4MAYD

Crystal structure of an immune complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
262
structure length
255
Chain Sequence
QLVHFVRDFAQLGGAGVSQTPSNKVTEKGKYVELRCDPISGHTALYWYRQSLGQGPEFLIYFQGTGAADDSGLPNDRFFAVRPEGSVSTLKIQRTERGDSAVYLCATSALGDTQYFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYSLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crossreactivity of a human autoimmune TCR is dominated by a single TCR loop.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MHC class II HLA-DQ-alpha chain
total genus 56
structure length 255
sequence length 262
ec nomenclature
pdb deposition date 2013-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mayD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mayD02
2R56H 5HGGS 3RA7L 3IGAB 4E41E 1MHEA 4NO5B 2OJEA 4M5YL 5KSAC 1GGYA 3WNOA 5SWZE 5C3LD 3MYJB 2Y5TB 1MI5D 1AIFB 4XI5D 1LNUA 4X5WB 2F53A 2JCCE 4RFOL 2DTML 1UACL 4NJ9L 2WINA 5A3ID 2AXJA 3ZE0E 4P5TA 4U6TA 1A5FL 1QFOA 3BWAB 1A6TA 3KYOB 1AGEA 5GJTL 1PSKL 1MCKA 2H8PB 2MHAA 2YRLA 3WNMA 3L3OA 1CGXA 1MFAH 3NCJL 4NKMB 5D72H 3ZKXB 1AD0A 2FJFB 3S35L 5FHBL 1MFBH 5JR1L 1P69B 3ETBF 4LFHD 3GBNH 2B0SH 5LGKA 3QPQD 1UWGH 1MRCL 3VGAC 1ORQB 1NGWA 1ZLWK 5EIIB 5LGJB 3DVGB 2GT9B 2ADGA 4XC1H 2HWZL 5JMRA 1SM3H 4NQDB 1IKNA 2BOCA 2VLME 4GQPH 2NXZC 2XWTB 4WGWB 1DBAH 4R4BA 2MJWA 1T21A 4JKKA 2EO1A 3FKUS 4MXWL 5FYJU 3WFDL 5EUOA 4RMSA 4B50A 3C5JA 1YEEH 4K3JL 4PJ9D 4UTBH 1LEIA 5IT2H 3SCMC 1VKXB 5IW6B 4H26A 1VFAB 2ZUUA 3HE7C 2JJSA 5DFVD 4CN1A 1V3LA 2M1KA 5D1QA 4F37F 4XNQB 2YD7A 1EO8L 3S36X 4PJGE 2V5SA 5D2NC 2ZCKH 3QULB 1K8IA 5IHUH 1UM5L 5D7LD 1MWAA 2CLVB 4PBVC 4V2BA 5IV2B 4Y4KC 2PO6B 2BVOB 4ZS6C 3IDUA 2FNBA 3HRZA 1W72B 1K2DA 1NCCL 2ZUVA 1K3IA 1VFUA 3GFUA 3VFTB 3DROB 3PL6A 3TBSA 5HDBE 5FYJL 4ORZC 1XF4B 2Q7YA 2VE6B 2YHGA 4JQVC 5I76B 3FB8B 3MGOB 3VWKA 3MYZA 5KS9F 5E08H 1OGAD 3BKML 3Q3GA 1OAXL 4YGAB 2E7MA 2XYCA 4P46C 4GMTH 2YA2A 3QDHA 4OCMC 1VPOL 3PG2A 3VMPA 3W9EA 4MA3B 1AO7D 3QXUA 4L8DA 4TTDC 1FZJB 5J1TC 1T1WA 1ZT7B 3U36B 1FG9C 3LSOB 4M48H 2Q6WB 3LEXA 4H5SB 2ZNXA 4FQIL 4PV8A 4MVBC 4XAKE 3O8XA 3MV9D 4HUWA 3IDMB 4CRPA 5D7LB 2V17L 3TVMD 2YD8A 4IDJH 1T04A 1RHHB 3OR7B 4HT1H 5BOZG 2Z31C 3CFKA 4KZDL 1CIUA 3GSOB 1S7WA 3BGFB 4YHIA 4R4BB 3O4LB 4QOKA 1D6VH 3OXRB 2ZWLT 2WNGA 1D5XB 4YWGH 3BT2L 4D0DA 4NN6C 5C6WH 3SCMD 2O61B 2XKSA 1D7FA 4LLWA 3MROA 1VKXA 1OGAB 1U42A 2A83A 3R0MA 5DWUH 1F58L 4YHMH 3TYGL 1JF1A 2J6EA 3PWPD 5JW3H 5H37G 4DKEH 4P9MH 5CP7B 4HUKB 1YEJL 2BCKA 4PRIB 1G6RA 1DQDL 1T1YA 3M1BB 1QTYT 4URTB 4Z5RB 3IFPA 4MWFA 3S88L 2FX9L 4IBLT 4PBWD 1T4KB 5F8RC 1MELA 4M8QA 4GRWB 3LHPH 4FFVD 3P9MB 5MENE 1A14L 3A67H 4P2RE 3BQUC 3ARUA 4K71C 35C8H 3CPLB 1LD9B 1Z9LA 4DKFL 1T0NB 4AH2B 3C5ZD 4NO5A 3RVXC 1DVFB 3RBGA 3GBML 4X4YB 5E8EB 1U8KA 1NSNH 3BE1H 1G9MH 2J5LC 4OD1L 1OGAA 1FP5A 3C9NB 1I8MB 3WDJA 4NGHH 4FXLA 4G42B 3QP3A 4W68A 3CSBA 3MCLH 3MGTB 4HEPG 1P9MC 2NW3B 4U7MA 4U7KA 2DTMH 3BVNA 1KC5H 3EJZC 5E5UB 2VLLA 2IQ9H 3MCG1 3VI3F 1ZHKA 2BY1A 4B5EA 1QFUH 3BDBA 4P59H 2ZUXA 1Q9WB 4I5BB 2J4WH 3FQRB 3PL6C 2LVCA 5IJVB 1HE7A 4NRZA 4KPHL 4IRJC 3BJ91 3ESVF 1KPVB 4YBLB 1JWMA 5F7EL 1RIUL 1S9KC 4EBQL 2EIZA 5SWZD 2L0DA 4PGEA 3EO0A 3ZHKA 1RULL 5HI3D 1H5BA 2DDQH 1OAQL 3GSRA 5CILH 2R39A 2FCBA 3H7LA 3MLVH 3P40A 5CGYC 3G5ZA 3A6OA 4C56E 4DQOL 3O9WC 2G75B 3A6BL 5DI8B 2VLJD 3F7PC 3HI6L 1MHHB 3JV4A 5LWYL 5EUKB 2FH8A 5FYLE 2ICWA 4Y2DB 4DOHE 2MCPL 1ACYL 2Y4SA 4I0PC 5ABDE 3CH1A 2A74A 5JW4N 2GY7B 4XPHH 3MFGB 3QISA 1MHPL 4ZAKA 3RY4A 3JV6B 1BAFH 2Z31A 4WHYG 1HXMB 5E2UH 4QTHB 4TOYL 3QUYD 5GJSL 5ELIA 3MNVA 3WL9B 1BIIB 1XGQB 25C8H 2IMNA 4NSKA 3F7VA 1JYWA 1AP2A 2DQCL 2VKXA 4LIQE 2Z91A 3FRUB 1N59B 2FBJL 1EZVX 3VGBA 2V6HA 5BV7C 1IGJB 3QG7H 2XTJB 3C09C 3BW9B 3AM8C 1CLOH 1O7SA 4OF5A 3E0GA 1TVHA 2NY2C 3WS3B 5C7XL 3Q0HA 4KK5D 5EG6C 4I3RH 2W59A 5JQHC 3RAJL 4XNXL 5KTEH 1OSZA 2Z8VC 2H6PA 3O0RH 4JJ5A 5LAXB 1OW0A 3AVEA 1HN1A 4XBPB 4I0KA 5L6YL 5DJAA 1QA9B 1OGAE 2VB5A 1KEML 2FGWH 2M26A 2W07A 2QHRL 4FTVE 3WUWA 4ODVL 3K74B 1WT5A 4H8WL 5KOVC 1LMKA 5FIEA 1GOFA 3T4YB 3ECBB 4P5MA 5F7KC 4MD4B 3VDCA 1IC4L 3S3SA 3T2QA 2COQA 4RA0C 2G5RA 4G5ZL 2EKJA 1ZWIB 5HHQA 3X3GL 4BZYA 3K2UL 3QUMH 4H5SA 4LCUB 4XC1L 3OKDB 5D1XB 4KK8C 1R3IH 4G9FB 1DLFL 2IH3B 4QRRA 1OL0A 1IGIL 2CKBA 4NYLB 2ATKB 2YRPA 3I50H 3UO1H 4ZFZA 3U83A 2OMBA 3TJHC 2H2SD 3R8BB 3MRFB 5B38A 4N5UA 3T1FB 1AGBA 4PJXE 5CIPB 5I1DA 4XP6H 1G0DA 5JOPD 1JPTL 1G7JA 2F54E 4JE4B 4LCYB 4AM0B 2ZSVA 4P2QA 5KS9E 2ZCLH 1UACH 3CVHA 2EEAA 4NJ9H 3I85A 4K8RL 5F1KC 1LE9B 1GGBL 2MMXA 3QYCA 1FIGH 4JZNA 3VXME 3BIBX 3MBEC 2UYLB 5EORH 1DP0A 4QCIA 5F7YC 1O0VA 5GS1B 1AFVL 5DS8B 1XIWA 3RIAK 3DIFA 2W60A 4XH2A 4LSTL 4MA1B 2W9LA 3MROB 2OL3A 1TJIL 5DLML 1VACA 5FK9A 5DMYA 2AGJH 4GLRI 2FHBA 2VDLH 5EIQA 4JB9H 2Y6SC 4LCIL 1GJIA 1NEUA 3I75A 3QWOA 4P48A 3VWJD 2YPLA 3GB7A 1H9VA 3DI2B 5C0ND 1ZOXA 4P57B 3WN5C 4AMKL 5IFJA 1I1FA 1MCDA 4OZHE 3ZO0A 2UWEE 4KTDH 3NFSL 4S2SA 1QBMH 5CBAB 4MXWH 2R0ZL 5F1IB 1P1ZA 1PLGL 2VXUH 3F7YA 4KRPC 4ENEC 3MACH 3QT2A 2X4RB 4R2GB 3NCEB 4UQ3B 5IW6A 3HCVB 1DFBL 1AI1L 4HBCL 3BQUD 4OFDA 4Z7VB 3ULVL 4R4NC 1OY3B 3MGTA 1A9BB 1I3RA 4IRSD 4K9EC 2D0FA 1UEYA 3HNTL 4L8DB 1BM3H 1JZ6A 5C0EA 4AQOA 4WGVB 4PLOB 4PRIE 2QTEA 2YC1A 4GRMB 1KCVH 2CRZA 4RGNC 2X89D 4DQOH 4ZPVA 4JGJA 2YPKB 1GGTA 5I16A 1G9MC 1ZV5A 2UWEF 2VWEC 2JB5H 1NBZB 4R0LC 4P2RB 3E6FA 2V9TA 5J8OA 1DN2A 3GK8H 1LO4L 4KKAD 1GC1H 4PJ5A 1E6JH 5CMAA 3T0AA 4ZUWB 3QPXH 3VCLB 3S88H 1OWRM 2I60L 4IJ3C 1KIPA 3KYMA 4MYWB 3WL9A 4J8RB 3TVMC 5GGQL 5KVGH 3CNKA 3F8UB 3G5XA 2WWMD 3GSNL 2A0LC 4UTAL 4O02L 5IBTL 2O5ZL 5CLTA 5TF1L 5AZEH 5I18L 2GJ6D 1RZFL 2X10A 3SJVE 2BNQB 4YDIH 3MRCB 1N0LA 1ZHNB 3QHZL 1UZ8B 5I1EL 2ICWB 4NKIL 4BM7A 1NGQH 4OV5A 1KPUB 4NO0B 1JVKA 1KN4H 4XAWL 2W0LA 3FJTA 1H0DB 1FCGA 3MNWB 1A6TB 4QKXB 3MJ8B 2R69L 5CEXB 4I3RL 4ONHA 3VD5A 5C0JA 4NC1C 2HT2C 4J6RH 1A64A 1MCRA 1CF8H 5GRYA 4PIRF 5BVPL 2CK0L 1R24B 1XIWC 1KG0A 4NQCB 4XNMA 5T1DH 4PJGB 5GQBA 2D2OA 1YECL 1KCUH 4ELKA 1DQMH 4BK5A 3HAEB 1VEMA 5J9PA 5IBUB 4ZNEA 3OB0H 4KK6C 3OZ9H 2K9UA 1G7IB 2WLYA 3TZVC 1JK8B 3LEYH 3IS0X 4QTIL 3KPRE 2DQIL 4BFIA 2CIKA 3DRQA 4CU8A 3WFZA 1G7MA 1HHHB 1RUAL 3O6LH 3QO1B 4OIIL 4RAHA 1NANI 3HI6H 3SBWA 2R4SH 3NABH 3JVGA 3PGDB 4Q7DA 5EOCH 3RWIA 3W5NA 3OG6B 5E94B 2P43B 5GGSY 2P5WD 4KJWC 4YUEL 3RQ3A 3SDXB 1P4IL 3EOBA 3MMEA 3MRJB 4JO2H 4X98B 1VFAA 4HH9A 5HPOA 5BRZB 3QFDA 4RAUA 4D94A 1DUZA 1X3DA 5BVJA 1EA9C 4G7VH 3ZT7A 1PQZA 3OJVC 2RFXB 1FN4B 1T3FB 1AXSA 3HAEA 1FIGL 3LV3A 2IH3A 5F6HJ 2PCPB 5H8DA 4OM1L 1Y6KR 43CAB 5TQ0H 1U2CA 4XCCH 1RJLB 1DQLH 4H1LA 1QOKA 5ESQB 4L8CB 4LLYB 4I4WA 5JOPE 3EOAB 3T65B 2G2RA 1U91A 2HT2D 1CU4L 5IB2B 3LRGA 2X9WA 1QNZH 5IB1A 1PSKH 4UT7L 3V8OA 4EEEA 5I8OL 1NC4B 1U8OB 3RDTB 3HUJA 2X4PA 3AUVA 4LNRB 3O11A 1UXWA 2A2QT 4NNPL 1Q0XL 4JKLA 2YRZA 4XVUC 4YE4H 2X05A 3UTTB 3S34L 3Q6FB 1G7HB 2V2TA 5F70A 5EPMA 4OTXH 4D8PB 4WCYH 2GJ6B 1G7QB 4M7LH 1W0YT 5JOFA 2VQTA 1BBDH 3V0VB 2XA3A 1IVLA 2YBRB 4LVHC 1MJUH 1FO0L 3U0TB 2FYYB 4LPCA 4JCLA 3VGDA 1G9NC 2Y5EA 4WO4D 2A6KB 3NABL 3TH2T 5IJKC 2DMKA 1YJDC 3CMOL 1NFIB 1FGNH 1KJVB 2C7UB 2DQCH 3O3AA 5EUOE 3IXAA 1CXFA 4EN3D 2AJSH 4K94C 4HPOH 1CFVH 3C6LA 4LAQL 4K94H 3CDFA 4NIKB 1F6LL 5TDOB 5EN2A 4JQIH 1T5XA 3RVUC 3HG1A 3GHBL 4OZFH 5GXBB 4NJAH 3LD8C 5DJXB 3V6ZA 3U2SB 3V5DB 1LNUB 4X5WA 2Y6SD 2QR0A 1DLHA 5ID0A 3MCKA 2A83B 2ICES 4NN5B 3B9DA 4P4KA 5IMOA 4R9HA 4PJXA 4XNXH 4LHUD 4L3EA 1Y18B 4POZC 4HK3N 5FB8A 2VDKL 4PG2C 2WBWB 3C08H 1NGXB 2UZIH 4LRIA 1NDGB 5IK3A 1JGVL 3NFPA 4HUMB 4U1KA 3TPUA 1RZJC 4XCEA 2GHWB 3FT4A 1U8LB 2CRYA 3IDNB 4LLMB 4M62H 1K9TA 3VXSD 4OJFH 2W0FB 3KHOA 2Y9RT 4PJIF 4HX1A 4YDIL 1HQ4A 4NUJB 2HKFL 1D3CA 5BW7A 4QCIB 3V5KA 3GO1H 4J4PC 1TQCC 3VFRA 2EYSA 3LB6C 1R3IL 2XZZA 3MUZ1 2HJKA 2V2WB 3SGJA 4HDIA 5L2KB 4NQDD 4M93B 3HMWH 4L1HA 4U6VL 2NXZB 2QQNH 3IDGA 3MJ9L 2DQTL 3ULUD 1INEL 1HNGA 1K2DB 4OLWH 1VA9A 5J9PB 4PS4H 1MCHA 4R7DB 4TUJA 4G6KH 2OSLA 3RL1A 3O2WL 3JWDL 1KJVA 3EYSH 4JR9L 5EC1B 4PJGA 1MRDL 2IQAA 3G5YA 3G6JE 3ILPB 4FQXC 5K9JL 5IVXA 3LQZB 3OX8A 4ZUSA 1QYGL 4ALAL 4X9HA 1FC1A 3PQYB 3DPBA 4K3EL 3BZFA 3HFMH 4P3DB 1K4CA 3BYYA 3DRTB 1FFOB 5F9DC 1TVBA 2F9BT 2APWA 4LF3B 3BPOC 2GTZA 4DVRL 1GXEA 3NPSC 5ERWA 5CJ8A 3K4AA 3PXJA 1A9BA 2C3WA 4OGYL 1OP3H 4L9LB 3HG1D 1D9KC 1S8DA 1A6PA 5JDSA 1J9CT 35C8L 1AXSB 1QBML 1BQLL 3PHOA 2MTPA 1D5MA 2NX5D 5J13B 4MD5B 3QUYC 3UTTE 5HD8D 1TVHB 2VSDA 1MCBA 2BXZA 4MB5A 1E6OL 2FJGA 4MNQA 3FOMA 3HI1A 2BNUA 2EDTA 2CJUL 2BOBB 1JV5B 1NEZG 1N59A 3BJLA 1ZANL 2KPNA 1JZ8A 4K3GA 2BXYA 5DD0L 3AB0B 3V7MA 3WV0A 2QSCL 2OR7A 1CFQB 2OL3H 4O2EA 2YPLD 5CCKH 3MRNB 1CF8L 4Y16B 4YHOL 2OK0H 4OZ4A 4PJCB 1AGFA 2JCCB 2SEBB 1AC0A 2XN9D 4P59L 5GRJH 3CFBB 1IQWH 1LO3L 4HKXB 4RNRB 3P9MA 3T0EB 3QDGB 1T22A 1KB5A 3VWJA 2PETA 2A9NH 3U4EB 3QUZC 3W9DB 4M4RA 2X1QA 4HFWA 3KLHC 4TNVF 4R7DA 4RBPH 3UAJD 1LQSR 1U8QA 4X7SL 4YDVB 3JBG7 3EOTL 4UBDD 3TO4B 3OZ9L 3N1QC 4AM0A 3TO4C 1NMAH 3TESA 4M6OH 4YFLI 4FQ2H 3GUTB 4JDVB 1Q1JL 4X6CE 1FQ9C 1MJJB 1YJDH 3PUCA 4NHUA 4Z8FL 1DL7H 2PO6A 3IJYA 2YK1H 4KHTH 5CD5C 4KVCH 3UMTA 3VFNB 2CK2A 1M7IA 4GMTL 1VFMA 2R0LL 4JFPB 3HR5B 1KG0B 4NQCA 3DUHA 1NKOA 3VWKC 1N2RA 2A6JB 1UM4H 4S1QH 4PJXB 1T1XA 4R97B 4JAMB 4KROD 1J5OL 5L88H 3DETD 2PXYC 5MP6H 3U2SA 3V6ZB 4G80A 4HG4J 4TVPE 3LSOA 4F7EB 2IAMC 1G7LA 1ONQA 3NA9L 3ZMRA 3FONA 1Y6MR 3KS0J 4HIHB 5F9OL 4ZFFB 4X99A 1YC8A 2NY1D 3C60A 4PJAB 2ORBL 4F9LA 3WLBA 3IYLW 3ROOB 1URLA 1MQ8A 2CPCA 4ZFOB 4JDZA 1MRFL 4HW6A 1UQSA 1UJ3B 4JFYA 3O0RL 3D39D 5JORB 4OZIE 1IC5L 1AQKH 1HYRC 3IRZA 1EFXA 1FYTB 4OZ4B 5E7FA 4KU1A 2GJJA 4C56A 4JFDB 2OZ4A 3L9RA 5CP3H 5C0BB 5KN5A 1AGCB 3F5WA 5DF0A 4F9PC 2FD6L 2RQ8A 3P2TA 1I9JL 5IB2A 4M7LL 3B9KD 1KLFA 2NYYD 1YNLH 2ZPKL 4HK0A 4U1GC 2ICWJ 3VMNA 2Z92A 4XP4H 5F7NC 1RZGA 1RU9H 2GUOA 4U1LA 5IW1A 3MNZA 5JXEC 5DVLA 2HLAB 4KJQC 2BK8A 1G7HA 3GSOA 4IRZL 2V2TB 1EERB 3FT3B 5TE4L 4O2FA 1CR9H 1E4XH 3ZHDA 2GAZB 5CJQL 5KSBF 3H9HB 5IMLB 4PRHA 5IIEA 1EJOL 3OAZH 1EMTL 2K3TA 2NY7H 2XWTA 3GI8H 1S7XA 3PGCB 4WI3A 4X6EA 3RY6C 3ARBB 4PGJA 3DSNA 4GKNB 3SN6N 2ADFH 1N6VA 2CSPA 5JDJA 3KPSA 5LGJA 4F33B 4I4WB 3IAQA 3VXTB 2AK1L 5JA9A 1UXSB 5E9DE 2P5WB 3BP6B 3NIDF 1B6UA 5K59E 2BSTB 2ED8A 4Z18A 3MODH 3SDAD 5DDHB 3O4LD 4BSWA 1FNEB 2PCPA 4I0PD 3GIVA 4HXAH 4X6CB 4HWBA 3RWEA 2WUCH 2X42A 4WTZA 4J23A 1PG7L 2BX5A 2JJUA 4P5KB 1NCUA 5E2WH 3TH4T 4JM2F 4GG6A 4V2CB 1ZVSB 3MA9H 1NGZA 2P4AB 5INDB 1X5YA 5F1NA 1IGTB 4JDTH 1N4XH 4NBZB 5EZJA 5CAYB 5KSBE 2ITCA 2IBZY 1AGBB 3DVFA 2P44B 3VD4A 4ZOAA 2CLZB 4S11A 4JGUA 3LMJL 1RJCA 3QXDA 4HGMA 2OTWA 3WIHL 1FGVH 2EDBA 2KKQA 3T0ED 1JYVA 4LHJB 5GRVL 4HGWA 4RX4A 2YD4A 4PRPD 3CX5J 5CKGA 5HGHA 4JHAH 1G9NH 1QBAA 4Y2DC 1ZVYA 5FM4A 5JO5A 3O4OC 4XPGH 1M71A 4XWOC 2CXGA 1BD2B 4HIEB 3VXQA 2CLVA 3NIGF 5ILTH 1KENH 2XZQL 2EICA 1I8IB 1JZ2A 4FQCH 3RL2A 4GAGL 4MJID 2YXFA 2MOVA 3EO9H 5JOEA 1RJZB 5TGBA 2AK4E 2VQ1A 3PWUB 2GITB 2GAZA 2O5YH 3G08B 4LDLB 1MF2H 3OF6D 4WWKD 1TXKA 1MREL 3SE3C 3TBTB 2EDRA 1SEQL 4JKPH 5D7IB 3P73A 4J3XA 5C07B 1B90A 5IEKB 4E41B 5DTFA 1H15B 5DVNA 1X44A 5D96B 1S7QB 4P3CH 3QEHA 4UNUA 5MI0B 3D3VB 4TPRL 3WD5L 3D25B 3DLQR 2VDRH 1N5YH 3VA6A 5I6XB 3P30L 1FJ1A 4NFDA 5GS2H 1XF2B 3C5SB 2E27H 1V3MA 1WICA 4CMHB 1KEGH 5TPWL 5E5MA 4WWKA 4OCLC 1XGQA 4PB0L 4QNPF 4PRHD 2QSVA 4GRMA 1JI1A 3ALWA 4M7KH 4MD0A 3TP4A 1XCTA 2DQEL 4XNUH 2HLFD 3WCYA 5JHDB 4LCWA 4N0YH 5GISL 3IFPB 3VXRA 1NCDH 4LHUB 3QIWD 1D6VL 4FHBD 3RX8A 4OSUH 2AV1B 2J88L 4MQSB 1FO0B 3MLPA 3LQAH 3HI1B 4PRPA 3I50L 3DX7A 5JIHA 2XICA 2GW5A 3GJFK 3MOAL 1IAKB 4ZAKC 1SJEA 1QFHA 5MI0C 5HVFB 4XRCA 1OARH 3MOBH 4H88H 2X6MA 4D2NA 2VZUA 5FFLA 2X9XA 4HIHA 1A7PH 3SE3A 4PJ8A 4G8GB 3CVIL 1OAUH 1W0WA 4YDJA 2JB6B 4C57C 5E6ZA 3DMMD 2BNUB 5DK3A 4NWTH 2V5TA 1Q72L 4J1UA 2AS5M 2CDFB 4M6OL 5C0CD 2MPAH 2J3SA 4ZSOB 1OAYH 2XKUA 2VR4A 5FA3A 2BMKB 3UJJH 4L3EE 5HPMA 5KSUB 1JGEB 5DR5L 2QQKH 5C08E 1XIWB 5TF1H 1LEKA 5I18H 1BJ1J 4BZ1H 5FYKU 4RMUA 4KDWA 4WFFE 3N06B 4OV6F 3RWHA 4Z7VE 2D4FA 4M48L 4W6YB 4GAJL 5ITFA 4LLDB 3QUZD 5ETUA 4HQQL 3ESUF 3VRLE 4DGVH 5I1LA 4PJFE 2CRIA 2Z35B 3QO0A 4L9DA 2IANB 4G7YL 2D7TH 4M4PA 5BMFL 2JF1A 4WFHD 2VTFA 1IQDA 3CFDA 3FT2A 1L7IH 4UOW0 4N90D 1YEIH 1ZKAA 3Q6GL 2WIMA 4ODTH 2HLFC 1P4LB 5FKPA 4JRXD 4LPYA 1OP5H 3PE9A 3HA0A 2VDPL 5B3JF 43C9A 1GVIA 1EH9A 1KIUA 4JO3H 3U82B 4BH8A 2VUYA 5DWUL 1YQVL 5FO9B 3RA7H 2GK0B 1S3KH 3V0WH 3V2AR 3GMNA 4DKEL 2BHYA 3EBAA 4I9WD 1KB5L 1TZGL 3QDMA 3PP4H 2R4RH 3Q5YA 3UC0H 4CMMA 5IWLC 3TNNB 3QDGE 2JJSC 1L7TL 3ARGD 2FX9H 4WTZG 3VFRB 4PRIA 5E08L 3B9KB 5EOTB 4F8TA 3CSYB 1EFXD 1XR8A 1X5FA 2F53D 4QRQB 1L6XA 1S5IL 5EOCL 4WUUB 2Z8SA 3LKPB 4RDQG 1OQOA 4F7TA 5FECB 3NVQA 1NLBL 5D72L 2DJ4A 4JFED 1CGTA 4ELMB 3L3DA 1OSZB 5IM7A 4FFVC 3RVWC 2PYEB 3UYRL 1B2WL 4OLZL 2F5BH 4HFUH 1C1EL 1OGTA 3BW9A 2H41A 2R9HD 2AEIT 4YHKH 1MCPH 5C0CB 1T66D 4DTGH 3L1OH 5C8JB 2I9TB 3HG1E 2O5YL 4KWUA 3GHBH 3QDGD 3RL2B 3INUL 4P5TB 4KRPB 2X44D 2KZ1B 2HT3D 5EZIL 5C7XH 2YD6A 1EGJH 3MUY1 3QI9D 4ZTOH 2R1WB 5I17A 2EDNA 4LRNL 2FEDD 5JW5A 2IQ9L 1IL1A 1YY8B 2AXHA 4S0SD 3QIBD 3FB7A 4UTBL 1BZQK 3KXFA 5DRZB 1I7RA 1MNUH 5AEAA 5C0BD 1ZT4A 3NOIA 1FHGA 3HMXL 3NGBC 1RURL 2F54B 4FS0A 1LE9A 3MV8A 5IFAL 2ED7A 3HLAB 4RAVB 2XQBH 5KSAB 4N0UA 2VLKE 4YJZL 1IILE 5DDHA 1A1MA 4JFDD 4QTIH 1QQDA 2AV7B 4HGKC 5BXFA 5D7IA 1A14H 3BEWA 4Z7NF 3DBXA 1UWXH 5I1GL 3UTQB 3A6BH 5IV2A 4YDKH 1KPVA 1X4XA 1Q9KA 3D39B 2VAAB 2V7NA 1CCZA 1IEAB 4XZUA 4QXTB 3AXLA 5EBWA 5B4MD 3V6BR 1XF5A 4P2CG 4NQXB 3WIFA 3RGVA 3L3HA 3D25A 3CMOH 2PXYB 3T0XA 3CUPB 3GBMH 1LO2H 3VXMD 3K3QA 1TJHL 4AEHL 5DT1H 5KW9L 5K9KB 1DLHB 3N0PB 5EU6B 5KOMC 3KR3H 5B39B 3TBVB 4APQC 1N64H 3NFNB 4P4KB 4OLZH 3P4NB 3SY0A 2BY3A 3DX7B 3B83A 2I24N 4N8CH 1T1WB 3QG7L 2NY0D 2VN7A 3FFCE 4MQTB 1IGYA 1GCFA 1OVZA 2IMMA 2FBJH 3SQOL 1WITA 2HJLA 5F88A 5JPNB 2VLRB 1NGPH 3UTSB 4G8IB 1QD0A 4ODWA 4YX2L 5CFHA 2GFBB 3V52H 2VXTL 5D7JD 3MRMA 3P0VH 4UT6H 3PV6B 2OYPA 1ES0A 5E2TL 3O2DA 4CJ0A 1HHHA 5EOCJ 2WINB 1TJIH 3K4DA 1FVDB 4U1NB 2OQJB 3L3JB 3RVUD 4IOFD 3STZB 1RUQL 3P4LA 3GSXA 3ILPA 2DM4A 4BSVA 4HGWB 2PTTA 3JTSA 4L3ED 3BZEA 4TRPL 2OP4L 1J86A 1YNTB 4ZFOA 4NKMA 4LKCB 1G6RB 1T1YB 4QF1A 1A3QA 2NXZD 4OCYH 1H3UA 4M1DL 3P30H 3IKCA 1NC4A 4MA7L 4Y16C 3HMXA 5HVWA 2VXVH 3IJHA 5KZCD 2ADJB 3BKYL 5D1XD 5FGCB 3NCFB 4PV9A 4PG9B 4LP5A 5I1GH 5JOFB 4MNGA 4UU9B 1C12A 2CO7B 1P6AB 5JDSB 2B5IB 3TNMB 4F2MB 1QR1B 5C86A 4PRAA 2NY5L 3TPKA 3EYSL 3EFDH 5CUSL 3VXUB 2MQ0A 3H0TB 4XT1C 3SDXE 3EO9L 4HS6B 4G8FA 3GJFB 3MA7A 4XBPA 3I3DA 5C2UB 4PJIE 5C0DA 4TYUA 1XCQB 3HKFA 2HAZA 3BHBA 3S5LB 1KTKE 1T1ZB 4M5ZL 5JO5B 3UJIL 5LVEA 3O6MH 3B3IB 1JPTH 5FGBC 5FXCH 3ARBA 2D9CA 1KC5L 5DVKA 1F00I 1NEZB 3V6FA 5DMIH 3LB6D 2E8YA 1I7UB 1MH5A 1U8HB 3VJ6B 4N1CA 1K8DA 2AJUH 1BF2A 3B8YA 1H3PH 2I60H 4Y8AA 1IKFL 1ZHKB 4GS7C 5BO1L 3RUGE 4MNGB 3RX7A 15C8H 3LEXB 3PL6B 4KV5E 1FE8L 3OKNA 3WUZA 4Y5VC 4AT6A 2UUDK 4JFFB 3BRDA 1IM9A 4BFIB 5K9QG 4Y16A 2BVOA 1S9WB 3K7UA 4Q6YA 2AJZB 5LBSH 4BZ1L 2ITDB 4AMKH 3ARGC 1UWEH 4QF1B 2E9IA 5DVOA 5KSVA 1CDCA 5F6IC 1MIMH 4S0TD 5C0RH 3ILQC 2IBZX 3OKMA 2NCMA 5GIRB 3IS1X 4Y89A 1TJGL 1NBYB 4PJHA 4GKSB 3VD3A 1UXSA 5ID1B 2XRAL 4JO1H 1Q9LB 3ARFB 4JFXB 1ODAA 3GSUB 4HLZH 2FO4A 4OLWL 5ESAB 5I30L 4J3VA 3KLAB 4MQ7B 2MCG1 4PRBB 4KQ4H 4S2SB 2ZCKL 4G6KL 1FZKB 5C0CA 4F7MA 4S1DD 4PJ8B 4FABL 3FTGA 4LKXB 5EU5A 3UTZA 4UUJB 5IBUG 4WV1B 5ICYA 1RZJL 4NWTL 1WWBX 2C1OA 5LQBH 1YMHA 3IJYB 1S5HB 4PYHA 1A1MB 3P77B 2DQJH 5DLMH 2R4SL 1X9QA 4PRNB 2EYTB 2DAVA 2XPGA 1F97A 5TE7H 3RTQC 4NN5C 1CTOA 1KIQA 4GJTB 1F8TL 1KF9B 4ETQA 5A2LH 4LPTA 5IR1A 5DHXB 4CVZA 4HKJB 4DVRH 3I02B 3C2SA 1MFBL 15C8L 1U58B 3BGFC 2J6EL 4J4PA 1X4ZA 3RUGB 4XMLH 1QFWL 4OF8A 2HFEA 2DQDH 1RUKL 4R3SA 5K9OA 1IC4H 5CIPA 5I1DB 2Z35A 3LAFA 3QO0B 3TT1L 5JORA 1JJUA 4I3SL 5EWIH 3B2VL 1B6DA 2VDMH 2VRAA 5HJ3B 1E6OH 1TZHA 2AXFB 5C9KA 4QRRB 2AJZA 4LVOC 2BY2A 2FATH 3S37X 4HWZB 3PDOA 1JV5A 5CD3B 2IAND 5D1XA 2QADD 1P53A 2B1HL 2XRAH 2EO9A 3RNKB 2Y25A 4RGND 1GOGA 1J18A 4YFEA 5IEKA 3BH9B 4QRSB 1GSMA 1CWVA 1J8HE 3QNYA 3RDTC 4UAOC 3AAZB 3KLDA 1ZS8A 4PY8I 3VRLF 3NAAH 5JHLL 3MR9A 4N9OB 4PJ9A 1D9KA 3QIBA 2YPLB 4DEPB 2NTFA 5J1SC 1Q0YL 3UTPD 4W4OA 5JPMA 1PY9A 4DKAA 5E4IA 3QUZA 2W9EL 2D0HA 5E9DB 5EO9A 4CN4A 1EAPA 3DIFB 1U8NA 3SQBA 3O8XB 3BP4A 5IHZB 1CDGA 4U1KB 4XXCA 3TPUB 4PRDA 2DM7A 1EK3A 2Z4QB 3OAYH 4PGEB 3QEUB 3BDYL 1EEZA 3IU3B 3MGAA 4PRPB 4NZTH 4XCYB 1B2WH 1CD1A 5D7IE 4XCNA 1XEDA 5DQDL 4AJ0A 4W81A 1MWAH 5IIEB 1OAXH 2VZTA 2P5EE 3B9KA 1NJ9A 3HC4H 4Z7WE 3MV7A 3TT3H 1DBML 2IWGA 2ZSVB 4P2QB 1CGSL 3FN9A 1F4XH 3KHQA 2A77H 2V9RA 4JRXE 5T1KB 2DQGH 3FOLA 2N1KA 1OD7A 2ARWA 1KFAH 3AAZA 4ZNEE 1RSFA 4HUVA 3RNQB 3T09A 2C4FT 3T77A 1HH9A 3RUGF 5EZLB 1Q8MA 4WI9A 4RAVA 4HCRH 4QHMB 3EDJA 1K4DA 4WIQA 5B22A 4FNLL 3ZTNH 4CUCA 3BKCL 3ES6B 4L29B 1OB1B 3ZYJA 1DEEB 2VMFA 3BD3A 1CI5A 4KPHH 4OCWH 5F9OH 4YHZL 4EOWH 4KZDH 4L4VD 2BP3A 1P7KA 1IKFH 5E8PA 1ZMYA 5GGSB 1MH5B 4H20H 3ZKMD 3D1MC 3JTTA 1HHGB 1T7YA 2B1AL 4MMXC 2D0GA 3QEUA 4IOSD 3T2NL 3ZDYE 3W81A 3WEXA 3T1WA 3V4PL 1A4KA 1VEOA 2BMKA 4P9HC 3IDYB 4GW4A 3VXMB 4TPRH 1HHKB 1INDL 4X7TA 1MFDL 2NX5B 1UVQA 3SKNB 1NCNA 1QA9A 1EHLH 1R3JB 2HT4D 3C8DA 3L5IA 3P0GB 3Q2CA 2X4PB 3WNPA 3KXFD 4X6DE 4Y1AA 5F96H 1JNNH 4U6YA 3QBTB 3S34H 1JL8A 1Z9SA 1I3RB 3BMVA 1LO4H 2H32H 4OTXL 2WIIA 2DL9A 4MHHG 3OHXB 3O3BA 1CGUA 1T2QL 4I77L 3N85H 4K9EL 2CDEA 4YIQA 3DVIA 1M71B 1NKRA 5HHVL 1NFDF 4KMTL 4UDTB 2PO6D 3T4YA 4FQCL 1JPFA 4FQXD 4WV1A 5ICYB 1TDQA 1RZIB 4MA1C 3LN5A 3G08A 3FAXA 3T0DA 1EJOH 3SQOH 3FQXA 5ISZB 2DIBA 1G9ML 1U8MA 3JSSA 4F7MB 5IEHB 4P3DA 1YNTA 3GIZH 3QUXA 1ND0B 3MBEB 4U6XA 1XF4A 2VJXA 2CD0A 1NCWH 2W60B 2Q7YB 3O9WD 5TF0A 1FZOB 3WKML 3NGBB 4S1SH 4HUVB 1PG7X 3LKOB 4ZS7H 4DVBA 1F3DJ 1U58A 4YHYC 2AK4D 1FJ1B 1IGFH 4ODWB 1DEEA 3QDJB 2JE8A 4E41D 3HAEH 2X41A 1YEGL 3WIHA 2C3XA 5ANMA 5JTWA 1JWSB 1S7RB 2F19H 4ELME 3UJJL 3LKNA 2DDQL 5DD6A 3KVQA 4MJ6A 4KI5C 3EO0B 3RUGA 4GG6B 3ZKSD 2R1WA 1IEHA 3BO8B 1BVLB 1C08B 5L9DL 2YPVL 3RPIB 3LS5L 3MBXL 3VGFA 1A7QH 5SX4I 3CX5K 1H5BC 4CW1B 2PR4H 2FZ3B 3H9SA 1KJ2A 5DI8A 3FFCD 3H0TA 4P46D 1LEKB 5IMOB 1FC2D 1F90H 1KTLB 3QWOB 2UV3A 4WY7H 3W11D 2P5WA 1Q9KB 3BP6A 1SY6H 5CZXC 4OZHF 1ETZA 4CVXA 2CDFA 1CQKA 4G8GE 3SDCB 3RNKA 4JM2C 2DBJA 3FCTA 3L7EB 3K8MA 4YEFA 4G8GA 4HHAB 1F11B 1FLRH 1I8IA 1SMAA 4YNYB 5GS1C 1F13A 1MRDH 1CLYL 2JIXD 4LSRL 4FQ2L 4PP1D 4Z7WA 3DXAB 2X70A 2CDGA 1RUMH 3G5XB 3OSKA 3PWPE 2DICA 4MJIA 4QXGL 5I1AA 2FEEL 3NACH 1AXIB 2F53B 2D03H 3HZYA 2FYYA 4L4VA 1JHLL 1BF8A 4IRJA 3L3KB 1I1YA 2UZXB 4XXDA 3IFOA 4KZEH 1RUPL 1A6VH 2WP3T 3WD5H 2H8PA 2CKBB 1QRKA 2F8VA 1U9KA 1TNNA 1VESA 4HMCA 3WXVH 4JY4B 4U1HA 4M6ML 3UPRB 1NBZA 3MSPA 1NL0L 3D3VA 1IGYB 3FB5B 1ZHBB 2NY3B 1A1NA 3ULUH 2IC2A 1JN6A 1EZVY 1BQLH 5H35B 2VKWA 1M7DB 3KYNA 5D7JC 5B38G 4I1NB 4FNLH 2DQTH 1ZANH 5HDOA 2CIIA 5A1AA 1A6UH 1JGDB 3D0VA 4OT1L 1ULVA 5ICXB 4Q58C 2VYRE 4RFEA 5FM8A 1OLZA 5LGHL 2O26U 4PJ7B 2OMNA 4LRNH 3PHQB 4OD2B 4CW1A 3AREA 3F65A 2IPTH 1ED3A 3EDFA 2BNQA 5F89A 4ZFGL 5HDQL 5ADPL 2NX5A 1RULH 1Q9LA 3ARFA 5CZVH 3M8OH 2VISB 2K7PA 4ENED 1IKNC 1M05A 1ETZB 1WK0A 4XPFH 1BFVL 3SDAA 4JZJA 3N1FC 5DQJB 3VXRE 2H2PC 1RAMA 1PJ9A 5IFJB 5TE6L 3WUWG 3SJVD 3BEVB 2H9GA 3KS0H 1QLEL 3MREB 5DHYB 2MCPH 4NOFA 4IRSC 3SCMA 1ITBB 4WI7A 1I9JH 1IFHL 3QUKA 4JM4H 5EO0B 3QCVH 2Z8RA 1NMAL 3QCUH 3PWNA 2EDJA 1CDYA 1BIIA 1JHKL 1OQXA 2EDHA 1YJDL 2EZ0C 2KUTA 3P11H 3HRZB 4JM2D 5IG7A 1HDMA 1QFWH 1R5IB 4KRLB 5SWQB 3IDGB 2ZKHL 4EQ2A 3HG1B 3ULVF 3TCXA 5CD3A 2R2BB 3QH3A 3SE9H 1UKQA 4Z78A 1QSFA 4M02A 3KPLA 5IROA 5GRZA 5HYFA 4PJ7F 3O8XC 4Y2DA 4QY8A 3WMSA 4R6UA 1X6LA 4HULB 4OFKA 1ZLVK 5D2LA 5DJDB 2E5EA 2R0ZH 1FVEA 3W9DA 1D6EA 2QSCH 3BPNC 5D7IF 2VDNH 4IS6A 1J5OH 5D9SB 5MERB 3STBA 1R3LA 4PRID 4X6BA 5BVPH 1S7UA 4R7NA 1ORSA 4JCMA 5E4EC 3HMWL 4OCRL 1U36A 4WU7B 5D96C 1GZPA 1MNUL 5K9KA 3C60C 1XZ0A 3IRPX 1MFAL 2DI9A 2D7TL 4XVSH 4ZO9A 3ZTJH 1IBGL 1ZXQA 1N8ZB 5I8KL 4X83A 2FX7H 1EV2E 1DSFH 1QFWM 4JKWA 4TQEL 5HYSB 4DGIH 5IQ9B 4KHXH 1EXUB 4JANB 5HVHB 1QSED 4MA8H 2DQIH 3I2CL 4G8EB 2XN9E 1PGRB 1KCKA 1AXTL 3HR6A 4D0DB 5HHXH 3WYRA 3IETA 5JW4M 4DUVA 4MD5A 3ARRA 1OTSD 4HMEA 5I2IB 4N9GA 4P2QD 2B7DT 1X6NA 1MFEH 2BJML 2XWBA 2Q3AA 2X89A 3VH8G 3FN0L 3RPIA 3N1GC 2VAJA 3IXTA 3NH7L 1BFOB 2NY6D 1AY1H 2EXYC 1K5NA 5GRWA 5D8JH 2P8PB 1OF2A 3FHAA 1ORSB 3FO2A 4OLUH 1DUYA 5DQ9A 1U93A 4MB3A 5JUEL 2YS4A 1F4AA 5IW3A 1NBYA 1GZPB 2UVFA 5DJCA 5DD1L 1MLBB 2EDFA 3QJHB 1EO8H 1HCFX 5MENB 4BKLB 2HJFA 2OR9H 4JDZB 1YNKL 2D31B 2IALB 1P4BH 3NN8A 3MLRH 4WEUD 3ZSSA 4YX2H 3F6IA 5HHPA 1MOEA 2XQYK 2H26B 3MRQB 4YHLL 4QGYA 1MFCL 2XPGB 2CR3A 5DD0H 4YPGA 2ADFL 4HZAA 2OQJA 2CIKB 3DRQB 1B4JL 4PJCA 1ZLSL 2DD8H 5D2NB 1R5VA 5A16B 3MRFA 4CVXB 5FDWB 3QRGH 1BP3B 1HNFA 4PTUB 2HMIC 5IKCB 4LU5H 1GYAA 1IQWL 4YK4C 1DZBA 1FRGL 4WUUA 2Q87A 1E4KC 4NKDB 2HJKB 5SX4H 4XNMB 1KB9J 3QQ4B 1NCAH 4Z7OE 4PBXA 5F44A 3B5GA 4LSDA 2OI9B 3IF1B 1WFTA 1EEYA 1Z5LB 4LEXL 3ULUC 4RSVA 2VIRB 4CVUA 2HH0L 1NDGA 3AREB 3QIUB 1OAKL 4FQ1H 3V4VL 4XCEB 2YPVH 4HPYL 4DN4L 5E9DA 1FO0A 5EO9B 4CJ1A 3O4OB 3C2AH 2VAAA 3QEQA 1C5BL 4X6DB 2AKRB 5BS0E 1S9WA 3U4AA 5C0AB 4M5YH 3SOBL 1LD9A 4Z7VF 1N64L 5IHBA 4ZD3H 5IKCA 2BVEA 2FIRT 2WLZA 1F4HA 4GAGH 5DJCB 3G5VA 4L4TA 1GZQB 4Z95L 2BSRA 5KJRH 3EJYD 1HIMH 5F9JB 2E7LA 7FABL 2VH5L 4GMSL 3SPVA 3DO7A 2EECA 4S1RH 4NCC2 4XBEL 1SJVA 2CLRB 4NFBA 5HGAA 4OLVL 4MJ2A 5ISZA 2NXYD 1SYSA 3QPXL 2VXQL 2ADIA 3DX8A 4LSRH 4QHMA 3ZT6A 4ODSL 3MZGB 2J8UB 4DZ8B 2IANA 4I2XE 4ZO8A 4M43H 4C4KO 5E8NA 3QRGL 4KKLC 4YFDB 1MRCH 1A3RH 4G6JL 1KNOB 4LPXA 1LO5A 3P73B 3PV6A 3OKLA 3WHE1 1QHOA 4H25B 1FG2A 2EC8A 4IHOA 4U3CA 5TE7L 2B5IC 3VE0B 2OX5A 3KPMA 4KZEL 4RWYL 4P99A 4QT5A 5C2BH 4L8BB 4LSPL 1H0DA 4NNPH 2NY3D 1NFKA 4X6CF 3Q5TA 4EDXA 1YQ2A 4LNRA 1KSRA 1TVBB 4KTDL 5BV7L 3RPKA 2GJ6E 4G7YH 1JWUA 5L0QC 3T3ME 3TIEA 5HHNA 4BFEA 4GG8A 3NBNA 4ZPTB 5E1HB 4RCAA 4PG9A 2AQ3A 4KQ4L 1S9YA 3OKKA 2GIYA 4XVJL 3C2AL 3H6JA 4XNZB 5IOPB 1M4KA 3MRIB 4KRMB 4F80A 4WFED 5EZOL 4JFEE 1DQML 3SKNA 2DF3A 4KKCD 1AJ7L 5HY9A 1YPZA 1RVFH 4LQFH 2F53E 2EDKA 3QZWA 3LQAL 1HHJB 4GLRH 1EMTH 4D9QD 2FHFA 3TN0A 4AL8H 2HG5A 1N5AA 3ZE1E 1OOAA 1KCVL 4R7NB 5DJXA 2NX5E 1OTTC 2NY1B 3CFJA 1C8PA 3HPJB 4PP2B 4TNWK 4GW5A 5HGDB 1JHLH 4OIIH 4V1DB 5TDPB 4N0FA 1J0KA 1Z9MA 1R3KB 1KOAA 3U7AA 3DO7B 4ACPA 4RISH 4MAYC 5E70A 4WU5A 3HZMA 1TQBB 2VDQH 3VRIA 3QDGA 3QG6A 1I7UA 4LDOB 4NQED 2DWDB 1AKJD 1KJ3L 4R3SB 3SDAB 4RGOL 5DJ2B 1OM3H 2CUIA 1CFTB 3P4MB 2G60H 4O02H 5IBTH 5T1MA 1D5XA 2N56A 5JIIA 1F4YL 3MBEA 3QUKB 3U0PA 1I9RH 2YD1A 5TH2B 4P3WA 3CFKB 2Z0BA 1QEWB 1KLUA 3FQXB 1FFQA 1UB6A 1EEZB 1D9KB 4Y5XA 2W0KA 3AU1B 3RIAF 1TPXB 3GIVB 2R1YA 4HIXL 4NQDA 4D3CH 1C08A 4IOFC 1XH3B 4GKOA 3T0VA 5GRJL 1INEH 2VISA 4PJ7E 3K0WA 3BT2H 5F7MC 4Y4FB 2VDPH 2YUXA 3IDYC 1KIPB 2HKHH 3KYMB 5DMKB 2WMPA 1J1XL 4EUPG 1PZ5A 4NO2B 4ODTL 5EU7C 4H8WH 3PHQA 4OD2A 3LV3B 5HHPB 2ICEA 3E8UL 3O6KH 3SHSA 3O41B 5DK2B 4XMKH 1JUFA 1I85A 4R4FL 5JW4R 3AY4A 1FL6B 4PLKC 4X9GA 3RY6A 5HHXL 2R4RL 5I15L 5IW1B 5IROC 1N5AB 4KHTL 5I71C 1HHGA 1XAUA 5GSRA 4PJHE 5FO8A 4FXKB 1UQSB 1CFNA 3CC5B 4NT6A 5I75B 2C1PB 5F3BB 1UKTA 1DVFA 4Q0XH 3VFGL 1WBXB 3I3EA 5I1CL 2IFFH 5J11B 1F6FB 1OB1A 4ZUWA 4I18C 1AY1L 1IQDB 4ORGB 1GZQA 4M8VA 2MNUA 1NPUA 4GBXD 1ZHLA 3IFLL 5HHVH 4HJGA 3QB7C 4BSVB 3P0YH 5HYQB 3RI5F 1LDPL 3EJZD 4ZQKA 5J57B 5IVNA 2VDNL 3CDYA 3K2MC 4QHKJ 1LWRA 4TUOB 1MCPL 3C5SA 2W9DL 3AC0A 4MS8D 3IXTB 3BAEH 2A73B 2JJWA 3VXSB 5F7DA 3LKPA 1KXTB 3FTGB 3EIFA 4LKXA 5EU5B 3PGCA 5EZIH 5T33H 3IDMA 4PJBE 1AGDA 4RGNE 1S9XA 2OL3L 1WAAA 1DSFL 1GHFL 2F74A 4EDWL 3JV5A 3I75B 1KT2B 4OFIA 2ZUWA 2BY0A 4NCC1 5IB3A 4U33A 2OK0L 5B39G 2R2HB 4WFHE 1LEGA 3RIFK 2ICWI 4UAOB 3J8F7 5SWZB 3I3BA 2MSPA 4P5TD 3BOVA 3ULVD 1HQRB 1KJ2H 3MRKB 5E0QA 4HWEL 1KEMH 2FGWL 3W9EB 5IP4A 4C83B 3GB7B 3HR5A 2UYLA 1MFEL 3VFMB 1MI5A 1JGDA 4O4YH 3MRGB 1KLGA 3IB4A 4PR5B 1A7PL 2Z91B 3MV11 4N5ED 3CVIH 5DJ8A 4IIQA 1XMWA 5DFVC 5I15H 4M7ZC 3THMH 1DQJB 5KAQG 5TJWK 5CHNB 5C0AE 4OZGE 1JFQL 3WFBH 1MJJA 3LIZL 4HPYH 3KXFE 3PIQA 4MSWA 1YN7B 2Y36H 1IAIH 5KSAA 2AVGA 3TZVA 3M45A 4DUWA 2CUHA 4NBYB 1E4JA 2YR3A 3FAWA 3CFJB 4QNPE 3S96A 5IVXF 2XZAL 3WJLC 4PJDF 1PX3A 4AT6B 3ARXA 2ED9A 3D85B 2EDXA 1HHJA 2QJDA 3SKMA 3K8LA 3CFCH 1T1XB 3K81A 3ZT5A 2EDWA 5KVMC 1MCOL 1PYWA 1MI5B 3IDXL 1J0JA 1JNHB 3S36H 3SE4C 3BEVA 1Z3GH 5IOPA 4G3YH 3EYFB 3OR6A 4GRLB 4CVWA 1A6ZB 4RGMC 1U0QA 3U4BH 4NKDA 3WSQL 3KPOB 1FL5A 2O5ZH 3QI9A 1QSEA 2XZCH 3BFOA 1BZ9A 4LSTH 4JDTL 3GDBA 2GT9A 5ACZA 3MNZB 4ELMA 1AQKL 4QGTA 2B1AH 3REWB 4G6JH 3HZVB 3BP7A 5F7FA 3PQYA 3RVVC 4ZODA 3IFNH 3TJHD 4HMDA 4NKOB 2Q20A 4J7RA 2QEJA 5CEZE 2MKLC 3H9HA 3KNBA 1R5WB 4N1HB 1T2JA 1ZE3C 1N3NA 4QRQA 3DXAE 5JXAH 4XVUD 3O8XD 1JRHH 3VW3H 1A47A 4HS8H 1ACYH 4R90L 5BJTA 5FV1L 4ONFL 3OKLB 1X5GA 1I3GH 1R6VA 2NY0C 1U6AL 2ZCHH 2PTTB 3KLAA 1F90L 2FGZA 5A3IC 5C92A 4PFEA 2GKIA 5A40E 2XFXA 4OT1H 3QIWA 1VFBA 5FO9A 1YY9C 4EKXA 4XP6L 1BQHG 25C8L 2A9NL 1HIML 2P48B 3JTTB 1E4XL 3BISA 1RHFA 3QEQB 3HRPA 1A1OB 1BHGA 4HWBL 3TZVB 4NSKB 1DR9A 3UZVB 2R56L 4R4FH 2DLTA 3FB7B 4XWGH 3VFVA 1R0AL 3X3FH 1EEUA 1D5IH 3QUXB 5KANG 4JY5H 2VL5B 4OLYL 4YBQD 4KROB 4DFHA 3IDIA 5IBLC 5J3HD 3BN3B 3BIKB 3GSVA 3U4BL 2D7MA 4RRPA 1PZ5B 1IGFL 3BH8B 4F7CA 2IH1B 3ARED 4LSPH 1MIEL 2DQUH 1MQKH 3QIBB 3KLHD 5JLZA 5FF6B 3EYVB 4UOW1 1RK0A 4U3XA 3IDJB 5D7JA 1HINH 2KQNA 1J1OH 5FA3B 5IGXH 3EFFA 2G5BA 2RGSA 3GBNL 5FYLH 3KJ4B 2FIKA 2AABL 2E6PA 2Z9TA 3BAEL 3ECBA 1V3JA 4P5MB 4X8JA 4N0UB 3G5YB 3IF1A 1WLHA 3LKRA 1SMOA 3T0BA 2F74B 3D18A 3L3HB 4AEIH 3WFDH 1OT1A 3D85D 3DV4A 4AK1A 3GRWH 2ZUQB 4ZUUA 4Z78B 2FR4A 4J3SA 4HIIB 1NGWB 5K9QI 2HFGL 3GHEH 2Q8AH 3UTTD 2PNDA 5IMKB 4XGZA 5C9JB 2F5AH 5CJOH 1OPGL 5D5ME 5I30H 4GUPB 1AD0B 1YEHL 2FJFA 5TDOA 1JCKA 3HNSH 5D7SL 4ZUTB 3FZUD 4MDIA 5CJXA 3P9LB 1Q0YH 2YD2A 3S6CA 4OB5H 4KDTA 3QSKB 3C60D 2X4NA 2A6KA 2X40A 3VXNB 4IEFB 4XMKL 5D6DA 3MRBB 2EIDA 3BRFA 4MVBD 1HH9B 3ZKQD 4PJDE 1OAYL 3QQ9D 3GRWA 2D7OA 1MCIA 1NFDB 1WCQA 4MD0B 1WEJH 1CG9A 4EZMA 4JRYD 3T4AA 1NCCH 3QPQC 1UWXK 3ZDYF 2ADIB 1ZGLB 3C5JB 1ES0B 1NGXA 1N7MH 4JB9L 4LHQB 2FBOJ 3GKWH 3QIWC 2P8LA 3LKSA 4JFFD 4DCQA 4FFWC 1QRNE 2KBGA 5HYSG 1PBYA 1XF3B 2X4TA 1G6RH 4PRBA 1NGQL 3VE0A 1PYWB 2FEEI 3HS0B 5ESVA 1G7PB 2HVKA 1BVKA 4F3FA 4PJHF 1JTOA 4JANA 4YPJA 4F7TB 5FECA 4D9QE 5CBAA 4JKMA 4B41A 4M00A 4MQXC 3W0WB 2ZOKA 4HKBB 3FQNA 5TH2A 2X4NB 1L0XA 3C6LB 4K3DL 5J7CC 4JG1H 5CSGA 5C0FB 2ATPA 5TQ0L 1KJMB 4D0CB 3EYFA 3OR6B 2V5MA 3ORJA 1YQVH 3V95A 3T4AB 5EU4A 3BGMA 3RWFB 2XWJB 4OI8A 5SWSE 5IJKA 1ROWA 1YYMH 2Y06H 3UROR 3I2CH 4M03A 1OTTD 1AIFA 1N4XL 3BEWB 2AEWA 3WS3A 2XN9A 2FECI 3DX9A 1I85C 1W0VB 3X12B 3TV3L 1OSPH 3CDGA 1MCNA 1KJ2L 4X4ME 3FQTA 1S5IH 2BJMH 2E6QA 5J6GA 2BCKB 2KQMA 1UFUA 3KYAA 3K46A 5FYLD 4JFOA 2HTLC 3W39B 2QKIB 5FUZH 3MX0A 2KZWA 5CBEA 2YWYA 5I9QC 1TLKA 5GS3A 2VLRD 3UTSD 5IHZA 3RTQA 5HGBB 5C0DB 4D8PA 3TN0B 2QADC 3JWDH 1CLZH 4ERSL 1KPRB 4QOKB 3ULUE 4MDJB 5EWIL 1VGEL 3NCYP 4EN3C 3BSZH 3MRIA 4G7VL 4NNYB 3KNBB 4LAQH 4IDLA 4K23L 43CAA 2V17H 1T21B 2YWZA 5I9QB 4OCXL 5FEBA 2CXKA 4Z7OF 3L7FB 1IEAA 4XZUB 1I9IH 5I74C 1BPVA 4OD1H 3L5XH 1U95B 4LPUA 1U91B 3WNLA 1IARB 5IB3B 5JHDE 2C1OB 1HH6A 3PJSA 2VC2L 1LK3H 4A6YB 3G9VA 4JFDE 2F15A 3MJ8A 3KLSA 4PJCE 3B5HA 3LEVL 1FRGH 3WUWB 1T5XB 4Z6AT 1ZA6A 5EOTA 2ZZUT 1A4JB 1RFDH 1Z9OA 5DHVB 3IKCB 1A1OA 2XQBL 5EC2B 1KCUL 3PP3K 5IMMA 1JBJA 5C0BA 4OZIB 1UZ8A 4K3HA 2FO4B 4H0HB 2YMXH 3N9GL 3CIQA 5E1AA 2XTJC 4PY7B 2EDEA 2EE9A 1XCTB 3Q48A 5CINL 1RD6A 3WEXB 1XGYH 4P2QE 3OKMB 5HYIA 5LQBL 3TIDB 2PYFA 5C6TL 2GK0A 2HRPL 5D6CB 1IZJA 4O2EB 3OGOE 3MRDA 3F58L 4Z7NE 4MB4A 4BUGA 3GMPB 4CN6A 2PR4L 4YNYA 3AMKA 4X8XA 4M1GH 4OM0H 1T83C 5HGAB 5DMKA 4YHOH 3JXAA 4LKCA 3SGKA 3VFTA 3UBXB 1BVZA 2DLGA 3ULSA 3WN5A 4OLUL 3N50A 3WFHA 3EDDA 3NPSB 4WVRA 4F57L 4XVJH 1JK8A 4NJAL 3O41A 5DK2A 2PW1B 3WJLA 2DM3A 4CVZB 1CVRA 5IB5A 4PJAF 3OHXA 4Z7WB 5FYKL 5HYSA 3TA3A 4NO2A 3CFEA 3V79C 2A9ML 2WM0A 2ILLA 4FZEH 4MNQD 1HQ4B 3G04A 1TTFA 1UT9A 2FLRT 3EYUH 4ISVA 2Q3ZA 3EDEA 4Z7UF 1MAKA 2EEBA 4Y1AE 1Q72H 2VR9A 4YBLC 3B3IA 3WKMH 2WBKA 4QXGH 3KDMA 4YDLB 3DBXB 1RUQH 4M43L 4OJFL 4HH9B 5AUMA 2DD8L 3RKPA 3DGGB 1AGDB 4LU5L 1Z0NA 4BZ2H 4EQ3A 3PWPA 3VI3E 4ZXBD 4OGZA 1KT2A 3WXVL 5SWSB 4Y4HB 1U8QB 3HNVH 2B4CL 1KTDB 2VDRL 1N5YL 4HUWB 4M93C 1NANH 4LLUB 1LE5A 3CX2A 4N0FB 4TUKH 4J3UA 4K55A 5MP6L 3F7VB 2DQHL 3LKOA 2ZUQC 2VDOH 3C09B 4Y1AD 3L6FA 3GZKA 4K9EH 2AABH 3NA4A 2HWZH 3HNTH 5E7BA 3T08A 3GKZA 1BM3L 4PS4L 2PYED 4N68A 1AR2A 1OTUC 1Y0LA 2YOCA 3CU1A 4NQDE 4NWUH 4OZGF 2OXHA 4WW1A 4QHKI 5EB9A 1WISA 4CMHC 2XN9B 4IMKC 3VXPB 4RX4D 3MLXH 4JZJB 5DQJA 1JZ7A 2J88H 5AUMB 3MV9E 1YPZE 5B8CB 5MHSD 3HPJA 4PP2A 2NZ9C 1JIBA 3OPZH 4DJMA 5IB4B 4IMLB 4NQEB 2PN5A 1LP9E 1J12A 2RBLA 3MV8E 4JVWA 2X09A 1AHWB 1IFHH 2NLJB 4JM4L 3UAJC 4U1MB 2VDQL 3VFUA 3QQ3B 4YXHL 2PYEE 1LO0L 4UILH 5DGRA 4XTRD 3HPLA 3M07A 3QUXD 3C5ZC 4FQQB 1RU9L 2PYEA 5E2TH 2YA1A 5FOBA 1ADQA 1JGVH 1D5MB 1OGTB 3TBTA 4UU9A 4LVOB 3UPAA 3DWTA 1JYNA 1XH3A 1H8NA 2NTSP 5L7XL 1RZGB 1JYXA 2JTDA 1T20B 3C9NA 1I8MA 4RA3A 4RWYH 5E4EB 2H32A 1NC2D 3VXUA 2DLHA 4LCIH 5DUPL 5IQ9A 1VSCA 3TNNA 1PVHA 3IFLH 4OF0A 3INUH 4KKNA 3RWDA 4AEIL 1GRWA 1CXEA 3CC5A 4NT6B 3ZDXE 4JQXA 5ENWB 1XR9B 4P46B 4HQQH 3VFWB 2A1WL 1FH5H 3CSGA 1N0XH 3SKMB 4PV9B 1CXIA 1GL4B 5CCKL 4ORGA 1FL6A 4NRXA 3C6LD 3I6KA 5MEQB 3DXAA 5LJYH 5TQ2L 4L5FH 1I1CA 3DX8B 5HI5D 3U9PL 4NNYA 3ZL4L 4FABH 1CYGA 1CFNB 5DUML 1CGYA 2QSTA 3UZEA 3E8UH 3KPNB 3O6KL 3I9GL 5CWSB 3X13A 4PJFB 4OB5L 1G7LB 2EH8H 5JHDD 2AJVL 1HI6B 4IRSB 1NGYB 1BOGA 4XPFL 2I5YH 3RWGA 1YYML 1RUAH 4NZRH 4PRDB 1HH6B 2AJYL 3WXWL 3GGWA 3V0WL 4AY0A 1MHEB 4WDIA 1MCFA 5IEHA 2HG5B 3PP4L 5ITFB 1E6JL 1DANT 5JPMB 3ARFC 3VFSB 1M6OA 4JFHE 4NQUA 5JXEA 1AD9B 4RISL 3V8CA 2VLKD 5IVOA 3NCMA 3SCMB 4V1DA 1YY9D 5TDPA 4FFWD 4ZSOE 1DBKL 1QO3A 3MR9B 1FNLA 1PG7W 4Y5VA 5DJ0A 1ZGLP 3ME0A 5J3HC 4JPIB 3AS3A 3P0YL 4M7LT 4CL7A 5ESVB 3EYQD 4D9LL 5KVGL 5CSBA 4D0BA 3CDCA 4FP8H 4PJCF 4WHCA 1N6QH 3NZ8A 4RFNB 2R2HA 4ETYA 3MJ7A 4CU6A 1DFBH 3IDJA 3QI9C 5D7JB 2G9HA 2CKBH 1CICA 4QRUB 1LP9F 4I5BA 3AXLB 5EBWB 1WIOA 5IB5B 5AAMA 4U1GB 4JZOA 3VH8B 4NRYA 1NC4D 4LP4A 4KXZH 2XG5A 1FFPB 2IPKB 2H2PD 3VG0L 4YAQA 1AC6A 3NTCH 4KUZL 3CXDL 3FT3A 4HUUA 4QRPE 2NW3A 4LEOA 4PGDB 3WFHB 5DEGB 2GK2A 1DN0B 2H1PL 1JWSA 1S7RA 1XR9A 2FSEA 5CSZA 4L5FL 4LHUA 4O51B 4X9FA 3RZCD 5AYUL 4TSAH 3TBWB 5F3HB 1UH2A 3OAUH 5BS0D 2C26A 1RIUH 3DSFL 3F12A 2X1PA 1ZLUK 1BBJA 5E2WL 2BDNL 5CEZL 3ES6A 2VXVL 4KHXL 3ZE1F 1HSBA 3AMLA 4WCYL 3U9UA 3N9GH 4DZBB 4PJBF 3TA3D 3WO4C 4L1DA 4JLRB 3RVVD 1CICD 4EI5D 1WZMA 3B6SB 4L4VB 2P46B 1CBVH 3U30B 2FR4B 5JNYB 1FVDA 2YXMA 4U1NA 1ZLUH 4OF6A 5C6TH 5HHOA 1QSEB 4JM2B 4JZOB 4FTVD 3OKEB 5FDYA 2ERJC 3LQAC 1J10A 3BQUA 1EHNA 2ZCHL 2A77L 3E3QE 3V5HB 5F8QC 5D5MF 1X5JA 4HHAA 5KSUA 5D2LF 1ZA6B 3QUMB 5FKAA 1JPGB 2IADB 3RGHA 4TOYH 1FG2B 4IHOB 4XGZB 5GJSH 3LKQA 3NIGE 2GY5A 3CAFA 2FX8H 3O3BB 1UCBH 2R8SL 4U0QB 3SGKC 2X4OB 3MODL 4YZFE 4KK6D 5GS0L 2X2YA 4WNQA 3F6LA 4ZOCA 5T3XD 2APTA 4HWUA 2NY1C 2VZ1A 2BNRA 1IE5A 1T7WA 1F2XK 4WW1B 4UNVA 3LDBB 3EYUL 4TUJB 1M7IB 3S8WA 3U48A 1BGXL 1WWCA 3U46A 5A2FA 4N8VB 3D39A 3R1GL 4P2OA 4P9HH 4Q9RL 4MJ6B 2QQKL 1V7MH 3O4LE 2GTWB 3DYOA 3LS4L 3DUSA 1UENA 4E0RB 3MYJA 4CU7A 1YC7A 1A6WL 1BQHB 4ZS6D 2VLRE 3UTSE 3QDJA 3PQYE 3SDXA 3TBYA 1GGUA 4N0CD 4YE4L 1D5ZB 1LVEA 5ANMB 4P23D 5T3XE 4HKZA 1XGUA 4F37K 3RWHB 1U8HA 3VJ6A 2GYSA 4R2GC 2FDBP 3IDIB 2HJFB 1HQRA 2APXA 5C0RL 3AROA 2GSGA 2IALA 2DQHH 1F6AB 4KJYB 4XNYH 1BD2E 2A38A 5I1LB 3V0VA 4DN4H 4JJHA 3BZ4B 1U8JB 3NFNA 4TTDD 4X4MA 1U2HA 4P46A 3D87B 5E6IB 3LIZH 2XWJA 1WJ3A 5DRNB 4ZXBA 2XZQH 3HE6B 2HFTA 5D93C 4FXGB 1IM9D 4F58L 1MWAB 5TDNA 4BH7A 3SOBH 4OKVB 4KK9D 5CGMA 2ZUSA 3QA3B 2NR6C 3CVHL 4LHUG 4K7FA 2VIRA 4JFEA 5D5MA 2IBBA 5E5RB 3L3GA 1WC7A 5BZWA 3SEPA 2DI8A 3ZHLA 1QZ1A 4UIKL 5DRWB 3OPZL 3MRPB 1LEIB 4JFZH 4GRLD 3AM8A 4H26B 3KPSB 4P3CL 4JPKL 1JF6A 1MUJB 2A6IA 5E99L 4Y1AB 4KGJA 4G3YL 4OAWA 4MJ5B 3SKJL 2WUBH 4JY4A 4U1HB 4AIZA 3S36L 3C8KA 4MMZC 3CSYA 2F19L 4HLZG 5JHDA 4EBQH 3S5LG 1NCAL 4PLJC 1V7NL 1XIWD 4QLRA 3DETC 1I1RA 4LSQH 4DGIL 2F5BL 5E6IA 1OAQH 3EYOB 5DA4A 5CILL 1EUUA 4X6FB 1WWWX 2O5XL 2W38A 3QI9B 1FVEB 4M7JH 4M62L 3PGFL 3VXNA 2YSSA 4PJIA 1Q9OA 3QZWG 4NQSB 1I9RL 4NO3B 3DXAD 4XCFH 1AQDB 1B0GA 2Z31D 4JREB 4FQJH 3ZTJG 1Y6NR 5LWYH 1NH6A 1HWGB 4IDJL 4JPVL 5C8JA 5F7WC 4XXCC 4X80L 3KG5A 1XZ0B 3P9LA 4NQEA 4NQVA 2WQ8A 2UWEB 5GSVB 1U6AH 5C9JA 4O51A 4KI5E 2C3GA 5GSRB 3ULVH 1PY4A 2N7AA 4W4OC 5FOJA 3RJDA 5IFHH 2ERJB 3B9KC 1G9NL 1YEHH 1EDQA 4Y16D 1CK0L 2FL5A 4NKQB 3S35X 5FM5M 1QKZH 4LLDA 4M9OA 2O93L 5IFAH 2H9GB 2AEQH 4FFYL 4UB0H 1SHMA 3VFOA 1CTNA 1T04B 2R1XB 5EIVA 2EEDA 3FQWA 1B4RA 1W72L 4Z8FH 5B4MC 5F21B 3DVGA 4NQCE 2CUMA 2NY4C 1GPOL 3FRPG 1HDMB 1IMHC 1YUHB 2I9LA 4F9LC 2P5WE 5HPMB 3LRHA 1S7SB 1UA6H 1B0RA 2VDLL 2X4RA 3MFFB 4OQTH 4PYGA 5D7LE 5FAAA 4ODHL 2IFGA 3X14A 1UZ6E 1S9XB 2WSKA 2D4DA 1C16B 5DT1L 5KW9H 2PXYA 1RK1B 3OGCB 3BESR 2B8OT 4PTUA 3ULUL 1BWWA 2C3VA 1G1YA 1MIEH 2BVPA 4OGAC 3RZWA 4POYA 4Y7MA 1LDPH 4W4NA 4IM8A 1CFSB 4KDVA 1TTUA 3OKNB 5HI3C 1JPGA 2RIKA 4FP8L 1DQJA 4HCRL 3ZTNL 4WU5B 1KN2L 3QZWB 3I6GB 4JFFE 4I3SH 2DLIA 1H3WM 3MRGA 1JGUL 4HG4K 2ATKA 3IXAB 3ULVE 1AQDA 5GGRB 4QOKE 2NW2A 5J89A 3C5ZB 2J7LA 5MEND 4LCWB 5HYEA 1CDHA 3DVNB 3KGRA 3VFWA 4GAYB 1CQYA 4PJBA 2FJGB 1AHWC 1S3KL 5E03A 2DLFL 3MRNA 4KKBD 3U46B 3NZHL 4XPTH 1QSFE 5IVXE 2Y06L 1A9EB 2AXGB 3HE7D 4NZRL 2EH7H 5DGQA 1INDH 5IR1B 2VLKB 5CEXA 4PRHE 2DQFA 5I17B 1D9KD 2WIIB 4JG0H 3B9EA 2DKMA 4C4KT 2OXGA 2PTVA 5KG9A 4WJ5B 3H2WA 3NCBB 2BOBA 2XI9A 5LXGH 1K3ZA 1AFVH 1MHCA 3NCCB 1CXHA 4WHTB 3SDDA 4IRZH 3VRJB 1NDMA 5M7QA 5GRUL 1EXUA 2AAVA 1EEQA 3VFGH 1FFPA 3EFDL 4ODHH 3QA3A 4FQQA 3TVMA 4RFEB 1QBBA 1CD0A 1HSBB 3I6LE 4DW2L 4F58H 1J8HA 1X7QB 3SGDH 4NC2B 1A7RH 3K80A 3T04D 3L3IA 1T7XA 4Y8DC 1YMME 3GKWL 4FXGA 1I3VA 4WO4A 3OL2A 2IBGA 2C3HA 3R0NA 5TFSH 3KPMB 1CLOL 5HHOB 2BSSB 5F93C 1ZT7A 2YPKA 4UI2A 5I16B 5T3ZE 2APVA 3W11C 2QQQA 3PNWB 5L88L 2HVJA 1O5DT 5I8EA 1IT9H 4M61B 5EFIA 2P5ED 1AO7B 1HILB 3PABB 4H1LH 3JWOH 3VH8A 3UDWC 3JWOC 3F12B 2N7BA 1K6QL 2V7NB 1UB5A 1UEMA 3KPRA 4LPWA 4GOSA 2ITCB 5T3ZD 2WBJB 4Y0GA 2DLFH 3LPGA 3BDXA 1QQDB 2YD5A 4PJ5D 4JRXA 1NAKL 1Q1JH 3ILQD 4DAGL 2C4FU 2MFNA 1HYSC 3Q5OA 3BXNB 4NP4H 4APQD 3K2UH 1FBIL 1RJLA 4R26L 1IAOA 3C60B 5C0AD 1FORH 2FD6H 1K8DB 2CRMA 4R8WL 3U1SL 4WO4B 4JPVH 4MAYD 1L7TH 4XCNB 3WIHH 1FVCB 1NJ9B 4KJPD 2X7LA 3VWJC 3VXSE 1ZSDA 3UXFA 4X5XB 3PHOB 3P4MA 4HAFA 3G6JA 3OKOA 2VLJE 2C9AA 2ZKHH 3LPWA 1LK2B 1MHCB 3SDDB 5GZNC 4IRSA 2VLJA 3MUHL 4OV5B 3REVA 2Q76A 1UB5B 5L2KE 5JLZB 1IGML 4OZFA 3MNWA 5TE4H 3QRFM 4NC1E 1MSPA 3MO1A 5E8DL 4CMMB 3MV9A 3MJ6A 1FFOA 5KVEL 3WS6A 1UZ6F 1NMBH 2HTKC 3EGSB 4XP1L 3RWGB 5DXWA 1I1AC 5E8NB 4W6XB 4NM8H 1LILA 1P7QA 4I18A 4E5XB 2JCCF 3GGWB 4JKPL 1AGFB 4Y4HC 1BZ7B 1PEZA 1QLRA 5EN2B 4UV4H 4LSUH 3PWVB 2OP4H 5GHWH 3SDCC 1NAMA 2AJUL 1OHQA 1PX4A 3C08L 4KC3B 3CVHB 4PJAE 4GSDL 3HUJF 3PL6D 5BO1H 3S35H 1Y0LB 2BVQB 2JJTA 1NBVH 2C7UA 3O3AB 5FGBA 5L7XH 1MCEA 4KJQD 1LO5B 3I6GA 2OS7A 2BSTA 4EUPH 3GSQB 1F02I 2CDGB 3TIEB 4NHCL 1F3DH 1OP5K 2IPKA 2WBJD 3CCHB 4RMTA 2QADB 5CINH 4JREC 3IGAA 3C5ZA 3EDKA 2ZSWA 4GKNA 1NCDL 2EYSB 4QRUA 5GISH 3MTRA 4MXQC 1CGWA 4P4KC 4ODXA 3LS5H 5F97E 1MHHA 4NRYB 1C16A 5KSBB 4NWUL 3VMOA 4Z7WF 4PPTA 1LO2L 1YYLH 1BZ7A 2C5DC 2Y7QA 4PJEB 2ADGB 4AEHH 4DN3L 4HF5H 2VOTA 3MLSL 5LCVL 5IB4A 5K59F 3WHXA 4QWWD 3FFCA 4G80B 1WFNA 4X7FC 2HRLA 4L8SA 3S37L 4PUBH 4U1SA 3QNZB 5EU6A 4CAGA 2NLJA 5DC4B 1MCOH 2XY1A 3BPLB 2M2DA 4FG6D 3UCRA 1RHHA 4LF3A 3ARWA 1DBBL 3QQ4A 3MRKA 2Q76B 5EOQH 5GGRA 1FZMA 1PQZB 2RFXA 3ZDZF 1H3XA 3RGVB 1FLTX 3IU3A 1S7TA 4HV8A 2FJHA 3WXWH 3QHFH 1H3PL 4MQ7A 1K4DB 1RZKL 3A67L 4NO0D 2P45B 4PD4J 3PDGA 2BNRE 5CHNA 3OWEA 1J05B 1CU4H 4PJFA 4WTXA 4DKFH 1MEXH 4TULH 5DD5L 4LRIC 5CKAA 1NGYA 5KSBA 4HC1H 5E6IC 1IM3A 4LLVB 3ET9F 4NCDA 3QG6B 2DYPD 5KSVB 1U3HC 4MGXA 1G6RL 4R97C 4GT7A 5I74B 4HZLB 5SV4A 1KCRH 4XNQA 1FGVL 4P5TC 2ZUYA 4GXUM 2CMRL 4LBEB 3R4DA 1LHZA 1HI6A 4FMFA 5D1XC 2BSSA 4AZ8A 4I0CC 4HKJA 4P2OB 1WBYA 3B8SA 3RGVD 3RVXD 1G84A 2E7HA 3QXAB 4HT1L 1CE6B 5FO7A 4GXVL 5T5FL 1JNJA 4PRHB 3L3IB 2AJSL 3ZLQC 4LQFL 3MOQA 1IRAY 1RY7B 4R96A 1PKQB 5AG9A 2AJ3B 2HT4C 3DGGA 1NUDA 1S5HA 5BS0B 1KB5H 1LO3H 1GOHA 4XPTL 5C0JB 4Q2ZA 2AW2A 3UJIH 1H3TA 4HS6A 5DJZA 4MCZB 3J7HA 1G1CA 3KPPA 4RDQF 3MLUH 2ID5A 5D6DC 5TE6H 4LCCB 5C07D 1W8NA 4WFFD 3WFCL 1N8ZA 2W9EH 2HLAA 2NY2B 3IU4L 5HI5C 3HE6A 1IAKA 2AEPL 5I1KH 4A6YA 1DBKH 1A4KB 3S3JA 4HJGB 5LXGL 3L5WA 4B7LA 1F3JB 3V4UH 4G8EA 1CG9B 3S96B 1DBJL 4D9LH 5H35A 1CT8A 4HC1L 3DVNA 4PLJD 4PP1C 5IMMB 3GJFH 3U30C 5HYJE 3HC0A 3MRDB 1YEDA 4EI6A 3NIFF 3GMMA 4RRPG 5FO8B 3WO4B 4DGYL 3S3PA 2FATL 1EBPA 1OTSC 4XMPL 4DEPC 3EGSA 4XVTH 3P4OB 1MJ8H 4MWFB 5J12B 4IOIB 5L2KD 2NXYC 1J1XH 1XGPB 3D69A 4AENA 1U3HD 3QXVA 1J88A 1YEFL 1B0WA 1CZ8H 1S7WB 4H20L 1ZAGA 3O2WH 5C0FA 3TCLA 5H94B 1AJ7H 1PFCA 5C08B 1P9MA 3MREA 2UZYB 3TFKC 3VFNA 3V0AC 4KVNL 4Q9QL 1WUNT 2HFFA 5E2VH 4NN7B 3FCTB 3UTQA 2B39A 1U8NB 1HKLH 4LK4A 1DDHA 3B9AA 1N2RB 4KI5D 3UTZB 4ELMF 4L4TD 3LKQB 1R3HB 5IVXB 4GW1A 5HTSA 4MJIE 1JWMB 1KJMA 1E0OB 4LLQB 1II4E 1FORL 3OQ3B 4YGVB 5C71A 4R2GD 5T5NG 1FYHB 4FMKA 3FQTB 1DBMH 4KUCD 2BNRB 5ALCL 1SY6L 4KI1A 1BD2A 2NY0B 2J1KA 2VL5A 1S78D 4R4ND 2B4CC 4XBGA 4QOKD 4DN3H 5I76A 1Q9WA 4MXVE 1T03L 3V4UL 4F57H 4Q9BA 5JZ7D 4WHTA 4IOIA 1VENA 4KMTH 2UY6A 3DV6B 4PGCB 4WEBH 2JK5A 4JN1L 2Y7QB 4PJEA 1TQCB 4PGBB 3T1FA 1J87A 2P1YA 5IQ7L 5JZ7C 4PLKD 3BGMB 4NM4L 3WIIH 3GBLA 4DTGL 1DBBH 3U79A 3QAZB 5EOQL 5IMLA 2ZOLA 3NIFE 1AKJB 5E8DH 3RWEB 2DJSA 3TNMA 4F2MA 3JWOL 2YPLE 1D5ZA 3FQUB 2VXQH 3L3KA 4WV1C 1F4WH 5EBMB 4QEGA 4TNWF 4YO0B 3UJTH 3P0VL 1LK3L 6FABL 2JCCA 3NACL 2IPUK 1EGJL 1AO7E 1CICC 5INCA 4ZTOL 3JTSB 1VDGA 4GRLC 4N8VG 3PNWA 5F1OB 4KUZH 4QWWC 4U6HB 1RUPH 1XGTB 1S9VB 1X5XA 4PGDA 2BNRD 1YDPB 1HOCB 3ARVA 3HZKB 5E5MB 4HIIA 1ED3B 1OF2B 1PAMA 4MXVF 1R5WA 1RFDL 2YEZB 1P7QD 4L3AA 1W2KT 4M1DH 1U3ZA 4U2YA 4LOUD 2LABA 5J1AB 4X0KA 2VABA 3KPQB 4R0LA 4PB9H 1JPSH 4K07A 3HS0A 4LL9A 3ARGB 5IF0A 3EJJX 1I7TA 1OT2A 4CADB 3K1KC 3O2DH 4KKLD 4U31A 1CS6A 1MCCA 1TCRA 5EDXA 4KMQA 5D1QD 3QQ3A 4KK5C 1KYOK 1PKQA 2P8LB 4CNIA 1J8HD 3ZYZA 4ZFFA 5I1CH 4O9HH 1VGEH 3K1DA 1OCWL 4M7ZB 1KUMA 1MUJA 2A6IB 4EI5A 1PKOA 2I07A 4NC0B 2MHAB 4HJJH 1T0NA 1SBSL 3HE6D 3SDCD 2X9YA 5BRZE 5DRWA 3G6JB 4MAYA 4XP1H 3MRJA 2FLBT 3U7YL 5B39A 4NM4H 2YKLL 3WS6C 3GMRA 1ZT1A 4PUBL 4APQA 3HFML 4JN2B 1F42A 3CUPA 1I8LC 3L3OB 5HSFA 1PDKA 5EPMB 4BFGA 1NC2A 3CDGB 3E6FB 6CGTA 5A2KH 5L6YH 6FABH 5B8CC 2R2BA 1E28A 1CD8A 1JHKH 3P11L 4XWOD 5EU3A 2E3VA 3L7EA 1EO5A 4LSVH 1Z2KA 3LH2L 5D2NA 4RGMB 3T2NH 5HBBA 2JJTC 1QBLL 4BQCA 3EOAA 5DD3L 4OUUA 4X6DA 5ETUB 2AQ1A 5L9DH 1T83A 5DHYA 1DJSA 4WENB 4OFYD 3WO3B 5E00A 1WTGT 4G9FA 2FZ3A 4Z7QE 3DV4B 2ZOKB 4HKBA 4WTWA 1AO7A 1HILA 2OLDA 3SGEH 4K3JH 5DUBA 1BJMA 2DB8A 1NLDL 1W0VA 4X80H 5ISZE 3DYMA 1X5AA 4L4VE 5J11C 4WDIB 2X4OA 4F33A 1Z5LA 4JHAL 3L3DB 1U8IA 1MY7A 4J2XA 4XPBL 5EU4B 4XNYL 4EI5C 4QXWA 4KKCC 4Z0BL 3KYKL 3JWNC 1MLCB 1CK0H 3MXVL 3TWCL 2R29L 4YDVA 4JO4L 1KPUA 4NO0A 4ZDHA 4EUPA 4UB0L 3Q3GB 1JPFB 1TVDA 3QIUD 4WWID 4H25A 2XZAH 4EVNA 1SJHB 4G8GD 4LGSB 4BKLA 3M8OL 3REWA 1NFDA 4Z0XA 5GS1A 1HHKA 1WCBA 4DZ8A 5J0BA 4PJ9C 4LVEA 4M5ZH 3FB5A 4H0IA 3BIAX 4N90E 5IVZA 3HHRB 1RIVH 3R8QA 3BRGC 5ECJE 4EDXB 1SYVB 2Q86A 4TULL 2IG2L 3LKSB 4K2UL 1AE6H 4Z77A 1P2CB 3TBWA 1FNGA 4HXAL 5T1LD 4GUPA 5EO1B 5MENA 4YHNA 1NL0H 4GKZB 3HC3H 2D31A 4B0MM 4W70A 1U8JA 1H8OA 1FDLL 4JRWA 4RWHA 1DVFD 2FSEB 1U93B 5T3XH 4WUKH 2VDML 5E8OB 1WZKA 4ONGH 4CBPA 2LTQB 4OZIA 5DUPH 2DM2A 1MY5A 2NYYC 3FQUA 2D9QB 5D1ZC 5I1JL 1BBJB 5CIPH 4X99B 2XWBB 1KN2H 2ENYA 1A0QH 5T3ZL 1MIML 5TGBB 4C54A 1J0HA 4O2CB 1UWEL 4PRPE 3PWVA 5DJZB 3SE4A 7CGTA 1FNAA 3WLWC 3QH3B 1J0ZA 3TVMB 1JMZA 1FV1B 3FFDA 3SKOB 1P7QB 4I18B 4E5XA 5BMFH 3MRLB 1N0XL 2RHEA 4LLYA 4RAUB 2NZ9D 3ZZ1A 5KVDL 3T65A 2GQHA 2H3NB 4XVSL 4J8RA 3MOBL 5FOBB 5ILTL 2IH1A 4KJWD 1YEFH 4KI5F 1E4XI 4PJ5B 2ZG2A 2JIXA 2I5YL 3QCVL 3PWLB 1A7NL 1N6UA 3LDBC 4NQTA 2EH8L 4FZEL 5ID1A 4BELD 3O6FB 3GSUA 4KUCF 1A2YB 3THML 5I1KL 3D0LB 4XNZC 1CLCA 1EIBA 3KPSE 5D2LB 3BX7C 4IIQC 5HYJB 3JUZA 1TENA 1N7ML 3KPNA 5CS7A 5GRUH 3U0WH 1IEBA 4WEMB 4O2CA 2IGFH 4U2ZA 1TTGA 1FYTD 5L2JB 1X5IA 3MGOA 3HC3L 3QHZH 1YEDB 1U3JA 3I6KB 5T1LA 1GH7A 5GGTA 2VO5A 1K85A 2CQVA 2NY7L 3GI8L 5SX5K 3RVTC 5HHME 4ZXBC 1VADB 2E27L 5F1SA 1N6QL 3DUUB 2C4XA 2DQDL 3G6AB 3QO1A 4KH2A 2X1OA 1RMFL 4EN3A 4E0RA 5I8EB 4GG6E 2EE2A 1MCSA 2WBJA 4LSSL 4QRRD 3MCLL 5ITBH 3GMQB 4MZ2A 2HFEB 4U4BA 1ZHBA 3X13B 4HSQA 1WT5C 3TFKD 3TT1H 1CVSC 4I8DA 2IF7A 2VITA 2DQEH 3DO3A 1UKSA 1JUFB 1BEYH 2JELL 2Y07H 1YMMD 4RQQB 1K6QH 5HJ3A 2FX7L 4QO1A 1KBGL 5I1IL 3P77A 2B1HH 3D0VB 1SVCP 3ALPA 3DURB 4LLQA 3U6RB 2XA8L 5K9OB 4PRNA 5HDQH 4YBQC 2JLLA 4MAYB 2V7HA 2E7CA 5ID0B 3IETB 4PJ8D 4TSAL 1RZJH 3RY5A 1DDHB 4BFBD 5L8JB 1DQQA 3T8XA 1BECA 1X5KA 3S97C 1F45A 1OLLA 2LAGB 5E6YA 2AJ3A 5FCUL 2NNAA 1AHWA 1INQA 3PDOB 4HWZA 4BUHA 3OAUL 1DQDH 3B9VA 3A0OA 1Q94B 4MCYB 4WHDA 5DMJB 1T2QH 3REVB 3T2OA 1JRHL 3VW3L 1NLDH 4HUXB 3VI4E 3ZYIA 3B43A 3MLWH 1YEJH 1HXYB 1IC7L 1CE1L 1QR1A 5SX5H 3WFEL 3QUML 1DE4B 4G9DA 4X98A 1SBBA 5DD1H 5M95B 3B6SA 3UYRH 3VXPA 4LQ1A 2BVQA 1OAKH 4WEBL 5JUEH