4MAYD

Crystal structure of an immune complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
262
structure length
255
Chain Sequence
b'QLVHFVRDFAQLGGAGVSQTPSNKVTEKGKYVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPNDRFFAVRPEGSVSTLKIQRTERGDSAVYLCATSALGDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MHC class II HLA-DQ-alpha chain
publication title Crossreactivity of a human autoimmune TCR is dominated by a single TCR loop.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 56
structure length 255
sequence length 262
ec nomenclature
pdb deposition date 2013-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mayD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mayD02
4S1DD 1KT2A 4K3DH 4YHYC 3GIZH 3H9HB 1OT2A 2NTFA 4HDIB 4N0UE 4CBPA 1FO0A 3U2SA 2ADGA 2NLJB 3M1BA 2P8MB 1RIVL 3MROB 1UYWH 2IBZY 2VXUH 3KWWB 4RDQF 4GO6B 4PJ9D 3VFWA 1BVLB 2ESVA 3VRLE 2EIEA 1FNLA 4NKOB 4IRSB 4L3CA 4GW5A 3AUVA 5FKAB 1U8MB 5ICZA 2F5BH 3MV7A 2CD0A 4J8RB 4ZFGL 2F53B 2WIMA 5J6GB 4JRXA 5GSVB 2R2BA 3JTTA 1DLHB 2VLLA 1AGDB 1DDHB 3RWIA 3PV7A 4OJFL 2GJZA 2M2DA 4X8XA 4E42B 4OT1L 5D7SL 3ZDZF 2LAGB 3FQWB 2B4CL 4NHUB 1MCHA 4MCYA 3QUYC 4GRLB 4XPTL 3SE3C 5FDWB 5J11C 3QDMD 5JOPD 2XWTA 3WIHL 4Y4HB 4KI5E 4HGMA 4PJFA 1Q9KB 5BZWA 1IGML 1FZOA 5CD5D 5MENB 5T1KD 4PJIE 1NCTA 5BMFL 2VITB 4U1JA 4R0LA 2OJZH 5E7FA 3U9PH 2DAVA 4HAFA 1HSAA 1WFTA 5FUOH 2AJYL 1NFDA 4NC1C 4Y7MA 4XNUL 1P2CA 4BZ2H 4JZOB 1T83C 2XA8H 1Q72L 3G5XB 1KG0B 5LXGL 4MNQB 4PRPE 3RL1A 5CMAB 2SEBA 5FUCE 4K9EH 1TVBA 3V95A 5ESAA 1ZWIA 2ERJC 1MJJB 5EZOH 2F58H 2GTWA 1IQWL 1TJIH 3MBED 3QI9C 1AGBB 3GIVB 5F96L 4CNIB 4JO4H 4ZUUB 2OX5A 2HFTA 5DMYA 1S9YA 4F15B 5GIRA 5E8NB 1BBDL 4U05A 4HXAL 1JGUL 3CK0L 3EDKA 1UJ3B 2ESVD 1UH4A 1CD9B 4LVOB 1FQ9C 4O2FA 4YDKH 5ALBL 3C6SB 4JQXC 3C5ZA 1A4JB 5JQ6H 4Y4FA 4LLWA 3GZKA 2APBA 2W92A 1S7SA 3BGAA 3MV7D 4PV8B 4DVBB 1N59B 3D3VD 1N5AA 3IVKA 1R0AL 2QQNH 3DGCR 4XNZC 4OCMC 4XNMB 4LKCA 1UB6B 5E4EC 4Y16B 3WNMA 4IM8A 2EIBA 3MMEA 1F4XH 4FZEL 5GS0H 3GSRB 3AS1A 4OIIH 4YEEA 5D7KD 3RWEA 1D6VL 2RB8A 5DVKA 1ZA3A 3MUJA 1P69B 2CMRH 2EYRB 2J4WH 5GZOD 5L6YL 4PY8I 2FEEL 1WUNT 2HWZH 2QSCL 2NQCA 3GIZL 4Y5XC 1GZPA 1ROWA 3ARGC 2Q6WB 4NFCA 3BESR 5GRUH 2HG5B 2JTDA 3TZVC 4IRZH 3JV4A 4FQXD 3DBXB 1R3HA 1TPXB 1ZSDA 1UYWL 2EDBA 4YEFA 1CD8A 4RQQA 4OQTA 5I15H 1FL6B 4WUKL 4I0KA 4PJIA 2VXQH 2V5TA 5C0FA 2Z4QA 1IGFL 5JIIA 4AEIH 4AM0B 4LCWB 3OR6B 5LGJB 1KJ2B 3BZEB 1NGYA 2C3WA 3DHJA 4PREA 1KJ2H 2DIAA 4PRPA 3PP4H 5SWZE 4X6DF 5CJXC 1PY4A 4P5KA 1RK1A 1V3JA 2EIZA 2ICCA 5E2TH 4HGKC 5IOPA 4GAGH 3QB7C 2HT2C 4LDEB 1Z0MA 4JKWA 2D31A 4FABH 4HZLB 4PJGE 3M17A 2CPCA 4OLXL 2YSSB 4ZYKA 3BWAB 1PX3A 3HG1A 3EOTL 3ALXA 3QFDB 5C0DA 5L8KB 4NQSB 3E8UH 1RJYA 4A6YH 4G7VH 2OJZL 3C5ZD 5DD0H 3UTZA 4Y4FD 2D4DA 1EDQA 1VFBA 3DURA 2GAZB 4MA3A 3HRZA 4YHPB 5FUOL 5TH2A 2XTJE 2EH8H 5I74C 1S7QA 2QHLA 3UX9B 2YEZB 2PW1A 2NY0C 4PBVC 1MRCH 4LPVA 4PGDA 3PV6B 1RUPH 4GRWB 1JI2A 4K9EL 1OT1A 1ONQA 3BKCL 3BSZL 3Q5YA 3ULVF 3MRFB 1TJIL 1G6VK 1JGDB 2I9LB 1DN0A 4JFFB 4Q0XH 3QZWG 3BFOA 5EC1B 5ECJE 5I1KL 1Q0XH 2Y6SC 3H7LA 4WI2A 1MJ7H 4L8SA 1CGUA 4BQ8A 4M6OH 5FO7B 4P5TC 4NQXB 1EGJL 3G6AB 2W9DL 3DUUB 4R7DB 4W6WB 5I2IA 1MHPH 1IC4L 2VR5A 2NXZD 3L7EB 1T2JA 4H88L 4PTUB 1YECH 4EXKA 4HJ0C 4LHUA 3HNVH 1S9WA 1KTLA 4XVJH 3PXHA 1HCFX 1A7PH 4IJ3B 2ZSVB 1IC1A 4U1IB 1KJMB 1J0KA 1Y0LB 2QHRL 3BPOB 2DKSA 2F19L 4LLQA 4Z7UE 2XIDA 4CVXA 5FCUH 5GS0L 3QHTC 4OIIL 5GGVH 1UXSB 3MRJA 4F33B 4OBRA 1H3XA 1KULA 4N8VA 5SWZA 5TDOB 4AIOA 5B3NA 2CMRL 4KK8D 4PGJA 1OWRM 2J4WL 5E5MB 3EW3B 3OKNA 2W0LA 1I4FA 1TCRB 3O45B 3HG1D 4FFVC 3EZ8A 1CT8A 1FNFA 1QBAA 3S36L 1I1FA 1R24A 1OLZA 1QLFB 2CO7B 1YPZF 2P8PB 1HHGB 4ZAKD 1HHJA 2EC9T 3VE0A 2YRPA 5DK0A 2VXQL 2Y5TA 1O7SA 4X4YB 4IMKC 4F7MA 1I1YB 4U0RB 4PJHB 1Z9LA 4AEIL 1HYSD 1CG9B 3UPRB 2YPKB 1AIFA 1NC2B 1KJ2L 1T3FA 1C12A 1FDLH 5DHYA 1C5DA 3PP4L 2EDFA 1T22B 1ZT4B 5I1AA 4FQIH 1PLGH 3ECBA 1BZQK 1JZ6A 1ITCA 4XWOD 1U8IA 4ISVB 3C6LC 1MCCA 3MJ8B 4GAGL 3BMVA 1ZT1B 5HHOE 5C09E 4HUUA 4FABL 3ARBC 3T0EA 4MB5A 3CCHA 1T0MA 4U1KA 4UIMA 4HKJB 3LS5L 2Y06H 3LN4A 3U6RA 3UBXG 2O5ZH 2Q3ZA 2DLIA 2HFEB 1N2RA 1WISA 5C86A 4TVSa 4P2OB 2UUDH 3E8UL 5HYJE 4G7VL 1NDGA 2LABA 5DD0L 1UM5L 1QYGH 5DD3H 1PEZA 4RFEA 1SBSL 3TF7C 1EEZA 2EH8L 5C08B 3F7VA 3ZHLA 3GJEA 4PS4H 3K1DA 3ARRA 5E94B 4DZ8B 1MRCL 3QH3B 3RWCB 3L5XL 2D7MA 3I6KA 5BS0E 1XGQB 4ONOA 1XF4B 4Q0XL 2R2CA 2VSCA 1IEHA 3RI5F 3F6IA 1MAKA 2DQTH 4IDJH 3HE6D 1IAOB 1T1XA 5CLTA 4DUXA 2HA1A 5E24E 1ZKAA 5F3BA 3RWHB 4HUWB 1CGYA 5GRWA 1MHPL 5C0AB 1FGNL 3JV0A 5HVHB 4NO5B 1KIRB 4X80H 4OLYL 5KSUB 4YDLB 4L1HA 5CEYB 3MLWH 5L88L 5AZEH 3E6FA 4XVJL 2HVJA 3ROOB 4S2SA 1A7PL 2ED8A 5A1AA 5CBEA 5I8CA 4EUPG 5CGYC 4AIXA 2O61A 1UWGL 1T66D 3IXTA 3BN9D 5FCUL 3F7QA 3NFNB 5GGVL 4DZBB 3VWJB 1ZHKB 5DHVH 5JORB 4NRXA 5ID0B 4KDWA 1XT5A 3D18A 2FHFA 2HRPL 2VE6B 1ZA6B 2YPLA 1QQDA 4RDQG 1F3DJ 3VGHA 5T3XE 4YBLC 1F02I 2BY3A 4RGND 1CFTA 3P0YL 5HHOA 4YIQA 5C09A 1G6RA 4JFXA 4X5XB 5TGBB 4JY6B 1C5BL 4MXWH 4XZUB 5TE6H 1NCBH 1OSZB 4IIQB 4OGXH 3TJEH 4XP6H 5E6ID 5HY9A 3SPVB 2DWDB 4PG2C 4XNZB 3QULB 5E4EB 5IGXL 3L95A 2BVPA 3HS0A 1CDUA 2D2OA 4LRIA 1KBGL 5F7YC 3MA7B 3SKMB 1BQHG 4KRPC 4QXGH 2AK4B 1N6UA 4FQIL 1PLGL 4P3DA 3VCLA 2EDDA 2JK5A 4JPVH 1B6UA 1LO0L 1RZJL 4LASH 2FX7H 3VG0H 4N0FB 2AXFB 3JV6B 3PNWB 2DWEB 4HGWB 4XAWH 4L9LC 1BEYH 5FOBB 1F90L 2DTSA 4HIXH 5IT2H 4GMSL 2Y06L 1FL3B 2R69H 4RMWA 3GI8L 5EWIH 5GSRA 1NBVH 3W9EB 1QLEH 5MEQB 4PJ8A 3SDAA 1YJDH 1QYGL 4XGZB 1CDCA 4C55A 5DD3L 5DJDA 1J1PH 4Q7DA 1QACA 4HWZB 2Q7YA 1A3RL 3VFTA 3LKRA 4MNHA 4LLDA 5C0BB 1BAFH 4HQQH 1M7XA 2C7UB 1T21A 3RWGB 4QRRB 4Z5RA 3EO1A 1RK0B 3Q3GB 2X70A 4YBHA 3KPPB 4YHOL 5EOTA 4ZUTA 4YH6A 4YK4C 3LEXA 1RHHB 1T7YA 2YPLD 5JIHA 2BSSB 4X9FA 1A7QL 1KCUH 1NEZA 3QDAA 2OXGA 4UU9A 4YWGH 1QFHA 4KROC 2CQVA 3ZKMD 1DQTA 5EA0H 1L0YA 1RJZB 2EZ0D 1J0YA 5EU6E 4KV5F 2FL5A 3I3DA 4X80L 3D39E 4TYUA 4OZ4A 1BZ9B 4MSWA 3MLWL 3IDNA 3QA3A 4NWTH 5D7JA 5AZEL 3SDXE 3TT1H 3QFJB 1PG7W 4HWEL 5HYSG 4OZFG 3TNNB 3HPLB 1CLYL 1F5WA 4D0DA 2FH8A 5D7LA 1QZ1A 2DB8A 4W68A 3CXHJ 4NJAH 5IHLB 3D85D 1E27B 5IVZA 4W4OC 3C08H 1NDMA 1Y18B 2WQRA 5CZXD 3CDYA 3DGGB 3FONB 1ZE3C 2HN7B 3QXUA 3WV0A 4G8IB 4QT5B 4Z78B 2BJMH 4PV9A 3DVIA 3TLRA 4PPTA 1XCQB 4CAGA 3ZYJA 1UC6A 2DIJA 3GFUA 3SKUD 4YXLL 3SDAD 4LMQI 3LEYH 5GJSL 3RZCB 4CMHC 5TE6L 3S34H 1MWAH 3OV6A 1DSFH 1NCBL 3PWUA 4Z7VB 2WUBH 2NTSP 3A67H 3QWOB 3TJEL 1LDSA 1K8IB 1JNNH 3PGFL 4LCYA 5E9DD 3P4LA 5CJ5A 4GKOA 4QOKE 3HC3H 1JZ8A 2XQBL 4HPOL 1M71A 5IB1B 3UTTE 3QXAB 3WL9B 2YD9A 1YMMA 4W6XB 2NR6C 3P77B 3ROLB 4YDVA 1L4IA 2F54D 1U8NB 4LDOB 3G6JB 1YNKH 3QO0A 4E0RA 4F7TA 4LASL 3KYNB 3HCVB 1JL8A 2ED7A 3X17A 1FZMA 3V6ZA 3EYVA 4XAWL 1BEYL 4Y4KC 1LP9F 4M6MH 2VC2H 2CGRH 4HIXL 5IT2L 5JDJA 4ZO7A 1BX2B 1BVZA 2R4RL 5EWIL 5C0NC 2GFBA 1I9JH 3AGVA 1QLEL 3BISA 3X14B 4AG4H 5D7JD 3RAJH 1YJDL 3D25B 4WU5B 1B4JL 1CDHA 5EU6A 2NY1B 1GVIA 1I9RL 3EDEA 3VGGA 4HIHB 3P4MA 5D7LD 4NKIH 5DD6A 1JTTA 3RQ3A 5JTWA 3GMRB 1FNSH 4HQQL 5FYKH 5C0RL 3KS0J 4G9DB 1KLGB 1OP3K 1X4XA 4F57H 3FTGA 2ZWLT 4F9LA 4G9FA 5FYJE 2F74B 43CAB 4JG1L 3S96A 1XGTA 5BV7C 1R3IL 2DLFH 2HH0L 4JLRA 3RP1A 2J5LB 2NY5C 1B0RA 2W1NA 4MQXD 1ACYH 2CXKA 2F15A 1BIIA 1I1RA 3IRPX 5IFJB 1NUGA 1NGWA 1RU9H 3X11A 4ORGB 4WWKD 4JKPH 4LCIH 2X1OA 5T33H 5LQBH 1NMAH 1KEGH 1MEXH 2A73B 4XMPH 1D6EA 4NWTL 5KG9B 3C9NA 3FB7B 5D71H 4OFKA 3VDCA 4U6VL 1YMMD 2B1HH 4ESKA 5KSVB 5KVFH 2OMNA 2VISA 5EUOE 1QFWH 3FKUS 4QOKA 4NJAL 4AIZA 4TNVF 3F7YA 3WO3B 1LO5A 3C08L 1KIPA 2VDRH 2FYYA 3BIKA 2FX8H 2CKBA 3TCLB 2BNQE 2V7HA 3VXOA 2NY3C 3RPIA 2PYFA 3TIEA 2W0FB 1RHFA 2AXHA 5DLMH 4ODVH 4F9PA 4U6XB 2QKIA 2GJ6D 4NQVA 4IOFD 3VRLF 1YYML 1OQOA 4YPGB 1KV3A 3AS0A 3BQUA 5D4QA 5CJBA 2B0SH 3FZUC 3OX8A 1A14H 1DL7L 1XF5B 1GAFH 4F37F 1K9TA 2HTLD 2ICWJ 4H0IA 5EBMA 3TYFB 1UA6H 1DSFL 3T65B 4J1UA 3OHXA 3DVNB 1JNNL 1I8LC 3MSPA 2LV4A 3HI5H 3HC3L 3CAFA 3W0WD 4HKZB 2VIRB 4KJPC 3PWNA 5DC0A 4G9FD 4NUJB 3UZQA 3FQNB 5F8QC 5HHMB 4YJZL 3BEWB 1NLBL 2W0KA 2XXMB 5I71C 3O6KH 3KPSB 3PWPB 1WCQA 4KI5F 4TQEH 2V2WB 5CJOH 3OAYK 1WVZA 1YNKL 4UT9H 4V1DB 1JPST 2Z31D 4PJIF 2AGJL 3BEVA 3UBXB 3RKDC 1B90A 5D1ZC 5F9WC 2AVGA 3K4AA 5IWLC 1QLRB 3C8KB 4M6ML 2VC2L 2CGRL 2E6PA 5IK3A 5IMOA 4GXUN 4AG4L 5EDXA 3RAJL 4L4TA 3N85H 2XZCH 1FE8H 5GQBA 3LDBC 4PP2B 3MFFB 1SEBB 4XWGH 5FB8B 5LJYH 3C5SB 4NKIL 3WLBB 5L0QC 2ATPB 1IGYB 5I9QB 5JLZA 4RMRA 3JWOC 5FYKL 3U1SL 1WWBX 4F57L 3NBNA 4JFEE 1OLLA 3VXUB 4Y19E 4X6FB 5I19H 1I8MB 1FV1A 1T5WB 3T4AA 4XP4H 3CLFL 5ANMA 4MVBD 5BRZA 4MCZA 4O2CB 1J11A 4UV4H 3RVXD 2JB5L 3MRCA 2CJUL 5K9JH 3NPZB 2E7LC 3H9SE 2HVKB 3BQUD 1ACYL 4CU7A 5IVXA 2WWKO 1J0JA 1QTYT 1IM3A 4OCSH 1P7HL 1X5HA 5JHDA 3E3QC 1EHNA 4OFYA 4I1NB 3HE7C 3FT4A 1RU9L 3WCYA 3PHQA 4JKPL 1BWWA 1OTUC 4YC2C 5T33L 4EUPB 1NMAL 2VL5B 2BRRH 3IXAB 1QSZA 3VFOA 3VXQA 4EUPH 3L3JA 4FQPA 2Z8VC 2PCPB 1MFCL 4H1LA 4KK5D 2B1HL 5KVFL 4P2RB 5I1LA 3GMOB 4GS7B 5A2LH 4WENB 4M1CD 1ZLSH 1FZJB 3QIUC 5HHNA 4QHUA 4XC3L 3PDOA 4YK4B 2VDRL 2VWEE 1PKQE 2FX8L 4MJID 5CWSB 1CLOL 2NY7L 3KXFD 5JNYA 4RBPH 3PP3K 1FVCA 2VAAA 2VLJE 3TA3D 5C3LD 3SDCC 3RGVD 1V05A 5HYQA 4ODUA 2VNCA 3CU7A 1P9MC 1OAKL 1U8OA 1GJIA 1T89C 5SWSB 4Z0XB 3RY6C 3KPOB 4OCXL 4L4TD 5E7BA 2EDNA 3SJVB 4XXDA 4NKMB 4MJ5B 1I7RB 2IH1B 3KLHD 1C08B 1UA6L 5EC2B 4FQ2H 4ZOCA 1RZFH 2GYSA 3OBAA 3CFEB 1CL7L 3GMLA 3RNQB 4HS8L 3HI5L 1JNHB 3DXAA 2X9WA 1I85A 3IJSA 5DD1L 4WVRA 3U46A 2VL4A 5F1NB 4KHTL 4PJGF 4TQEL 3ARQA 3VGBA 3H42H 5EN2B 5MEOB 3BAEL 1WV7T 4UT9L 5DS8A 3WFBL 4WI5A 3WKML 3P9MA 1MFAH 4AZ8A 1WCBA 1HSBA 5B3JE 2BHYA 2HJFA 2H32B 5JHDD 5TQ2H 5GGTH 1XGPA 3TPUB 2W59A 3U82B 2VDLH 4CMHB 4G6JL 5I73C 4ZUVB 4D8PB 1CN4A 3U7WH 3MR9B 4I0PB 4XPAL 4R2GC 3WJJA 3N85L 2XZCL 4I9WE 1FE8L 3EJJX 4MS8C 3JTSA 1G7LB 4F7EB 1EUTA 4U7KA 3SDDC 4JY5H 1MLBB 3WNOA 3MXWH 3FFCB 1H9VA 4JFDB 3NAAH 2PTVA 2JCCE 5TE7H 5IVNA 1BZ7B 4GKNB 4HPYH 4UILH 3FAWA 2IQ9L 3WFCH 1XR9B 5HJ3B 2X4OB 2P5WA 2DI9A 1WWWX 4WUUE 5KSAB 5HI5D 4M1GH 3MRPA 4UV4L 1CFVH 1S9VA 4X0KA 4X4MA 4I5BA 4LRNH 4ZNCD 4YFLI 3SGJC 2CIIB 4GAYB 4XH2B 2VLJA 5B39G 3O8XB 4Q58C 4PB0H 3MYJB 2G75A 5HYSB 4OZFB 3O4LB 2X4PB 4OZFH 4YAQA 5BVJB 3LPWA 2PO6B 4Z7UF 3BP5A 1YY9D 4NZRL 3DXAD 5T3ZE 5D96C 5IB3B 3MCKB 4B5EA 3EYUH 2E7MA 5IIEB 4QHMA 1R5IA 2YN3A 3UPCA 5F6HJ 3I50H 5GZND 5E00A 1NLDL 5DZNA 1YUHB 1ZVSB 3OKOB 1SEQH 4YBQC 1ZLSL 1PJ9A 5CJQH 4GRMA 5EU7C 4I48B 1AXSA 3TJHD 3O3EB 1PQZA 2PXYA 3N1PC 5GGRY 1NGXB 1P6AB 4GG6B 3L9RB 2VLKE 1JV5A 1K3IA 1JGVL 1FG2B 5E8OA 1HE7A 3WXWH 4DGIH 4S1DC 2FB4H 1J0IA 2ZUWA 1XF3A 1UQSA 3G5YA 4NP4L 4LLYB 4X6DB 1MCEA 4MGXA 1RZ8A 2YUWA 3BPCA 4YHKL 3QDJA 4FQ2L 1RZFL 1ORQB 2FJFB 4CN4A 3S9DB 2OSLA 4M7LH 3V5DB 5H37G 4CDGC 2R0KH 4PJ9C 5F1IB 4TSAH 1CI5A 3F12A 5DYOA 5JIKA 5ADPL 4PJEF 2NW3A 4RZCB 5JOFB 4OAWA 1I8IA 4Y1AA 2H3NA 3B6SA 4I2XB 1BVKA 1V7NH 4MWFB 3DMMA 1FIGH 4NN7B 1R3LA 4MNGE 3UPAA 3MRDA 3MOBL 4HC1A 3RDTA 5IM7A 4J3XA 1IAMA 4L8BA 2VDLL 3S88H 3P30H 3IS1X 4RISH 4TTGA 2UYLB 1R3JB 2ZCKL 4APQA 1V7MH 4QRSA 2FD6H 5CD5C 3VA2C 5IHZA 5DURB 4EQ3A 5L8LB 2XACC 4JG0H 4O2EA 3BW9B 3N9GL 3S5LG 1TDQA 4ZQKA 4L8DA 4XBGA 3UTSE 4TVPL 1A4KA 4UILL 3KLSA 3WFCL 1QRNB 4QXUH 4MDIA 4M1GL 4Y2DA 5MERA 4C83A 1CFVL 4WIQA 2BC4B 3MLTB 2W0PA 2ZP0T 3KPLA 1WZMA 3DX9A 4DKFH 3UTQB 1SJXA 1KPVB 2MCG1 4KQ4H 5CP7B 3RWDB 2BCKA 1IGIH 4PB0L 4JJ5B 4YHLL 2YWYA 4OF6A 3MNWB 3QDJD 2YD8A 3O2DL 5HHQA 3NFPB 4JO1H 2AEWA 3O3AB 4WW2A 4GW1A 3FB8B 3Q5TA 3MV9B 5I66B 4WDIB 3EYUL 1AGCB 2R2HB 4PJ5E 2XZAL 4Y1AD 3S4SG 4UTBL 5IB5B 4OI7A 4UOW0 1DQJA 3I50L 4PGBB 5E8PA 3VMOA 5AWNH 5JUEL 1SEQL 5D2LE 3GJFB 2GK0A 1JGEB 4OZIB 2YXMA 3BH8B 2APWA 2E8ZA 4ONFH 1MCOH 4H5SA 1ACZA 5DJ8B 3MQIA 4MNGA 3IFPB 1IC5H 5DUPH 3QJFA 3WXWL 5GZOC 1BWMA 4U1NB 2FB4L 5F89B 2P8LA 3WFDL 1QR1A 1MRFL 5DRZA 4F80A 4OF3A 5TF1L 3VXTB 1KB9K 4FQXC 4FQ1H 3MRNB 3TIDB 4OV5B 5F7UA 4DQOH 1IVLA 2FGWL 3EYSH 3NTCH 2OJEA 2H2SD 1UFUA 2OR8A 3O6FB 5DUBA 1NBYB 3T2QA 4LLVA 1JPTL 4QRPB 3ZSTA 1CR9H 3GBNH 4TULH 1V7NL 4UUJB 4Y2DD 4P57A 4PLKD 5BXFA 1PD6A 3HLAB 5CS7A 1ADQA 4MXVE 5DZLA 3LKSA 4N5UA 2B7DT 4XI5D 4NKQB 1PX4A 1KJ3H 3KJ4B 1TZHA 4L4VE 4O51B 1NBZB 2P4AB 4ZFOA 3V0VA 4UT6H 4BH8A 5C0EB 5HVFB 3PWVB 4K8RH 1ODAA 3H7BB 4M4RA 2PTUA 2V9TA 4JRYA 5IEKB 4KUCF 2A83B 3ULVL 5GHWH 3WJLC 2DQIL 4PY7B 2FD6L 1FFNB 3U0TA 5DK2B 3AM8C 4ZTPH 3NZ8A 3PGDB 3TBVB 2JE8A 4MD0A 3SGDH 3C5ZC 5JZ7D 4Y4FC 4JGUA 3IF1B 5CEZL 4H8WC 4AYFA 5DDHB 3MREB 2RFXA 1EX0A 4BK5A 4JFYA 2ZZUT 5JOEA 4O5LH 1H0DA 1YDPB 4C56B 1XIWD 4QXUL 4ODTL 2P5EA 1J8HE 5FYKU 4BQCA 2N7BA 4DKFL 4R3SB 4KQ4L 1CF8H 3SDXF 4KAQH 3ELAT 5AYQA 1IGIL 2CDFB 5ILTL 1S9KC 5F7DB 3WXVH 1DUYB 3K4DA 2X4RA 2EDRA 4TTDD 1UADC 3IAPA 3GSNB 1C7TA 1GOGA 5C71A 1M6OB 3S37X 1WZ1H 1QFWM 2D9CA 2IBBA 4NKDB 1I1AA 2F53E 2NXZC 4N8PA 2WIIA 3KPRB 5A40E 2DKMA 4G3YH 5ALCH 1A02N 3UO1L 4K71C 3GI9H 4KRNA 2X4UB 3QUMB 1JZ3A 1HNFA 4HMEA 4X98A 2QSVA 2AJZB 3BUYB 3OKKB 3CSYB 3U48A 3CFCH 1MLCB 1OWWA 2UV3A 4JN2A 4ONFL 1OOAA 2YD7A 3MNVA 3RL2B 5MENE 3BRDA 1EXUB 1ED3A 2OYPA 1IC5L 4AK1A 3PIQB 1DBMH 1ES0A 4KK8C 7CGTA 1IQDA 3VXMD 5E4IA 1HKFA 1CGTA 2FO1A 4QF1B 1G1CA 1MJUH 4WU7B 4HFWB 4ZSOB 4U1SB 5K9QG 3GMPB 3MLRH 4G6MH 1EZVX 4HH9A 3TPKA 2NYYD 4XB7A 4E5XB 2V2XB 4FQ1L 3B43A 2CUHA 4FMFA 1KLFA 4XCYB 4ZAKC 1W0VB 2DTML 4NQUA 3PABB 1KJVA 3LQZA 1RZIB 3DV4B 1KGCE 1GIGH 3I75A 1HI6A 3HAEG 4X6CE 1CR9L 3GBNL 1I9IH 1U6AH 4NSKA 4P99A 1HYSC 4WGWB 2AJ3B 4JQIH 2P5ED 3L5WA 4MA8L 1PZUB 3F5WB 2KH2B 3U36A 3CFIC 4KI5D 5DJZB 1N0XH 1S7RB 5KS9B 3ULUE 1FJ1A 1VEPA 3IDIB 4LEXL 4PGCA 5EU5B 4XWOC 3GSXB 1J8HA 4M48L 1MIMH 1A64A 3UJIH 5F93C 4K8RL 4HAGA 1NPUA 3K7UA 4L8SC 1EV2E 3BVNB 5IMMA 3VXPA 5J9PB 1MI5A 3W5MA 4JHZA 4KTDH 3VFMB 1IT9H 3WN5A 3ETBF 4P2CG 4R26L 4RFOL 2AV1B 3VRIA 4PD4K 1GXEA 3MJ9H 1YY8A 2BVOB 2OK0H 2OL3H 3CUPB 4JHWH 3ALWA 1LEKB 3RRQA 2QSQA 5HBBA 5D2NB 3BD3A 3GB7A 5L7XH 4M7JH 3FFDA 3FQRB 4ZPTA 4M93B 3WNNA 4HS6B 1CF8L 3D0VA 4LMQE 2EDWA 2KL6A 4PJ7A 1FL5A 2G9HA 3H0TB 2KQMA 1FYTB 3PG2A 3HE6C 2ZKHH 2OTWB 5FF6A 4OCRL 2C4FU 5EUOF 3WS3A 3CDGA 3GSNL 3W81A 3HZMA 2R1XA 3UMTA 2X4NA 3QQ9D 4EBQH 4LARH 4NYLB 5DJ0A 4G3YL 5ALCL 4Z0BL 4LAJH 3GI9L 3EAKA 4G43A 5CINH 3I6LD 3QG6A 1KENL 4LSQL 4O58H 5E6YA 1AHWA 2Y9RT 3QUML 2AEPH 4XB8A 5DJCB 1L9MA 4K3EH 4NQDB 4X6CA 3V7AE 1Q94B 1K5NB 1FFOA 1K8DB 1T66C 3CFCL 4MAYB 3MBEB 2DQEH 2ARWA 3BN9C 1VFUA 4PRDA 3SDYH 1PBYA 2NTFB 3VD9A 2KPNA 1FO0B 3U2SB 2ADGB 3L3HA 1MI5D 3M1BB 1NGPH 4YPJA 1IM9A 5ISZA 4JO3H 4RGNC 3VFWB 4OF5A 4B0MM 2ESVB 3SCMA 1JF5A 1NCAL 4GRWE 4L3CB 4GW5B 1PG7H 1I3UA 4NQTA 1G9NH 2UWEE 5ICZB 4MHHG 4JFFE 3MV7B 5JHLH 1GIGL 5E6IC 3SN6N 4IOSD 4JRXB 1I9IL 3HR5A 2VDPL 1AXTH 3JTTB 1F3DH 2VLLB 5J4MA 2RAMA 1JUFA 3RWIB 1GPOL 1A1OA 2GJZB 3QUXA 1N0XL 2AW2A 1P5VA 4MCYB 4Y5YC 3FOMA 4FTVE 4UZGA 2EDTA 1U3ZA 1JK8A 2XWTB 3CVIL 5T5NF 2ATKA 1MIML 4PJFB 3UJIL 5BZWB 1HQ4A 2DYPA 1AGFA 1FZOB 1U8PA 4UTAH 3JV5A 3U0WH 4U1JB 4R0LB 4N0YH 5F9OL 4KTDL 1J5OH 2HFGH 1IT9L 1HSAB 5AZ2H 1MFDH 1NFDB 3LKOB 1P2CB 1Q9OB 2CK0L 4BYHA 3RL1B 1CK0H 2Y72A 1MUJA 3MJ9L 2EICA 1FVDA 3X12A 2OL3L 3KPNA 2R9HD 2Y5EA 2IGFH 4JHWL 1TITA 5ESAB 1ZWIB 2GTWB 5ACLA 1DUZA 3ZKND 1BQUA 2A1WH 2JJTA 4UAOC 3QIBD 1OW0C 2HTKD 1U92A 5I6XC 5KN5A 2P46B 1S9YB 5L7XL 4M7JL 3W82A 4JEGB 1SY6A 2V17H 25C8L 4HLJA 4OF7A 5ISZD 3IDGA 4YO0A 3V4PL 2Q76B 5F21B 3TN0D 4WFED 2VSDA 1QSEE 4NC2B 4O2FB 3U30C 3ZKMC 1ZV5A 3TO4A 3HUJE 3C5ZB 3MJGX 4EBQL 2EZ0C 4LLWB 3ARFD 2G60H 3DYPA 4CVZA 4D9QD 4AMKH 2BXYA 1FVEA 1N5AB 3IVKB 5CINL 4LKCB 1FFPA 4LVHB 2X4TA 5E99L 2AEPL 2UWEA 5LCVH 3MMEB 2ID5A 3RWEB 1SJEA 1DQQA 4LRIC 1KTDA 1X5LA 1T0PB 3MRMB 4N1EA 1ZA3B 4LPXA 1B2WL 2G5RA 1E6JH 1QSFE 2FIRT 2YOCA 1REIA 2DQEL 2IC2A 5CZXC 2X41A 1GZPB 4G8FA 3VH8A 5CIPA 1U8KA 4DFIA 1K6QL 1FO0L 4FTVA 3JV4B 3B5HA 3HKFA 2WP3O 1R3HB 1ZSDB 5C08E 5FHAH 3CJJA 4RQQB 4I13B 4OQTH 4PJIB 1KEML 4JZJA 4YR6A 5EU3A 3MOQA 3SDAC 1G0YR 2DS4A 5EZJA 5C0FB 2Z4QB 4NO0A 4KKBD 4P46C 3CH8A 5F7EL 1G9NL 1X44A 1VGEH 3J8F7 1EUUA 3B2UC 5JHLL 1NGYB 4TPRH 4PREB 2CLZA 3AXLB 5B3JF 2GHWB 4HKBA 4PRPB 1CGSH 4P5KB 4KPHH 3BJLA 1CVRA 1RK1B 1LMKA 3TVMD 2EIZB 2MMXA 5EO1B 4E41A 1FAIH 4WRLA 5IOPB 2FJGA 5KZCD 1IFHL 5C0AE 1X5IA 32C2A 4X6BA 4PRIA 2D31B 4K94L 4NC1E 1AFVH 3M17B 1BF8A 4ZYKB 3HG1B 4DKAA 5C0DB 5FGRA 2XPGA 1NSNL 5C2UB 4M8VA 5D5MA 5C6WH 2JCCF 3MNZA 3ZT5A 1RJYB 3RVVD 1E6OH 1F58L 4N0YL 3UTZB 5E95B 4JKMA 4NUGL 1VFBB 1J5OL 1SQ2N 3DURB 5AZ2L 4MA3B 3HRZB 1MFDL 5TH2B 3MACH 2IAMD 1QSEA 4QRUA 1S7QB 5D7JC 1FH5H 4DK6A 4OFIA 5BS0D 3GNMH 2PW1B 4K23H 4RBPK 3HUJA 1MCNA 1A8JH 4PGDB 3AFLA 3CU1A 3GMMA 1UACH 3HI6H 3M8OL 3CFJA 1UM6H 2ZPKH 1C16A 2IGFL 4NNYA 1ONQB 3V6OA 3NPSC 4WTWA 1JFQH 3OB0H 3EYFA 3CD4A 2A9NL 3ZZ1A 1DN0B 2BXZA 3WNKA 5ITBH 1AQKH 4D9LH 2OR9H 3LS4H 3QDGA 2V7NA 4OLWL 3ZE2E 2V17L 1JTOA 1QSFA 1IGCH 4L8SB 3QG7H 5IESH 3QAZC 4G7YL 4PLOB 5I2IB 2GKIA 1NBQA 4MQXC 3JXAA 1QG3A 4JANB 5E70A 4LHUB 4UNTA 1S9WB 3GDBA 4UIKL 3KS0H 4F3FA 1KTLB 4R8WH 4XVTH 5LAXA 2NCMA 4WWKC 1T0NA 5GGUA 4X7SH 3V2AR 4AMKL 2AK4E 4ELMA 4ZO6A 2AJSH 3ZL4H 1Z3GH 3KJ6H 4LLQB 2I26N 3MV8A 4DCQA 5LCVL 3CFKA 4CVXB 4E41D 3MRJB 4NQEA 4PTTA 3QUYA 4HK3N 2IJ0C 2MWCA 5I76A 4N8VB 5SWZB 5JMOC 1E6JL 1SVCP 2FX9H 3OKNB 1I4FB 2UZIL 3OKEA 1OAQL 1C1EH 5F7LB 4J3UA 4XPFL 1CT8B 4RAUB 2HP4A 1QKZH 4IOFC 4XTRC 1R24B 5CILL 1T83A 3MLYH 1HHJB 3VE0B 5BVPL 5C0BE 4OQTL 5DK0B 1JWMA 2Y5TB 2YD2A 1OGTA 2MCPH 2VABA 3HAEH 2N7AA 4F7MB 4WFGE 2ZUXA 4JHBA 3NCJH 4QRRE 5LGHH 2H1PL 3MBXH 4Y5VA 2HTLC 2ZG2A 2B20A 3QI9A 4Q9QL 4PRBB 1AIFB 1T3FB 3ZMRA 1V3MA 1C12B 5DMJB 5DHYB 1C5DB 4XAKD 4KPHL 5I1AB 1X5FA 3OR7A 4F9LC 1OSPL 1U8IB 4HUMB 2LFGA 2W60A 3WSQH 5KOMC 1KCVL 5D1QD 1HXYA 3V5KA 3T0EB 1GGCH 3CCHB 2IFGA 1CBVH 1AFVL 1T0MB 4U1KB 5T1LD 2Z31C 2AJXL 4UIMB 3B9KA 1T4KA 3LN4B 5C07A 3U6RB 1NCWH 4JQXA 1QBLH 2A0LD 4DOHE 3JWDH 1E6OL 1NDGB 1QBML 1AXIB 4RFEB 4LF3A 5I0DA 3DOSA 1EEZB 4UV7L 4KUCD 3F7VB 1FH5L 5JA8B 3GJEB 3MRIB 3GNML 1FSKB 3MV8D 5CGMA 3HI6L 1B4RA 4L5FH 4U3HA 4J4PA 1UM6L 4NQED 1TQBC 1HQRA 2ZPKL 3I6KB 3ZTNH 3QHZH 5GRJL 1PSKH 4Y5XA 4F8TA 3KPQA 4G5ZH 2W9EH 3ARGA 2QQQA 4MX7A 4WWID 4DKDC 3KPTA 5ITBL 1AQKL 2J8UA 4JO2L 3RVWD 4TUKH 4JFQA 1E4XL 5F3BB 1I3GH 4MVBC 2FH6A 3QG7L 3D39D 5IESL 4Z7VE 3RVXC 2XKSA 4R4BA 3EFDH 2R29H 1CLCA 3HMXA 2QSTA 4FNLH 4XBPA 3BQUC 1RIUL 5TQ0L 3ZYIA 3L3GA 1MCBA 2R4SL 3HZKA 3QWQB 4N9GA 1NUNB 2AEQH 3E6FB 4YXKL 3TESA 5D2LF 2HVJB 4S2SB 4O02L 1ZXQA 1EHXA 5CBEB 2X05A 4IMLA 5I8CB 3G6JE 3ZL4L 2Q8AH 4F58L 2O61B 1VACA 2A2QT 2GTZA 3KJ6L 2EDLA 3IXTB 4RNRA 3SKNA 4DGYH 1JNJA 4XBEH 3MUGA 4JPWH 2D03H 4KK5C 1FGVL 4ERSL 3T1FA 5EPMA 2NX5A 3OF6A 4NRXB 4M1CC 4NN6C 3D18B 5C0CA 1RURH 2FX9L 4JM2A 1NMCB 5D1XD 2YPLB 3AY4C 3B9KD 5C07D 1QQDB 3LKNA 1C1EL 1CFTB 1LK2A 3TA3C 5HHOB 4YIQB 5C09B 1G6RB 4ZMAT 4JFXB 3RGVC 3QEUA 2LU4A 3MLXL 3JWNC 3VFGH 1QPPA 3U30B 4CVUA 3MLYL 5CEXA 1ZGLP 2L7JA 1ETZA 2QEJA 1A6TA 4CU6A 2XICA 5HY9B 3UTTD 2VKWA 1W72A 3MUZ1 2HKHL 3MBXL 4QHKJ 3UC0L 3QPQD 4HFUL 3KLHC 3L95B 4J4PD 4MXVF 2BVPB 4NQCD 1MY5A 3CIQA 3HS0B 2XWBA 3F8UB 1A6ZA 3D48R 2ZSWA 3FHAA 2Q1EA 3MLVL 4I4WA 3VCLB 2JK5B 5T5NG 3B9VA 4UOW1 3WSQL 1G7MA 2ILLA 2AI0L 4KMTH 1GGCL 1CBVL 3AAZA 1O0VA 4YHNA 1BOGA 4PJ8B 2BRQA 4ODXA 4D0BA 4XNQA 3JWDL 3SDAB 5CCKL 4K7FA 4OQ1A 1X9QA 1ZAGA 3BYYA 5DJDB 4HT1H 1YYLH 3NGBB 3GJFK 4HZAA 5CP3H 2Q7YB 3VFTB 1ZTXH 4RA0C 3LKRB 4MNHB 4LLDB 5FYJD 3FO2A 4FFZH 2ZJSL 2HT3D 3ZTNL 1ZGLA 3QHZL 4NBZB 4Z5RB 3H9YA 1PSKL 4GMTH 2X70B 2W9EL 2H45A 5EOTB 4ZUTB 5C0CD 4JM2D 3LEXB 1A9BA 1KCLA 2RBLA 4MQSB 4TUKL 1NEZB 1OAUH 3VRJA 1G1YA 2ADFL 1HK6A 4UU9B 1QVOA 1INQA 2IFFH 2VXSH 5HI5C 2GIYA 1JMZA 5MI0C 1CFBA 1PFCA 2FL5B 4FNLL 5T3XH 4OZ4B 4KTYA 4MSWB 5HGDA 1TFHA 1ZVHA 2LVEA 2PTTA 3IDNB 2FCBA 4BSWA 3QA3B 4X9BA 5D7JB 2AEQL 1W2KT 3IGAA 5HHME 4HUNB 2CDGA 1L0XA 3MLUH 4D0DB 1YY9C 1LNUA 2RCSH 5D7LB 4V1DE 5DMKA 2KZ1B 1DCLA 3NPSB 3C6LA 1GGBH 5IVZB 4XBEL 4JPWL 1NDMB 4U1LA 3MXVL 3ARBA 1TJGL 1NC4D 3NCFB 2CDEA 3U4BL 2XWJA 3GMNA 1RURL 4PV9B 2MQ0A 4PBWD 4KMLB 4R4FH 1D5XA 3TJHC 3U0PA 1FCGA 3RI5K 4KRLB 3RUGA 1G6RL 1XH3A 4N1HB 3VFGL 3VGAC 4LGRB 3PWUB 3AREA 4M7KH 5JR1L 1D9KD 4DEPB 2JF1A 4FFYH 4YHMH 5HI4D 4PGZA 2XY1A 4LCYB 5EORL 1UCBH 1AI1H 1AGEA 2D3VA 4YHIA 4QO1A 3ULUF 1YMMB 3S35H 3O0RH 4YDVB 3PWLA 2M26A 2ZG1A 3RY4A 1BPVA 2WBKA 3P73A 2VZVA 3FT2A 4E0RB 1HWHB 4F7TB 1B6DA 3UJJH 1EEUA 1Q1JH 4XCCL 5JXAH 1BF2A 2I60H 3W2DL 1FZMB 1DP0A 1MCPL 1U36A 3V6ZB 1X3DA 3FO0H 1CDJA 2P24A 2BOBA 1BBJA 5HHXH 1P7QA 5EUKA 4ZD3H 4P2QA 2D9QB 5JA9A 1PVHA 4OTXL 5FDYA 4JVUA 5EU6B 4P2RE 1OGAA 1HH6A 1YYLL 5L2JA 3P4MB 2YPVL 5DD6B 1ZTXL 5F71A 4ZTOH 3BPNB 2XKUA 1DEEA 5F6IB 4FFZL 1CZ8H 5C70A 1MJ8L 3FN0H 3BRGC 2WUCH 3FTGB 3DHMA 3BOVA 1WIOA 3NMEA 3NH7H 4LPCA 3S96B 1XGTB 1HXMA 2HLAA 4JLRB 4JN1H 5J0BA 5SWSE 1KB9J 2KZWA 4KFZC 5E2WH 3F6LA 3SJVE 3L6FA 2A38A 1RZKL 9CGTA 2EDHA 4LEOA 1B0RB 3QDHA 4J12A 2PR4L 5D7IE 5C7XH 4OSUH 5B38A 1NGWB 3UTPD 1P6FA 3X11B 3ARED 5DF0A 3BDYH 5T3XL 3I9GH 2ADJA 3OJ2C 2Y25A 5BJTA 1S8DA 2VDQL 1D6EB 1HILA 7FABH 3C9NB 3BDBA 3O11A 4DTGL 3O2VH 4LU5H 1H15A 3VDBA 4BH7A 1EZVY 2VISB 4QOKB 4POYA 4PJBA 3F7YB 1VFMA 1GGBL 2GT9B 1LO5B 1KIPB 4LPWA 2FYYB 3BIKB 2CKBB 2OZ4A 1YEIH 4L9LA 2V7HB 3VXOB 1KXTB 1EIBA 3TIEB 2X4SA 4ZS7H 4CADB 3OL2A 5F8RC 2QKIB 3D2UA 5J3HD 4NQVB 5C0IA 1P7QD 3NCMA 2IPUG 4GRWF 5I75B 4P2QD 1CIDA 3OJDA 2UWEF 3OX8B 2XN9A 1HEZA 3O81A 3DECA 1EJOH 4JFDE 5EBMB 4TVPE 3NFSH 1OGAD 4J1UB 4M7KL 3OHXB 4FFYL 4YHML 4GAJL 4R90H 2B5IC 1RIHL 1YQ2A 1AI1L 4OD3H 3PQYE 2WK2A 3PWNB 4NJ9H 5C0GB 5K9OA 3K46A 1AJ7L 4TOYH 4LPUA 3O0RL 2H2SC 2D7TH 3WUWG 3FRPG 1BD2D 1BECA 5GGQL 2BSTB 1KB5A 3BEVB 4PR5B 5F9AC 1I7UA 3UJJL 3SE8L 1Q1JL 1S5HB 5CKGA 3O4LE 2DD8H 5FYJH 3TV3L 4Y2DC 4PLKC 1AD0A 3VWKD 1WAAA 3GSWA 3WD5H 3L1OH 3OPZH 4KJYA 4XI5C 4NM8H 4W6YB 2UZYB 1OY3B 5HHXL 4MMXC 5EO9A 5IK3B 5IMOB 1QFWI 3LSOA 5K93A 4ZD3L 4NOBA 3H2WA 4EKXA 4L4TB 1RUMH 5GRXG 4PJAE 2W91A 5AD0A 1H3VA 1LO3L 1NANH 2X7LA 4GKSA 2XT1B 5ESVA 4WW2C 4W4OA 1TIUA 3K1KC 5JLZB 4NZUH 1F4AA 4UQ3A 2VN4A 4DFHA 1CZ8L 2IH3A 3SQBA 5JZ7C 1S3KL 4GG6E 4FQHA 3OB8A 4LSVH 2WLYA 5SV4A 1FV1B 3O2WH 5ICYA 2I24N 1IGTA 3T4AB 5ANMB 5BRZB 2X40A 4MCZB 4X7FC 4JN1L 2J88H 3IFNH 5E2WL 5BZDA 4M6NH 4KZDH 3MRCB 2BNQB 5D70H 1U8LA 1YEKH 4OUUA 1XIWC 3HUJF 5IVXB 1QHPA 4UI2A 3MTRA 1IM3B 4IHOA 1KC5H 3FT4B 5T5FL 3PHQB 3BDYL 3I9GL 4LQFL 5C8JA 3VXQB 3VFOB 1JWSB 5FO8A 2R8SH 1P7KA 4I2XE 4TTDC 4NHCH 1JYVA 2ZG3A 2IANA 4H1LB 4EN3A 5DZOA 1ERNA 5K33A 5I1LB 4ZXBA 1N3NA 3BGFC 3PQYA 3OAUH 5EH1A 5HHNB 1BQSA 4QHUB 2ZOKA 3PDOB 4ACPA 1Q8MA 4BFIB 4MAUH 2OTPA 4Y4KA 4KY1H 2CKBL 3SO3B 1FVCB 2VAAB 4NBXB 3MLZL 4O9HH 4UNVA 5DFWH 5F88A 4WI7A 5HYQB 4ODUB 5MI0B 5FV1L 4HHAA 4LSDA 3PGCA 3SOBH 1WIPA 1U8OB 1IE5A 1VPOH 3W11D 3GHBL 4HSQA 5DI8A 1EVUA 4XXDB 3BE1H 5I1EH 4NDMA 4WV1A 5CEZE 4BKLA 2JLLA 1EJOL 1HINL 4PJDA 1FPTL 3D9AH 1CXEA 4U31A 5L2KD 3GMLB 4PJAA 5DO2D 4KDTC 4QGTA 3DXAB 1HWGB 1QRNE 2NYYC 4OD3L 3K2UH 1NCDH 4NJ9L 3GSOA 3IJSB 1Q9LA 3U46B 4RIRA 5KANI 3NIGE 3U9UA 5F3HA 4U3CA 2D7TL 3GGWA 4RWYH 4JREC 3L3OA 4FQJH 1ZT7A 1WBXA 3NCYP 5DS8B 4Z18A 3P9MB 2LTQC 1S5IH 3QXDA 1WCBB 1HSBB 3OJVC 3LRHA 2HJFB 12E8L 5EIIA 3REWB 3WD5L 3WE6A 1IAIL 1XGPB 4KI5C 2BY1A 1VDGA 4U6YA 4LSSL 4G6AD 5TF0A 2A6JA 1M05A 3T0DA 5I17A 4NNXA 5E08L 3QWRA 1A6VH 3S3SA 4R9HA 4G6FD 1ZEAH 3GO1H 3CLEH 2Z9TA 1OM3L 2FWOA 1LWRA 1R6VA 2PYEA 5H35A 2IAND 3JTSB 1JMXA 4EN3D 5KW9H 3ARVA 4LSPH 4M03A 5EO0A 4CW1A 4F37K 3IB4A 4OD2A 4ZXBD 35C8H 4WI3A 3L3KA 4OZIE 1NCUA 4L3EA 2PN5A 3BIBX 1F6AA 5I30L 1MRDH 4OV6F 5A43C 2P5WB 5J1SC 1BFOA 1HHHA 4MA1C 1FLTX 2FECL 4LSVL 4JPKH 4JFOA 3E3QE 3DYMA 3O2WL 1MIEH 5E5RB 5H2BA 3MRPB 4X0KB 2P42B 1S9VB 3IFNL 3T08A 1MQKL 4JAMA 4KZDL 5D70L 1E28A 1YEKL 2LQRA 1ZS8A 2VLJB 1BOYA 1LDPL 2CH8A 4AENA 2ZUYA 5EB9A 1KC5L 3AS2A 3BZFA 1ZMYA 3JVGA 3BP6A 1QPXA 1L6ZA 4YAQB 3CH1A 5TE4H 3UJTL 1KPRA 3BP5B 2HJKA 3S3PA 4ZOBA 4QRPE 5FYLD 2EDXA 2DL9A 3W39A 4QHMB 1R5IB 4HIIA 1ND0A 4EEEA 3QQ9C 5E00B 3RVUD 1XGRA 3WNLA 4HDIA 5I8EA 5D1ZA 4YX2H 4GRMB 4XNXH 1A6WH 1AXSB 1KCSL 3MODL 1PQZB 2PXYB 2R56H 4ONGH 4GJTB 3QEQA 1J7VR 1JV5B 5E8OB 3S6CA 3QWRD 4HJJH 3SOBL 2Z92A 1XF3B 2VDMH 3G5YB 3O3BA 1F00I 2DBLH 4U7MA 4OLZL 3D1MC 2PYED 1RZ8B 3QIWA 3BPCB 3HRPA 4PG9A 5GS2D 3QDJB 3OB0K 4KVCH 2C5DC 3EUUA 3W5NA 2OSLB 4GAFB 4L3ED 3WN5C 5KBNC 2V9QA 2YK1L 3RU8L 4ZDHA 4AY0A 3F12B 5DYOB 4P23D 3SGEH 1FN4A 4OI8A 2NW3B 1NCDL 4C56E 1FRGH 4OAWB 1I8IB 4Y1AB 2H3NB 3B6SB 2DQJL 1LO2H 2J6EH 4L3AA 4HLZG 1BVKB 3C60D 4YGVA 4OZGE 4AL8L 4L4VD 1GZQB 4RWYL 3DMMB 1R3LB 4G8GE 2E7LA 1U8QA 4FQJL 4I3RL 4QY8A 3OXRA 3UZEA 1OVZA 4LFHD 4YDIL 3MRDB 3HE7A 6FABL 4L29A 3RDTB 2FO4A 3T77A 5IM7B 2A9MH 4L8BB 1VENA 1JPSH 3KPRE 1BFVH 3BZDA 5E03A 4NCDA 4W81A 1A6VL 1LVEA 1ZEAL 3GO1L 4APQB 3CLEL 4QRSB 2B5IB 1QNZH 5KW9L 3DNKA 2O26U 5IHZB 1JCKA 4DGVH 2XTJC 3QIUA 3G5ZA 4O2EB 4ZQKB 4L8DB 4XBGB 5T3ZH 5CUSH 1WJ3A 1DFBH 1A4KB 5L8JB 5FECA 1MREH 4K55A 5FA3A 5HHVL 1AHWC 1ZLUK 3SDCA 3OGOE 3RY5A 4NNPH 2YA2A 4Z7VF 1OARH 1INEH 4M61A 4MDIB 1P9MA 2R9HC 5M95B 4Y2DB 3WFHA 5MERB 4C83B 4CL7A 2J7LA 3KPLB 4NGHH 3DX9B 5AG8A 1FNGA 1NAMH 2VB5A 4ZSOE 4IRSD 3ZKNC 4HK0A 3C6SA 3QIBC 5F7FA 2HTKC 5ADOL 1E0OB 2BCKB 2MJWA 5AYUH 1A9EA 3QIWD 3P2TA 3OZ9H 4JGMA 1N59A 3RNKB 3E2HC 2F53D 3V7AG 5CD3A 3N0PB 3G6JF 3GKWL 3GSVA 4XNMA 5HHQB 3GEWB 3DYOA 4V2BA 1MAJA 1YN6A 4WW2B 3C8DA 4GW1B 3TN0C 5EU7E 1H3TA 5TJWK 4IEFB 1EMTL 2XKNA 4TRPH 1QD0A 4KZEL 1T6VN 2H26A 1HZHH 1XR8A 1DQJB 5D9SA 3ARFC 1DE4A 4Y4HD 5J06A 5E8PB 2XYCA 2X1QA 1OAZL 2GK0B 4YX2L 5IJVA 4S11A 2BVQA 3HMWH 1A7OH 4OZGA 4W70A 4JHAH 1HKLH 2K1MA 2R56L 4H5SB 4G8GA 4MNGB 4ONGL 5LGKA 3QJFB 4NRZA 1JZ4A 1FORH 1OTSD 4MNQD 2LU3A 1TTGA 2P8LB 4NM4H 1QR1B 3ULSA 5DRZB 1BGXH 4BELD 3LQAC 4YQXH 1KJ2A 5E8DH 3SDDA 5DJ6A 2RQ8A 4KJWD 5C92A 4KQ3L 5D72H 5ESQA 4KVCL 1CXHA 4KHXH 2OJEB 4HWBH 5JW3H 3N1FC 2VLRA 1H5BC 5FXCH 3D69B 4M7ZC 4PJCE 1FRGL 2G2RA 1LO2L 2J6EL 4KKBC 5T1DH 5J8OA 2IPTL 3DX8A 3SGJA 4P57B 5BXFB 5IG7A 3LKSB 5KTEL 3RZWA 5JOPE 2EC9U 4A6YA 1OP3H 1NEUA 1TZHB 4KC3B 4XPGL 3TVMC 4ZFOB 3V0VB 4BH8B 4HC1L 3OMZA 4X7EC 1JPSL 4HJGA 2BZDA 1ZOXA 3PE9A 2EECA 5HI3D 5GS0D 4EXPX 4JRYB 1OPGL 3T2OA 3DVGA 2CRZA 5F7HA 3U0TB 4JQVC 1UM4L 3BD4A 3NZ8B 2A6IA 4DGVL 2FBJL 4MD0B 4NQDE 3RVVC 4ZFGH 4HWUA 5IB2A 1HHKB 2I07B 5T3ZL 2IAMC 2RFXB 4PJ5B 4QEGA 1DFBL 4OJFH 2JIXA 5J56B 1DANT 4JFYB 5FO7A 4NNPL 4NQXA 5D7SH 1OARL 1H0DB 3WFZA 1RMFH 2B4CH 2P5EB 2E9IA 4XPTH 1EO5A 4ZG1A 3WIHH 5JW4Q 4GQ9H 4NGHL 1IGMH 4MB4A 4LHQB 4LCWD 2ESVE 5BMFH 1X5YA 1A3LH 3MGTA 3OZ9L 3R0NA 2X4RB 2N4IA 4U33A 2AJYH 4Q74A 4PJ9A 1H8OA 1WF5A 3MV7E 5CZKA 5LXGH 1I1AB 3K8KA 3LEVL 1L0QA 1S7VA 2WIIB 4J6RH 5CZVH 2VLRD 1UXSA 1JRHI 2BVEA 3CDFA 4E9LA 3QXWA 5TDOA 3GMQA 1U8JA 5D7KE 4X98B 1GC1H 5BQ7A 3TC9A 1IQWH 4I3SL 2D0GA 5GS2H 5F96H 4PJCA 1NCNA 3CZFA 1RUKH 1CD1A 1EFQA 4PJFE 2YMXL 4M9OA 5FA4B 4JN2B 3MNVB 2R39A 4JHAL 1HKLL 1ED3B 3QDMA 3Q6FA 4HXAH 1JGUH 3SGDI 4FFWD 3CK0H 1IQDB 4OUOA 1NFDE 4XCNA 4CUCA 4NM4L 3RGHA 2AQ1A 5T1KA 1BGXL 5ALBH 5ICXA 5E8DL 3FMGH 4HH9B 4B41A 1NC2A 3C87A 4JVPA 2IALA 2OQJA 1RQ5A 5D72L 1CTNA 1R0AH 1TVDA 2VZ3A 3HNTL 5C6PB 3LQZB 4HWBL 3T2NH 5MP6L 3VGDA 2XNAA 4FZEH 2IEPA 2JIXD 3I75B 4KXZI 4MDJA 2XG5A 1HI6B 1D6VH 1KN2L 4M00A 4NSKB 2V5SA 5K59E 3L5WB 3STZA 1INDH 5L6YH 3V6OC 1RI8A 2QSCH 3U36B 1G9ML 1ADQL 2JB6A 4P2OA 4S10A 2JJSA 1AR1C 4L8CA 3VJ6A 1FJ1B 1D5IL 4PGCB 5FM5O 1J8HB 3I3BA 4AEFA 1VEMA 4UB0L 3INUL 4EQ2A 5D1QC 2NNAA 3DRQA 3QCTL 4WUKH 3TBSB 3VXPB 3IJYA 1MI5B 3TP4A 3V6FA 1X5XA 5FYJU 2GY5A 5EBLA 1Q0YL 1IGFH 4LOUD 1XGYH 2YKLH 3WN5B 5HVWA 2A0LC 4FMKA 3VFUA 5I1GH 3FOLA 3D3VA 2XRAH 3VRIB 2YBRA 1YY8B 3CSBA 2FEDD 5A2IH 4CVWA 2CLVA 1K85A 2EEBA 3MCG1 5D7IF 2G5BA 1RMFL 3GB7B 2M1KA 2WBJA 1NH6A 2ICEA 3FFDB 4IRJA 4OLXH 4GQ9L 1GGUA 2RR3A 3IS0X 4FHBD 4ZPTB 3EOTH 3D0VB 2GUOB 2OI9B 4F8QA 1JF1A 4OGZA 4PJ7B 1FL5B 2G9HB 1A3LL 3KYMA 3PP3H 4FQXA 3RVWC 2CR6A 2ZCLL 2Y4SA 1NC2D 1NFIA 2DKUA 3QSKB 4X7TA 5FF6B 2DQGH 2P48B 3WS3B 3REVA 3QJHA 5IJKC 3HZMB 2R1XB 3D5OF 5FM8A 2X4NB 2X89A 5DHVA 5KAQF 4J6RL 3NFNA 5DJ0B 5CZVL 3PHSA 1A3QA 4G43B 3QG6B 1UH3A 4OCYH 4M5YL 4Y5VC 3BKCH 3P4NA 2FZ3A 3BSZH 1AHWB 1GC1L 1ZGLM 3ESUF 5I1KH 2ITCA 4X6CB 1RUKL 1FFOB 4P2OD 3SY0A 4GSDH 4X5XA 3HG1E 5TGBA 3ORJA 1S9XA 4PRDB 3LVEA 1IZKA 1EGJH 2W9DH 4X7DC 3V8OA 1Q9WA 3B83A 1IC4H 4H88H 2E7BA 3WJLA 4UNUA 1IM9B 3ULUH 3F62A 3AM8A 3PL6A 5D1XC 3B9KC 5GRYA 5IMLA 3D0LA 3FMGL 3BPLB 4RGMC 3SCMB 4WEBL 1JYWA 3K8LA 2Q20A 3B3IA 4HLZH 2QHRH 3ARUA 2F19H 4M3JA 5GGVY 2Z8SA 3T2NL 2O5YL 3MUHL 1DVFC 1AO7A 4WEUD 2DWEA 3HR5B 4J3TA 3QPQC 4J4PC 5D8JH 5EFIA 5C0AD 1IC7L 2N1KA 1JUFB 2C3HA 2WBJD 1A1OB 1INDL 2NY4C 4P9HL 4IRJD 4PFEA 1IEBA 3QUXB 3W9EA 1RVFL 3RPKA 1CXKA 1JF6A 4FQCH 3FOMB 4PJAF 5IQ9A 2ATKB 2JJWA 3S36H 1HQ4B 2DYPB 1AGFB 1U8PB 2CSPA 5D93B 1CFQA 3PDGA 2X89D 3HTLX 4HEPG 4ZUWA 1IEAB 3K8MA 4ORZC 3VWJD 2VLMD 1XGYL 2YKLL 3GUTA 4GG6F 1S7WA 2BNUA 3Q3GA 1MFBL 5I1GL 3O41A 2XRAL 5JPMB 1MUJB 2F5AL 5IQ7L 1FVDB 3X12B 2W65A 3KPNB 1U0QA 1WT5C 3TFKD 1IL1B 1DUZB 2B2XH 1OAYH 2AK1H 1KCKA 2HT3C 3VI4E 1U92B 1RJZA 5KN5B 1CVSC 3NZHH 4P3CH 4PRHA 3LS5H 2FSEA 5J13C 1CXLA 1SY6H 3T0AA 4JM2C 5C2BH 3PL6D 2EE2A 2KUTA 3IDGB 3QFJA 4YO0B 1UT9A 5DRWA 4U1GC 1H3PL 1UM5H 2DQGL 5TDPA 4ZAKA 1SBSH 1VKXA 3TO4B 1QFUL 5IR1A 4CVZB 1FVEB 3L5XH 1AR2A 1AO7D 3G9AB 4MZ3A 4OCYL 3SQOL 2VZTA 1FFPB 2XV6B 4XP1H 4GRWH 2X4TB 5HPMA 2UWEB 2UY7A 3DUSA 1NL0L 5DTFA 2R0LL 1SJEB 1DQQB 3T0EE 1UKTA 1KTDB 1UJTA 1VESA 2FDBP 4GSDL 4K3JH 1UWXH 2DQUL 1MWAA 3FCTA 3HC0A 4RGNE 3CPLA 4G8FB 3VH8B 5CIPB 1U8KB 3RBSA 3QISA 1FGNH 3FHQA 5CIPH 4FTVB 5C0BD 4OLYH 3ULUL 3RX8A 5L88H 4QRTA 5DGRA 4AT6A 3UROR 1SMOA 2OS7A 3C8HA 5BOPA 4JZJB 4YR6B 3NIGF 4PRNA 3BHBA 5EZJB 4HS3A 5DC9B 1MCQA 4NO0B 4FQLH 1UWGH 3B4NA 4RWHA 1J9CT 1D9KC 5HI4C 1CD0A 4CDHA 2A6KA 3EYOA 2CLZB 4U3XA 4HKBB 3KPMA 2EEAA 3DIFA 1UEMA 1VFOA 4P48A 5D8JL 5DEZA 1S78D 2HRLA 3VA6A 3HN3A 2RIKA 4E41B 2HRPH 1FFRA 4PRHD 1KTKE 5EOQH 1CFNA 2FJGB 5CGTA 32C2B 4X6BB 4PRIB 2BFVH 3HE6A 4FQCL 3P0YH 3QFJD 3DETD 1D5BA 2BX5A 3VD5A 2VH5L 1C5BH 3QCUH 1F4WL 2XPGB 1WFOA 4OZIF 1F3RB 3VG9B 3QZWA 3MNZB 4AJ0A 1F6FB 4HUXA 4D9RD 4Q6YA 1I3VA 4MD5A 5IGXH 1QSEB 4QRUB 2UVFA 3VU2A 4OM1L 3GBLA 1KBGH 3HUJB 5HGBA 3GMMB 5C3TA 3EYQD 3CFJB 5E56A 1C16B 4NNYB 3PHOA 1FG9C 4HX1A 5JW4R 1LO0H 2YPLE 3EYFB 4GLRI 4HK3J 4YHYB 1RZJH 2B2XL 1WSST 1OAYL 3RZCD 5IFJA 2AK1L 1WC7A 4DKEH 3QHFL 3WYRA 3NZHL 3QDGB 4HWNA 2V7NB 3BJ91 4P3CL 1F90H 1H3UA 1QSFB 4GMSH 2D7NA 2B39A 3GI8H 1SY6L 4S1RL 2ZCHL 5C2BL 5IVOA 2Y23A 1GGIH 4Z7OE 1P1ZA 1S7XA 4F3FB 1A3RH 2QQLL 5E6IA 3MRGA 5LAXB 5JO5A 4BK4A 1T0NB 3AREC 5GGUB 4ELMB 3DSFH 1GRWA 4QTIH 4UDTA 4XP1L 3ZLQC 3MV8B 4DCQB 3CFKB 4YHOH 2GSGA 4QLRA 4YPGA 4Y5YA 4NQEB 1A7BA 4PTTB 3QUYB 1QHOA 3VXRA 5J11B 5I76B 1PYWA 1A7QH 1UXWA 3GSUA 5AUMA 1UB5A 4K3JL 2DLEA 1XF5A 1XF2B 1M4KA 2NY1D 2WINA 1JHLH 4L9DA 3OKEB 3IAQA 4P9ML 3DVNA 5FYKD 5JW5A 5J3HC 3MLSL 1RAMA 5E9DE 1R3KA 1WFUA 4M9PA 4HWEH 5IW3A 3F58H 3WO4C 1JWMB 4K3GA 1CLYH 4Z7WE 1OGTB 4OZGF 4X5LA 2VABB 1OAXH 4FQLL 4Y5VB 2ERJB 4TNWK 2A74A 3B5GA 3MRRA 3QI9B 4Z8FH 1IMHC 2F54E 5INDA 1OW0A 1AY1H 5HSFA 3FB6A 1SBBA 1A2YA 3OR7B 1G0XA 2NY6D 3K80A 2XQYK 4ETYA 5EULV 4NO3A 5EOQL 3FB5A 2YD4A 2BY2A 4PJXA 1HXYB 2BFVL 3V5KB 1JP5A 2R0WL 4YXLH 3MFFA 5GJSH 2WQ8A 3B9KB 5C07B 3QCUL 3VD3A 1M7IA 2ATPA 1IGYA 3VWKC 5I1HH 1DQDH 1VSCA 4ZS6D 3PGFH 3ES6A 3LY6A 5FK9A 5B8CA 5D7LE 1L7TL 1S7UA 1F13A 4LF3B 4LCCC 3T04D 3R8QA 2AJVL 4NPYA 4YUEH 2XQBH 4HPOH 2EDOA 5HXMA 3QNYA 1K4DA 3TCXA 1L9NA 5K9QI 4FZ8L 4TSCH 5FKPA 1HQRB 5D6DC 3TBTA 3VXRD 3D85A 1MCIA 4Y5XB 3QQ3A 5DVNA 3KPQB 3ARGB 4MX7B 4DKEL 1AQDA 3TZVB 1PG7X 1KELH 4JR9L 5HYFA 4JFQB 5E2VL 3DTXA 2R4RH 5GRVL 5H94B 5DQJA 4R4BB 5KAQG 2DQFB 4LSTL 1B4JH 5JDSA 4XBPB 4P46A 1I9RH 2DQDH 2EH7L 3KPSD 1GGIL 3PWPD 3L3GB 2XI9A 3HZKB 1L7IL 4N9GB 1EAPA 3QRFM 5KS9F 4S1SH 4KUZH 4OLVH 1YMME 3D87B 5E9DA 5J12C 4V1DD 1B0GB 4RGOH 3DSFL 5C0RH 3HI1A 4Z7WA 4R7NB 4IMLB 2ICWI 4QTIL 4AEHL 3QXTA 4H20L 1VACB 2GTZB 4RNRB 5DJYA 3SKNB 4UQ2A 4JG1H 3K3QA 3QNXA 3MUGB 1MPAL 3EDDA 1R3IH 2HH0H 4K7PH 4WHCA 3T1FB 4P49A 2F54A 5EPMB 1BM3H 1MCWM 2NX5B 4WHDA 3O6LH 2HMID 3QPXH 3HR6A 4KKLD 5C0CB 3NA4A 2DRUA 3QUKA 4JM2B 1TZIA 1KN4H 1JHLL 1H3GA 1LK2B 4PRAB 3CFEA 1BQHA 4CJ0A 4HBQA 4NBYB 5EU4A 3RWFA 4PJCF 5I74B 1T20A 4CMMA 5CEXB 2NY0B 3VXUD 3W11C 1ETZB 3TEUA 4WHTA 3F58L 3ZKSD 3EZJB 5F1NA 4U6VH 4DOHB 1A6TB 3W0WE 4G9FE 1W72B 1OAXL 5FO9A 1W72H 1N4XL 2XWBB 3ZHKA 4Z8FL 1A6ZB 2ZSWB 5DO2C 5GGTA 2EDEA 1R5VA 1AY1L 1P84J 4I4WB 1YZZA 1F11A 4P5TB 3IDMA 1G7MB 1YYMH 3RA7H 1MY7A 3GRWH 4I0PA 4GUPA 4WTZA 2H2PD 3ME0A 1DL7H 3AROA 3AAZB 4P46D 4YHNB 2VUYA 1QO3A 4P2RD 5BW7A 4ENED 1BOGB 3MRQA 2R23A 4WWKA 4ZPVA 4D0BB 5I1HL 4XNQB 3B2UD 3TNMA 1DQDL 4K7FB 4G6AC 4GT7A 2Q87A 4M1DL 4K2UL 2MKLC 4YUEL 2I9TA 2Z91A 2KBGA 2IPUK 1UVQB 1GHFL 2MKWA 1NLBH 2MHAA 4HD9A 1NGZA 1PZ5A 4EN3C 5FEBA 4TSCL 3FO2B 1ZGLB 4ZXBC 5C1MB 3WS6C 2AGJH 3O8XA 3X13A 4DWHA 3MYJA 1A9BB 1H8NA 5DHXB 4OZFA 3A0OA 4EI5A 4MHHI 3CSPA 3CMOL 1KELL 3BUTA 2PO6A 5GS1A 2GJ6A 3VRJB 1A7RL 1J05A 1INQB 1QVOB 1CS6A 4ZFZA 5IBLD 1LE9A 1A21A 3P4OA 3I85A 1W0WA 3I02A 3MCKA 1MAML 4I8DA 1JBJA 5ELIA 2DQDL 5HGDB 3BP4A 3AB0C 2PTTB 1RJCA 1DLFH 2L4OA 4BSWB 4WV1C 1YUHA 1U42A 3IGAB 4KUZL 4OLVL 4S1SL 1YNTB 5BCAA 4C59B 4RGOL 4PJFF 1YEHL 4JY4A 3W0WA 3U1SH 1LNUB 1EERB 5LG1A 4BQBA 5DMKB 1ZANH 2B4CC 3C6LB 2R0ZL 3MRLB 5SX4I 4B53A 3L9RA 3KXFE 3CLFH 4U1LB 3VXSA 4K7PL 1NFDF 3ARBB 3LZFL 3CC5A 1BM3L 2JB5H 3O6LL 1QR4A 2CDEB 2Z31A 3RVUC 4I0PD 2XWJB 1NMBL 3QPXL 2CJUH 3GMNB 5E8EA 1KN4L 3DO7B 3K81A 2MQCA 1D5XB 4L4TE 3BRFA 1BMGA 4WTXA 3FFCD 4JFDD 3BKYH 3EO0A 4TVPD 5INCA 1TNMA 1XH3B 4EZMA 1A1NA 1FFQA 2Z93A 3KDMA 3AREB 4XPBL 3ESVF 1MFCH 3V0WL 5KSAD 1HIML 5K59F 4MZ2A 4MWFA 3EOAA 1AGEB 2DMKA 3S37L 1W72L 1D3CA 4YHIB 5ANME 5BRZE 4XC3H 4LIQL 3O8XD 3S98A 1CLOH 2NY7H 5ENWA 3PWLB 4XRCA 4P23C 2ZUTA 4EI5D 5IVXE 2C26A 3P73B 2OCFD 2PO6D 1G7IA 3C60C 5JHDE 3BWUC 4XTRD 1I3RA 4BUHA 4JPIA 4XVSL 1OAKH 3RA7L 3GRWL 1ZK9A 4Q9BA 4OCXH 3T4YA 3QCVL 2P24B 2BOBB 4U7SA 1BBJB 4K3HA 1CLZL 5EUKB 4P2QB 2JKXA 1FBIL 3WO4B 1E4KC 3JVGC 4N8CH 1CL7H 2Z35A 4FXKA 3LV3B 2WMPA 4JE4B 4HS8H 1OGAB 5JW4M 1X7QA 4N9OB 2AERT 5DD1H 4RRPA 1U95A 4DK3A 4KHTH 4PUBH 1DEEB 3WIIH 3VXSD 1G0DA 2NXYD 4WW1A 1KPVA 3BAEH 4M3KB 3WFBH 3STBA 2FIKA 3AY4A 2XG4A 4JKLA 4MJIA 3WKMH 5FGBA 1HXMB 2HLAB 4YBLB 3EGSA 3KXFA 4DN4L 5F6HI 3P0GB 3TA3A 43C9A 2HAZA 3L6FB 3X3GL 3MGOA 3RGVA 4LEOB 1EPFA 3O3AA 5HYEA 4HV8A 5IHBA 4G6JH 5B38B 2CRMA 4XPAH 1LEIA 4IRSC 3WHXA 1U9KA 3DXAE 3TWCH 3TBYA 2ADJB 5BJTB 1DLFL 1A7NH 1S8DB 3KGRA 3QIWC 5DGQA 1HILB 5JXEA 1EK3A 1YPZA 5CKAA 2DN7A 2QQKL 3O11B 4KRPB 4D0CA 1H15B 4BH7B 2IQ9H 2PF6A 1ZANL 4KGLA 4PJBB 5DJ8A 5FGSA 5GGRA 4PLNC 1WWAX 4XMLH 3NN8A 4TUOB 4GRLC 3RBGA 1QP1A 4L9LB 3ULVD 3MV01 5F89A 2MQ3A 2XA3A 4Y4HC 3R0MA 3T0VA 2X4SB 3E6HA 3VFNA 3H3PL 4L4JA 3D2UB 5C0IB 5DURD 3VGFA 3ILPB 3BKYL 3OJDB 3FQTA 3ZKQD 1QEWA 2XN9B 3B8YA 1HEZB 4NZRH 1OTSC 5DXWA 2DBJA 3QXVA 1U2CA 3UYPA 2NY2D 3OKDA 4K9EC 3ZO0A 2OMBA 4P4RA 5JPNA 5IV2A 3MPCA 2P5WE 4KJWC 3T0BA 1V3LA 3FAXA 5I1IL 1NLDH 5K9KA 1E4WL 5SX5K 5HHPB 3GBMH 2GSIA 1DBAH 1R5WA 2H9GA 4X4ME 2AABL 5I8KH 3SKOA 4DVRL 4F15C 3OQ3B 2CIKA 3TH3T 1KB5B 3IU3A 5DMGD 4KROB 1I7UB 1X4YA 2J8HA 1JGVH 1HHIA 1AD0B 5HD8D 1UJ3C 2R1YA 3MV9D 4HIEA 3GSWB 1HOCA 4P5MA 4NP4H 5HDOA 4KJYB 5IEHA 4MJ6A 3U4EA 3B2VL 3CNKA 4LVOC 5EO9B 5I1DA 4DUVA 3BH9A 4YHKH 4IOIB 5D7IB 3IF1A 3Q2CA 4N8CL 1U91A 4OM0H 5DDHA 4CKVX 5JXED 2VZ1A 5AD0B 4KK9D 2X7LB 4HCRH 3OG6B 4Y16C 4TUJA 3O3UN 4QYOA 5HI3C 5GS0C 5ADPH 5FAAA 5ESVB 4WY7H 3QQ4A 1YDPA 3VI4F 1BLNA 3NIFE 4NRYA 4PUBL 1KXQE 4UQ3B 3WIIL 1F6LL 4HBCL 2IH3B 2FBOJ 3BD5A 3VDAA 4FQHB 3MRKA 4HIJA 1KNOA 5ACZB 1IGTB 4Y8AA 3MOBH 5D6CA 4LPTA 4RAVA 4WNQA 1FLRL 5BZDB 4XP5L 2GI7A 1TPXC 2H32H 5KSBE 1U8LB 5IFAH 3VFRA 4QGYA 3QDJE 3RWJB 4QWWD 4IHOB 3O6FD 2ZCKH 1WK0A 2L0DA 3ZSSA 2X4UA 4QRPD 1T1ZA 5CSZA 1RZGA 2GY7B 4OF0A 3TWCL 3L7FA 1KACB 2BHZA 5C8JB 1A7NL 4Y1AE 5FO8B 2E9WA 4W4NA 1BFSA 4HKXA 3N9GH 2APFA 2IANB 4JFPA 4EN3B 1RFDH 1P4LA 5F9DC 4TVPH 1MLCA 4K8RD 4ZXBB 1N3NB 5E5UB 3PQYB 1X5GA 1LO4L 4XMLL 2ZOKB 2LAAA 3PIQA 3SEPA 3C5JA 1WWCA 1X5KA 4Z9KB 4Y4KB 2Y36H 2OZ4L 3SBWC 3UP1A 4HFWA 4C57C 1NANI 5F88B 4DJMA 1VERA 2DM2A 4YHLH 4Z76A 1YN7A 4HHAB 3PGCB 2V2XA 3F7RA 4ZUSA 2VQ1A 3FQUA 4XCYA 2FHBA 3O2DH 5DI8B 1WBYA 5C0JA 1MCRA 4NDMB 4WV1B 2YRLA 2K3TA 4FFWC 4BKLB 1YEEL 3TGXA 4PJDB 2BNRA 2XZAH 3LRSA 3J7HA 4UTBH 4DAGH 4PJAB 3H3KA 4LLUA 5JUEH 4GW4A 3GSOB 5IW6A 5J6HA 1Q9LB 5BV7B 3GBML 4RIRB 1DBAL 4KVNH 1U8HA 3U9UB 1D7FA 5I8KL 5EU5A 1GOFA 5F3HB 2YC1A 1YEFL 3GGWB 2CRIA 1DQML 3L3OB 2ICES 1ZT7B 1WBXB 3OKLA 2NZ9D 1J87A 2FGZA 3QXDB 3ARZA 3KPRD 5EIIB 5GXBB 2ITDA 3WE6B 3WFDH 1MRFH 4U6YB 5KSBA 4ONHA 3TT3L 2A6JB 1M05B 2BDNL 3MJ9A 5TF1H 1DBJL 5I17B 2YS4A 1KOAA 2OL3A 3HZYA 4IJ3C 2QADD 4OM0L 1JN6A 2FWOB 2FGWH 2PYEB 5H35B 3BPOC 4HCRL 3V79C 5EO0B 1YQVL 4X99B 4CW1B 5B39A 4WY7L 1U2HA 4OD2B 1JPTH 5A16A 8CGTA 1UWXK 3L3KB 4LOUC 1AKJA 5MHSD 5KOVC 2NY3B 1L6XA 4WFHE 1BFOB 1HHHB 4HULB 4JFOB 2FEDC 2J3SA 5H2BB 3JUZA 4JAMB 3ZDYE 4Z7OF 1E28B 1ZS8B 5IFAL 4AENB 1F8TH 3BZFB 3ZE1E 1S7TB 3S35X 3LD8C 3ULVH 3BP6B 2DOCA 2YA0A 1P5UA 2DQIH 2BNRD 3CH1B 4LSRH 1KPRB 2HJKB 1XZ0A 3T8XA 3RIAK 5EOCJ 2CUMA 4KJQD 5CEZH 5I71B 3W39B 1YC7A 3R1GH 4LAQL 1RFDL 1VGKA 1OP9A 4HIIB 1RSFA 1ND0B 3UTOA 5IMKA 1RZJC 1F2XK 1XGRB 4LL9A 5I8EB 5D1ZB 5F9WB 1W8OA 4ODTH 1N64L 1V3KA 2YZ1A 2Y36L 4R4ND 5E1AB 5L9DH 4UMGA 1T03L 5I1CH 2Q8BH 3VXME 4OCNC 1KCRL 3QEQB 5ILTH 4JRYE 4P2OC 4Z7WF 4X5WA 2H41A 1TETL 2JJSC 2Z92B 1XAUA 1CWVA 3LDBB 3O3BB 3ZE0E 2BERA 1LP9A 3WHE0 3QIWB 4PG9B 3BI9X 5L0QB 1RZ7L 3UO1H 5SV3A 3MO1A 4QXWA 4X4XA 4DAGL 3LHPL 1K3ZA 5IB4A 3JWOH 1UG9A 1AKJD 2XZZA 4ZDHB 1KIUA 1FN4B 5FYLL 3QR2A 2P5EE 4KVNL 4OFPA 4N90D 5BV7L 4YGVB 5GRVK 3GJFH 5GGSB 1BP3B 1FYTD 1T04A 2HFFA 1U8QB 4QY8B 1XIWA 3OXRB 3LIZL 2NY5L 5DQ9A 1DBKL 2C1PA 4HW6A 4NWUL 1NUFA 3HE7B 2WBJC 5HVHC 3P40A 4L29B 3S5LA 2FO4B 2IQAA 3T77B 4I18A 4IRJC 1LD9A 3VFSA 4YC2B 3LKOA 1A6AA 1LQSR 4YDLC 2YUXA 3O9WA 1H3WM 1Q9OA 2VERN 5FFLA 2UZXB 3ARTA 4J3SA 4NQDD 3UAJD 2ARJA 2DTMH 2FLRT 3BKJL 3KNBA 4MAYD 1U3HA 2YN5A 3QIUB 5ITFB 5JIPA 2K7QA 2HKFH 3G5ZB 3VWJC 4NZDA 1A5FL 1ZHNA 2EKSA 4N5ED 2AEIT 4OFVA 4MA8H 5FECB 1UWEL 2R1WB 5FA3B 3SDCB 3NA9H 2AJUL 2FATL 5DQDH 5DJXA 3U7YH 2Q76A 4M61B 3V52H 4N0UA 1ULVA 3WFHB 4M43H 4LEXH 3TFKC 3S4SA 4C4KT 4M48H 3GM0A 1FNGB 4U1MA 1SHMA 4HK0B 1YEJH 5KVGH 4N0RA 3VXMA 4IIQC 3SGEI 1A9EB 1F8TL 2DQCL 1EVTC 5CD3B 4JRXD 3GSVB 4YE4H 4KDTA 3PL6C 4J7RA 4LSRL 2BMKA 4R26H 4LBEA 4RFOH 1YN6B 3I6LE 3MZTA 3DX6A 4OD1L 1YEGH 3MRMA 5HVGB 2XKNB 3R1GL 2QLVB 4OLUH 3IU4H 1M7DA 2FJHA 2H26B 1I9EA 1XR8B 5D9SB 1T1YA 3MCLH 1DE4B 4K3DL 1II4E 1MQ8A 1SVZA 1NQBA 2ENYA 5IJVB 2BVQB 2ARJQ 1IRAY 4R96A 4OZGB 2EDKA 2K7PA 5L9DL 2IF7A 2VXUL 5I1CL 2Q8BL 1ZHLA 1MI5E 4G8GB 1YJDC 5MEPA 1X5JA 4X8JA 5I73B 3O9WD 5HTSA 2Q86A 4NT6A 4NRZB 1Z9MA 4R2GB 3L3IA 4OCRH 3FT3B 3ULSB 3GSNH 3ILQD 2F5BL 3SDDB 4A2MA 5DJ6B 1SJHA 3AXLA 4Z0BH 1U3HD 2X9YA 4LDLB 5ESQB 1KENH 4LSQH 4ODWA 3FRUA 4LHUG 3JWOL 4RMVA 4EDXA 3QUMH 5EO1A 4U49A 2VLRB 2DLTA 2GITA 1AD9B 2BP3A 2G2RB 1A22B 1KIQA 5F97E 3DX8B 4MXQC 1FC2D 1Q38A 4U6HA 5IG7B 4PJ7E 4A6YB 1S78C 5C9JA 1MVUA 4N8VG 3U9PL 3CFBA 4BZ2L 2XA8L 4HJGB 1EHLH 5D96B 1WBZA 5F7WC 3DETC 4N1CA 1NCAH 4PLJD 3DVGB 2A6IB 5DA4A 5DRXA 2F58L 5EZOL 2PUQT 2IBGA 4AQOA 4YZFE 2XXCB 5IB2B 4JO4L 5EIVA 2HKFL 2VDPH 1NJ9A 4X83A 4RA3A 3VI3E 4JKKA 1GPOH 4QCIA 5C9KA 1FNEA 1HDMA 2JIXB 3NA9L 5DQDL 3EYQC 3U7YL 3GM8A 3V52L 1LEGB 4M43L 2NW2B 3BZ4A 3CVIH 5ISZE 4JANA 2L7UA 3W9DA 3RZCC 4YDKL 1YEJL 5KVGL 1MNUH 2WZPD 5JQ6L 4WFEE 3RX7A 2WAHA 3MGTB 5F9OH 2QQNL 3NABH 4PRPD 4YE4L 5IF0A 4PJ9B 3IRZA 4D9QE 3BGMA 2CK0H 1F4XL 1S7VB 1OF2A 1D5ZA 2CKNA 3K74B 1YEGL 4B7LA 1DTUA 4OLUL 3IU4L 2DJ4A 3GMQB 3RHWK 1U8JB 1N8ZA 3MCLL 5BQ7B 2HWZL 5ETUA 3TM6A 1MCLA 3K4ZA 4PJCB 1K2DA 5F9JA 5GRUL 3CZFB 1CD1B 4IRZL 4MYWB 4RAUA 4PJGA 2QTEA 5DFVD 1C8PA 25C8H 5I15L 4G80A 1VFAB 3Q6FB 3QDMB 3V4PH 3HAEA 3SHSA 3LD8B 2PETA 4QHNA 4XCNB 4UBDD 2NY1C 4D94A 5T1KB 3BO8A 4XVUD 5ICXB 1ZLVK 4JJHA 4PRBA 2IALB 1ZHBA 2OQJB 5J57B 4CJ1A 2VZOA 1WZKA 3L5JA 1QRKA 2AKRA 3AMLA 3KLAA 3OTTA 5IVXF 5E99H 5E2TL 2XNAB 4X6EA 4PJEE 1B88A 3HB3D 4MDJB 2ICWA 2UVEA 1MH5A 3OAZH 1KUMA 3I84A 1B2WH 1RJLB 5M94B 2B1AH 2J5LC 3STZB 1KT2B 2Z8RA 3H9ZA 4OIBA 3TO2A 3QIBA 3U79A 1GL4B 4LHUD 2YD6A 2IPKA 3NOIA 2JB6B 1OHQA 1UZ6E 4A6YL 4L8CB 1VCAA 3VJ6B 4ZODA 1K6QH 1FO0H 2NY6C 2X1XR 3NIDE 1ZLWH 2I27N 5H37H 1KPUA 4LCUA 2NNAB 3DRQB 3TN0A 3IJYB 3OKMA 3MRIA 1EHLL 3V6FB 4PY8J 1KEMH 1RUPL 5EBLB 5BO1H 3O6MH 5F7EH 1IAKA 5SWZD 3ARFA 3VFUB 3FOLB 4Z7UA 3D3VB 4ZS6C 3IKKA 2YBRB 2C1OA 1Q0XL 2R2BB 3QEGH 4NO2A 2E27H 3H8NA 2CLVB 4OZHE 5HYIA 1MJ7L 4M6OL 1I7ZA 2G5BB 1IFHH 1WZLA 1CXIA 2X5PA 2ORBH 2WBJB 3V0AC 4K94H 1YECL 2ICEB 3P9LA 5IUSA 4IRJB 3S8WA 4OIAA 3HNVL 2HJLA 5KANG 1NSNH 1MNUL 1JF1B 2XTJD 1UEYA 3KYMB 4Q2ZA 1F58H 4FQXB 1NFIB 4NUGH 4X7TB 3NABL 3REVB 1SYVA 3QJHB 2KDGA 1H5BA 3MX0A 2MTPA 2FEEI 5DHVB 1XCTA 2SEBB 3M8OH 3UDWC 2CUIA 1EFXA 1TVBB 3RIFK 3T0ED 5IKCA 4E41E 3BYTA 1JWUA 2FZ3B 3P4NB 4LPYA 2A9NH 3LPGA 4PRIE 3V8CA 3RX5A 2ITCB 4PJEA 3TVMA 3ZT7A 3SY0B 4OLWH 3FL7A 3T3ME 5GIRB 1S9XB 5D5ME 2CLRA 4P4KA 5SWQA 4G7YH 3EDFA 2EXYD 4PGEA 1Q9WB 4OLEA