4MAYC

Crystal structure of an immune complex
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
191
structure length
191
Chain Sequence
ENVEQHPSTLSVQEGDSAVIKCTYSDSASNYFPWYKQELGKRPQLIIDIRSNVGEKKDQRIAVTLNKTAKHFSLHITETQPEDSAVYFCAASSFGNEKLTFGTGTRLTIIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Crossreactivity of a human autoimmune TCR is dominated by a single TCR loop.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 38
structure length 191
sequence length 191
ec nomenclature
pdb deposition date 2013-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mayC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mayC02
3H2WA 4LARL 4FFVD 4P2QA 3SDDC 3HZYB 4U1HB 4AY0A 3FB5B 1TZGL 5IV2B 3O4OC 1FQ9C 4QWWD 3QI9A 4LCCC 1NGYA 4WIQA 1RZJL 4N0UB 4Y4HA 1YY8B 3TYGL 3GM8A 1WZ1L 2OTWB 2EIBA 3CXHK 3PDGA 3ARXA 4PRPD 1V7NH 2NY7L 2NY6B 2PYEB 3D3VB 4BFGA 3GMRA 3VGHA 1T83A 5TDNA 2B5IB 4F7CA 3DMMA 1CGSL 3GRWA 3F7VA 3N9GH 4G43A 4OCLC 4Z7NF 4NQSB 5D5MB 2OYPA 4YDIH 3PGFL 4YHOH 4RDQG 1NCBH 1OAKH 5D1ZB 1CI5A 4RGND 2VLME 4YO0B 5FO7B 3U9PH 5C70A 1NMBH 4NM8L 3DOSA 2H8PB 1Q0YL 3GHBH 5D72L 2NYYD 2CLZB 4S11A 4KDVA 3ETBF 2FGZA 5KBNC 3QIWC 1KB5B 2ZNWA 2I26N 1EO7A 3RKDD 3WNPA 4GLRI 5L88L 5BS0A 3H9HA 5F9JB 3O6FB 4Q9QL 3T0ED 1IBGL 1B6DA 3ZTJG 3WXWH 2NNAB 5I8OH 4HWZB 3Q6GL 1XFPA 1RZFL 2AXGA 4OLVH 3O2DL 1KCRL 1YNTB 4JR9H 1F3DH 5KZCB 2F8XC 2A6DA 3IDIA 4XNZB 5HHVH 3QUYD 3VFSA 3NTCH 2IMNA 3PG2A 2IPTL 3BRFA 3BW9A 4LSSL 3B83A 2FHFA 1AD0A 1RUMH 1I9IL 3SHSA 3WIHL 1S8DB 1FYHB 4FFZL 3GSQB 5I1JH 4FXKB 3KYNA 2WUBH 5ADPH 2VN4A 3BZ4B 4XVUC 1XZ0B 4M9PA 4O4YL 4F7EB 4G6FD 1KEMH 4JQXA 4O2CB 2HG5A 4XMPH 4D0BA 3OKLB 2R2CA 3INUL 5IMKA 1AXSB 2BOCB 5C2UB 1BD2A 4LIQH 2VISA 5J1AA 2ATKA 4ZXBB 3KG5A 1ZS8A 4WUUE 3BKCL 3BQUA 4YDJA 1G9ML 3O4OB 3EOAB 3G9VA 1BX2B 4R7DA 5EOTB 1H0DA 3B9KC 5CINL 1A6TB 3PL6A 1LHZA 1FVCB 3DGGA 4I0KA 3FTGB 4QRSB 3V5DA 4BZ2H 4CDGC 4BH8B 5HHME 3P0VL 4WHDA 4U31A 4YHPB 3K4ZA 5D7LE 4HZAA 2B0SH 2LAGB 1CE1L 3CFCL 4FQXC 5BZDB 3W11D 4CW1A 1DBKL 1JNLH 2BDNH 1JPTH 2EE3A 1CR9H 4HLJA 4HS8H 3WNKA 2UZIH 5KSBA 5JOPE 2BSTA 5IFAL 5KOVC 4R97C 3MRHA 2HVJA 5I1EH 1DLFL 5I6XB 5D7JC 2ICWA 5SWSA 5CMAB 1NPUA 5EIIB 3P73A 5DUMH 1Q94A 5BOPA 4QOKA 4NP4L 1BM3L 2XTLA 4O02H 3O8XC 1A1MA 3N1QC 3FB6B 4PJ8C 2E5EA 4JPKH 1SY6H 3T2OA 2RJMA 3W5NA 3HPJB 4X98A 3UTOA 2EDWA 2FX9H 1IMHC 3BKML 5BRZD 4HMEA 4F7MA 1MCFA 4RNRA 5I76A 3MFGB 3QQ3A 4HKJB 4LLYB 3ZDXF 5I1CL 4NQDB 4XP1H 4Y1AB 1J8HA 4P23C 4ZTPH 32C2A 1N6QH 1QSED 3G04B 1HILB 3IFLH 3PWVB 3VRLF 3B5GA 3MRPA 4RAUB 4X4YB 1T5WB 5BVPH 5J4MA 1HHIB 3NZ8A 4WDIA 4MMXC 3ULUD 3D18A 4AM0A 4AT6B 1KTDB 1J88A 3V8CA 4JM2B 5HPMB 4UTAL 3MJ7A 2A9NH 2BK8A 5DRXB 2WP3T 5FB8B 4F57H 2GCYA 3VXSE 1WGOA 3RY5A 1YQVL 1AGBA 4HAFA 3IS1X 4MNQB 5L7XL 1VGEL 4ZDHB 1GZPA 5LGHL 4CVZB 1QYGL 3IJYA 3DTXB 2NY0D 4L3AA 4JLRB 4GH7B 2NXYC 4H1LG 3QUKB 4K94L 4Q58C 4XC3L 3KPQA 4LOUD 3VWKA 3GUTA 2A73A 1U58B 5HPOA 2VH5H 3I9GL 1OD7A 3B9KB 4NQVB 4TVSa 2ADFL 1AJ7H 4OT1L 4JFDB 4GAYB 1BZ7A 1N2RB 1TZIB 2Z31B 1CFSB 4JRXA 3OGCA 1RU9L 3KPRD 1OTTD 4XP9H 1RFDH 3MRKB 4HGMA 2BVPA 1YN6B 1T0MB 4ZSOE 1YEDA 5DMIL 4ZPTA 3PQYB 4NC2B 5SV4A 1PD6A 3JWOL 3MX0A 2HTLD 3MXWH 1B0RA 4HLZH 1N6VA 1OSPL 5I1IH 4I4WA 2VLJB 3PWUB 3MRIB 4JY4B 2IH3B 3NPSB 1A2YA 2EH7H 4YE4L 4P9ML 1QSFB 4JG0H 1TXKA 4LMQE 2Y36H 4GMTL 1GJIA 4J6RH 2Y5TA 1A7PH 2PXYD 5HSFA 4KHXL 3K8KA 2SEBB 4FFVC 2HFFA 5MEQA 1F13A 4ISVA 3S34L 3T4AA 4AIZB 1FC2D 2VLRD 4ETYA 3HFMH 2B4CC 2IANE 4RMRA 3R0MA 3FFCE 1ZAGA 1YJDL 5DEGA 4YX2L 4PJHB 1IC4L 1I7RB 1CDIA 4HS6A 4WY7L 5AYQA 4Z77A 5HDLA 4HC1A 2DYPB 4EN3B 3OBAA 2ILLA 1JPSL 1NGQL 4PP1D 2DWEB 4RGNC 4IS6A 4M7LH 1MFAL 3T3ME 1QFUL 4TSBH 1RUQH 5IFHH 4D9QE 3ZDYE 2N4IA 3CVHL 1I8LA 2APFA 1RZ8A 5ADOL 5JORB 1PEWA 4JM2F 5J12B 3RKDC 3RWDA 1UWXH 1V05A 3CDGB 4OCNC 5JXEC 3GNMH 1MWAB 1DE4A 4K23H 3I6GA 4N8CH 2ADJA 1DQLH 5ENWA 3F58H 2VLLB 3BI9X 5FDWA 4PLKD 3U36B 3WFCH 1EZVX 3BP6B 3K4DA 1X5IA 2KZ1B 3GBNH 4TTDD 4IDJL 4IJ3C 4K3JH 4WW2C 4F2MA 4HZLB 3LRGA 4MQXC 5DVNA 1AO7D 1F11A 1RIUL 3MV7D 3DX9A 3UTTE 3BKYL 4NO2B 1H8SA 3MYJB 2YK1L 1FNSL 5L9DH 1LO2L 4WGVB 5HHNA 4C54A 4QTIL 3LN4A 4L4VA 1L6ZA 5E5UB 1CGXA 4U3HA 4KMTL 5DFTA 1FL3A 4Z7UB 4NOBA 5H35B 4YXLL 1ORSB 1QLFA 5GGRY 4HGWB 3U48A 3OKNB 1NCWL 3A6OA 3RI5F 5E8OA 3IXTA 4G5ZH 5IR1B 2XN9E 5I74B 1JZ5A 1JNHB 1M7IB 4V1DA 3ZL4L 1ADQA 2GAZA 1Q0XH 4FMKA 5HJ3B 5C0CD 4R4BB 4ODXB 4PJ9C 3RVXC 4Y2OA 4ZTOH 3VFVA 1MJ8L 4HWBL 5TGBA 4HSQA 1IFHL 1JGEB 1H3WM 3FQXA 3MNWA 3TVMC 5TF1L 1IT9L 4OLYH 5JR1L 1YC7A 3DXAE 3EJZD 1SMAA 3ULVL 3TIEB 1I3GL 3LS5L 2O5ZL 5SX4I 3UO1H 4JHZA 5C0AE 1YEIL 4ODHL 2X6MA 1WFOA 1ZLUH 5EZOL 1KUMA 1HDMA 4WU7B 2FX7L 4Y4FD 4M6NL 4ZFFB 4LSVH 4P2OC 1QVOB 3VXRA 5DGQA 1S7SB 1LK3H 1BF8A 3STZB 2DLGA 3HI5H 3S7GA 1UXWA 1C7TA 1F4XH 4XPHL 1FYTB 1RMFL 4Y5VC 4G8EA 1F3JA 4IJ3B 2NX5D 1K4CA 3DV6A 1NBVL 4ELKA 4X83A 3T65A 1GC1C 4X6FB 2AK4B 3JWDC 3SE9H 2Z91A 1J1PH 2EICA 4IRJD 1VFAA 3T0WA 1ADQL 2ZNXA 2F5BH 4YR6B 3PHSA 3WHXB 4XAKD 3LVEA 4W4NA 1LDSA 1T5XB 1UKTA 3GIZL 3MLWH 4G6ML 3RY6A 1KENH 3E6HB 2NY0C 3TA3A 2DQEH 4HIHB 1IKFH 4KY1H 1DDHB 3IT8D 4NFDA 4PUBH 5C6TH 3WHE1 4LOUC 4WFGE 4P2RB 3MA9L 3C5JB 2FIRT 4OF3A 3OKYA 4U05A 4Z6AT 3HMXL 2D7TH 4YPGB 4JKMA 3Q0HA 1AGDB 1T89A 3MBED 4HUXB 1OTTC 3FB7A 3PGDA 3VXQB 2X4QB 4LVHC 3RX5A 2C9AA 4HBCL 3Q1SH 5J11C 4HUWA 4PJ9B 2AXFB 4MD5A 2FBJH 3E6FB 2MCPH 3FCTA 2GJZA 1ZLSL 1NCNA 2FB4H 2ED8A 3L7FB 3TVMB 1HSAB 5ILTH 3B9EA 4JRYE 1MVUB 1IQDB 1XF5A 5DJ2A 1S3KH 5KVFL 1BVZA 2EE6A 2X44D 4FQQB 5IGXH 4I0CC 3S36H 1Q1JH 5I66B 3O45B 4KUCD 4HKBA 2C3XA 4U1IB 1IGYA 1KLUB 2X4NA 4LSRH 5B38G 4ODTL 4PV8B 2BNRD 2DQUL 4XMLH 1GXEA 4PFEA 1EHLH 1U6AL 1F97A 4XP5L 1JV5B 1W2KT 4Z95H 1JWMB 1W0WB 2P8PA 4P2OB 2C4XA 4KJWD 2V2XB 4DKDC 5BXFA 2H2PD 4KQ3L 3RU8H 1MH5A 2UUDH 3C6SA 4PRHA 4GKSB 5FGCB 3HAEA 4R2GC 5FO9A 5DS8B 2VO5A 1YEEL 2J8UB 4PJXE 3TIDB 3TYFB 1LEKA 5H8DA 5J9PA 4H88L 4QCIB 5KJRL 3H3BC 1ZGLM 2BNQE 3KJ6L 2QQKH 2XQBL 5B39A 4ZOEA 1TIUA 1UB6B 1KCKA 4O9HH 4KK5C 3CH1A 1LO5B 3MV8B 3HE6C 4OKVA 3VXPA 1LO0H 1G6RA 4G8IB 3RVVD 2KL6A 5C07D 4ELMF 3RTQD 4K71C 4PB0H 1ED3A 2XICA 3ZE1F 1KIRA 3RWHA 4DGVL 1X5HA 3DUSB 5EBWA 5HYQB 3ABZA 3D39B 3LQAH 2J8HA 4YGVB 5LG1A 2BMKB 4M6MH 3DI2B 1G84A 1IQWL 3GSUA 3SKUD 1H8NA 5SWQA 4WI9A 3I02A 3G08A 1H3PL 1PG7H 4LVHB 1P84K 5HHXL 3UTZB 3CXDH 5J11B 1S7WB 4E5XA 3KXFD 1EAJA 1FE8H 5IFJB 1DQJB 1IAII 5F9DC 1JNNL 4LMQI 4X5XA 1S7XA 1RVFL 5KS9E 4G8FA 2YD3A 3IETA 3QDGA 4G9FE 4C56D 2JB6B 3FOMA 4MDJA 3PWLB 3C08L 3MRCB 4RX4A 3AM8C 3BESR 5DVMA 2QKIA 4M02A 3UTPD 3RWEA 3GMMA 4Z7VA 4J1UA 3O9WD 4Z5RA 5C9JB 1HZHL 1JTTA 5FIEA 3QUXC 1I7UB 5I8CB 2GFBB 2IFFH 3LKQA 3PWPA 1WBZA 5BV7C 1T1WB 1I1YA 2J12B 1CICA 4X8JB 4CVXB 4LSDA 1J5OH 1TTUA 2MJWA 3BSZL 1SBBA 1HYSD 4Q9RH 4KTDL 2X4TB 3L5WA 4LLVA 5LAXB 3H9SE 4PD4J 4L8SC 4NSKA 4R2GB 3FRUB 4OKDA 2ITCB 4K8RL 1WV7T 3JBG7 4G8GB 4R26H 5D7IE 5HY9A 1PY4A 5E08L 2F58H 4O51B 4FZEL 5D1XD 1UJTA 4KV5F 5DJ0A 1D5IL 5IBLD 2XRAL 1E6JL 2A6IB 3W0WD 1JWSA 1IM9A 2HKFH 4L29B 2D7QA 1JGVH 2DD8H 4LSTH 3PHQB 4WUKH 5FOJA 3EJZC 4MD0B 4WI4A 1U8JB 4PG9A 5E5MB 3HE6B 2EKSA 2H32H 4OGXH 5ALCL 5F9AC 1CDUA 2JCCE 4JKPH 2FWOA 4K71B 3C5SB 5EU4B 3QUZC 5DRNA 4QNPE 4EOWL 4P3CL 4ZQKB 1A9BB 3DI3B 4O00A 1IKNA 2WV3A 4HIIA 3VU2A 4HLZG 2D0FA 4RRPG 5DYOA 4X6DF 4LQFL 5D7SL 4C58B 3IFOB 5IW6A 1R5WA 1Z3GH 4GOSA 1BAFL 4OI7A 3TNMA 4PS4L 1N0XH 4N1EA 2XG5A 1FNEA 3WO4C 5T1LB 3DROB 3I2CH 4I48B 4IRJC 3C60D 1T4KA 1G7IB 4WI8A 5C0JA 2ZPKH 4NC1C 4QHUA 1A7RL 1VFBA 2P5WB 3MO1B 3UJIH 5FYJE 4G42B 5GSRB 2BFVH 2HRLA 3BH9A 3PV7A 5HI4D 3NN8B 2IQAB 4L3EA 4HJJH 1P1ZA 3JVGC 2GT9A 4HWNA 4NZDA 3ELAT 2PYED 1TJGH 3V4UL 4Q0XH 5BV7B 5DJDB 2PO6C 2AJSH 4LCYB 3QWRD 5FF6A 1DUYA 4YHKL 5B8CA 4R3SA 4L8SB 2YS4A 1D9KC 2WBJB 1JZ4A 2HMID 5HHMB 1MWAH 5D93B 3HZMA 4JAMA 5JQ6L 1SEQH 5D7LB 1GGCH 2PF6A 2VQ1A 3RI5K 3FMGL 3O6FD 4GLRH 1AD9A 5KSVA 3HI1B 5ICZA 1WZMA 4PLOB 3P4OB 5CP7A 3QPXL 2VRAA 1K4DA 4NNPH 3GEWB 4NNYA 1JUFA 3HE7C 3I50H 2ESVE 3CFDA 3TCLB 4YQXL 5KZCD 1BGXH 3QUZB 3MFFB 2Z8SA 5JDSB 2ZUSA 3C8KB 3MBXL 4ZFGL 5BZWA 4GG6B 2JELH 3THMH 1OTUC 3FQRA 1BHGA 4HPYH 1V3KA 4P9HC 4JVUA 4MS8D 5DJAB 3QDJE 5DMYA 4JFEE 3Q5TA 4LCIL 4AL8L 4WWKC 4APQD 3WLBB 5EO1A 1X3DA 1JF1B 3IDUA 4NO5B 4DW2H 3DYMA 1LGVA 2V17L 5DMKB 5HGGS 4MNGE 2W9DL 1EX0A 3OHXB 1NCAL 4JN2A 5KVGL 5GGUA 3MZTA 5D2NA 5DUPL 4ZXBD 3MOBH 4Y19E 4JJ5A 1MAJA 4KQ4L 4AG4H 3HMWL 2UVEA 2IH1A 1MELA 2CO6B 3RTQC 4ZAKB 1D6VL 1J12A 4X4ME 4CDHA 4HUUA 3QFDA 2B2XL 3M45A 4L4TA 5ECJE 3ARBB 1UM5L 1CFQB 2NTFA 3HLAA 3NCYP 1JBJA 3UJJL 2J7LA 3V4VL 2DKUA 4C4KO 2R9HD 3QPQD 3T2NL 8CGTA 2DQHL 4XBGB 3F8UB 4PJ5E 1S9YB 2A83A 5T3XE 3QSKB 2FATL 3VRJA 1D9KB 1EAPB 1DP0A 5M95B 1VADB 2AXHA 3BRDA 3T0AA 1A22B 3LMJL 2BNUA 4ZSOB 3BPOC 3NCBB 2YEZA 3DBXA 4TVPH 5DHXB 1AE6L 1TCRB 4M43H 5T1MA 3IVKA 3MR9B 2C1PA 2E7CA 4FZ8L 4F8QA 1WIPA 2W65B 1L9NA 2Q6WB 3HE7B 4Y1AD 3T4YA 3TO2A 2OXGA 1R24A 2HJKB 4ALAH 2WUCH 4X7SL 1IAOA 3ARVA 5F96L 4NKIH 5DZNA 3QEQA 2R0KL 4ZO8A 3ARDC 4Z76A 5IHZB 4TRPH 1ZT4A 2YBRB 2O5XL 3D25B 4P5TA 4JM2D 1J87A 3TJEH 2IANB 3FFCB 1Q9WA 4WWKB 3LD8C 5EZJB 1AHWC 3UJTH 5JZ7D 1EXUA 5D1XC 3L95A 5I18L 4PV9B 4OBRA 1SJEA 5IBLC 5HI5C 1VHPA 3SO3B 2P49B 1WBYB 5GIRA 2VLKE 3VXTA 1U3HB 1A3RL 1G7JA 4FXLA 4CU6A 5FGRA 1YYLH 4FHBD 2HJLA 3TPKA 1U8KA 4Z7OF 3AAZA 2X5PA 3O41A 3CPLA 3G5YB 1S7RA 1I3UA 4YXHH 2Z31D 4HX1B 5CBAB 2LV4A 5T1DH 4GRMB 5E2UH 5ID1A 35C8H 1QQDA 3KPSD 1YNLH 3MODL 1LK2B 3B8YA 1KN4H 4EI5D 5I1DA 3GJFA 3S9DB 3H0TB 3MOQA 2EO9A 3PQYD 1CLOH 4LPUA 1ZHNA 1MAML 3I6LE 3UTSA 2WIIA 4W6WB 5D1QB 4DTGL 2FH8A 2VLJD 3K74B 1XMWA 4NHCH 3G5ZA 3BEVA 1QSFD 3BXNB 2IG2H 1QNZL 4OCWH 5HYFA 1N5YH 4OCSL 1JGUL 3BPOB 2D0GA 3TN0D 1UM6H 4PJDE 3BUTA 4H5SB 4ZO9A 3QNYB 4H8WC 5DWUL 1YZZA 5HI4C 3UTTB 4Y2DB 4RWYL 2W9EL 5IG7A 2P24A 3WS3A 4UTBH 2WBKA 1P5UA 2P5EE 2QV2A 2Y72A 4OLXL 5EH1A 5TE6L 1I1AA 1KTLB 4HDIB 4P57A 2BVEA 1I7ZB 3L3JB 2R0ZL 1T0NA 4MWFA 2H3NB 5MENE 4DK6A 4Z7WE 4EN3D 3BT2H 1YYML 4RWHA 1HWGB 4MQ7B 4XNMB 4U1GB 1P4BH 5AZ2H 5GRYA 1L7TL 1X6LA 4EDXA 5T5FL 3REVB 1SM3H 2VIRB 1RUPL 5KVEL 3EJYC 5IEKB 3LKRB 4Y8AA 4IHOA 3L3IA 2YUXA 2XN9B 3LD8B 5FV1L 1INEL 2HMIC 1AHWB 3O3AB 4DGYL 4L8BA 1T21A 5DJ8B 3BDXA 1Q9OB 3F7RA 3NABH 4PPTA 4P5MB 5IMMB 5GJTH 3V7AG 5MERB 1UXSA 3VG0L 3R06B 3X12A 4OF6A 1TNMA 2J1KA 3V5HA 3BD3A 4KKCD 1T2QH 3V4PH 5AZEL 5ANMA 3QISA 4G6KH 1N7ML 2V2TA 4CN4A 3DXAB 1KB5L 1DUZB 3HB3D 3VFNB 5LJYH 3C9NA 1P4LA 2HT2D 4JDZA 1WAAA 3BGFB 4DN4L 5JUEL 3HZVA 4NDMA 4OZ4B 3T3MF 4OZFB 5C0AB 4XT1C 1N4XH 4ODUA 5IEHA 3ZDYF 4UIMA 1F6AA 3CX5K 5TE4H 3OSKA 3MRJB 2EZ0C 1CU4L 4YDVB 1A0QH 1P6AB 3MCKB 1FZJB 3KPMB 2R1XA 1A6WL 1MLBA 1U8OA 1LWRA 4B50A 4KTEL 4WNQB 4JFOA 4APQC 3MROA 3MACH 3TBTB 4M5YL 4ODSH 1Z9SA 4RAHA 5ITBH 1T80A 4MJ6A 1NDGA 3FQUA 5GRUL 2DF3A 5E00A 3WUWB 1BEYL 2I60L 3ILQD 2I5YL 1TVBA 3QIWA 3K0WA 1X5LA 4JFFE 1CD0A 4DKEL 5DA4A 2MHAB 3DHMA 5CD3B 4WHCA 4ZS6C 3CK0H 4NQCE 4GBXB 3DO7A 1NAMA 3QWOA 2P7TA 5SWZB 3LCYA 1XGUB 3V0WH 1BQHG 1PDKA 4MXQC 4BSVB 3BUYA 2BCKB 4J4PC 6CGTA 1CGYA 1G0XA 1O7SA 4I8DA 3MRGB 3QPQC 1INQB 1HH6A 5CD5D 3BAEL 3QXAB 5HHPB 1Q9LB 3RAJL 1F6FB 3QZWB 3VW3H 2FH6A 3ARFB 2CRZA 2ZOKB 3K2MC 4GKNB 5I15L 5E2JA 3RUGE 1IC1A 5F7WC 3ZO0A 4YDKH 3FB8B 4G9DB 3VXUA 5FFLA 1FFNB 4U1KB 4XNQA 1KYOJ 4OD3L 4U7KA 3VGAC 2UWEA 5TQ0H 5C0RH 3UYRH 2EDJA 2LU3A 5JXAH 1S9XB 4U0QB 2WANA 1HK6A 5JHDA 3HUJA 5GS1A 4XB7A 5E8DL 3BZEB 5E7BA 4JRYB 5GGQH 3LEYL 5I1KL 2DQFA 4BKLA 1IE5A 1Y18A 1WC7A 4DKAA 2RR3A 3UPCA 5ESAA 5I73C 3VWJC 1OW0A 2RCSH 4A6YB 2HYMA 1NAML 2XFXA 1ZSDA 4NRZB 1MFCL 4OD1L 1WWCA 3MV9D 4AJ0A 1U8NB 2H6PA 3KYMA 1XIWC 3HNTH 3N85H 3UPAA 1QEWB 3HG1E 2WNGA 4G7YL 1S7TA 5JPNB 2Z8RA 3KWWA 1EUUA 4FQXA 5E9DA 3VXMA 5T3ZH 4LEOB 1QKZH 5J8OA 4PRIB 3JSSA 2F54A 1FO0L 5FHAH 3OG6B 1TVDA 4JREB 1T7VA 3GSVB 2PKDA 5GHWL 3WS6A 2GSGB 5D7JA 3S37H 2HFEB 4D9RD 3D85A 5GZOD 2XZAH 3H7BB 3OB8A 4LPYA 4ZFOA 3BZDA 1H3GA 2LVEA 3D0VB 2CDGA 4OFPA 4PJ8A 1XF3B 1YNKL 4LBEA 4KUZL 3DURA 5A2IH 3EFFB 3OG4B 2HTKD 4JO3H 1ZT1B 1JPGA 3L3OA 4LL9A 4QYOB 3NFNB 3KPPB 5K9JL 1A7QL 2OZ4A 4M7JH 3TBWA 4P23A 3O11A 2V9TA 4LU5L 1K6QH 3FQTA 3H3PL 3IKKA 4LRIC 3KYKL 2NY4C 1JI2A 3K1DA 1CK0L 3RVUD 3EYSL 5KVDL 3CIQA 3K8MA 3DVNB 2ZG1A 2ZJSL 2CR6A 3VD9A 3W39A 5BS0E 2VZ1A 1KPVA 3S4SG 4KXZI 5HYJD 4LPCA 3VGAB 5HGAA 1M7DB 3TN0C 3ILPB 4KKBC 5E2VL 2X9WA 4HXAH 4Z0XA 1Y0LA 1GCFA 3WUZA 4RFEB 4ZUTA 1I3RB 3BKJL 5KS9B 2ZUQC 3I75B 1MHHB 3BD5A 5JW3L 4G9FB 2P44B 4XCNB 1R3JA 5E99L 5MHSD 2JTDA 3U1SH 5CSZA 4AH2A 2H9GA 1Q8MA 3P2TA 2MWCA 3I3EA 3LB6C 3V6ZA 4OZGF 2AEWA 1WFUA 2WINA 3O6KH 5HDQL 3G6JA 4L8DB 4QHKI 1XIWB 5GJSH 5JOFB 5ERWA 5HGHA 1A1NA 1BZQK 1LE9B 1ZANH 1ACYH 1KFAH 3NFPA 4CVUA 1N6UA 1EEZA 2RB8A 5HVWA 3PV6A 4GKZB 3MQIA 1EVUA 2RBLA 3H9SB 1DQDH 1ZTXH 4DEPC 1UVQA 5GS0C 2DJ4A 5D7IB 1AGEA 1PLGH 1VERA 3LRHA 4JGMA 2QSQA 2CH8A 5I0ZA 1DBJH 4PRAA 1S9VB 2M8XA 3WD5H 5AAMA 1P4IL 4LNRB 1HHHB 1LE5A 1UJ3C 1XCQA 5EZIH 5EUKB 3V6FA 4IIQC 4PJXF 3O6MH 2YRPA 3RWIB 2HT2C 2YWZA 3JTSA 4U3CA 1FPTL 4GQ9L 3OX8B 1OARH 3RVTD 2O5YL 2HFGL 5CKGA 2JCCB 5A1AA 1A5FH 4PRPA 5DMJB 3HR5B 12E8H 2ZUYA 3VFPB 4J7RA 4NRXB 1EEYB 1LNUB 5DJCA 4H1LA 4U1JB 4WO4C 5SWSE 1U8MA 2DBLH 1IAIH 4JPIA 2Z35A 3IDJB 4QOKE 5IB5A 4QRTA 4G80B 1G6VK 1CLZH 1EGJA 3ILQC 3QO1B 5E1AA 5DRWA 1FV1B 2BVYA 2I9TA 1NC4B 4LAQH 4CGTA 4JZJC 2X9YA 3CFKB 4OLUH 3IKCB 5IESL 1MFBL 1RIHL 3MGOA 5K9QI 1J8HE 5KN5A 5LWYL 2ZUQB 5EZLB 4GAFB 3IDNA 5LQBH 3P11L 3P4NB 3DVGA 4LSUH 4K7PL 3EYQD 5EU5B 3T2QA 2IWGA 4I18C 5E6IC 4EXPX 5KS9F 4S1QL 1IEAB 3U9UA 3QUYA 4TNWF 5HHOB 1EUTA 2B4CL 3LKOB 3I84A 4JO4L 4WW2A 3CFEB 2VL5A 4LCUB 1J86A 2VC2H 3D9AL 4LKCA 3RA7L 2VLMD 4PJGB 1GSMA 4QHNA 4NRYA 2Q8BH 4MAYC 3VFMB 5I71B 3BEWB 5ESQA 2Q8AH 5DZOA 1MF2L 2BRRH 3CCHB 3WEXA 1XH3B 4HK3N 4M8VA 2CGRH 1BVKA 5CEYB 4ZPVA 2AJ3B 3RFZC 1OWWA 1EGJL 5DI8A 5EUOE 4JRXE 3TH3T 2Z4QB 1UJ3B 4JFZH 3U0PB 4IIQB 4H25B 2PW2A 2D3VA 2VXSH 4PGDB 3S5LG 5DT1H 5BQ7A 1K3IA 2QHRH 1TNNA 1CYGA 3UMTA 2ESVB 3FT3B 2XKNA 5T1LD 2LABA 4ENED 4POZD 4JB9L 4U1SB 4CADB 1NDMB 3QHZL 4PBWD 1A4KB 2JCCF 4WO4B 1RJZA 5GRZA 1MCSA 4ODBD 1BPVA 3TBVB 1OGAE 3QNZB 2IBZX 4HCRA 3GSNH 4MX7A 2VXTH 2VMFA 5T3ZD 4J8RA 4M4RA 1D6EA 3BYYA 4MNGB 4LNVA 4FQCH 4I2XE 2FDBP 2VDLL 2VXQH 2X1PA 3K7UA 4WUUD 4PJAB 4Y19B 2QQLL 2HTKC 5BRZA 1JPFA 4HG4J 5GS2H 5I30L 1U91B 1EVTC 1I85C 4XPGL 1P7QB 4OF0A 5E4EC 4ZFZA 3DX7B 2EDQA 4KPHL 4PGJA 1QSEA 2WBJD 3TT1H 4XP6H 2BSSB 3KLHD 2B1AL 1OD9A 5IBTH 4XHJC 3GHEH 4Q7DA 2D9CA 2FRGP 3MLZH 1VGKB 1QTYT 2DL2A 4GRLD 4PJ5B 3OZ9L 2X70B 3PGCB 4LAJH 2C3HA 1DFBL 4MAYB 4D9LL 5ID0B 5T1KD 1MCPH 3IU4H 4YBQC 3QQ9D 3WV0A 5JOPD 2NLJB 2I27N 3MLYH 1NCDH 4EUPH 3MLUL 4UNUA 3B6SA 5IF0A 1UCBL 4QXUH 4OSUH 1MY7A 3O3DA 3CVIL 2AJVH 5DRZA 3V5KA 1F90L 5L2KE 3CU7A 1B3JA 2CKBB 2J4WL 2NR6C 5K93A 3S6CA 1FGVH 1LO3L 4E41A 3NCYS 4GS7B 1JE6A 2HLAB 5CIPB 3RZCB 2ICEA 4GXUM 2W60B 1CGUA 2YKLH 4MCYB 2DQDL 1BOGB 3ULVE 5BJTB 3QIBB 3ARTA 4WEMB 4M61B 1CS6A 5E94B 3EOBA 4WEUD 1VPOL 2E6QA 1NUGA 2JJTC 4YHMH 2Y07H 3RWGB 3QJFB 4LGSB 1D5ZB 3GSWB 4L4VE 5ETUB 4EI6A 2XYCA 3NZHH 4O58H 3ME0A 1X5FA 1OM3L 3RKPA 1VEOA 4P2YA 1V5JA 3VXSD 5GRVK 1WT5A 5AUMA 3U4BH 4ZAKD 4JFQB 4X7FC 2PXYA 5TDOA 1MFDH 3ZDZE 3WE6B 3F6LA 5DQDH 4PJFA 1AH1A 5FYLL 1G9NH 1YPZA 3RGVC 1C08B 2A0LD 3FO9A 2DTMH 1S9WB 1FVEB 4CMMB 1EJOL 5D8JH 1ZT7A 5A3ID 2VLRA 3BWUC 1RULH 4QRQB 5J6HB 2EYRA 1H3UA 1E27A 1IAKB 3G5VB 1MCWM 1MHCA 5A2JH 4PYGA 2CDEB 5HGBB 3WSQH 5KG9B 4GAJH 4CN1A 4NIKB 1C16B 3SDAD 3F7YB 2CD0A 2HWZH 4Y16D 2YUZA 5FUOL 1IILE 3HRZB 4UDUA 1Z5LA 3GGWA 3WL9B 2MSPA 1JN6A 2R56H 4RQQA 4HS3A 5LXGH 5KAQF 5TE7L 1TFHA 4A6YH 4KROD 2DBJA 3MUZ1 1RHHA 3CJJA 1VACB 3VXRE 5F7DA 4KZDL 3S96B 1KJVA 4PJDB 3CZFB 2NZ9C 3IAGC 2VDKL 3IU3B 2YUWA 1HHKA 3LIZH 4YIQA 2F5AH 5GS3A 3MRQA 2ZWLT 1I9EA 1QFWL 2P5EB 4PGZA 5F7YC 1KJ2L 5IK3A 4YGAB 5E8NB 5I8EB 3QCUL 1UFUA 2ITDA 4C83A 5DHVH 5CZVH 3V9FA 1I4FA 5MENB 4X5LA 1CWVA 4WFFE 1FDLH 3WJJC 5IMLA 1T20B 3U46B 2YC1A 4N9GB 3DRTB 5B38A 3V2AR 3MV7A 4U4BA 1LEGB 4HIJA 4KVCH 5I2IB 1ES0A 4UUJB 5K9OA 4NNXA 4D9QD 2CIIB 3LQMA 1QR4A 3S35L 2AEQH 3QXWA 5AEAA 3AM8A 1U8QA 3FQNA 4C55A 4YDLC 2R0WL 4H0HB 1OP5H 5IW1B 5IOPA 4UI2A 3RGVB 2RFXA 1IARB 5JDJA 1HWHB 1NCUA 5C0IB 1JIBA 4Q6IC 1YUHA 4CL7A 4HK3J 4NUGH 2JIXB 4NKOA 4UQ2B 5D1QD 3PHOB 4F37K 1MRFL 2GK0A 3ZZ1A 1D5MB 4LRNH 2JK5A 1UM4H 5EIVA 4NWTL 5IQ9A 5FA3B 2KQMA 5DLML 1J1XH 1DANT 4POZC 4RZCB 3IAPA 2NCMA 2IALA 3V0AC 4L9DA 5C0CA 3ORJA 3A6BL 1B2WH 3G5XB 3MUGA 4W4OA 3S98A 3MREA 3VFWB 3WKNA 1CF8L 3UTTD 4FQ1L 1BZ9A 4Y2DD 3IDMB 4JR9L 4NM4H 2FJHA 1FGNH 2MCG1 5HBBA 5CWSA 5I75C 5CZXC 4NZUL 3F5WA 4PTUB 4FQJL 4L3CB 4YWGL 4DK3A 3BHBB 3GI9L 3MA7B 3JV6A 4X7TB 2RQ8A 1MJUH 1U2HA 3QI9C 5HDBF 1AGCA 4JFFB 2VR5A 4RA3A 2VZTA 4O5LH 5ADPL 4PRHE 5MEPA 4Y4FA 1YDPB 4H20H 1OY3B 3SDYH 2FD6H 4NQCB 1FSKC 3CLFL 1SY6A 5C8JB 4UINL 2OBGA 3KDMB 5B4MC 1Y6MR 4PJDF 2IPKB 5GS2D 3I3DA 1BVLB 5BV7L 4ONGL 1C5BH 4NO0A 2HT4D 3T08A 3X3FL 2NX5A 5J3HD 2H1PL 2D31A 4IRJA 4GRLC 3L6FA 3L9RA 1PQZB 1R5VA 3KLAB 1ZXQA 4IRSD 4BZ2L 4JFYA 4Z0BH 3QXDA 4Z7WF 4YJZL 3RUGB 3OR7A 5ISZE 3D69A 2BC4B 1TTGA 4WCYH 1CDGA 5F21B 1QLEL 1KT2B 3HKFA 1T7YA 4N8VG 3T77A 2P4AB 1I9JH 3HS0A 1WEJH 1T7WA 4TUJB 1T1YB 1QPPA 2OR9L 4S1SH 5I0DA 4LQ1A 3AXLB 4MXWH 2X2YA 3WXVH 2R2BA 3MBEA 2NMSA 2YZ8A 1QBLH 4U6YA 4TQEH 3UTQB 1K9TA 4PIRF 5ESVB 4DCQA 1KJMB 4K55A 2FX9L 1T22B 3QDGE 5HHQA 3Q6FA 4FFWC 5FYJH 1O0VA 3EZ8A 3PDOB 2DS4A 4D8PB 3HG1B 1HIMH 2ENYA 4HGKC 3U4AA 2DM2A 3QNXA 1P5VA 3CC5A 4HFUH 4JQXC 1DN2A 4RRPA 4GBXD 3IDGA 1J1OH 1RZGA 3PWPE 5J6GA 4P2QB 1FNGA 2AGJL 5FHBL 4B53A 2BNRA 1NGYB 4Y4HB 1CDHA 1MQKH 1HQRA 1F02I 2BOBA 1RK0A 2BJMH 3PL6C 5GGSA 4X9FA 4OQTH 1JJUA 5I1GL 4M5ZL 1MLCA 1VFMA 4XNYH 3LS4H 4LEXH 5IJKA 1CDJA 1RURH 2CUHA 2D03L 1UA6H 3MCLL 3GMRB 3ARFD 5TDNB 5IB3A 4XTRC 4F7CB 3DMMB 5I17A 1OCWH 3F7VB 5ICXA 1X5AA 3F12A 3ALPA 2AXJA 4YHZL 5E6ZA 2FJGA 1IGJA 4Z7QE 4I3RH 1TTFA 3HC3H 4K94C 1RK1A 3VXNA 2VKWA 3BH8A 4XPBL 3UBXI 1DEDA 3LH2L 3WNLA 4KROC 2VN7A 5BS0B 3H9HB 1W72H 4YXKH 3QRGL 4PB9H 4UB0H 5FM4A 5C07A 3RTQA 1IGCL 3OAZH 4R0LA 1KN2H 5I1IL 1YMHA 1NCCL 1TPXC 3O6LL 3RUGF 2EH7L 2AXGB 3L3HA 3MRNA 5IVZA 5JW4M 4HWEL 2CJUL 4IBLT 3AU1A 1A7PL 4OIBA 5F1IA 3IDIB 3N1MC 1BJMA 2DKSA 3BW9B 5MEOA 3MJ6A 1D5BA 2AABL 3BD4A 1NEUA 1AD0B 1U8LB 4FP8H 2NY3D 1SJHA 3KYNB 3AMLA 2J5LC 3KXFA 2OR7A 4P9HL 4JVPA 1I9RL 3VGFA 2BNQD 5CEXA 2HG5B 4D0BB 1B6UA 4XPTH 4C56A 5IMKB 1IC7H 2YUVA 4UBDC 1YN7A 3MRLB 4N0CD 5J1AB 2ATKB 1ZS8B 1YJDC 3BQUB 4M7LL 4YDJB 5FKPA 2GITB 1W8OA 3O9WA 3PWJA 4R7DB 2NY1B 3B2UC 3E2HC 1OOAA 3UC0H 5I1LA 2YPVH 3V5DB 3GK8H 5T3XH 1CTNA 4CNIA 1QBAA 2A1WL 3OKDA 1MRDH 1DL7H 3GNML 4WTXA 3FO0H 2G60L 3L5HA 3CU1A 1ZVHA 4HIXL 3SN6N 3BGAA 4EUPG 1EHAA 4ZS7L 1UGNA 5F70A 3V52L 3FN3A 5D1XA 5ICYA 5KSBB 3BIAX 2AV7A 2HVJB 3MRHB 1KLGB 4NWUL 3W0WA 2CKBH 4N9OB 1CZ8L 5SWSB 2VDRL 1XR9A 1FFPA 5CIPH 1Q94B 2DM3A 4G9FD 4QOKB 4R90H 1A1MB 2ZCHL 4NN6C 1E0OB 4GSDH 3GSXA 4JHBA 4X98B 4EQ2A 1I75A 4OGAD 4F7MB 2IPUK 4RNRB 4OJFL 4F9LA 2CLRA 3QQ3B 1K8DA 1I8MA 2DMKA 1FL6B 4LASH 3QULA 5E6YA 5F1NA 1J8HB 2QSCH 2OSLA 1UADC 3G6AA 5C0NC 3DARA 3QT2A 1BOYA 4QLRA 1WIUA 2LE9A 5INCA 3DRQB 3NZ8B 4WDIB 3O2WL 4KJPD 4AM0B 2XTJC 3DECA 2IADA 1KELL 5D2NE 3OTTA 5CGYD 2Q3ZA 3MJ7B 4U0RC 1XF4A 4YBHA 5IQ7H 2GCYB 4GQPH 1AGBB 3RX7A 2EXYD 1MCKA 3LRSA 1JHKH 1GZPB 2UV3A 3O0RL 4L4TE 3IJYB 4G6JL 5ACMA 4KRPB 4UT7L 4FTVA 4TPRH 3NCCB 5EWIL 4BJLA 3KPQB 2C1OA 2XA8L 3VWKB 3GUTB 2A73B 4FXGB 3H42H 3L1OH 4ZTOL 5DZLA 4QXGL 4FQLL 3V6OE 1DBAH 1B4JL 2VSCA 2PYEA 1FBIH 4X4ZA 3U2SA 3E2HB 5EUOB 3DETD 1WLHA 4JRXB 4KRLB 1CBVL 4LKXA 3OGCB 4WJ5A 4DKFL 4NQSA 4CU7A 5GRJL 3N1FC 3QWRA 2BVPB 3Q5OA 3TV3H 3LZFL 1BBDL 4ZPTB 1KBGH 5HYSG 5JHLL 4JE4B 2H8PA 1RJYB 3DWTA 3Q5YA 4XWOD 5IROA 3LDBC 4I4WB 4TSCH 4QY8A 1NC4D 1A6VH 1A2YB 3SDXE 2NY2D 4F7TA 2R1YA 5EBLA 4NC0B 3O6FA 3WFZA 2Y5TB 1F4XL 4PRBA 2PNDA 5IHLB 3QUMA 2NNAA 1OGAB 5IWLC 3QEQE 2ADIB 2FHBA 5MEQB 2HFFB 5TDPA 5C7XH 4ISVB 2AJYH 4LFHD 4S1DC 4H8WL 2YD5A 3VA6A 3T4AB 2AKRB 3P3YA 4I2XB 4WU5A 5FYKE 5FCUL 4YHNA 3VMPA 4DFIA 5DEGB 5DD3L 3SCMB 2Q7YA 2E8YA 2UZXB 5IT2H 2J6EA 1OAZH 2IC2A 4HS6B 5KSAD 3S8WA 5HYIA 5F72S 4Z77B 3BJ91 1UWGH 1S8DA 4KY1L 2YHGA 1BQSA 4APQA 2XTJB 4IS6B 3RIFK 4XCEA 2WAHA 4CUCA 4F7EA 1CFNA 2W59A 4HQQH 4Z18A 3OKLA 4E0RB 1RZ8B 2R2EB 4NQXB 4MJ4A 4QRUA 2AEIT 1RZ7H 3A6CH 4JZOA 3RWDB 4ZXBA 1B0WA 1UQSA 5D9SA 4KAQH 5TPWH 3EOAA 2QSVA 1ITCA 2YPLE 4HIEA 2QTEA 1DE4B 4KRMB 2Z93A 3I6GB 4PG2A 1EBAA 2ADJB 4U1LB 5J1TC 5ENWB 1A6TA 3UBXB 3NA9L 1FVCA 2Y06L 4QRSA 5F7EH 2MCPL 3FZUD 3WLWD 3QUML 5FDWB 2ESVD 1SYVB 3DSFL 1DQQB 4HJ0D 3UAJC 3CX2A 2FEDD 3QH3B 3MNVA 4YHPA 2Y23A 5EC1B 1EMTL 1Q1JL 2XXCB 1OB1A 5L2KB 2DLFH 1A4JA 3HC4H 5BZDA 4FNLH 3CDYA 3UYPA 4M6OH 3MLXL 1F11B 3AFLA 3QDJD 4JFED 5EUOF 3VI3E 2J6EL 3OPZH 4OIIL 5DC9B 3RL2A 2FO1A 4K3EL 3DX9B 4Z95L 2B1HH 2VUOA 2YD8A 2E7MA 3SJVD 1GHFH 3ESUF 2E7LA 1D3CA 3TGXA 5HHNB 3I6KA 3RY6C 1X9QA 3LN4B 4L4VB 1GAFH 1BFVL 3QA3B 2BVOA 2VKXA 3TA3C 3ZT6A 1FL3B 1YEJL 2D7PA 4N0CC 1YEKH 5TQ2H 4N90E 1AKJD 4HKJA 1KCSL 3SGDH 3EDEA 4B7LA 1A7BA 3BFOA 1TQCB 4Y1AA 4RAVA 3G04A 5JIHA 1E4XI 1HILA 2PCPB 4KMQA 3FRPG 3PWVA 2QL1A 2DI9A 5KANI 3IXTB 4RAUA 4X4YA 1HXMA 4MSWA 1IZJA 1YEGL 5F93C 3KHQA 4LARH 4V1DB 4JM4L 4JM2A 2GAZB 1TZGH 4BH7A 2YD7A 3RVWC 5I19L 4PR5A 2QR0B 1RZJH 3ECBA 1KCLA 3DVFA 2KUTA 3TYGH 3VFVB 1WZ1H 5IHUL 5TGBB 4U2YA 4ZDHA 4IOIB 2NY7H 3CFBA 3FQXB 3MNWB 1BQHA 5ANME 1P7HL 2GUOA 4QXWA 3EDFA 1TITA 4XCCL 1ETZA 4HUVA 1A64A 1CGSH 1WAAE 4P3WA 3PGFH 4PJIA 2HP4A 1EH9A 2WK2A 2OK0L 3RX8A 1MJ7L 1U58A 5C0BE 1MHEA 3TF7C 3DX8A 1L6XA 4NM8H 3X3GL 3RZCD 1J05B 1Q0YH 5D72H 1RAMA 1T66D 4OGAC 2Z31A 2H32A 1MPAL 3VXRB 2IQ9L 4G7VL 3KPSA 3LKSA 4M3KB 4KI5C 5GZND 5L88H 4EI5A 1UXWB 2D9QB 3VD3A 2Q20A 4Q9QH 3PQYA 4KI1A 2X4RB 1B4RA 1A6UL 5D2LA 4G8EB 2ZCKL 1T1ZA 1ND0A 1F3JB 3QFJA 4ELKB 1K4CB 1UEMA 4PLJD 3GJEA 1KULA 3T65B 1DQTA 3Q6GH 2Z91B 1RZFH 3MRIA 2IH3A 4LFHG 5F6IC 1EFXD 1QSFA 2IFFL 3O2DH 1BIIB 1KCRH 1SJXA 4PRDA 4GMSL 2LU4A 1J5OL 3TN0A 2IPTH 4LSSH 4Q9RL 2B7DT 2VLKD 3P40A 1CXHA 4CN6A 3VCLB 3EOTL 3ULVF 2EIEA 5GRXG 3L7EA 3DGCR 4KC3B 3WIHH 1GIGL 1TLKA 4X7EC 4FFZH 2I9LA 4NQDE 5FECA 3K80A 4AIZA 3MGTA 3SGEI 1KXTB 4YK4C 3RPIA 4AENB 1QO3A 1WWBX 2GTZA 2H2SC 5KOMC 4O4YH 3MLVL 4XVSL 1I7RA 2XOTA 1JGVL 2DD8L 2W92A 1PKQE 3JV5A 4WUKL 4RBPH 3INUH 4EN3A 4KDWA 1MQ8A 3FB7B 3PGDB 3VXUE 1I1RA 3BKCH 4NFCA 3I6LD 1MCEA 1G9MH 3ZDZF 3H9ZA 2UWEE 1AQKL 4HUWB 4YEEA 5CINH 2N56A 3VDBA 2LQRA 3HUJE 4U6VL 2GJZB 1C8PA 3QG7H 3P0VH 1NBYA 1XF5B 2XNAB 5DJ2B 3PP3H 2K9UA 5EULV 1MCLA 1MWAA 4NBXB 3CLEL 1OVZA 1L4IA 4KJQC 4BUGA 2HLFC 1CE1H 3CFCH 2X4NB 1DBKH 5ALBL 3OAYH 3U36A 3QEHA 3BP6A 3QHFL 5IFAH 2LVCA 5C08D 1A3LL 1DLFH 4HKZA 3ZSTA 3CMOL 4EDWL 1F8TL 2LAAA 1INDH 3S4SA 3WIFA 1IVLA 5BXFB 1XEDA 4NP4H 1BM3H 1MH5B 3C6SB 3IJSA 4HZLA 4PRHB 3N1PC 4FG6D 5BMFL 5FO9B 3BKMH 4RISL 1LEKB 1YECL 5HVGB 5J9PB 5I1CH 2IPUG 4KZEH 1A7NL 1UH4A 1GOHA 5D6DA 3SY0B 1MHPL 1FN4A 4N0RA 5KAQG 1AXTL 1J0IA 2AK1L 3VXPB 5H35A 5IP4A 1NFDA 4JZJA 5L6YL 3OXRA 4UTAH 2YN3A 3IRZA 5GS0L 1ED3B 4NQED 1MFNA 4QT5A 4GW5B 2JIXD 1KIRB 3RWHB 1YQVH 2CIKA 3NBNA 1H8OA 3FZUC 5EBWB 3VDAA 1OQXA 1VGEH 3FT4A 1CIUA 4L1DA 4HJ0C 5LGHH 1M7IA 3EO9L 4PP2B 1PZ5A 2EECA 1QYGH 1NC2D 3GSUB 5F71A 4XX1G 1VESA 5T33H 4DOHB 5SWQB 4LLAA 5HJ3A 3I02B 4R4BA 4XC3H 3LHPL 1V3MA 3G08B 4GRWE 5DQ9A 3NIFE 5EOCL 1CD9B 2K1MA 4OM0L 5LGKA 5E0QA 3VFOA 2BY3A 3I9GH 2V7HB 4E5XB 1BGXL 2ADFH 3VMOA 4OT1H 5DSCB 3ARQA 4LK4A 2RHEA 1RU9H 4X5XB 1S7XB 4LLDB 4G8FB 4PGCA 3IETB 2FLRT 1HI6B 3QDGB 1V7ML 3FOMB 1W0VA 4MDJB 4UV7L 5DMIH 2HRPL 4JFFD 4BSJA 4LPXA 2QKIB 3V95A 3RWEB 5C0EA 5HVHC 3JWOH 4Y5XC 2OJZL 1OSPH 2OJEA 4J1UB 4LVNC 5FK9A 1FZOB 4Z5RB 5C09E 3TC9A 1GOGA 3MNZA 3SDCB 4YAQB 4YE4H 3ARZA 4P9MH 3PWPB 1WBZB 4QF1A 4P0DA 1CICB 5CJQL 1L0YA 1SEBA 2A9MH 3OKMB 3MV9A 4KHXH 3TT3L 3L5WB 4AG4L 4LLVB 3KPNA 2DI8A 3CDCA 4X6FA 3S34H 2X89D 2ZKHL 4NSKB 1M7XA 4W81A 1KPUB 5HY9B 4ELMA 3EGSB 2E6PA 3C6LD 4H0GA 4KWUA 2X4PB 5DJ0B 2JE8A 5EO0A 3ZKND 4C4KT 4YX2H 2NY5C 5JOEA 1JWSB 1IM9B 4JO1L 4Z7UE 4WY7H 3E6HA 4YLQT 3EHBC 4PG9B 1IC5L 2VDQL 3VMNA 2EKSB 4DQOL 3ZLQC 4BK4A 1JPSH 1NGQH 1L0XA 1MFAH 1QFUH 3R8BB 1NSNL 2FWOB 4PRPE 3RWJA 3X11A 1IEBA 3CVHH 5DRNB 1T03L 4YPGA 1I85A 4HIIB 4HW6A 4M43L 5DYOB 2O26U 5GZNC 2X4QA 4RGNE 3MLRL 1TENA 4OFYD 5C92A 1R5WB 4X6EA 4P5KA 2YPKA 3E6FA 3TNMB 1PSKL 4ZNEA 1FNEB 3HG1D 2DN7A 3ARED 2ZUTA 1MNUL 5EO9A 3ZTNL 5K9QG 1FG2A 1CXKA 1T4KB 5IVXA 5C0JB 4QHUB 1DVFB 1VFBB 3S5LA 4NQTA 5HYJA 4CVWA 3TH4T 3BH9B 3IDXL 1SQ2N 2QEJA 1HINL 4IDJH 4YHYC 4LSPL 4IMLA 3FOLA 4PV8A 5DA0B 4UZGA 1RIUH 1FL5A 3N06B 4ZG1A 5HVHB 1MCDA 1P1ZB 1ULVA 2ARJA 1JWMA 1CLCA 3BKYH 5C3TA 3JV4B 2YK1H 1FNSH 4NN5C 1LO2H 1Q9KA 2V2XA 1G1CA 2WM0A 1FYTE 3GKZA 1QSZA 1WVZA 4QTIH 4NJ9L 1FVDA 4GKSA 4K3DL 1AY1L 4BFBD 4KMTH 1I1FA 5FF6B 4F3FB 1ZA6A 1Z6JT 4YXLH 5B8CB 1URLA 2JJTA 1NCWH 4ZOAA 5AG8A 4JAMB 5E2UL 4YHLL 5F9OH 2VQTA 1YNLL 1AD9B 5KSVB 4MA8L 3ZL4H 5ICZB 2ZP0T 3PWNA 5CP7B 2YMXL 4X6DA 3P30L 1QBML 4BQCA 3BE1L 4WGWB 3S3SA 1MJ8H 4HWBH 2VXUL 4JPVL 4NNYB 1JUFB 3DUSA 2WWMC 3VJ6A 1IFHH 3CFDB 3BO8A 3KR3H 1AR1D 2YXMA 5TF1H 1IT9H 5JR1H 4Z7QF 4QRPA 2L0DA 2PR4L 3ULVH 4TNVF 2JLLA 2HJFA 3LN9A 4XCFL 3QO0B 1Z9MA 3C5ZB 1Y6KR 4S10A 4P5TC 3FQRB 5FOBA 2ZZUT 4OF5A 5ELIA 5DMGD 1YEIH 4U6XA 4ODHH 4M62L 4F15B 4HFWA 1MOEA 5EZOH 2FX7H 4M6NH 1XGTA 5EO1B 3BWAA 2W07A 1LP9E 3KPLA 5TFSL 1FLRH 2LTQB 1GGIL 1UACL 2JB6A 3BYTA 5GGUB 5D2NB 4XPHH 2VR4A 1RMFH 1ZOXA 3Q3GA 3T3PE 3BQUD 1NBVH 4X4XB 2GK2A 1MAKA 3B2VH 2NY1D 4ETQA 4ZD3L 3QQ4B 1ADQH 3LKPA 4LP4A 3QFDB 2JJVA 4CVXA 4L4TB 1A6AA 5C6WH 5FGCE 3BP5A 3HLAB 3GIZH 1U8HA 4HXBL 4G6MH 2J8UE 1P6FA 1CT8B 3V4PL 2ITCA 1X5GA 2A83B 1XF1A 3WHE0 2G9HA 4X6CA 2EE9A 3SGKC 1I8KA 3ALWA 1E4JA 1UKQA 3EUUA 5DO2C 3VRJB 5FYLE 1NCTA 4Y89A 4FQIL 3MA9H 1EA9C 2YD1A 2A6IA 3HMXH 5EU7C 1GGUA 3EYUL 4L29A 1G7HA 2JJUA 3KNBA 3CFJA 2YEZB 3DBXB 5H37H 3HHRB 4XI5D 4DFHA 2FR4A 5HVFB 1S78C 5T1MB 4GT7A 2XV6B 3FT2A 2C1PB 3BX7C 4NBZB 5CJOL 3JV0A 5HI3D 4HBCH 3GBMH 3SDXB 4E41E 4UV4L 2XZQL 5EU4A 3JTTA 4GO6B 3QDAA 1I1AC 1ZLSH 1J8HD 3FN0L 3TO2B 5H94A 3WJLA 2QADD 4N0YL 3VH8G 5KVFH 3QEQB 4Q6IA 3IFOA 4Z76B 1SVZA 3CXHJ 2BXZA 1ZT4B 1JPST 4P5TB 5IB1A 3U79A 3MRMB 1HYRC 5T1LA 5IBUG 2DQUH 4TSAL 3RDTC 1Q9WB 1U6AH 2ZSVA 3BZFA 1G7IA 4XP5H 1ZWIB 1G7MA 3ULSA 2PTTA 3EYVA 3RZWA 3RIAF 1EXUB 3C6LC 3L95B 4G42A 5FM5O 3OJVC 1SJEB 3ZKNC 2HVKA 3F62A 4KRPD 4KQ3H 5GIRB 3BP4A 4LLWA 1YPZE 3SPVA 1ZLVH 5A2LH 3TJHD 4UT9L 1G7JB 4FQ2L 1YEEH 2CUIA 4ORGA 1YEHL 3FFDA 2HJLB 3AB0B 1U8KB 1C1EL 2B8OT 2FGWL 3AAZB 5SX5H 3O41B 4H88H 3CPLB 5KJRH 4ODWA 3ARWA 1U95A 4MYWB 5DXWA 3E1F1 3KJ6H 1MEXL 2XQBH 4WUUA 2EO1A 2BRQA 4FFYL 5ID1B 1QQDB 2YPLB 5C0DB 2VERN 2WBWB 1JF5A 1T3FA 3AC0A 1HOCA 1WTGT 3GJFB 4G8GE 3TESA 2YSSB 5J57B 1N59A 2DLEA 1ZHNB 3QDME 2WBJA 2D0HA 1HCFX 1AGFB 2WIIB 4PRNA 5IM7A 2R0LH 4RMWA 1FZMA 4DGVH 4BUHA 4X5WA 3G5ZB 3WNMA 3AREC 2FZ3B 4GRLA 2RCSL 4CJ1A 2YZ1A 3GMNA 3HI1A 4Q74A 1LDPL 5KW9L 1YEFL 5T1KA 3OAUL 1OGAD 1H3PH 1QHPA 4BQBA 3CAFA 4GXVL 5HHXH 3N85L 4P3DB 3AVEA 1HN1A 5IG7B 2P24B 4BZ1L 3WS3B 1JRHL 4I3GA 3TCLA 4OI8A 2X7LB 4JPWL 3N0PB 3KJ4B 4P57B 5JDSA 2BVUA 1JNNH 3C8KA 2GTWB 3SCMD 1F58H 1RVFH 1MRCL 3BDYL 4MA3B 3QXTA 4WV1A 3SDXF 3V7MA 3UP1A 5E03A 2YR3A 2VWEC 5EBMA 4EDXB 3U7WL 3MV7E 4KK6C 3WLBA 3K3QA 4OGYL 1U3JA 2P5WE 2Z8VC 1AFVL 1HZHH 3L3IB 1CL7L 2FSEB 3ZKSD 2EYSA 4JFPA 3OXSA 3OHXA 1XGPA 2DAVA 4L8BB 1T21B 3C09B 3GRWL 1OAXL 4I0PD 1JZ3A 4UQ3A 1UXSB 2GSIA 3J7HA 3BSZH 2NXZB 5B3NA 3K2UL 2V7NB 4UMGA 3VXSA 3V5HB 2PN5A 5K9KA 5GS1C 1TJHL 3SKNA 4K8RH 2EIZA 5ANMB 3E8UH 2V2TB 1JFQL 3UPRB 1CIDA 5E08H 3SDDB 4FZEH 2DJSA 2F19L 3C9NB 1P4LB 4JDZB 5EORL 1D5IH 4NDMB 4LCCB 2XRAH 1E6JH 1AR1C 4L9LA 2C4FT 1OW0C 5C0BB 5DJ6A 4ODUB 2JJSC 5L2KD 1AP2A 1F6AB 2CK0L 2BY2A 5CKAA 4A2LA 4PJ7E 5ALCH 4AEHL 2R1XB 3HI6L 1U8OB 1MLBB 1RZKC 5DMGC 4F8TA 3QCTL 3SDAA 3MROB 4Y16A 5E2WL 4ONHA 4ZSOA 5MI0C 4EOWH 2ZG3A 3U1SL 4P3CH 1NGZA 4N8VA 4MJ6B 1NDGB 4L4VD 3EIFA 2ZOLA 5E00B 4LQFH 4S2SB 3CUPA 5D5MF 5D7SH 1TVBB 3WS6C 3QIWB 4MJ5A 3O6KL 2VAAA 3O3EA 4F33A 1EZVY 1BAFH 4PS4H 4X80L 5DVKA 5J56B 3DO7B 1M71A 1NAMB 1OGTA 4GG6E 1FRGL 1A7RH 3P4MA 1E4XH 3WFDL 2YA2A 3NIGF 3CD4A 4KJYA 3ARSA 1CFVL 1RPQA 4MCZB 5EU6D 3BUYB 2OP4L 2BSRA 3S36X 5FV2A 2Q87A 2ZSWA 1PLGL 2W91A 1FNFA 1GGBL 1W8NA 4OCRL 5F8QC 1HH6B 1R3LA 4NOFA 2APBA 2VDML 4NC1E 1FO0B 1WCQA 1PKQB 4XAKE 3V4UH 2VZOA 1JK8A 3VXUB 3S88L 2MQ3A 4XNQB 2XWTA 3D0LA 3REWA 4UOW1 2D7OA 2UWEB 4OAWA 1WK0A 4YHKH 4QXTA 1KLFA 2HAZA 1U92A 5JHDB 3FHQA 3HUJB 2NZIA 4I3SL 4J3TA 4EBQL 5GS1B 4ONFL 4RMTA 5JIIA 1E4WH 3OKOA 5CBAA 3VXRD 2GY5A 2DQFB 4DVRL 1FG9C 4R96A 5JQ6H 1OF2B 6FABL 1DJSA 1LK2A 5ESAB 3FMGH 1OTSD 1NAKH 2XFXB 1ZSDB 4M48L 3PXJA 1HH9A 5IKCB 3QPXH 1IAIM 2H6PB 3KYMB 4PY7A 2N7AA 5J13C 4MD4A 3EZJB 4YUEL 4WFFD 1NUDA 1S7TB 3EO1A 4YQXH 1HKFA 1FIEA 4FQXB 5LQBL 1I8IB 5E9DB 3VXMB 4NBYB 3MBXH 4ZFGH 3MC0A 5F88A 2F54B 3NFSL 5F7LB 4HH9A 4R97B 4Z8FL 3UTTA 4Y2DA 5D7JB 4HT1L 3QB7C 3D85B 1PG7X 4LCIH 5GXBB 3RL1A 4LLMB 4MQSB 3SKOA 1KTLA 2C5DC 3SGEH 4XMKL 2CDGB 3O8XB 4NHUA 2V17H 5JW5A 4PJ8B 3GSNA 5I8KL 3SE8L 4HV8A 1S9KC 3DURB 4QWWC 3FL7A 4FS0A 2W9DH 5FO8B 3SGJA 1NCAH 1MI5E 1JPGB 5KVGH 3L3OB 3CSBA 4XNMA 3MXVL 5DUPH 1XF2A 2BRRL 2VIRA 4KQ4H 4P23B 3O11B 5DTFA 1DEEA 25C8L 3HMWH 5GSVA 3FQTB 3UBXG 2XQYK 3O4LD 4MAUL 4LDEB 1D6VH 4AEFA 2X4SA 1MIEL 2B2XH 4LCWE 3P0YL 4P5MA 1UM5H 3BDBA 1A7OL 1U3YA 3W39B 3UJJH 4GRWB 1E6OL 3V4VH 3GMQB 2NYYC 1QRND 2ED9A 4IRSA 5HGAB 3T2NH 2DQHH 1UZ8A 2VITA 4M7ZC 4Z0XB 1Y0LB 2FATH 3PIQA 2R4RL 1DUZA 3RWFA 3VFNA 2NXYB 3QEUA 4TULL 4OFIA 4ZUTB 3T0EC 3C2SA 2Q76A 1PAMA 4PREA 5GGVL 1R3JB 3OJ2C 3GSOB 4YZFE 5CSZB 4AH2B 2ZUWA 4EUPA 4ZYKA 2H9GB 1AE6H 3HUJF 4UILL 3V6ZB 4PJEA 4PRHD 4P46D 2P43B 1ZK9A 4TUKL 4MA7L 4FZ8H 4YFDB 2XT1B 5C09B 2WINB 3QUYC 3WIIL 2P1YA 5ERWB 4FQCL 4DAGL 5HGHB 1FAIL 1A1NB 1RV6X 1WICA 4MGXA 3IFNL 1KG0B 2P8LB 4WFHD 3V6BR 4X7SH 3NFPB 1TJIL 4HKXA 5F96H 1EEZB 4HC1L 2R0KH 4C56E 4NZTL 2H41A 4I0PC 3OB0H 3UTPE 4NJAL 4OZIA 2O5XH 1UVQB 5CD3A 1AGEB 2Z9TA 5LBSL 5F1KC 2ARWA 3MRFA 5EN2A 3F7PC 1XGYL 4PRAB 5ISZD 5IBTL 5A40E 1NLDL 1XGUA 3ES6B 1XCQB 4GAGH 5IWLA 1LE5B 1PY9A 3V6FB 1UWXK 2FECI 5I18H 3U0WL 5GRVL 4HK0A 5M94B 3JTSB 1F4WH 1MCPL 5DFVD 5E56A 2XZCL 1A3RH 1DZBA 1YY9D 4MXVE 4PRPB 4D0CB 4JO2L 1B0GA 2FX8L 3ARFA 4OM1L 5DJCB 2X1XR 4H1LB 2DMCA 3W0WE 2MOVA 3D2UA 4RGNB 3QJHB 4JPIB 5TH2A 4Z9KB 4KVNL 3W11C 4LPTA 4PJHF 2Z35B 4OLZL 3MODH 5IB5B 4NCC2 4QRTB 1IGML 2C3VA 2YKLL 2GHWB 2PYFA 4DGIH 5DRWB 1MAMH 1WWWX 1WJ3A 4LVOC 2EEAA 4HPOL 3ARGD 4OZGA 1HHGB 5DD5L 2MKWA 4P4KD 4XPAL 4DTGH 3OB0K 4HMDA 1JHTB 3SDCD 1A6ZA 1QP1A 4GRWF 3MGOB 2XG4A 4MB4A 4WFEE 1QNZH 5KN5B 1JNJA 3T8XA 5HYSA 4OCSH 1JGUH 1I1CA 3IDNB 4KHTL 4NRZA 3RHWF 4A2MA 5CBEB 1U93A 3DVGB 3QHTC 2PW1A 1U8NA 2X1QA 1CFTA 1LD9A 4R4ND 4RWYH 1DR9A 3U4BL 3TO4D 3U9UB 4PJCE 4OLXH 3QUYB 4XB8A 1J0ZA 1IGFL 4NZRL 3IXAA 5TE6H 1CDBA 5C0GA 4WW2B 3ULUC 2VL5B 2R0ZH 1MCOL 4LKCB 5CFHA 5CUSL 5DHVA 4QHNB 4NRYB 4PJXA 1YYMH 4FTVE 5ESQB 4MJID 3VE0A 1L7TH 5T5FH 3WEXB 2BNQA 3WSQL 4G6FB 5SWZE 5KVEH 5FUZL 1WISA 1BVKB 4K9EC 1XF3A 4X9GA 4ZPVB 3P9WB 1INEH 5IVOA 5F3HA 5DI8B 5JLZB 4DGYH 1JP5A 1VFOA 2AJZA 4ZUWB 2PW2B 3EFDL 1MCCA 5KTEL 3VG0H 1ZGLA 4NFBA 1OTSC 3GO1L 5D6CA 1ZLUK 4E9LA 1G0DA 3NH7L 4Z7UF 5JIPA 4EVNA 5AZEH 3NACL 3G6DL 2MPAL 1N7MH 3CH8A 1RUKL 4OGZA 1KB5H 3VI4F 2N1KA 4DN4H 5JUEH 1DVFD 4UU9A 3K4AA 4K3HA 2HTLC 2AP2A 5IUSA 1RJZB 4XRCA 4LPVA 3UXFA 1M7DA 2R39A 3OKEA 2DM4A 1YMMD 1CU4H 3FO1A 4PJBA 3U7YL 4DUVA 2EDNA 4MX7B 1WT5C 3DYOA 3HZKB 1LP9B 4KTEH 1D6EB 1NH6A 2PXYC 2E9IA 3CSPA 1KTRL 4M5YH 3TFKD 3WNOA 4Z78B 2APVA 3SQOL 5GRUH 4JJHA 3SE4A 2XPGA 5BRZB 1BEYH 1JPFB 2I60H 2I5YH 4OD2A 4DKEH 4ZFZB 1EO8L 4ZUSB 3LQZA 1QSEB 3U82B 3EO0A 1OAQL 4NN7C 1XGQB 4JDTL 5BO1H 1R0AL 1LE9A 1L7IL 4PRIE 3U0TB 4Y5VB 1CDYA 1ZVYA 4PP1C 3B9VA 1RJLA 1P84J 4FQHA 2MFNA 1CXIA 5CJXA 3RWCA 5DK0B 3QIUD 4RCAA 2V5YA 3FRPA 4U1MA 1JMZA 3LPGA 4Y88A 3BAEH 5C0FA 1U2CA 1HHHA 2RIKA 4G3YL 1VFUA 3B6SB 5IF0B 2NY0B 5I15H 3V7AE 2IAMD 4OZHA 3O3DB 1BBJA 5DRZB 3V5KB 4ZUVA 3C5ZD 4PLKC 4E41B 3EDDA 2ICEB 5GGTA 4Y4KD 3ROOB 1J0KA 5CEZL 1NEZG 1ORQA 1AC0A 1CCZA 4OV6F 5E8DH 1EEYA 1LNUA 1IM3A 2E8ZA 3LEYH 5I1KH 4KK9D 4TTDC 1RIVH 4WTZG 3EOBB 4P99A 2LU7A 4AQOA 4OTXL 1F45A 2UUDK 3VA2C 1CQYA 4LGRB 2HN7A 4EI6B 1NAMH 1F5WA 4NT6A 1MFCH 2FD6L 4OD1H 5FM8A 2FHCA 5AUMB 5KANG 5B21A 2VB5A 5TDOB 4G7YH 5L0QC 3TM6A 4PJFB 2EEBA 1H5BC 1YPZB 2X4OA 5L8LB 1KJ2B 3P4NA 3O3BB 1ZKAA 3T2PA 4NGHL 1FO0H 4WHTA 4L8CA 1G6RL 1LP9F 1SMOA 1ZT7B 3DUUA 5GHWH 3QXVA 2VLRB 3IJHA 2EH8L 1YY9C 4P59L 3AUVA 2EYRB 1E27B 2V9RA 4QRRE 1MHCB 5BW7C 5KSAA 4NN7B 1YNKH 4OQTA 5GGTL 4KUZH 3ZE0E 5D4QA 1A14L 1Z5LB 2JJWA 3GGWB 2PTUA 3QDMB 4PJIE 4W4OC 5K9JH 1A7QH 3CCHA 3CSYB 4OFVA 1N8ZA 1MVFA 2A2QT 3EKCA 4LU5H 4RQQB 4HS3B 2X4UA 3KYKH 1JHLL 2J8UF 2R69H 5C1MB 4ZMAT 4RGMC 1RHHB 1CK0H 2XWBB 3LV3A 4PBXA 4ONOA 3EYSH 4P4KC 5INDB 5KVDH 1RZIB 5F7DB 2XQYG 1KJVB 3WO3B 5HYEA 2UVFA 1E28B 1TETL 2ZJSH 3KPSE 1KJ3L 3MJ9A 1HHKB 3TWCH 1C12A 4Y4FC 1NUFA 1W72A 4M1CD 5D2LE 3MRQB 5E2VH 1MJJA 1QFHA 3TZVD 1NJ9A 2Q3AA 2CR3A 3QFJE 3VRIA 1CLYL 5IK3B 3FT3A 4JANA 1OAYL 2ITDB 4LHQB 4C83B 3SE3C 1I4FB 2AVGA 3BKJH 1A6PA 5JW3H 2DQGH 4NPYA 3C2AL 2O93L 5E99H 3GMOA 2YC1B 4JCLA 3TBVA 2MTPA 3QDJA 4JFEA 3UDWC 3MV7B 3QNZA 5CJBA 3NGBC 4HIJB 1J0JA 4OQTL 1ES0B 2R4SL 4CRPA 5K9OB 4NNXB 1ZVSA 3RNKA 4ZO6A 2OQJB 5HDQH 4MNGA 3SJVA 2OL3A 4N1CA 4QKXB 4EEEA 1TCMA 5I1AA 1U8QB 3ZSSA 1H15A 2CKNA 1JL8A 1FIGH 4Y5XA 5IOPB 2Q1EA 2DI7A 2YPLD 2RFXB 1AKJA 2E6JA 4ERSL 2NY6D 1NLBL 2DL9A 3D3VD 5FUCC 2QQNL 3QUXB 1MFEL 5HHOE 1MCNA 2FCBA 3MJ9L 4NKOB 2GK0B 4GRWH 5AD0B 1YPZF 5D1ZD 2JK5B 4HUMB 1FCGA 3IDYC 3MBEC 4PJGE 4X99A 1P4IH 4PB9L 3WFHB 1AC6A 4O2EA 3HC0A 2CQVA 2IALB 1KN2L 1FPTH 4PJ7B 1QRKA 4GQ9H 3O2VL 3MUGB 1DANU 2HFGH 2O5YH 1L9MA 1OWRM 3MREB 4MVBD 1C5CL 1G1YA 3RJDA 2Y6SD 1X6NA 1BZ9B 1SYSA 1KIPA 5CWSB 3HCVB 3F5WB 4YHIA 4RGMB 1KCUL 1K2DA 5IB4A 3R1GL 2COQA 3JV6B 2OL3L 2CKBA 3U4EA 5GGRA 4N90D 3RZCA 3GM0A 4Y4FB 2CPCA 3SKJL 3W2DL 1BFTA 3MRRA 5CJ5A 4HMCA 4KJWC 1QACA 5IJKC 5EOCJ 1OPGL 1TQBC 5E94A 1NGWB 2H2PC 1PZUB 5IESH 1MFBH 4D3CL 1KXQE 3QJFA 5LWYH 4CMHC 4NO0B 3PABA 5ETUA 2NX5B 3P11H 3WO4B 2XZZA 4K2UL 4K7PH 1X5KA 4JY6A 4IRJB 2VE6A 3L6FB 3GKWL 3NGBB 1EFXA 1R5VB 1NFDE 2I25N 3QIUC 1VSCA 4S1QH 1QA9B 3SDDD 3HNSL 2B4CH 2B39A 2V5RA 3OR7B 4PJAE 3D69B 2VLKA 3S3JA 4JO4H 4N68A 1CD1A 2NY5L 3D9AH 4PBVC 3RA7H 3RVVC 5C0BD 2IAMC 4IRZL 4R0LC 3T77B 3HS0B 2OMNA 5J6HA 1MF2H 4X7CC 2C7UA 3G5VA 3S37X 4M1DL 2PO6B 5KG9A 4M7KL 1F42A 4LHUB 4Y4KC 4O2FA 4OQ1A 4JHWL 4PTTA 1LILA 2R2BB 2D7NA 3IDYB 1EGJH 2R1WA 4EJ1C 1GZQB 5LKNA 4KK9C 4U6YB 5DC0A 3VFGL 5DQJA 5HHQB 3VGBA 3Q6FB 2Z92A 2Y25A 4OB5L 3WFBL 2GKIA 4NZJA 4NKDB 3SKMA 5DD0L 3A67L 4KGLA 3QNXB 3CC5B 4WW1A 3WN5C 3P9LA 3L3KA 4DVBA 4JB9H 4PJ7F 5JNYA 1DBML 1RZGB 3SOBL 5J6GB 5J0BA 3IU3A 2OTUA 1FNGB 4LSQL 4R4FH 3O9WC 4NQDD 2BNRB 5DVOA 1OHQA 4ESKA 1HQRB 2BOBB 5C08A 5GGSB 5AYUL 3ZKXC 5E8NA 1QLRA 4I5BA 1MLCB 2AV1A 1HHJB 3GDBA 5F7KC 3VXOB 4ELME 4Z7WA 3TNNA 1HYSC 1MI5B 1T20A 2M26A 2FBOJ 5I17B 2VDLH 2R23B 3MJGX 1GVIA 5ICXB 3F12B 3RNQA 2WMPA 1S7VB 4V2BA 2QQLH 4BFIA 3WCYA 4UDTA 2FJGB 1IGJB 1V3LA 4UUJA 4MNQD 4GG6F 2FO4A 4XPGH 2OLDA 4DZBA 4XVUD 4D9RE 5GGVY 4JY5L 2AI0L 1RK1B 4KPHH 2BXYA 4LCWB 3BISA 1T1XA 3BH8B 2UZYB 3B5TA 2B1AH 5ACZA 1C5DA 1NQBA 4AEIH 3B9KD 3OZ9H 3RTQB 4QHMA 4JFDD 1IEHA 4F9LC 4N5ED 4NQEA 2H26A 4D9LH 2EDTA 4M93C 4M1CC 3VD4A 1UG9A 3TZVC 3MRNB 5IVZB 5FA3A 1PKOA 3MLUH 5F1IB 3AU1B 1NC2A 1UCBH 4RZCA 5IVXE 5MEOB 1D5BB 1BFOA 1N3NA 1K85A 5AWNH 3SGKA 5JMOC 1JGDA 1JZ8A 3CVIH 3DO3A 2VXVL 2AQ2A 5HYJE 2AJYL 5CP3H 1F90H 1SJHB 2J4WH 1T0PB 1D5XA 1LO3H 2VDOL 2DDQL 3C60C 4IOSD 4WI7A 2DKMA 5D7JD 2C3GA 2IGFL 3WKML 4MHHI 5FYKL 4GG8A 1GOFA 5LVEA 4L3CA 3BHBA 3O8XD 4XHQA 3ZMRA 3IYLW 4DUWA 1BQUA 3STLA 4C56B 1UWGL 1VPOH 5MHSE 1YN7B 3FN9A 5D7KE 4JFFA 1UYWL 4KV5E 2R29L 5FKPB 3O9WB 3PWJB 2W1NA 1OM3H 2NY6C 3W5MA 4P23D 1A21A 4QGYA 1DCLA 1GC1H 2X42A 3ZKXB 3JWDH 3UEZA 5I1LB 4ODVL 2DYPD 3ARDB 3A6CL 1M05A 2HFTA 4CNIB 5D1ZC 3STBA 3CX5J 2O61A 3K8LA 4BM7A 3OKDB 3PNWA 1FORL 5EIQA 5TPWL 5FYLH 3OL2A 1Z9LA 2G2RA 4S0TD 2X89A 3QEGL 3RDTA 1SVCP 1EJOH 4P48A 4U6TA 5IROC 3C8DA 3LPFA 5D1XB 3C6LA 4X6BA 1P53A 1KXVC 2WLYA 2EXWD 5FKAA 2Y6SC 3RUGA 1DBBL 1HQ4A 2BC4A 3W0WB 2NXYD 3O6FC 3TBYA 1XR9B 4GW1B 1EBPA 2OTPA 1J9CT 1KT2A 4CBPA 4QRPE 5FUOH 1P9MA 5CILH 2GJ6E 1X4ZA 3GSXB 5DDHA 3BIKA 2YRLA 2B1HL 2CLRB 3RY4A 5C09D 1I8MB 3AXLA 3QULB 4M93B 4XNZC 5TE7H 5F1NB 4QGTA 3OR6A 1FC1A 1KPRA 4EIZC 4KZDH 5ESVA 4S1RL 1JZ7A 4OFYA 5INCB 4MS8C 2VDKH 3RP1A 3C87A 3DIFA 2E27L 3HG1A 1CVSC 3AREA 1QFWH 4N8PA 4PJCB 1JTPA 1XF4B 5JW4R 4YZFF 1KJ2H 2A74B 1XGRA 1BLNB 4KMLB 3L5JA 3BMVA 4AK1A 4HAGA 4XBPA 2A77L 3QCUH 3VH8A 3LRSB 4ZXBC 3ZYIA 4OFDA 3O2DA 1RUAL 4FTVB 4TOYL 1QZ1A 3M8OL 5IMOA 4PG2C 4DN3L 5CGTA 2C1OB 4FN0A 1WTLA 5CHNB 4XVTL 5SV3A 1HKLH 4X6CE 3WIHA 3FONA 3U2SB 1MCRA 4Q2ZA 1KCVL 3S35H 4LKXB 4WJ5B 5FYJU 5F1OB 2R9HC 4GW4B 3CFIC 4XZUB 2R0WH 2JB5L 5EOQL 2Q86A 2J2ZA 3LQAC 2CLVB 5MP6L 1TVHB 2RGSA 4H26A 4AMKL 1NGXB 5I6XC 5F97E 4QY8B 1MRFH 5DD6A 2E7LC 4F7TB 5C6PB 2R1YB 5EBLB 5JXED 2XI9A 4NWTH 4XWGL 3LKNB 5DLMH 4MXVF 5E8EA 3S3PA 3H8NA 4PRBB 2FIKA 2FL5A 3QUMB 4B0MM 4TVPD 1Z0MA 5H2BA 3A6BH 5D70L 5TDPB 1UZ6E 1CF8H 2DQTL 5F89A 4FQ1H 1ONQA 3AS0A 1ZLWH 2APTA 2P8MB 9CGTA 4OV5B 4JFXA 4WU5B 2JJSA 4NZUH 1FYTD 4YHNB 3PE9A 4FQJH 5IHBA 4YWGH 2Q7YB 3GI9H 4MQXD 4XGZA 2AK4D 1U8LA 4JM2C 2AEPH 4HF5L 4I1NB 4JHAL 3TBSA 1CDCA 4APQB 2I07A 1T2XA 2R15A 3L3DA 4XCEB 5DK2A 5T3ZE 5JZ7C 1A3QA 3CLFH 1CFNB 1X4XA 4UINH 3FO2A 2YD2A 1EERB 4P2QE 3D87B 4QRUB 4JZOB 4M1GL 5BV7H 3MRLA 4ONGH 2F53A 1UQSB 3X3FH 5D9SB 4P2RD 4PJCF 2GITA 5E8PA 4HIEB 4B5EA 2YRZA 1H3TA 2Y4SA 2Z93B 2H1PH 1T04B 43CAA 2V5TA 2Z31C 3KS0J 3GZKA 4N5EC 3H3KA 1MREL 3QG7L 2HKHH 2P42B 3MNVB 5GPRA 4EI5C 1UB5A 2WIMA 1ZLWK 1OB1B 3FQWA 1QLEH 2G75B 4IMKA 4MNHA 4PJ9D 3RVXD 1A4JB 3VGGA 3OKKA 3NPSC 3TVMD 4JZNB 3RL2B 2OR9H 1KLGA 4XXDA 3W9EA 1RZKL 1INDL 4X0KA 4UT6L 3MRDA 3I6KB 4LLQB 2BVOB 5BCAA 3DV4A 2ED7A 1U8IA 3U6RB 1QR1A 2A6KA 2AJUL 4P2OD 1FL6A 5C71A 3E0GA 3QYCA 4KZEL 2AAVA 4ZFOL 4RAVB 5I73B 4JN1L 3VWJB 1DSFL 1CE6A 3EYFB 1CXLA 1M1SA 4EN3C 1NL0L 4POUB 1HXMB 4MSWB 4OUOA 4Z7OE 3DRQA 1BJ1J 1M6OA 5IIEB 4U1NA 2AGJH 5FHBH 1FZKA 1HSBA 3UROR 4BH7B 2IBZY 3QR2A 2OZ4L 4R7NA 1KEGH 1MCJA 2Y5EA 4PR5B 3D6GA 3ECBB 1JMXA 4QRRB 2F9BT 5FYLD 1B9ZA 5I1GH 4M5ZH 3MV8D 3CFBB 1BQHB 1BD2E 4LLUA 2GUOB 5J12C 3V0VA 2EXWC 1IAMA 2D03H 3MCLH 2QSTA 4PGEA 5T33L 1ETZB 4OIAA 4HUVB 2DWDB 1NFIB 4PJIB 4KKCC 3VGEA 4YHZH 5C3LD 2DQIL 4FXGA 2EDLA 2M2DA 1MHEB 3B8SA 3DX8B 4E41D 3D39D 5FA4A 2OCFD 3HB3C 4HULB 5EUOA 4D0DB 2H32B 5CGMA 1KNOA 1MUJA 4XPBH 3MRBA 5B22A 3M17A 3LH2H 3KPSB 5I16A 3LKSB 1GGTA 4EI5B 4XPFL 2CMRL 3QRGH 5JPMA 3CVHA 2VDNL 5D2LB 2DQJL 1T1ZB 2NY4B 5KSBE 1ND0B 1RJYA 1IGCH 1P7KA 3QFJB 4P4RA 3QCVL 3BMWA 1SJVA 2EDBA 3GJEB 1EHXA 1NCCH 4OCMC 4XP4L 3O6LH 3PP4L 1HNFA 4PRDB 1M4KA 2E3VA 3GB7A 5D6DC 5LCVL 4HWEH 2CJUH 4AEEA 1WBXA 3T1WA 1FH5L 1I7TA 2A9ML 3TN0B 2ICWJ 1OGAA 2AABH 2ADIA 4OCXL 1LO4L 3L7EB 5DUBB 5GQBA 2I9LB 5FECB 1KOAA 3MGTB 3T0EA 2AKRA 3RPIB 5D71L 4P9HH 1QO3B 1ZHBA 1S7QB 4I2XA 2GTZB 3UZVB 5E1HB 1I9RH 1JI1A 5I74C 4I77L 3SCMA 3NAAL 4ZOCA 4R2GD 4G8GD 5DJYA 5CD5C 3P77A 3QDMD 1N64L 4RGOL 4JG1L 2R8SL 5FGSA 3GI8L 43C9A 1Q72L 5F7UA 1PX3A 4E0RA 3BVNA 4NQXA 2R2EA 4KK5D 1BF2A 5DR5L 3HE6D 3K46A 5DVLA 4I0PA 1NBYB 1AI1L 2A1WH 5FXCH 4QTHB 4DEPB 2G60H 3HRPA 1VA9A 4K7FB 5BVJA 2CDFB 2W0FA 4U1LA 4XCYA 4JQIL 2NW2B 4HIXH 3UBXA 3GBLA 4ZS7H 3V52H 1SYVA 15C8L 3QEHB 4U6HA 5T5NF 1DQQA 2EYTA 3KPOB 3ZE0F 5M7QA 5D7IF 4XNXL 3QH3A 4HKZB 1EJ6A 3I85A 4PJIF 4NWUH 4RFOL 5EC1A 1CZ8H 4HJGA 4RMSA 2VDRH 3S4SB 1IGIL 4HWBA 3WIFB 5L2KA 1CGWA 3IJSB 1J0HA 2ZCHH 4XBEL 4JCMA 4KKLD 1BQLL 2HH0L 2PETA 5ACLA 2P5WD 4OJFH 2APXA 1S5IL 2MQ0A 5JA9A 1T7ZA 4E42A 1T2JA 4HHAB 4QNPF 5JQHC 5D2LF 5EPMA 1FN4B 3QA3A 4B7IA 1TZHA 1F4YL 3JUZA 2YD9A 4WEBL 3O2WH 5GZOC 1NFDB 3B4NA 4JZJB 3VFUA 2VDPL 3OXRB 2A6JA 1KELH 1OAUL 1QG3A 3AS3A 2VZ3A 2ORBL 3QUXD 2GYSA 3EAKA 2PCPA 3ROLA 4QT5B 4R8WL 5IB2A 2CIKB 3MCG1 3SGDI 5F9OL 3UX9B 2DQCL 3FT4B 4TUOA 4U49A 3ZKMD 1ZEAL 5EU6A 3O0RH 1PZ5B 4G6JH 2KBGA 2XTJE 2J88L 1R3KA 4UT7H 4I18B 1ZA3A 3MOAL 5E6IB 5C2BH 5EWIH 5HHMD 2QR0A 2WSKA 2XA8H 5DQ9B 3ARYA 5DEZA 4QXGH 4FQLH 3RVUC 4F9PA 1B4JH 3B3IA 3TPUA 2W0LA 2Y9RT 5D7LD 3VFOB 3GMLA 4IOIA 3KR3L 2A38A 5EA0H 4FRWA 1CBVH 2QHLA 4JQVA 4FABL 1KIUA 4EXKA 1BWMA 4DKFH 4ZUUA 4TTGA 1SBSL 5GRJH 3HNVL 4PGCB 2VABB 4OZFH 1W0VB 3HMXA 4XAWL 3LZFH 1BBDH 1KC5L 2VOTA 2X40A 5JHLH 4PJGF 5C0EB 1NMAL 1J05A 4PJEE 4HCRL 1HEZB 2OJEB 3QUZD 3JXAA 5FK9B 5F9WC 4J3XA 2C3WA 1WCBA 3MNZB 1FLRL 4QF1B 1G7QA 2EDFA 2FNBA 4F7PA 5ITFA 5DEFA 1SEBB 2X4RA 1G7PB 4OCYL 4NO0D 2ZCLL 3MV9B 4F58L 4WI6A 2VNCA 8FABB 3KPRA 3KPNB 3B2VL 1JRHI 3DVIA 4H8WH 3PJSA 1CVRA 1BIIA 4OZIE 1HXYA 1CGVA 4ELMB 1DQML 5FCUH 5EO0B 5DD3H 1GPOL 3DHJA 1CD8A 3VCLA 3ULUL 4NO3A 5E5RB 2FJFA 3M1BB 5CJ8A 4U3XA 4XC1L 2E7HA 4EIGB 3TCXA 4GUPB 5CCKL 4AENA 3ARBD 1CL7I 3X14B 2K7QA 3RWJB 2PO6D 3TP4A 3X11B