1RL 3GMRA 3OB0K 1QOKA 1BJMA 1NGZB 4WCYH 2ZCKL 3BKYH 3MV01 5F7FA 1FRGL 2EC9U 2BCKA 1DLHA 2VERN 4S0TD 2EE9A 4NO0A 5J9PB 5DSCB 1N59B 5DQDL 3LHPH 4JRYD 1MFBH 3STLA 1NAML 4MCYB 1F97A 4G6AD 5CEYB 3B6SA 4HC1H 1A6UH 1ZVSA 5K59E 4PRNA 2H1PL 3T4YB 5HHPA 4I48B 4BZ1H 1HYRC 1A2YB 1UCBH 3HNVL 43C9A 4JVUA 2W92A 2P5EE 4OKVA 4PJDB 5ESVB 2C1PA 4KC3B 5TPWH 5I1KH 3MLUH 5FDWA 1YYML 1EMTL 4GAGH 3HFMH 1BQHA 2A0LD 3B9KB 1S5IL 2Q7YA 4ZNEE 1X9QA 4ODXB 3NN8A 4X0KB 4J3OC 2VE6B 3JV6A 4Z6AT 4Z7VE 4JZJA 1OAQH 3WFHA 1SYSA 3QUZD 3NIGF 1JPSH 4GQ9L 4U1NA 9CGTA 3CLEH 2PF6A 3GMQA 3L5WB 2YMXH 1HHGB 3Q3GB 4GRLD 4AEIL 5KVEL 3FTGB 4L4JA 4GG6E 3CIQA 1HCVA 4R7DA 4U1LB 3REWB 3T0XA 4KI5F 1N8ZB 2X1XR 3RU8H 5CCKL 2NXZD 3IF1A 2DQUL 5ILTL 4TUJA 3TGXA 3QI9A 2AEIT 4PJ7F 4E41E 3SPVB 5M7QA 4DK3A 2JB6B 4Z7NF 1SEQH 2C3VB 4U1HB 3ULUL 4ZSOE 3UBXI 2WUCL 3BD4A 1BZ7B 4JRWA 2NY1B 3MRRA 2C3WA 5HVGB 4JZOB 2Y36L 1F2QA 2EEDA 3SHSA 2Z4QB 5HYIA 5I75B 5INDB 1A22B 1QBBA 2G75A 5ENWA 1SMOA 1IMHC 2XA8L 1BWMA 3D25B 1A6ZB 1UQSA 1MRCH 2PYEA 2HKFH 1EA9C 3C08H 3ZT7A 3I9GH 2DQEL 1KC5L 2FECL 3ZHDA 2GHWB 3DV4A 4G6MH 3GHBL 2IANA 3M8OL 4PRHA 4HUVB 2AEQH 2R56L 5B3JE 5LQBL 3WXVH 4L3CA 2DQFA 5EZIH 3D39A 3B9AA 4FQLL 1FYTD 1TNMA 5KVDL 3W2DL 4OD1H 3ARPA 2RFXA 5EBMA 4BKLA 2B2XH 2J8UA 2G5RA 4MNHA 5FECA 4J3WA 5JO5A 1OAUH 4PJCE 2Y25A 4JCMA 1RZJH 4XCEA 3EYUH 5DJ8A 1HZHH 2XN9A 3QDJA 3MFFA 3IJSA 2GJ6A 5JTWA 2CXKA 5HGAB 2FBJL 5FUZH 4ZFOB 4YXKL 3V6FA 3FRUB 1MF2L 3D3VA 1L9NA 3KYMB 4TSAH 1LE9A 3RIAK 1KCRH 1ZSDA 2QHRH 4NWUL 3VWJB 4NKMA 1XGRB 5FHAL 2F58L 1MCWM 1J1XL 1V3KA 3HNTL 2OTPA 3QSKB 5GRVK 1J87A 5DGRA 4QRRD 2AAVA 5IIEB 1KJVA 2DQIL 4P9HH 4D0BA 4J3UA 2G60L 3NTCL 5CHNA 5DFVC 3T77B 1KPVA 5EBLA 5SWZB 1ZTXL 5H37G 5LAXB 3V95A 1HXMB 1EHNA 4QHLB 5GZND 2ZP0T 4FZEL 4PJXF 1B0RB 2AJSL 2W0FB 3SGJA 2VLRA 5HGBA 4XNZB 5FA3B 4Z7WE 4OI7A 2YD3A 4Q6IB 1EXUA 3CVIL 3V7AG 1JNNL 5GGTA 1QLFB 4P23B 3T2PA 5C2UB 2E8YA 4TOYL 1FVDA 4MJ5B 5L7XH 3DO3A 1JGUH 5ID1A 2XWTB 2AGJH 1QACA 2FX9L 2R2BB 4N8VA 4R90H 1F58L 5GRZA 3HI5L 2UVFA 4TSBH 4C59B 5E6IB 1XR8A 1NEZB 3L5HA 1F6AB 4OIAA 4LARH 4DUWA 1FSKC 2R29H 1INQB 2X4TB 2NTFA 3E2HB 4P2OC 1ZEAL 4X6BA 5F9JB 3NCCB 5D7JD 2DM3A 4CMHB 3CVHH 2Y6SD 2CJUH 3BZEB 5INCA 15C8L 4HPOH 5C0BD 3JTSA 5D8JL 3V6OA 3AS1A 4MSWA 1S9XB 2OTUB 4MX7A 1T5WA 3RGVC 5EU3A 1YZZA 2DYPA 3GM8A 4NM8L 1CF8H 1SM3H 1AE6L 3TN0D 3U7AA 5E56A 1CE1H 1RULH 5D1XC 1B0WA 1J8HA 5B4MD 5I0DA 4HG4K 1VB9A 1X5GA 3SOBH 2J8HA 3X14A 3T0WA 5EUOF 4NN5B 1HQ4A 4HJJL 4GRMA 1B2WH 1AGBB 1LO4H 2IQ9L 5I1HH 1KF9B 3QXVA 2NW2B 1IL1A 1MFDL 4LEXL 2ADGB 1OAYL 3GSOA 4MA3B 1QRND 1YY8B 2IFFL 3ZKNC 5SWQB 3FQXB 4JHBA 3MJ9A 3OKMA 3GSNA 5JIHA 4EBQL 2I07B 3SE3C 5CEZD 1JTOA 2FBOJ 1LQSR 1MCIA 5HTSA 1CD9B 4HGWB 3AY4A 1ZLUH 2A1WL 3L95B 4Z77B 2XY1A 1IGYA 5TDPA 4IOFD 4XC3H 4CDGC 2V5SA 1B0GA 2XZQH 2QSCL 4E0RA 4MQ7B 3K4ZA 5IB4A 4WW2C 1MY5A 2EDKA 5FOJA 3G6JA 3DV6A 2E7LA 2X4UB 3CDGA 1J11A 1B4RA 5DD1H 1CFSA 4KY1H 4MQTB 4P49A 2WBJA 4EIZC 4WU7B 3ALPA 2HT4C 3O9WC 4FFZH 1WVZA 1M7IA 3G6AB 1DL7L 4EOWL 3H7BB 4HCRH 4LOUD 3QDGE 5K33A 3FN0H 1FNSH 5BQ7B 5IQ9B 1CGVA 2GITA 4GKNB 2RGSA 5GS3A 2WQRA 4PJBB 3SGKA 3VFMB 5HHXL 3UTSE 1A6AB 1G9NC 3CUPB 4LL9A 2VLLB 3O2DH 2YSSA 1RK1B 1ADQL 2NW3B 3BKCL 4OIBA 5IB2A 3C5ZA 4NKIH 5AYUH 3QJFA 1U8IA 4ODUB 1BD2B 4V1DB 1FZKB 1G0DA 1IQWH 1BZQK 4CU8A 5BV7H 4UQ3B 1PY9A 1S9YB 2P8LB 4ZUVA 5FF6A 1R3KA 3LIZH 1AQDA 2NY0D 1FL6B 1D7FA 3W82A 1IEBB 2F8OA 4HMEA 4R4ND 5I1JL 3DETD 3BGMA 4HAFA 2WIIA 5CBAA 1Q94B 1LNUA 4NO2A 3QIBC 4O2CA 1W8NA 2QR0A 5GJSH 4PJ8B 2J5LB 3CZFB 1DQML 5T1KB 1D5XB 3ZZ1A 2NY6B 3PG2A 3VRJB 3DYPA 1EBPA 1QYGH 1RJYA 1I1FA 1ZHKB 2R0LH 4RAVA 4WWKD 4E41D 3ARFC 4XP9H 4CVZB 3W9DB 4P4KD 1IAKA 2OR7A 4RGOH 5BO1L 5T3XD 2X44D 2EDDA 4LPTA 5GGUB 1BFTA 1HINH 1KJ2H 3X12B 5F7WC 4X4MA 3UBXA 1OWWA 3MUGB 4KJQC 3VE0B 3EDFA 5HDOA 2C4FU 1HOCA 3BDBA 1BZ9B 4ZXBD 1J0KA 3U7YL 4BH8A 2D7NA 5L2JB 4HJ0C 2PCPB 3WIHH 5EC1A 4P5TB 2AW2A 2GT9B 3G5YA 5EPMB 5GGVY 3QEUB 2ADJA 5HVWA 1RZFH 1E27B 1JTPA 1UXSB 3PGFH 5KSBF 2J3SA 1OM3L 1J0IA 1BFVL 4MCZB 4NHCH 5EU5A 4NGHH 3AXLA 4WW1A 4R8WH 4HWBL 3OR7B 3MJ7B 3WXWH 2B8OT 3B9KD 1XGUA 4KZEH 5E5MA 3L7FA 3TIEB 1EIBA 1MCJA 1RZKC 4HXAL 4XAKE 1T20B 1CS6A 4IJ3B 2UVEA 3FCTA 3OKKB 2YUVA 4XBEL 1MVFA 4GKZB 4KTDL 1U95B 3JTTB 1CIDA 4R4BA 1P4LA 3MODH 1U91A 3QULA 3L3JB 2AJYL 4ZPVA 4AQOA 5KAQF 4N1CA 4QY8B 3PWPA 4N0RA 4AEEA 3LKSB 4L8DB 1PZ5B 3B9DA 4DUXA 1G6RL 1X7QA 4W4OC 1RUPL 1JE6A 3CU7A 1VA9A 3F12A 1GGIL 4ESKA 1FNEA 5ISZB 1X6LA 5F7LB 3BKMH 4MNGB 1YEIH 4KPHL 3Q6FB 5DT1L 4U1JA 3DVGB 3OGCB 5C7XH 2NY1D 2HKHL 4ZFZB 2ZUWA 3UO1H 1AC6A 4PJIB 4U1MA 1JRHI 1ZOXA 1II4E 3MXWL 1GL4B 2ESVE 3U4EA 1BJ1J 2HMIC 1T6VN 3INUH 4I5BB 2FWOA 1MHEB 3DBXA 5JQHC 4X9HA 5ITFB 2VXTH 1I8KA 5LCVH 1F3JA 4P3CL 1BECA 4XGZB 4Y8DC 3U9PL 3OJ2C 4L29B 3SDAC 1T1WA 4I2XA 2BJML 4PYHA 5A2KH 3QUXC 3N0PB 2DD8H 5CKGA 1AXTL 4K3JH 5ID0B 3VXRE 4LSTH 5ERWB 3OKEB 5F96H 3HZVA 3HRPA 3B43A 3BP4B 4CN1A 4N0FA 4IRSA 5LXGH 3GK8L 4LLMB 4XVSH 4RQQB 3ULVL 3PL6C 4S2SA 3FQUA 4MXVE 1IM3B 3Q6GL 5A16B 2MPAL 3F5WA 1OP3K 1D5IL 5I17B 3T0EE 3FB5B 4H25B 1T1XA 4WTXA 3WD5H 2IF7A 2J6EH 3BOVA 1KENL 1MWAL 5F88B 4ZFFA 1IEAA 4R96A 3LB6C 5KVGL 4G80A 5DRXA 3VWJD 4AEHH 4M8QB 12E8L 5EO1A 4PJCF 2RAMA 3KPLB 4PJDF 1K4DB 5EU6B 1T1YA 5JXAL 4FG6D 4O58H 4YDLC 4YHNB 2VDML 3UYRL 4U2YA 4KVNH 4XXCC 1I3GL 4GO6B 1Q9LA 4O2EA 4XMPH 3MJ9L 4FFYL 3TIDB 4HV8B 3X3GH 3GSNL 5J3HD 3WJLA 1LO3L 1L6XA 1VFMA 4M6OH 3FN3A 4CVWA 2BSRA 2D31B 2ZPKH 3KXFB 2OK0L 1BEYL 1Q1JL 4OZFH 3SDYH 5I74C 1YC8A 2A6JA 3C8HA 3S4SB 5E70A 2BSSB 5EZJB 3IDMB 4U6YA 3O3BA 4M7LL 4P23D 3TBWB 5ADOL 3FT2A 4F33A 5HGGS 3UZQA 4HEPG 4BFIB 3DX7A 3GJEA 5A2FA 2A73A 5IV2B 3NVQA 1GIGH 1P4IL 3QDGD 1YECH 4I77H 1RZ8B 3RL2A 2NX5A 5GS1C 4DKEL 4QRUB 1U8HA 4HX1B 2XRAH 3ZKMD 3BUYA 1YNKH 3MLTA 4KHXH 1RIUH 4H88L 1RZIB 5I76A 3MQIA 4UTBL 2VITB 2FLRT 4KKAC 1GZQB 2CMRH 3B9VA 4TQEH 3UTSD 3O0RL 2R4SH 2V17L 2IANE 5DMKB 2ORBH 4YHML 3DUUA 4LLYB 4H1LA 3OKNA 1QZ1A 3K7UA 3SJVB 2R0ZH 4LASL 5JOEA 2J8UE 3D9AH 4OAWB 1YNTA 2JJUA 3C2AL 1A7OL 5GGSY 3KPMA 4IS6B 5IVOA 1DANT 4LGRB 2VXSL 1W8OA 3QDHA 1T4KB 4LCIH 2OXHA 4RMTA 3MBED 1NFDA 2EE6A 2IEPA 5FYJU 4J12A 1MAJA 3H9HB 3HAEH 4HKXB 4ZO9A 2P8PA 1LEGB 2KDGA 2NQCA 1NUNB 3CSYB 4WHDA 4XPHH 3V79C 4CRPA 3KXFE 1TTGA 3VXMA 3TNMB 3O3AA 2VO5A 1HNGA 1L0XA 1D3CA 1FGNL 1NUDA 1W0YT 5B22A 2X9YA 1F90H 5JLZA 4IBLT 2ED8A 3WIFB 4PPTA 2A9NL 1KIPA 4QTIL 3F7VA 4DK6A 5T1DL 4H8WH 5EO9B 5CIPH 1XF5B 5T1LA 3TBTB 3MLVH 4I0PC 3PWJA 3WS3B 2I60L 3TC9A 3TCLA 2GTZA 4BZ2L 4JDZA 1PLGH 4C58B 2Z93A 1YUHB 5DRNA 4OGAC 5IFHH 5HYSB 4MD5A 2N4IA 1Y6NR 4OUUA 1I4FB 4YWGH 4E42A 1FAKT 2D0HA 1A6VH 3S35H 3ZL4H 1LILA 3QXAA 2P7TB 4ONGL 1G7HA 1CLOL 1OCWL 1HHJB 2VSDA 4APQA 2GSGB 1JYWA 2GAZB 3P0VH 3BH8A 5CP3H 1S7SA 4ONHB 4UV4L 4P59L 5DD0L 2BVEA 5T5FL 2J1KA 3CFBB 4O9HL 3SJVE 5HHOA 4XVTH 5DD3L 1BD2D 2A2QT 4N0UB 2ITDA 3FMGL 1A14L 3ULVE 1XCQB 1QBML 5HDBF 3C8KB 5B21A 1YY9D 3HC0B 1C1EL 3MRDA 5HI5D 5E94A 4GMTL 1T1ZA 1S78D 4Q9BA 5JQ6L 4K8RL 4QT5A 4YK4C 2H2SC 2C3HA 1EZVY 4RNRA 3PDOB 4P2RE 4JFXB 4OLYH 2XKSA 4N9OB 5FOBA 4PJ8D 3IDXH 1FZOB 5T1KD 2NY6D 3D69A 5B8CC 1MI5B 2NCMA 3FQTB 2DLEA 7FABH 4ENED 5CINL 5JPMA 3U4BH 1C5CL 4MHHG 4PIRF 1TLKA 3IGAA 2K3TA 3DXAB 4F80A 2HG5B 2XT1B 4EZMA 4RX4D 1E6JH 1SBSL 4NCDA 5DI8A 2YPKA 4ELME 4F7CB 4AZ8A 3EGSA 1NCAL 4YDJB 3TH4T 2ESVD 5J1TC 1XF4B 1K2DA 1ZVHA 3UTTA 4AG4H 3T04D 5LBSH 5DJZB 1ETZA 1IBGL 2JK5A 4M8VA 4BFBD 4PJFA 1FSKB 4GMSH 4PGDA 3H7LA 2R8SH 1MJUH 2H6PA 1ZA3B 4P2OB 4OCXH 4P5TD 4F37F 3G6JE 1FG9C 4F7PB 3G5ZB 3CSGA 5IMKB 4LKCB 5DD6A 4XHJD 1CD0A 1FFPA 4P2CG 1U3ZA 4UBDC 1CD8A 1HKFA 4OZGA 4PUBH 5DJDB 4K9EH 2EXWD 4MLIA 3G5VB 3QFJB 2X4PA 1E4XI 2XI9A 3K0WA 1NJ9B 3QQ4B 2QKIA 1A9BB 2W60B 1GVIA 2W65B 5GGSA 4LMQI 5I1CL 5DLML 1FH5H 3FAXA 3C5SA 3PWVB 2YS4A 2VXUH 3ARDA 4NRZA 5BZWA 4N0UE 1QFWH 3DYOA 4PJBF 1WTGT 3UJJL 4LLDB 1K3IA 5IMMA 3AB0C 3LS5L 4ZS6D 1CXHA 4TVPL 1AFVH 2FATH 3RVWD 1ZLVH 3MNVA 4YXHH 1WISA 5TGBB 1AIFA 1AO7B 4P5KA 2JELL 4GQPH 3QFDB 1H8SA 1A1OB 1EFXB 2D4FA 2PETA 4XCCL 3C6LA 3DIFB 4DKFL 4IOIB 4CGTA 2OYPA 3GI8H 5EC2A 1K85A 2OTWB 1JZ8A 4L9LC 4OM0H 4U6HB 1R3HB 4B5EA 5FEBA 5CJOH 3QCVH 3K1KC 5ISZD 1ZGLA 4WW2B 4QRPB 3RNKB 1OTUD 1EEYA 4XCYB 2ATPA 5JHDB 4M1CD 2D9CA 3IXTB 4MXWL 3GMLA 2IQAA 2R69L 4G6JL 3JWDL 4HH9A 3O9WB 3FQNA 1H3UA 5CZXD 5GIRA 1RUQL 1FNAA 1Q0XL 1CTNA 2JF1A 5GGVL 1CT8A 1J5OL 1AP2B 3RWDA 5D7IB 1JHTA 1HSBB 3RAJH 1QP1A 2ILLA 4NZRH 1DDHB 1KJ2A 1Q9KA 3ELAT 1IRAY 3MRKB 1R5WB 2HT3D 1WFOA 3PV6B 4JG1L 2UV3A 3MRBA 1MOEA 2A6DA 1CDBA 2DWDA 2EC9T 3C09C 3HB3C 4CW1B 1DBAH 2BOCA 4FQQA 4U1GC 3KDMA 5HPOA 4LLUA 4FS0A 4TNVF 3P9LA 3C60A 2JE8A 5DHYB 2B4CC 5C0NC 4G8FA 1J1OH 4ZTPH 3MUHL 3VFSB 2XQYG 4CU6A 4N8CL 4OF6A 3OX8A 3EYSH 3MRJB 4RRPA 1SEBB 5EU6D 3VI3F 2QL1A 1JP5A 5TQ2L 1SY6A 1TJGH 1N0XH 3U83A 5AZEL 3SN6N 4PRIE 2O5ZH 4G9FB 4OCMC 4XCFL 1JGVH 3TT3H 3VG9C 3WEXA 3P0GB 2V7NA 1CGSL 5LGJB 2FEEI 1FNGB 5F6IC 4F7MB 2OSLB 4HULB 3VDBA 4DN3H 5TE4L 4F58H 3KWWB 2P47B 1ZANH 2WUBH 1JI2A 4JPIB 3ARFB 2X4RB 3QNZA 4UDUA 4OLEA 2VIRB 1YEGL 1H3PH 3T2OA 5EWIL 5CJXA 2DQGH 3KXFD 1NBVH 2E7BA 5C8JB 1GOFA 3LDBB 5JW4N 2VMFA 5HXMA 1JV5B 3UJIH 4Y5XA 2LTQC 4OF5A 2D7TL 5MENA 4LQFL 4X4ZA 2BNRA 4ODWA 3PWPE 4PJHB 4YHLH 3LH2L 3DOSA 4GS7B 1TENA 5I1EH 4CL7A 5I15L 4TULH 4HXBH 3IKCA 2FO4A 1YEJL 2DMCA 1RMFL 1U8OB 1KIQA 4KAQH 4UI2A 3WFBL 4PJIF 4GAJH 3RDTA 3K46A 3ZDXE 5E24E 1JF1B 4NUJA 4BA8A 4QOKA 3IDIB 1WZLA 1CLZL 4NBZB 1C5DA 1L7TH 4YUEL 5ICYB 5IG7A 5E2TL 3K8KA 5F7EL 1I3RA 4AM0A 3ZDZF 1I8LC 2FYYB 2YRPA 4OM1H 5J6HA 2VJXA 4K2UH 3HHRB 2HA1A 5I8KH 5I8OH 3S5LB 3LQAC 5F6HJ 5I6XC 4JO3H 4I2XE 5HPMB 1DP0A 4WUUA 2FB4H 2Q6WB 1HXYB 1N26A 1CZ8L 4BSVB 1JPFA 4BK5A 5CZVH 4A6YA 3RVVC 3TEUA 5FCUH 2WP3T 3SJVD 5F3BA 5L8LB 1IT9H 1UACH 2Z35A 3PJSA 1YJDH 2F5BL 1TVHB 1V3JA 1NMBL 5C0JA 1S7XB 3BE1L 4KDTA 4XXDB 4M4PA 4KK8C 1G7JA 1CE6B 4UNUA 4XCNA 2E5EA 1K8IB 3Q5YA 2X2YA 2UWEA 4HUNB 3QPXH 1RJLB 5F6HI 4DN4L 4NNYA 2FRGP 3BQUA 4P2RD 3QG7H 2ITCB 1K8DA 3CFIC 3GGWB 3WO3B 4HSQA 5CAYB 4Y1AA 2YA2A 5DUBB 4NQCA 1H8OA 4Z7QE 3I85A 3TNNB 3K80A 5ANMB 4PRDB 4HIIB 4IDJL 5F89B 5HJ3B 4BQ9A 1HI6B 1N6UA 4PJHE 4ZDHA 1BGXH 3RWGA 5EFIB 1D9KC 2YPLA 1RIVH 1EZVX 1R5IB 1E4KA 5E1AA 3SDDB 3SKJH 3SDAB 1LE5A 1XF2B 3QZWB 3QUXB 1YEHL 1JRHL 3TBVA 2UYLB 5C07A 1NGWA 1C08B 4YGVB 1A47A 1IFHH 3OZ9L 3DX9B 3O11B 3HI6H 3MREA 3F62A 4P3DB 3VXSB 3NCJL 4FQPA 3SGJC 2GK0A 1FGVH 2WP3O 2HFGH 3PWLA 5LWYL 3OG4B 3WUWB 1M6OA 4ZS7H 5CKAA 1NGQL 4PB9H 4PV8B 1MREL 1G7QB 3MV7A 1VADB 1OAZH 3CFDA 5EH1A 4L5FL 2DTML 1FAIH 3P4NA 1EJOL 1MLBA 3V0WL 1U8PA 1GC1H 2W9EH 4OD2B 4WFFE 1A4JA 2HFEB 1LEIB 1OPGH 2QJDA 3KNBB 3CH1B 1VGKB 1IGML 2Q86B 4X6CB 3MUJA 1KB5B 1N0LA 4H20H 5C09E 5DFVD 3JWOC 4JR9H 5GS0C 4NBXB 4YGAB 3RNQA 3J8F7 3E6FB 4XH2B 3K4DA 3R1GL 3BIAX 1BBJB 3SE8H 6FABL 4NO3B 2P5WE 2VAAB 4IRJA 2P43B 3H0TA 2X7LB 3FL7A 3KYNA 4K3DH 1BJ8A 3IB4A 1PEZA 3V6OC 4IEFB 4EQ3A 2DOCA 1EK3A 5I74B 2WAHA 2DLIA 1M71A 3DXAD 1TTFA 1BWWA 1B88A 2F54A 2Q7NA 2H45A 3DO7A 2Y07H 4Z7OF 3O41A 1UZ8A 4BH7B 3ISWA 1Q9WB 3KR3L 2DJUA 4LSQH 4R26L 3VD7A 5DA0B 4WJ5B 3D0LA 5IF0A 2EIZA 4M5YL 1FC1A 4YFLF 3P11L 4AENA 4QXGH 5JZ7C 5GS1B 1NC4B 4AIZB 1K6QH 2QBWA 3QEQA 5BVPH 4P2OD 1DQLL 4FABH 3DTXA 2B1HL 1YMME 3QAZB 3CPLA 5H94B 5BS0A 1GYAA 1KCUH 2XQBL 4WV1A 3HN3A 2HAZA 3KYKL 2IGFH 8FABB 3N85L 1MH5A 3EO0A 3NA9H 5EIQA 1FZMB 3RGVD 2BFVL 5D2NA 1I3UA 5DJ0B 4HWEL 3QHZL 3QT2A 4XMKL 4DVRL 1A3LH 1OF2B 5D6CB 5D1XD 1XGYL 3VA6A 4UZGA 2X9XA 5F7HA 4JM2A 2E7LC 5JXEA 1P9MA 4K7PH 3G08A 1F4HA 1TZGH 4M00A 2WBJC 1MNUH 5DZLA 1WIUA 4CBPA 2X5PA 1DN0B 2BZDA 5SWSB 4MNQB 2Y06L 4QWWC 1R3IH 1SY6L 3ZKND 2I9LB 2J88L 4TNWF 3E3QC 1EHXA 3VRLF 2D03L 4EI6A 1UXWB 4YHOL 4MD4B 5GRYA 3FOLB 3WKMH 5GRUL 2E9IA 5IHUH 4P2QB 4GKOA 2AP2A 2B5IC 4Z76B 2CK0L 2YPVH 4YHZL 1LP9A 3A6BH 2XZCH 4NUGL 2Q1EA 5DRZB 3QEGH 1I1RA 3OWEA 4KV5F 3L5XL 5DVOA 4ERSL 4U6XA 4XPTL 5IGXH 3WBDA 3VXUB 5E9DA 1JGEA 4OSUL 5ALCL 1CK0H 3V5KA 1OLLA 3LV3B 1WT5A 4QRQA 1S9KC 1Q38A 4M7KH 1NCBH 2HT4D 3O9WD 4I0PB 5CJBA 3NBNA 1OQXA 4PLKC 5FGSA 4AH2B 1FFQA 2AXHA 2DKUA 5MP6L 2IADA 4QHNB 5IVXA 5F8QC 4JPVL 5C0GB 3U9UA 2XWJB 2EE3A 2VDNH 1ORSB 1CFVL 4WI6A 4V2BA 4XX1E 4JVPA 1CQYA 3GSUA 3UTTE 4HGMA 5JMRA 1QA9B 2A6IB 3MNWA 1PG7W 4JFZL 4YE4H 1IM9B 3HR5B 4NRXA 3HUJB 2C4FT 3V4UH 5E8PB 4NQXB 4J3SA 3GKZA 5I19L 2PO6C 5ITBH 3G5XA 1YN7B 3MV11 1Z3GL 3P30H 4OZGE 1T21A 3OB8A 4AL8L 1M7DB 5SWSE 1I7TA 1MCNA 2DLGA 2PW1A 3O2VL 5DS8B 3MCLH 2AXJA 2DI9A 3BWUC 5SX4I 1N64H 1NCWH 1FL5B 4G9FD 1F8TH 4H5SA 1H5BA 4YK4B 5DTFA 5D6DC 3BP6B 3QIBD 2VR4A 2C1OB 3G04A 4OFKA 1QR1A 4LNRB 1KFAH 2JCCB 1HHKB 4PJGA 2LU4A 2DM7A 4OLXL 4BYHA 2GY5A 3ARFD 4NQDB 4EDXB 1AD9A 1Z9MA 4OQTH 1HK6A 2VZOA 3IS1X 4JDVA 4XPGL 5FB8A 3RWHB 1IEHA 4Z7UE 1NBZA 4GKSB 2L0DA 3O4LA 4KXZI 4RMRA 5C1MB 1UG9A 4KJQD 1Q0YH 4UT9L 2B1AH 3L3DA 3N1QC 1MJJB 2JB5L 4WW2F 1IGFL 2EDBA 2ICWI 5KW9H 5EZLB 4HF5H 5IB1A 4ALAL 1AR1C 4HJ0D 5IW1A 1BX2B 3QIWB 2F8VA 2VLKB 3GO1L 3ZKSD 5K9JL 4JKMA 4I0CC 5D96C 2BNUA 4ZUTA 3ZDYE 3NH7L 3UC0H 3MLZH 4Y16C 5CSZA 2OZ4H 4OBRA 5J6GB 1SJHB 5EO0B 3BP7A 3EDEA 1CDHA 5D7IF 1JK8B 5F9WC 4CN6A 5EORL 1MRDL 4X4YA 1S5HB 2Y7QA 3EJZC 3QDMA 4YBQC 2O5XH 4GFTB 2IH1A 1JYNA 1DEDA 2ZNXA 5FYKD 1RFDL 3AU1A 3AB0B 1QHOA 2UZIH 3WFDL 4WU5B 4NT6B 2Z8RA 1PSKH 3OG6B 1H3XA 4G8GB 3FT3B 3OAZH 1IC4L 3WFZA 1MQKL 4LRIA 5FYLH 3QO1B 4KQ3L 4PGBB 5JW4M 4CAGA 4KJYB 1IGJB 1PD6A 1KPRB 1QEWA 4L9LB 1AJ7H 3HMWH 1ES0B 4OFPA 3QP3A 1KBGH 1T7ZA 4N5EC 3SDXA 1U42A 3FOMB 5ALBL 4MJ6B 4JLRA 2R2HA 5FUCE 4OLUL 4PRAA 1U93B 4AJ0A 3GUTB 2HMID 4OT1L 3L3IB 5HY9B 1ODAA 1G0YR 4I4WA 1G9EA 4LHUB 3PXHA 1AD0A 3VXTB 5IBTL 1MAMH 5IKCB 4OZHA 2AK4E 3SDAD 3QUXD 4GSDH 5C71A 4LDLB 3F65A 3QUKA 4FQJL 3FZUC 1L0YA 4PJHF 1HILA 4XBGA 4EI5C 3BDYL 4PRPA 3RA7L 5D7LB 4Z78B 3WJLC 1YMMD 2VDKH 4RWYH 5HDLA 3C09B 2OQJA 3HZMB 3PL6D 1KEMH 3VXSD 1GOHA 4OIIL 3T0BA 2R1XB 2VKXA 4U1GB 2JJSC 1MFAL 4YO0B 3K2UL 2R0WH 1F2XK 3GMRB 1BIIA 5F71A 4RFNB 3LB6D 1H3GA 5GS2D 3QUML 2BCKB 1DLHB 2ZCLL 3IDJA 5F9OH 3O6ML 3KPRA 4GBXA 4OGZA 3BPCB 2VB5A 2GFBA 2HH0H 3STLB 4X7SH 3U7WH 3VCLA 3VFPA 5HI4C 1GZPA 5JNYB 3HCVA 3PHSA 4QCIA 5EZOL 4JHAH 4Y4KA 4GXVL 3B6SB 3V52L 1ZVSB 4Y5VA 1TJIH 4EDWL 5F6IB 3CFJA 4PRNB 2LQRA 4ZFGH 3MRNB 1BHGA 4H26A 4N9GA 4PRBB 1S7UA 5HHPB 2VR9A 4D2NA 2RIKA 2YN3A 1PDKA 4LDEB 5CBEB 4IRZH 3C9NA 1FORH 4OKVB 4QF1B 2C1PB 3A6OA 4MVBC 1OTSC 2GKIA 5IHBA 5FDWB 3TYFA 3AROA 2LTQB 4M1GH 4ZUSA 2FEEL 1XGQA 2MHAA 5A2IH 2IAMA 2Q7YB 3S3SA 5ETUA 3U2SA 3JV6B 2MQ3A 4XAWL 3QWRA 5TE7L 3WFHB 5L8JB 5CUSL 3ARBA 3T2QA 1U2CA 4L4VA 2APVA 1CBVH 1XGPA 5DJXA 1IARB 5B39G 1RZJC 4R7DB 4Y1AE 1E6OH 1MCHA 1ROWA 2ZOLB 5C9JA 4L3AA 1NC4D 5MI0C 3IF1B 3SDCC 4TUJB 1CGWA 3TT1L 3I50H 3EO9H 2YPLE 4KKAD 3V2AR 3U36B 5I6XB 1KLFA 3TO2A 3MRRB 3BEVA 3JWOL 4JDTL 3NAAH 4Q9RL 4LVOC 4P9HC 2G75B 5BW7A 4PGEA 3VH8G 1UQSB 3I6KA 3ZHKA 2PYEB 5CFHA 5MERA 2OR9H 1DQQA 3WNNA 3ZYIA 2ZUQC 3EDDA 3DV4B 1HSAA 1EEZA 3WNLA 3F6IA 2YD8A 4MA7L 4PRHB 3OAYH 5SWSD 4MNQD 3QXDA 1NCUA 2P8MA 4B41A 1GHFH 3D39B 3EHBC 1Z6JT 2RFXB 5EBMB 4BKLB 4WDIA 4MNHB 4NQEA 5EU4B 5FECB 5JO5B 2I24N 2HJFA 3GIVB 1R3LA 4P2QD 4FTVE 4YHPB 4XCEB 4JG0L 4X6CF 5DJ8B 4POYA 4LMQE 3AGVA 2XN9B 3QDJB 3IJSB 2GJ6B 2D0FA 4APQC 3LKQB 3PGCA 2VL4A 4F3FB 3D3VB 1LE9B 2ADFH 1IQDA 3GSWB 4X98A 2Q8BH 2CRYA 1QLRA 2AK1L 2F53E 2YA0A 3ILPA 3VXUD 5FV1L 1KUMA 4NKMB 4HT1H 3QNXA 3UTQA 4RFOH 4Z8FH 1PKOA 4ZG1A 4OJFH 3C6SA 1JBJA 2DBLH 3RKDC 4I0PD 2EYRA 3WV0A 3DVNB 4KMQA 1KJVB 4BQ6A 1A6TA 4D0BB 5M94B 3QHFL 5CHNB 5KVFH 2BSTA 3AMLA 4P4RA 4OGAD 2XWBA 5F72S 1JPGA 4CNIA 4HZLA 1T03L 5C08E 2VISB 4JKPL 2ICWA 1UWGH 1OP5H 1VEOA 4UNVA 3ZLQC 2VLRB 5HGBB 3UEZA 4EKXA 5EOTA 1U3HC 3NCMA 3ARQA 2EDXA 1IM9D 1FCCA 1EXUB 4NJ9H 4NOFA 3P9MA 3GMOA 2AJVL 2LFGA 3C5JA 4JRXA 4JKKA 1FVDB 1I9JL 2D4DA 4H0IA 1YYLH 3SCMA 2DLFH 5ID1B 3TJEH 4M62H 4N8VB 4F37K 1NBQA 1P84K 1XR8B 2DIAA 2IG2H 2WM0A 3VH8B 4ETQA 4YXLL 2P1YA 5D2NE 4PGCA 2VDLH 1FL3A 2XTLA 4CU7A 5IK3A 2NTFB 3W39B 1KGCD 4X6BB 2HWZH 2H2SD 3QA3B 2BVYA 4YDVB 5IT2H 5F7DA 4P5MA 3NIFF 4G42A 5LGKA 1I7RA 5INCB 3NABL 1EHLH 1F5WA 1DFBH 3MSPA 4NWTH 3JTSB 5EBWB 5JW5B 1T5WB 4NQDD 5EU3B 5DWUH 4GAFB 1S3KL 2UUDH 3RUGE 1UEMA 1J8HB 1UYWH 1P4BH 5IJVA 5AWNH 4C54A 5F44A 1INDL 1ULVA 3X14B 1HQ4B 3EAKA 1F4XH 5C0AA 3UYOD 1KTDA 1LO0H 2OJEA 5FIEA 2PNDA 1G6VK 3MRQA 1FFNB 3E8UL 2AQ3A 1IL1B 4BQCA 5T3ZL 2EO9A 3GSOB 1KXVC 2FSEB 2AK4D 4JPWL 5IESH 3S37X 2VLKD 2ZUVA 1KELL 2GSIB 4ZUUA 4JQIL 1MPAH 4PGZA 4R4FL 3MO1B 4UBDD 3QWOA 2YK1H 1I75A 5TDPB 4NKQB 1IGIH 2EH7L 1DBJH 1B0GB 2JIXA 4QRSB 5BV7C 5D9SB 5HI3D 1RHHB 3DMMC 4LU5L 5B38A 5IB4B 2DMKA 1I7UB 2Q3ZA 3HE6A 2ATKB 1S7TB 5IVXE 4J3XA 4F57H 3DV6B 1IKFL 1T0NB 1YMHB 2EDEA 3CDGB 4LHJB 3JZ7A 3JUYA 3ZDYF 3VWKA 5FGRA 1K3ZA 2WBJB 2ZZUT 2QQLL 1U0QA 2Z8VC 4HIEB 4G8GD 3HUJF 3RPIA 2RCSH 3NFSH 2OP4L 1HEZA 1ZK9A 1OWRM 3D18B 1MCOH 1T80A 2Z92A 2D0GA 4DZ8A 3V7MA 3KLAA 1V7ML 2R1YA 4FQXA 3WFEH 1TJHL 3H42H 3X17A 4UQ2A 2DQJL 1U8LA 4OB5H 1AGDA 1H3TA 1C12A 2YSSB 2IWGA 1UENA 2PTVA 2VDPL 1QSFA 5HVHC 5IB2B 3QJFB 2JCCF 1U8IB 3C60C 4NFCA 5TDOA 5JOPE 1LO5A 1NANH 4PFEA 1VGEL 2BXZA 4PJGE 2JJTC 4QEGA 5B3NA 1A4KA 5FF6B 4NKDA 4ZUVB 1OAKL 4YZFF 4LHUD 3GRWA 3NMEA 3IU4H 1AQDB 3WIIH 1XR9B 4JFDA 2ZG3A 3OKDB 2NY7L 4X6DA 3PV7A 3VXOA 4O51B 1KN2H 2DQHH 3BGMB 3EYQC 5CBAB 1LNUB 1ERNA 4NO2B 4KWUA 1S7QA 2G5BA 2ERJC 4JFPA 4P46A 3O4LE 2EYSA 3OKLA 4RA3A 2YC1B 3GDBA 3W11C 4JFEE 2IPKA 3F58H 1RJYB 1I1FB 5DVKA 4RAVB 1MCRA 4QXTA 1U6AH 3HB3D 3O6FC 1JYXA 1V3MA 5DURD 2FGWH 3O45A 4Y88A 3FRPA 3ABZA 4WFGE 4JFFE 2FD6L 4Y5XC 1QVOA 2PO6B 5C0ND 2GIYA 4Q74A 5IW3A 4U1KA 3MROA 5DHVA 5FV2A 3GNML 3OPZH 1DBKL 1HOCB 1RV6X 1ZT7B 4ZD3L 5MHSD 4NKOA 1VESA 4NZJA 1V3LA 1WBYA 2Z8WC 3QDME 3P4OA 3RDTC 4MGXA 5IWLA 3SGEI 2AKRB 4NFBA 4PJ7A 3O3DA 2VZ1A 3AS2A 4P9ML 1DQJA 3S37L 5D1ZC 2JJVA 3DSFH 5E2UH 1TXKA 4LBEB 1WJ3A 2PXYA 4GW5A 4NRYB 4FTVD 4X4XB 5JUEH 2K1MA 3AXLB 4WW1B 1PEWA 5I1KL 3AREA 4YPGA 4NC2B 4GAGL 5GRJH 1FV1A 2P45B 3HFML 1XZ0A 1MCPH 5F9DC 4OFVA 1XGUB 4U4BA 5E5MB 3IDNB 4CDHA 5D71H 5KG9A 2F53D 4L1HA 2XZAL 4KGLA 1Q8MA 1HHIB 3FCTB 2ZCKH 1JPSL 4Y19B 1FRGH 4EUPA 2WWMC 3SDXE 4IOSD 4R4BB 3VGEA 3L1OL 1ZT1A 1P4LB 3LEVL 4K55A 1OSZA 1U91B 3QULB 5DQDH 4ZPVB 5DMYA 1J8KA 3KYOA 1NAMH 3KPOA 4F8QA 2LABA 1K4CA 4Y16B 5FGCE 4NC1C 3ROLB 3F12B 1ZHNA 1FNEB 2PN5A 5F9WB 5T3ZE 1SEQL 1FZJA 4U1JB 5DEFA 3HNVH 1OY3B 1JNJA 1N2RA 3M17A 3WNPA 3CXDH 4OZIA 2R9HD 4Q58C 2FWOB 4WO4D 1T7YA 3RVVD 1YYMH 1YEFL 3DBXB 1UZ6F 4PRPE 2XPGB 1MRCL 5I1GL 1S5IH 4G7VL 1F3JB 1LDSA 3C08L 4HHAB 2Y5TA 1E4KC 3DX6A 2ZCHH 2E7MA 2VZVA 3FQRA 2KZ1B 4KK8D 3QUZA 4OD3H 3P3YA 2ZSVA 4NQVA 2DQTH 3D39D 1LDPL 4LF3A 3WXVL 3HZVB 4OF3A 5H35A 4HUKB 4PJXA 4AEIH 5I16B 4JN2A 3CNKA 5KVEH 5I8CA 5DJAA 8CGTA 3KPRE 4LAQL 4IRSB 1FG2B 3U79A 4D9RE 2DQUH 4S2SB 5ILTH 2VQ1B 2B39A 3BRGC 2XN9D 3QDJD 3N9GH 2AERT 2X4SA 4NNPH