4MB3A

Crystal structure of e153q mutant of cold-adapted chitinase from moritella marina
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLQQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chitinase 60
publication title Crystal structures of substrate-bound chitinase from the psychrophilic bacterium Moritella marina and its structure in solution
pubmed doi rcsb
source organism Moritella marina
molecule tags Hydrolase
total genus 173
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4mb3A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb3A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb3A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb3A01
2X0HA 1U6AL 2X4NB 4HIEA 2ITDB 3NH7H 2WZPD 4RFEA 4NZTH 4ZUWB 3LKPA 5B8CC 5ANMA 4GG8B 5B38A 3ZO0A 3QQ3A 3HE6C 1V02E 4J3WA 3V7AE 4KKBC 2GCYA 5ESQA 1NGPH 4KFZC 2BNRD 2XQYG 4Z2IA 4P2RD 3ULVH 3PQYD 2AV1A 1MYRA 3M07A 4F8TA 4OZGE 5F3HA 1UWRA 3DGGA 1BG9A 1NCDL 5IIEA 2BY2A 1FV1A 4XTRD 5IEHB 5EOTB 2GTZB 1EAJA 1RUQH 4MCZA 1DANU 3ARGB 5D1QC 1DWGM 2FJGB 2Z8VC 4LLWA 1MNUL 4CAGA 2JIEA 1D9KA 3DRQA 2X4SB 1A6TA 4DK3A 4UTAH 3G6LA 4HPGA 2EECA 4N0FA 5DEFB 2EEDA 4Z7UE 1XT5A 3RVWC 1DBAH 4NQTA 1QQDB 4LK4A 4OFPA 3S97C 4JDTH 3WIJA 1BYCA 2BXZA 3BH4A 3RDTC 1V6VA 3JVGC 3NTCH 4PBGA 4CCDA 3IS0X 1UJ3A 2AXFB 3RHWF 5FECB 2J78A 1M71A 5ABHA 1OINA 1ZTXH 4UCFA 5SX5H 4XB3A 3N1GC 1OSZA 1SEQH 4F7CB 4Q2ZB 2CK2A 4OTXH 3LS4L 3HMXH 4OD3L 3FQNA 2D31A 2EIDA 1NL0L 1MCFA 3AHYA 1QA9B 3HCVB 4FFWC 4YIQB 2WPGA 5AYBA 2OLHA 3MJ9H 3ULVE 4KK6D 3LSOA 3MTRA 5FKAA 3B9KC 3AIBA 1S7WA 5C0NC 2YC1A 2WWCA 1BIHA 2AJSL 4F80A 4BZYA 2BSED 4JFXA 3O9WC 2JCCB 1OGTB 2DM2A 4ZUUA 3U5YA 1P1ZA 1RVFH 2DWEB 1UWXK 3MFGB 3RVUD 4M3JA 3QHFL 4HPOL 4IMKC 2WIIA 3CHCA 1NAML 3FFCE 4F37K 2Z31A 3RWDA 5DK3A 3WBAA 2Y24A 3C08H 3U4AA 3CDYA 4ZOCA 3PHOA 1WZAA 4EDXA 3A47A 3SDXE 4G9FB 3VXRD 1U42A 3MRDB 1I4FB 5BMFL 1OT2A 4PV8A 5ESVA 4E8CA 3H42L 3SKJL 3VFPA 3MGOA 1OBAA 1XGQB 3GXIA 1F3DJ 4QOKA 3HG1D 3MRGA 2JF7A 2A0LD 4MHHG 3BX7C 5CPSA 4Y5VC 1AHWC 1R3JB 2HVKB 3C6LC 5D1ZC 5B39A 2GW5A 3OAZK 1TVBA 5F6HI 3BAXA 2IMMA 4XNZB 3TIEA 1V6XA 2HLFC 5CSBA 4XZBA 5D5MA 4EVNB 1HINL 4XCYB 1XF5B 3WJLA 4OZIB 2DQEH 1MUJA 4K94H 4UOJA 5AZ2H 4DUWA 3BLKA 2A1WL 1Z32X 3G5ZA 1H3PH 3O3BA 2ADIB 5EO9A 4P57B 1IL1A 4QWWD 1I1AC 3FONB 5TH2B 1N8ZA 1NMAL 1YJDL 3VJ6A 1SBSH 4Z7NF 2J3SA 4G6FB 3BMVA 1I9EA 3SCMD 4OCXH 4APQA 1JF1A 4PJXB 4KRNA 4PJ9D 5MI0B 5A8QA 5E8PB 1ADQA 3QFJA 2HWZL 5BXRA 5T1LB 4HDIB 5IGXL 3JWNC 3SKMB 2L0DA 5KSUA 4I3RH 5K9QI 3BT2L 4DGVL 4WTXA 1U8JB 3NIDF 4P5KB 3Q5OA 1CBVL 2IBGA 1V3MA 5AAMA 3P4NA 4JFEA 5HI3C 5BVPH 1YEKL 1PD6A 3UZVB 4BA0A 1KLFA 5IMOB 3MRKA 1I3VA 5I66B 2D4DA 3EUUA 5C09A 3VGEA 3ZDYE 1FIGH 1XFPA 4FQIH 4YPGA 1WT5C 2C1OA 1UOKA 25C8H 4V28A 2E5EA 1WP6A 4ZUTA 5GGUB 1G0YR 1LO0L 1A6WL 3AYRA 3MJ6A 4LNVA 2YSSB 5A2BA 3NCFB 3RIAF 3WN5C 1KJ2B 1MHCA 2DSWA 5C0EB 4UDTA 2F74B 1EFXB 5CJBA 1FFNB 2RB8A 2KPNA 3OB0H 5C08E 3INUH 3PTQA 1RZGB 1W2KT 3CLFL 5TDOA 3SE9L 3VFNA 2E6JA 4RIRB 2R0LH 1JN6B 4UMGA 2EYRA 4LVEA 1LP9B 3GO1H 4V1DA 3KPSB 1QOKA 2V5YA 1NEUA 5EU6D 3MZGB 1AKJA 1MFCL 1IARB 1SJVA 1D5ZB 1QOXA 3GBNH 2D03H 5FCSH 3PWUB 1ES0A 1UFUA 1KN2L 3QQ9C 5D2LB 3ZHKA 1S9KC 3MJ8A 5GRJL 3IU4H 1AJ7L 1DQDH 3BE1L 4PN2A 4NJ9H 3VFMA 2Z1SA 2PTTB 3VDCA 1NPUA 2C1PB 3MLWL 2J8UE 5FKPB 3BPOC 1F3JA 3PHSA 1DWFM 1UZ4A 3AB0B 3BWAB 4FZ8L 5D72H 3PL6D 4LU5L 4PJIA 4OCSL 2VITA 5EIIA 4LRNL 5FYJU 3QG7L 2COQA 5CAYB 2VLRA 4WO4C 1AGEA 4J2XA 4R0LC 3W5NA 1B3XA 1MREL 3MSDA 4Y19D 4WWKD 5IB3B 5CZXC 5ISZB 2NY2D 5DR5L 3I50H 2BVOA 2DIAA 3V4PL 1GOWA 4Y4HB 3IFOA 4WY7H 3LRSB 2FHBA 1QYGL 3IDYC 4G7YH 4I3SL 4FFYL 4JO1H 5I1IL 3QUKB 4RE2A 4YFEA 4R4BA 4XVJL 3WMSA 1PZ3A 1B2WH 2WBWB 5D6DA 5C1MB 2DH3A 4HC1L 3T2NH 1V02A 4IPLA 2FJHA 3A67H 2I9LB 1K3ZA 3WQ8A 5FUCE 5C0RH 2NW0A 4OCMC 2YMXH 1SEBA 2BY3A 3C8KB 4RZCB 2AK4D 2IG2L 4LSPH 5C2BH 1M04A 3CHDA 4OZGA 4YO0A 1GOOA 4JAMA 2QKIB 3P0VH 2OMNA 1K85A 3UBXI 3QJHB 5F96L 4YDJA 2H1PL 1KCVH 2HKFL 1MFVA 1KJMB 4BA8A 4P9HL 2P43B 3EOBB 1A3QA 4F3FB 4PTWA 1QHPA 2VLJB 4M61B 1K6AA 4WI7A 2CIPA 2JALA 4LSRL 1JTTA 4AM0A 1EJOH 1JAEA 5K9JH 2QLYA 4PJGF 4Z7UA 3K81A 4LQFL 1JMZA 1Z9LA 3DUHA 1NBVL 2CRZA 4Z2KA 1FLRL 2NZIA 1JHTA 5GSRA 3QUMA 3ETBF 1MLCA 5HGHA 3IDNA 3DMMB 4FQ1L 1IAKB 4S2SA 3QAZB 4NN5C 2BVDA 4TPRH 1FL3B 3C5ZC 2JJWA 2Q7NA 4YHPB 4CU8A 2YL9A 5DUML 5HYSG 4FFZL 4H88H 3PBGA 5IV2A 4M7LH 3SDAA 3CC5A 3PWLB 2HJFB 1KCUL 1KPUA 3L4TA 4NUJA 4RGOL 1F6FB 2IADA 5T3ZD 4AZCA 3G08A 1R24B 1IAOB 3FO2A 4JZ5A 1LD9A 1CFNB 4Z7OF 1J8HB 1HIZA 4PCTA 3B9DA 4NKIH 1SMAA 3GK8L 3GMQB 1E6ZA 2QSTA 3UTSD 4HBCL 1ZLVH 4OIIH 5I1AA 1H0IA 1KENH 1YEHH 3MRBB 5DHVA 3QDGE 3IGAB 2WWMC 4HFWA 1DANT 4ONFH 2BSRB 3I6KA 4LLMA 2V2TB 1DUYA 3I75A 3OIHA 3DHPA 4QHNA 1HEZA 4K8RL 2WMKA 2D3VA 4X4YA 3TZVD 1CDJA 3OGCB 3IFPB 1PZ2A 3V2AR 3TBVB 2VLMD 5IEKA 4H8WC 2VTFA 4Z95L 4NWUH 2I25N 5GGTL 3EJJX 1MF2H 4ELMA 3FFCA 4HIXL 2B0SL 4OQ1A 4NOBA 5EG6C 5CLWA 4V2CB 1WBZB 1JGEB 1PEZA 4FTVD 4ODVH 1XCQA 3LS5H 3D2UB 1UR1A 3FN3A 2OBGA 3NA9H 4ZENA 4R90H 1T4KA 4JY4A 1I8IA 4JREB 2CHOA 1A02N 4ZS6D 1FZKB 4WI4A 1AXIB 3DUSB 2HTLD 2APVA 1NDGB 3TONA 4LNRA 1N4XH 4BZ1H 1T04B 4LSVL 4NQVB 1LVEA 1FA2A 3WO3B 4FABL 2VCCA 2WBJB 3U6RA 2E9LA 2VXTL 5ADPL 5HHOE 1FH9A 1OD9A 3SHSA 3EDFA 2P8LA 3RPIA 5E6IC 4U05A 3KLHD 2ZUQC 1FL5B 1UD8A 1U36A 3C5SA 3LPGA 1S7SA 2J7DA 4DM2A 1MCWW 2A9MH 1BM3H 3HMXA 5HHQA 4J28A 3WMCA 3N1PC 4O2EB 4ZOEA 1PKQB 5FO8B 3RA7H 2NT1A 1QKZL 2YKLH 5ESAB 1RUPH 4F7TA 5MP6L 3MJ9A 2OQJB 3DMMD 3CFBA 3ORJA 3STLA 3UETA 4I4WB 1G6RB 3QIUA 2APXA 2HFEA 4WKHA 3EFDH 1UM5H 2JK5A 3BZ4B 4TRPH 5E70A 5GGRB 4K8RD 1ZBWA 1ZT4A 3TEUA 1LWRA 1ZHNA 4HFUL 3BVNA 2Q7YA 1ZA3A 3EOTH 3GJFK 1BLNA 2DKMA 2W60B 4HX1B 4H5SB 3LMJH 1KJ2H 4XGZA 4Y4KA 1F2XK 3X14B 4AD4A 3GSNH 4KWUA 3FB8A 2HVJB 4TTDC 1JZ3A 2QJDA 4XPFL 1INDH 1EJ6A 5HGAA 5HYJD 5E99L 3CPLB 4JDVB 4PRAB 4R2GC 3GUTB 2EDQA 5GS2H 1RJYA 1D6EB 1S7RB 5IMLA 4R97C 3MRPA 2EYTB 1PZUB 4OIBA 2D23A 3D18A 2OM5A 1KELL 3T0EC 5DT1H 1MQRA 5GPRA 1HXYB 1VADB 4LLUA 1JWSB 3QO0A 1DWAM 3FO1B 4L4TD 1NFIB 1R5WB 3OG2A 4ISVA 2FB4H 2YD1A 4X4XA 2ARJA 3O4LB 4PBWD 3MMDA 2VDOH 1X5HA 3MXWL 4JFHE 4PJHF 4EIZC 4Z7WB 3ULUH 5BYWA 5D2NB 2Y8KA 3P4MB 1MXDA 4JDZA 4EDWL 3WEOA 4NQUA 2Y1VA 1MW1A 4MNGE 1F02I 2BC4B 3Q5YA 3AOFA 2X4OA 2ADJA 5BVJA 3V7AG 1QSEB 4LLDA 2EH7L 2X4RB 2HT4D 2XXMB 3KPLB 3O6FC 5D9NA 2ZSWB 1T66D 3SE3C 1GGCL 5C9KA 5I24A 3VXMD 5EU7C 4AEFA 3U82B 3G6JE 3BZEA 2RGMA 5ADOH 1KBGH 2YL5A 4NKDB 4H8VA 4WDIA 1I9IL 3C2SA 1PQZB 2J8UA 4KHTL 4FS0A 1PX4A 2V2WA 2ZSVB 4HLZH 4PGBA 1N3NA 4EUPG 2GFBA 2HT3D 1DL7H 3G6MA 3HZVB 4WFGE 3AM8A 3KPNA 1G7IA 1UYWL 3I6GB 1T2XA 4R26L 1TQBB 3VGFA 4Q9QL 4OFYA 4U0RC 1WAAF 3LN5B 1H8NA 4JPWL 1GIGH 4DWHA 1WDPA 4GRWF 3WD5H 2OTUA 5DQ9B 1C5BH 3H7BA 4DGYH 1YEJL 3VFVB 5D2LE 4U1IB 5L9DL 2GQHA 2OL3B 4UBDD 1IC5L 1MCDA 1S5IH 3WUEA 2G60L 4IOIB 3ROLA 3MODH 4WW2A 3LZFH 5JQ6H 5LCVH 1NWRA 2G3IA 2LFGA 1VJZA 1B3JA 1O7AA 1GAFH 4U1MA 2VJXA 4LEOB 3BZFB 2D7TL 1DVFB 1PY4A 4PJ7E 4OM1L 5DK0A 2VCAA 1A3HA 1MSPA 4JFPB 4OD2A 2HAZA 5DF0A 3QDJE 1MIEH 1KWGA 4KK5C 1U3HB 1D3CA 4XVUD 1LGVA 2DF3A 1Y18B 4ZO6A 4WENB 5JQHC 2EXYD 4J6RH 3M1BB 3HPJA 5JUVA 2V5DA 4GMTH 2VN4A 1ZS8A 2R0KL 1QNQA 4XBGB 2WMJA 5JXAL 3C8DA 1FYTE 1OAKL 4HZ8A 1T7ZA 4F57L 5L7XL 3EFFB 5MEOB 1YY9D 4XP9H 1JK8B 1RSFA 3I6LE 2VISA 2H32H 4NRYB 5CGMA 1JWUA 3PZGA 1M7IB 5D71H 1HL9A 4Y5XA 1SM3H 1OF2A 2XGIA 5I1JH 3IVKA 5H37G 3N85H 4HULB 1F3RB 3BQUD 1MI5E 1J0ZA 1ONQB 4NZRH 5FA4A 3RGVC 2C7UB 3BD3A 4QRTA 1OD7A 3QUZC 3EW3B 3RZCC 4LX4A 4NNPL 1NMCB 4JG0H 4N0YL 4NZJA 5BO1L 5D1XA 3EIFA 3KPTA 1CBGA 4K3DL 1WBYA 4MVBD 3TPKA 2YDRA 3PHAA 4L4OA 2WMPA 4HQQL 2DGAA 2J12B 2VLJE 5CEXA 4P4KB 1KGCE 2E3VA 2X4SA 2F54E 2HKHL 2EXWC 2XQYK 3RUGB 1X5FA 4TULL 5FYLL 4WLCA 1IC4H 4NRXB 1LEKB 4GW1A 5BV7L 1CXIA 3QDGA 4PLKC 5IROA 4PRPB 3MCKB 1DSFL 1RJLA 1J18A 1EMTL 2GSIA 4Y16C 3VFTA 3D1MC 3FOLA 1EOMA 1UWGL 2YD9A 3THML 3NCMA 1CLZH 4XNYH 4BCEA 1ADQL 2IMNA 3K4ZA 1DP0A 1TDQA 2X1XR 4YAQB 5FHAL 3A4AA 3NFNA 2EC8A 3STZA 4BQ9A 2Z31D 3RNKB 2ZG2A 5F88A 3TF7C 3VXQB 5M17A 2ZG1A 5AYIA 2GAZA 4HH8A 3WKML 3RIFF 1DVFD 1O7SA 2J2ZA 4OKDA 5A3ID 3ZJ6A 1T3FA 3MXVL 4N9GA 1QA9A 2NW2B 4QLLA 3ZDXE 4NCDA 5C8BB 3UTTE 1WF5A 3DETD 1OSEA 1A3LL 2NR6C 4HZLA 2AXHA 5GHWL 4QKXB 1A0QH 3GSVB 5HHOA 2IPTH 3DV4B 4PMUA 4G6JH 1MJ8H 1JNNH 2XRAL 4QOKD 1W72A 1OGTA 4XXCC 3ULSA 5HDOA 3PV6A 1ZVSA 5J7CC 4Y1AB 4UT9L 2OYLA 3QG6B 4FQQB 1V0MA 5SV4A 3MRIA 3S9DB 1A7NL 4UIMA 1HNFA 4UQ3A 3DSFH 4KKAD 5MENB 3TCLA 4OCWL 3ZR5A 2X70A 1OTTD 1U95A 1U8HB 1U8NB 4XPAH 1XH2A 3V6FA 5FYLD 1UCTA 5D96B 5GGQH 4RAVA 1R3HA 3V0WL 3U79A 4ZXBA 1OTUC 1KB3A 2YK1L 5KSAB 4XPHH 4I48B 3SDCB 2X5PA 4PUBH 5AC4A 4Z7VB 2VDQH 3P4OB 1F90H 5FYJL 3VGGA 3UBXB 3QFJD 4C56A 2OK0L 2AKRA 3UX9B 3FT4B 4DQOH 4I18B 3L3KB 5IMKA 2RIKA 2A3BA 3WE6A 2NZ9D 4Z7QF 2E0PA 1TQCC 4K7FB 4MA8L 3RRQA 1T7VA 4PGZA 3RWGA 4Q74A 3QPXL 4JFED 2DLIA 2HH0L 4P46B 1C08B 2E4TA 4KHXH 1GOQA 3CAFA 5C09D 1XYZA 3L3DB 3QCTH 4YDKL 2EPLX 4D0CB 1U41A 4J3OC 3ZKNC 4U1NA 5IB4B 2HFFB 3IFLH 2VZSA 3AHXA 2RAMA 4TTGA 2OI9B 3DX6B 4X5LA 5DRWB 2XWEA 1IZKA 3R0NA 1YNKL 4WEBL 2WMIA 1ZEAH 2VSCA 4AH2B 3S96B 3O11B 1KB5A 1NGWB 1TJHL 4U3XA 4JM2C 3MZTA 3NAAH 3WH7A 1Z6JT 4HIHA 2WNWA 2NY3C 2VIRB 1WAAE 2J7LA 3GNML 4XP5H 2IH1B 3QXTA 4HF5L 4CVXA 4LCYB 3AREC 4MNGA 3MRJB 3UJTH 5CS7A 4JRYE 1RZJL 5I1CL 2OTWB 5GGSB 4G6ML 1XF3A 1F45A 2IGFL 1LK2A 3FAWA 3RWIB 1BQSA 2WV3A 3VIIA 5B3NA 3G6JA 2FR4B 4NT6A 3EYQD 4MDJB 4XUYA 4D6GA 2ORBH 5FYJD 2WMHA 3DGCR 2EPMX 4QDMA 2FDMA 2OL3H 4NFDA 4YK4C 5E2UL 1PG7W 1EFXA 1NGZB 4FN0A 4R7DB 3GSNA 5MEND 5FO7B 4R3SA 3QUML 1N6QL 3O4LE 5D7JA 5IBLD 2WAGA 1BFOA 3VXTB 3W38A 2OCFD 4MXQC 5EIVA 1KR0A 3VXSB 4AW7A 1HSBB 1GVYA 1QBBA 2VLRD 4D9QD 3JXAA 4Y7MA 4H2CA 2DH2A 3BDXA 3ALWA 1R5VA 3V4UH 4PTTA 2OYPA 4U31A 2DM4A 3C9NB 4NGHH 2O9RA 4UU9B 1I1WA 3JUYA 4KGJA 1QBMH 3B9VA 5E94A 4PJGA 3NH7L 4X5WA 5D2LA 2ZUTA 3L4ZA 4CADB 2O26U 5HVFB 3Q48A 4NRSA 1ISVA 3WHE1 4W81A 5E1HB 3VA6A 1NGPL 3MV9A 4PJ7A 5CP7B 3ULVL 1JPGB 3QDJA 4WJXA 4J27A 4HG4J 4YHZH 3FQTB 4JO2H 4QEGA 1GUVA 1ITCA 1L8NA 3ZYIA 3CH1B 4D2NA 1OCQA 4NIKB 1FYTA 1AFVH 4QXTB 4Y2DA 3FMGH 2D3LA 3WEXA 4OQTH 3B6SA 4HV8B 1V7NH 3W0WE 3MLSH 2P46B 5FA3A 4UTAL 1JNHB 2W1NA 4QGYA 1I8LA 2YA2A 1FNEA 5EZOH 1DBAL 2K9UA 3O3AA 3MOAH 2J7GA 4JDTL 4YHYB 1JNDA 3O8XC 1ORQB 2JF6A 4QLJA 3TO4B 1MI5A 3NACL 4GQ9H 4M6ML 1OCWH 1R6VA 3NTCL 4U1GC 4OGXH 1YEFH 4TVCA 4G8GE 3DTXA 3QHOA 1BZ9B 4NQCB 4PREB 4D1JA 1YA5A 1FHDA 2NW3A 1EK3A 1KFWA 2OSXA 1ZTXL 1CG9A 3RL1A 1U92A 3SDAD 2SEBA 3V5HB 1OGGA 1LDPH 3HMXL 4F3FA 4P7OA 3QQ4B 3BEWB 3H6JA 4LCCC 4JR9L 1TETH 3CUPB 2F54A 3RQ3A 3LPFA 3QXVA 3MJ9L 4S3KA 5DUPH 1E1FA 2BMKB 4UOZA 3QUXA 1WZ1H 3VXNA 1CFTB 1FNHA 1VGKA 1XGPA 4ZFZA 1X5ZA 1CXKA 3SY0B 1WNOA 4KH2A 2AI0H 1RVFL 1I8MB 1FL3A 1AE6H 1CFVL 2ZOKB 3QFDB 1FBIH 5IFJA 3X3FH 2ZXBA 1QLEH 3CTTA 3BPCB 4JB9H 2VDKL 1B4JH 4H04A 1UZ6F 1QEWB 3PXJA 1CVSC 2YD7A 1U8MA 3EYOA 1HIMH 3BWUC 4I0PC 3E8UH 3C08L 3CZFA 2H32A 3VH8B 5J4MA 1UKOA 3IF1B 1R24A 5GZND 1VBRA 3N18A 3U7WH 1B3VA 1EX0A 5EOCH 4HOWA 1U8QA 1V3JA 3ARBB 3PTKA 2MPAH 4EI5C 5HHPA 2GTWB 5IK3A 1AC0A 3UTTA 1KC5H 2IANE 3WXWH 3H8NA 4PRPE 4MJIB 3R1GH 2V2TA 2NXYC 4LLQA 3LRGA 3X17A 4NKMA 5IB1B 4UV7H 3U0TB 4IS6A 5FF6A 3P40A 3QXUA 1KACB 2ZUWA 3OGCA 5IB2A 5BRQA 4CD5A 5DYOA 2V7HA 1C7TA 4MWFA 5I1DB 1XGUB 2B2XL 1A4KB 4YHKH 5EUOF 3IFNH 5AZ2L 1WCBA 3WNLA 2EE9A 3MJGX 1H3PL 4U1LA 1WIOA 4XBPB 1KWKA 1NEZA 2DDQH 3MRHA 4XMPH 1B6UA 1C91A 5H2BA 3T8XB 4LDOB 4TUOA 3GEWB 2APWA 3BESR 3DUSA 3B5HA 3QIUD 4GJTB 4M4PA 4NQCD 3ARDC 4R4FL 5A6MA 3P0YH 1UM4H 1XH3A 2F8VA 1O6IA 4D6IA 1VF8A 3D3VB 3AZTA 1LF1A 3AMLA 3NDYA 5M94B 4W68A 5HJ3A 3TJHC 3VE0B 4UFHA 4XVTL 2P8MA 4ODUB 4I3RL 5FDYA 2APBA 3P73A 3SPVA 4ACZA 3EDDA 5HBBA 2DLEA 3H3PH 4M29A 1NCTA 3IKCB 4Y4KD 2R1XB 5TE4H 4GW4A 3WF1A 1T83A 1R87A 3PWJB 3L3IA 4JZJC 4L8DA 1A4JA 2EZ0D 3FRUA 1T1WB 3GSUB 3L3GB 3VIJA 1ITXA 1HH9B 3QNYA 3JWDL 4Z2JA 5JO5B 5B8CA 1FIGL 4FQIL 3SCOA 25C8L 3O4OC 3HE6A 1H49A 3BZ4A 3EBVA 3KDMB 4TSBH 1E6QM 3KPMB 4WKFA 1AR1D 3N1MC 4GMSH 3W9EA 4POZC 3ROOB 3O2VH 1DBBH 1WSST 4FOMA 1OL0A 4XC3H 2EPOA 3INUL 4RWHA 1AC6A 1PLGL 3FZUC 3U4EB 4L8CB 2HJLA 2R0LL 2FWOB 1WAAA 2I24N 1VERA 5CD5C 5ERWB 5D1QA 3AICA 3WQWA 3BAIA 5J3HD 3FTGB 4HAGA 1IFHH 5T1DL 3GBNL 2D03L 1NDMB 3CPLA 5J1SC 4JRYA 4ZNEE 1DBKH 2X8RA 5DSCA 1IM9B 4F9PA 2EIEA 3IU4L 2X40A 3QHTC 1XC6A 4X9BA 3QDME 4NJ9L 3TBYA 4IDLA 3IJYB 3ZE0F 5IQ9A 3RDTA 4XCNA 1G9NL 3JVGA 5SWSB 3BYYA 3TPUA 3OAYK 1LE5A 4QXGH 4M1GH 2XFRA 1G9HA 5D72L 1US3A 4U6XA 1DUZB 1WC7B 2OR9H 2R69H 4P48A 2A38A 3TVMB 2KZ1B 4HLZG 3ARFC 4N8CH 5I8CB 2AEQH 2KDGA 3UEQA 4OFYD 3SGKC 1KXVC 4HAFA 4JFQA 2HRLA 2Q76B 1AXTH 2V5CA 2AJVH 2PUQT 5FB8B 4JO1L 1GGBL 3B9KA 1NGXB 3V7MA 3BJLA 1EIBA 1DFBH 1RUMH 1HHGB 3B9AA 4ONOA 5DJCA 4J7RA 3T2NL 4PMZA 3S6TA 1T5WB 1AO7E 3O9WA 3CDGB 4QHLB 2VRQA 2XKNB 3A67L 1Z9OA 4I8DA 4X4ZA 4TSCH 5C0RL 4JGUA 2ZX7A 2YMXL 4XWOC 5I17B 4IMKA 5GS1C 1J10A 5C0CA 3F6LA 3I6GA 3VXSE 3P0VL 1NUGA 4HUUA 1HWGB 3CFJB 4HPYH 1KCVL 5HVWA 5DMGC 5BZWA 1XHGA 4KUCF 3CUJA 2FYYA 3W0WA 4U1IA 1EJOL 3FXYA 5K9JL 1QI4A 1T80A 2EDJA 5CD3B 4ML4A 4W6WB 2DPEA 5HSFA 2ICES 4JFFA 2QTEA 3LEXA 4Q7DA 5JIHA 4PYSA 3HR5A 4OOZA 3MRLB 3C6LA 5D1ZA 4B53A 1XH1A 1BLIA 4FRWA 4Q7NA 1GJUA 5CZKA 4G8GA 2PB1A 3L4XA 1ZBCA 2EDHA 4PGCA 2EDOA 5DD6B 3LDBB 5BRPA 32C2A 2YRPA 1KSRA 4IISA 5BQ7A 3MYZA 3VM7A 4M7LL 1Y7VA 1W72L 2R1WA 2WLYA 3HI5H 1OWWA 4XHJD 1TITA 5C0JA 2GK2A 1I1AA 5M95B 4KDTC 3CXDH 5FK9A 3L5WA 5E8OA 4MZ2A 5EC1A 1U33A 3ILQD 4BQCA 1UWQA 5C7XH 3VRJA 1RFDL 1I9RL 4NKIL 2P47B 2YBTA 2MCPH 3HFMH 2YJQA 3WSQH 1HN1A 3OJVC 4QF1A 1NUDA 4G8IA 2A6KA 2Z8WC 1TTFA 4OIIL 4U1HB 2JELH 4PJAF 3RM9A 1YEHL 3MYJB 3MMEB 2RQ8A 1KIQB 4ONFL 1OVZA 2DKUA 5L88H 3E0GA 4F8XA 3TIDB 2PR4H 3QDGD 2WIMA 4IHOB 5BJTA 2F2HA 2JKXA 4XV0A 3DVGA 3QIBC 1NCWH 4UNUA 2C7UA 3VIPA 1KCSL 1KNOB 2PO6B 4NWUL 5C0AE 3WENA 4OQTA 1VBUA 1MF2L 1XH0A 4WU5B 1SY6H 1T22B 2DM7A 2NXZC 2R9HD 1V6UA 4ODVL 2PWGA 4UQBA 1A21A 3LS5L 4NDMB 4MNLA 3NA9L 2UY6A 4L1DA 4R90L 5DO2D 2ZWYA 1WT5A 1XIWC 1ZVYA 1IGJB 5HHNB 3HN3A 4NC1E 4K9EL 4TVDA 3NA4A 2WWKO 4LCWE 2B5IB 2WQRA 2XSBA 2XSAA 1N4XL 4NRXA 3WN5A 1QI0A 2IANA 4YFDB 3AQUA 3JV6B 4P2OB 4X6DB 4W8AA 3GSWA 4OUOA 4PRPA 1TA3B 5GNYA 4MB5A 1H11A 5HHOD 3MR9B 1CDCA 4ZMAT 2BNJA 4HOZA 3LKOA 5D7SH 1HILB 1A9BA 1MHEA 5F1IA 3VGHA 1HNYA 3OLGA 2E27H 4UNVA 2CIIB 2A9ML 1BM3L 5DJDA 1U3JA 2CIKB 4LVNC 1IQDB 3MRFA 4F7PA 1KB5L 3RA7L 4IRSC 1E6PA 1IGTB 5F97E 2YKLL 1RUPL 1VCAA 1EA9C 3MJ7B 4G9DB 5E00A 5EU7E 4NFBA 1EEZB 1SR0A 2VWEC 4G6AC 4S11A 5T5NF 1ETZB 1UM5L 2W66A 4TRPL 3L5JA 4OKVB 2VL5B 3P77A 1P2CB 2VLKA 1N5AA 4QTHB 3KJ4B 3ESVF 3AS2A 5E8NB 4ZXBD 3ECQA 4MJIE 3V6ZB 2EJ1A 4IPNB 3OSKA 3EOTL 1OIFA 4BUGA 4JM2F 3BUYA 4WO4A 2DWDB 2BNQE 4C56D 3CIQA 5E8EA 3O45A 3LMJL 3W39A 3QG6A 3THCA 4HWEH 3GSNL 1SJHA 2I60H 3K0WA 4KAQL 2FO4B 3HZKB 5IJKA 3TNMB 5DHYA 4ORZC 1C12B 2DSKA 3FY1A 3W11D 2GT9A 3QB7C 1HJSA 3QGVA 1A7PH 4F33B 5FCZA 2GJ6E 3VWKB 1ZHKB 5DT1L 3CFEB 4FQLH 2G8ZA 2PO6D 3PZIA 1HYRC 3UG5A 2EDWA 3QOKA 4XRCB 4C83B 3G5XB 3JV5A 1ZANH 1C7SA 4P2YA 1GZQA 5LGJA 2CDEA 1RUAH 1T21A 4X83A 3REVB 1XR9A 4FLQA 1KG0A 2FB4L 1FCGA 4RMRA 2VDOL 3ULUL 1K4DA 1E6OH 3VGDA 4JZNA 3W9DA 1KIRB 4JFHD 4GSDH 2XV6B 4HZ6A 2EDFA 3BSGA 4QRRB 5DUBB 2VQTA 1Z9MA 2BERA 2HFGH 1Y0LA 1YMHB 1Z3GH 2CH8A 3ZL4H 3C6SB 3PZVA 3GNRA 3F8UB 3E6FA 1I7UB 4NPYA 4OFVA 4ZNEA 2XWBB 3TM6A 2FNBA 5TE7H 2P24A 2PYEB 3QDMA 5I5RA 1KBGL 2IAMB 3TA3B 1HQRB 4U5IA 3MLUL 2CDFB 4W4OC 1GZJA 3CCHA 1KPVA 3C5ZA 3RWCB 1JFQH 3ZDZF 3CLEH 3GMOA 3RY5A 1ZV5A 3MNWB 2IH3B 4JPKH 1DL7L 4MJ2A 3MCLH 1HJWA 4MD0B 1LO3L 4GKSA 3C60C 5IFAH 1EDGA 1HJUA 1M6OB 4WFGD 3E2HB 3WQ6A 1AXSB 3D3AA 5ITBL 1GIGL 1MLBB 2FIKA 3BRFA 4AMCA 3DX9A 3WD5L 1L7IH 4PJDF 1FGNH 1C5BL 1LEGA 1QTYT 4DGYL 5IKCB 1FSKB 3QXDA 1S5IL 4D6HA 3MUJA 1H2JA 2A3AA 1SHMA 3MODL 3LZFL 2BFVH 5JQ6L 3WNOA 1YYMH 5I1LA 1MRDH 2XPGA 1AO7A 2HMID 5E9DB 2CBUA 1UB6A 2ED9A 1CD1A 4F15B 3MV9D 1J01A 5HHVH 5EU5B 4HKBA 4QTIH 1DN2A 4XP4H 3MGTB 2V9TA 2W0PA 4JL2A 4J6RL 4MMXC 4ELKA 3WS3A 5C0FB 2YUZA 4FHBD 3D9AH 2AK1H 4C7DA 4F37F 5I79A 5LAXB 5CG0A 5F9AC 4D9RD 1JCKA 5K59F 1FYTD 5A2JH 5CJOH 1LO2H 1TIUA 4XP9L 1MCPH 2WW5A 4MTVA 3N1QC 1ISXA 3PWPB 3WFCH 5K9OA 5DZLA 5DI8A 4HUMB 1A1OB 4CADA 2QBWA 5GS0H 5D71L 3I6LD 4H1LB 1SM3L 1WK0A 2XT1B 4X99B 1A1NA 2DBLH 5KEZA 3CFCH 3HKFA 5IHZB 5E6IA 1WEJH 5T3XD 1TJGH 4NZRL 3LH2H 3BFOA 1MI5D 4M1CD 1IM3B 4WCYL 1FFPA 4QXUH 1WAWA 3HR6A 3WY1A 3RWFB 4JFWA 4MAYB 4RDQF 4PGDB 3WF2A 5AZEH 1NMBH 3VWJB 3CLWA 3OKOA 1CFQB 5JPMA 4XZUB 3VRIB 5MERA 5DQJB 4BQ8A 2X4QB 3L7EA 4MQ7B 1KV3A 2B1AH 4B0MM 2ZXAA 4JL1A 2WVSA 3OKNB 3BAJA 1E43A 3QSKB 4EKJA 2QQNL 3PHQA 2YPVH 1DBMH 1I85C 5FD0A 1A14H 4LLYB 4PJHB 4OLWL 3IDGB 2J7CA 1FN4B 1JGLL 1JZ2A 2XNAB 3TTSA 1IC4L 3RNQA 2R15A 3ZKSD 5L2KE 3BP4A 4MAUH 3QUXD 1EBAA 3ARWA 1XRVA 4NSBA 3X13A 4KQ3H 3QI9B 1X5JA 3NGBC 3M8OH 5DRNA 4EJ1C 1ZT7B 4P7NA 1HE7A 1YPZE 3KG5A 4GBXB 4GO9A 5HYQA 3OF6D 4NM4H 1E27B 3WF3A 4RWYH 5C0AA 4UT7H 1CVRA 3BEVA 3EOAB 4ETQA 3WHXA 3F7VB 3RM8A 3OQ3B 3NZ8A 2FBJH 5DRZB 1B0RB 1A6AA 2UY4A 5E9DD 2OP4H 3MLTA 4DAGH 2P5EB 4JN1H 2IBZX 1QD0A 5DURB 4RGMB 4KJQD 2GK1A 3L4UA 4LCWA 3WELA 4MJ6B 1RI8A 1S5HB 4GRWB 2VR9A 3UTTD 1K5NB 2H3NB 5A6JA 3ZYJA 5EU4A 3SY0A 2IPTL 2EC9U 4G6JL 1MJ8L 1YQVH 3H0TA 2GVYA 1Z5LB 3BIKA 4NN7C 1I8MA 4P3WA 1JZ5A 5ITFB 1MQPA 4LVHB 4TUFA 2ZOKA 1IZJA 2O9OA 4HCRH 2XTJC 4ODBD 2C4XA 1K8IB 3BPCA 4HUVB 1QEWA 1X4ZA 4I3GA 3MSPA 3DSFL 2O5ZH 4OZHF 4QRSA 4RAHA 3CMOH 3MS8A 3NUKA 3BGMA 3O6FA 2H2PD 5CUSH 3MKKA 2CUHA 2MNUA 3SE3A 3T77A 4XPAL 1YN7B 1GHSA 1XEDA 4DJMA 1AI1H 1S9XA 3UBXG 4XCCH 1GCFA 3U2SA 1J0HA 5DD5H 4UOW0 4MAYD 4FQCH 4HKJB 4JEGB 1ZLVK 1UWIA 4XPHL 4YLQT 4PLJC 4PUBL 1EXUA 5IOPA 4YC2B 2VDQL 5GXBB 1F90L 1S7QB 2V2XA 1A6PA 3PZUA 5IESL 3NN8A 1B3ZA 2IXVA 3AMDA 1N2RA 4P23D 4F58L 3QZWA 1SY6A 3IDJA 5CJXC 2BNQA 2B20A 3TBTA 1GH7A 3VFRA 3B2VH 4A6YA 3U5UA 1OPGH 1Q38A 4Y8DC 3ZJ7A 4MA3A 3LB6C 3N12A 5I9QB 1A8JH 5D93B 1E4NA 5HHXH 1SFSA 1QO3B 3OMZA 1HHHB 4NO3B 3WLWC 3MGAA 1GYAA 3MREB 4CU6A 4KHXL 3KYNB 3T4YA 1XGRA 2FSEA 2BVQB 5IFPA 4QRUB 4U7KA 5J89A 3QCTL 4YBLC 3TV3L 5IR1B 2GJ6A 4WV1B 1JJUA 1KYOK 1OGAE 3IFLL 5MEQB 1PYWB 4AENA 5KVMC 4I5BB 4KKBD 4X6BA 3K7UA 3V6OE 4K71C 4CMHC 4UQEA 1W0YT 1I9JH 2R2BB 1TVPA 3BO8A 2AP2A 3QA3A 1BD2E 3NAAL 4J1UB 2LTQB 3ARUA 3O2WL 3PWNA 2P5ED 4RRPG 4XP5L 1BPVA 5AC5A 4XHQA 1OP5H 5DDHA 3MOBH 1E71M 3MFFA 1XF2B 4Y5VB 1AHWB 1CDHA 4MA1B 2EQDA 3NIGF 5E5MA 2FEEI 4JKPH 5TGBA 4PLOB 1LNUA 1AD0B 1FNAA 2XFYA 1F4WH 1HWHB 4JRYD 3RVVC 2Z91A 3RVWD 2P1YA 2ZOLB 1YEIH 4HK3N 2NMSA 2OS7A 2ORBL 1GGIH 3G6AB 4HWZB 2EXOA 3ARSA 3ZYOA 1ORSA 3RDTD 1R5IB 3VX0A 3RGVA 2GDVA 2AW2A 2OJEB 5CMAA 3D0VB 3QUZA 4AL8H 3VDBA 4LP5A 5FUZH 2ZNWA 4DEPC 3RZCA 3W27A 1ZHBA 4HGKC 2CJUH 3FN0H 2FWOA 5F9OH 4WU7B 5ILTL 5AD0B 5ERWA 4ZFGH 3V4UL 3F7YA 3I9GH 4JLRA 4NGHL 1QFHA 5F89B 1Y6MR 4XCFL 4Z76B 1U8KB 4HKZA 4X7TA 4Z77A 3MX0A 1QBML 4FFWD 2E9IA 3SO3C 2J8GA 5HGDA 3LPPA 2DSUA 3B9KD 3BSZH 5KVFH 3AFBA 3QEGL 4GH7B 5C0ND 5INCB 4JFTA 3F12B 4Y16A 5EA0H 5D7LB 5DC4B 1QLRB 3O9WD 1D9KC 2MJWA 2QR0A 3WBEA 3WF4A 4PYGA 3HAEA 2ZZUT 4PLNC 4L3EB 1P53A 5FUOL 4YHZL 5SWZB 1MFBH 2WUCH 1J1OH 3T08A 1F11A 3WFEL 4HMEA 5C0CD 2NY4C 2YBRB 3C2AH 1JNLH 2H8PA 5C3TA 3DI3B 1T1ZA 2X44D 4GRLB 4OF7A 3KPOA 5FV2A 1E1EA 4RAUA 4EN3C 4LBEB 4M93B 3FMGL 5F7UA 5CBAA 1MCCA 4OQTL 4ZOBA 3QUYB 1IAIH 4DOHB 1MVYA 4Q6IB 1V7NL 3MLSL 5HI5C 3HLAB 3NZHH 1LO5A 2PXYC 2F8XC 5ID1A 3W0WD 4IMLA 1VFUA 1FNSH 5CSYA 4ZQKB 2OR8A 3T2PA 5A40E 1Q6CA 3MOAL 3EDJA 3SE4C 1UKSA 3BUTA 1UYQA 4JFFD 1MFEH 3C87A 3A6CH 1QFOA 4LARL 1CECA 2H9GB 4GQ9L 4GKNB 12E8H 4ODXB 4QHLA 4XXCA 3CUIA 4HXBH 2XQBH 4O58H 2UWEF 1YEFL 1BQHA 4OGXL 1EQPA 3C6LD 5D1ZD 5AWNH 1WWCA 5HGBA 4X7FC 3FKUS 4GKLA 4G8GD 3CVHA 2HLFD 2V5SA 4LIQH 4MS8C 3S98A 4U1JB 3CZJA 3T04D 2ZICA 2D0FA 3QR3A 5F7WC 2WHJA 2R39A 4RMSA 5IM7B 5BZDB 2CKSA 2ADGB 4JY5H 5JOPD 4BFGA 4RMVA 5ACZA 4AYSA 1VACB 4M6NH 3KS0J 1I1AD 3H9SB 3VGAB 4PJEF 3EYSH 1LEIA 1TETL 1CLYL 3BKMH 3OKMA 3FN9A 4R0LB 4X5XB 2QMJA 3BYTA 4RFNB 5DUPL 1KXTA 4K7PH 1WZ1L 4W7VA 3QEUA 4KRUA 4W8LA 3EYVA 5L2KA 1E4JA 4KV5F 5KG9B 1QFPA 4QNPE 1PGRB 1AGBA 2AI0L 1NBZB 3GIVB 3VMNA 3GSQA 3VH8G 4DWSC 1B3WA 1W0WB 3RDKA 1AE6L 1RY7B 1FBIL 1YPZA 4JG1H 4P5MA 3X3FL 1B30A 3AIQA 1QLEL 3RKDC 4JB9L 2CBIA 1B4JL 2D49A 5KSBE 2Y23A 3O3EA 3VG9B 4FLSA 1DQJB 2P5WE 5CJQH 1HIML 5BW7C 1RV6X 5HI3D 3M17B 3E8UL 2PW2B 1DBJH 1V08A 3FQRA 1GQKA 1BAFH 1MH5B 3U7WL 1A6UH 3FQXB 3S36H 4Y4FB 3IJSB 3PABB 4GAGL 4MNQB 4PMRA 5IUSA 2A74A 4TUJA 2MPAL 1WGOA 4P2QE 2AJYH 1Z0NA 4LXFA 1KC5L 1UM6L 2LAAA 4K23H 4M3KB 3UTZB 4MNHB 1V7MH 3QIWB 3G04B 2ZCHH 3R1GL 1TPXC 2IAND 5F1KC 1GXEA 3GKZA 2C4FU 5BV7C 4JM2A 2Y8VA 4QT5A 1YDPB 4RQQB 1K9DA 1E72M 4PY8I 3RY4A 3O3DB 2IBZY 3EHBC 3DIFB 4OGYH 4YR6A 2NNAA 3MA7B 1Z9SA 4YHKL 5I77A 4WTZA 5A6BA 3IFNL 5DJAA 4JHZA 1JGUH 1IBGH 2XN9B 3AROA 5EBGA 3SKOB 2GDUA 4PJBE 2Y7QB 3LMYA 1CGXA 2DDQL 4XMPL 1CGUA 2VYRE 1I8KB 2OMBA 3QQ9D 2M26A 2Y5EA 2YR3A 3K1DA 3DXAD 2H41A 1CWVA 1S9VB 5K33A 1QACA 1DQTA 4FXKB 3P0YL 3ES6B 1T5XA 5MHSD 1HXMA 1EH9A 3LRHA 4AZGA 5GZOC 1Q0YH 2VLKD 4NC2B 5L0QC 2GUOA 1BJMA 1LILA 4JFZH 4XNMB 1FYHB 2OTPA 1HJQA 5KTEH 1S46A 4E0RA 4ZFFB 4YDLC 3IJ7A 1QRNB 5K9KA 1RULH 4WO4D 2WC4A 4D6DA 1S7TB 4DKDC 3H3PL 4FQ2H 5F7HA 4HBQA 1MFNA 5CZXD 1G7PB 2EC9T 1WO2A 2MHAB 1F4XH 4LSSH 4MSWB 5GRZA 4CNIA 1FHGA 4QYOA 1U93B 3DBXA 2AV7A 4NRZB 5H35B 1RUKL 5DJ6A 5DJ2B 4NWTL 2W0KA 4U6HB 4WUUE 4DVBA 3UAJC 4GAYB 2DI7A 2J88H 3T65B 4B7IA 2DQCH 2B7DT 2OWWA 5E56A 2A77H 1OGAA 1OM3L 5DXWA 2Q8BL 4JPIA 3V6OA 3BDYH 3JBG7 4DN4L 4HCRA 4GMSL 3O2VL 1DBBL 4WFFD 1FG2A 3VXUB 1NGQH 4O5LH 1BBDH 4AIEA 3KL5A 1SYSB 2EYSA 5I1GL 2V3GA 3Q6GL 2JE8A 2FX9H 4EK7A 1BD2A 4PUEA 2E9JA 1M7DB 1E6JH 3VM5A 4AZ8A 4RMTA 1UA6H 3VI4E 4U1KA 1C12A 4J23A 1UD5A 1IFHL 3RTQC 1XR8A 4K2UH 3BAKA 1AD9A 1NCCL 1Q9LA 1CPUA 3KNBA 1KULA 3O8XA 1J1PH 4OI7A 4HOXA 5ETUB 1UZ8A 1KQYA 3QDMD 1QR1A 4UILH 1CE1H 4XRCA 4QXGL 3BH9B 1FNGB 5JR1H 3C5ZD 2B4CH 3TT1H 2RGSA 4OCNC 1BOYA 1L7TL 3TJEH 4AEHH 4BH8A 4PJ8C 5IHBA 4EI6A 3VILA 2OR9L 4M7ZB 2R69L 2BOCB 2X4PB 2CLVB 4Z2GA 2AGJH 3L5XH 4N8CL 4OBSA 5HY9B 1I3RB 2AEQL 3DHMA 4OV5A 3CK0H 3V5DA 3NFSL 3PIQA 3VINA 15C8H 1MCOL 1SVZA 4LCCA 4LRIC 3UTOA 5SX4I 4RA0C 1CXLA 4F7MA 1EUTA 1IGFL 4NKOB 3VD3A 2CYGA 5E6ZA 1FORH 3I84A 4GRMA 1WTGT 2HFTA 3DX8B 1K4CA 3M46A 1UHVA 4UT6H 3AHTA 1CF8H 1QRND 5EUOB 1DFBL 1S7UB 1DLHB 4NQXB 1YEDA 5H94A 1KT2A 5EOCJ 4O2CB 4OF6A 5JHDB 1BP3B 4TSCL 1AO7D 1CYGA 1GCYA 1E3ZA 3U36A 4X7EC 1MVUB 4I0PA 2VDRH 3K3QA 4PD4J 3QULB 2EDKA 1JE6A 1JDCA 1HHJB 1ZAGA 1B2YA 3FRPA 4LLAA 1EO7A 4NQSA 3TYGH 1PG7H 4HHAA 5DK2A 2UYLB 1QI2A 3ZSTA 2E7BA 4D3CH 3RILA 5I75B 3MV7B 1G0DA 3WFDH 1NLDH 4EI5A 2X0YA 4CU7A 2ZUMA 5C0GB 3VDAA 1KXHA 5E4EC 1J0IA 2XZZA 2C3GA 3HUJB 2BNUB 4UUJA 4XCEA 1JZ6A 5CEYB 3PZQA 5T1MA 4ZFOB 1YYLH 1BGXH 3QBTB 1K6QH 1LO4H 3GRWH 5I1HH 5E6ID 3MV8A 3VOCA 1UB5A 5EU5A 3FT2A 4N8PA 5ICYB 4YJZL 4EOWH 4EXPX 4PRNB 3V6BR 1T7YA 1HHIA 1G7MA 1XZ0B 1I7ZA 5SWZE 3OHXA 3ULVC 5DTFA 3AJ7A 4AZ7A 5J9PA 2NY6C 3HI5L 1G7QB 2AEPL 4C58B 4ACPA 3SDYH 3CXDL 4H8UA 2WVUA 3KYOA 5IHRA 2VDNH 2VWEE 4GO8A 1T20B 4DOHE 1C5CH 4LGPB 5F93C 5JW4N 2IPUK 3CZ8A 3GGWA 3ARDA 2YPKB 2MCPL 2JIXA 3WSQL 3NIFF 2A73B 4N5EC 2JELL 1YMMB 2E9BA 4WGWB 1JUFA 4FQHA 5L88L 4TTUA 4D9LH 3MNVB 4AZ6A 2PR4L 5TF1L 1KTDA 4ZUSB 3T2QA 3QH3B 1NCWL 3MV01 3ZTNH 1T03H 4EE9A 4DKFH 3GMPA 5KSBA 3TWCL 1FE8H 2P5WA 4TTDD 2CBVA 1SY6L 1NWUA 5I30H 3WNNA 1TMCB 1E0WA 4KDWA 1XSKA 3FQUB 4R2GD 1IT9L 2XFXA 5I2UA 1NLBH 2CQVA 4A6YL 5KN5A 4CMMB 3VD9A 1JBJA 2I5YH 1FZMB 1I1YB 1M1SA 3L6FB 1HQ4B 3T0ED 4P2QA 4H25A 4HH9A 4YDVA 4LCWD 2EDNA 4RFOH 1ZT1B 5E08H 1P9MC 4HMDA 1ZMYA 1IAII 3CO4A 2FEEL 4JHBA 1M05A 5D7SL 3NSNA 1K9TA 1UJTA 4HEME 4YBQC 4GBXA 1MPAH 3VXPB 3MV7D 3OWEA 2E27L 5DJZB 1N5YH 3BKJH 2X42A 1EV2E 3PJSA 4EQ3A 1CE6B 3QOMA 2ZIDA 4QFUA 2W0FA 3DECA 4F7EA 4JFDB 4PJBA 1RIUH 5DHXB 1R85A 3O6FD 4TNVK 4MDPA 1PEWA 1OTSD 1QVOA 4ZS7L 1BQLH 4X6FB 1ZGLA 1EHXA 4HU8A 4M8QA 4AC1X 5ID0B 4QHMA 1S5HA 1AGDB 3BC9A 4R7NA 1IEAB 3W26A 3RWEA 5J12B 3U1SL 4D8PB 1W91A 1FVEB 5I2IB 1JP5A 5JXED 4NQEB 1MJJB 5DEZA 3B4NA 2EDTA 3VI3F 2OYKA 4RNRB 2ADFH 5JW5A 5KS9F 4M9PA 4XT1C 4ZAKC 4ZPVA 3REWA 2BNQD 1UXSB 3SGKA 1KXVA 2ESVB 5IMMA 3MRCA 4YFLF 3NFPB 5LQBH 1T89C 2V3FA 3F58H 2C4FT 5KZ6A 5F6IC 4DKEH 1E15A 2PKDA 4K94C 2IJ0C 1ZSDA 2VR4A 1HH6B 4L8SC 4WUUA 1FL6B 4YGAB 4N0UB 4QRPE 4WF7A 2IQAB 2DQXA 2D4FA 3TT3H 1N59A 4FQLL 4HKXA 2GJ6D 1W1YA 3CH8A 4XNQA 1CT8A 1ZANL 3I2CH 2Y5TA 5DJ8B 3II1A 1RUAL 5GS1A 4PB9L 5CKGA 4KK5D 1CTOA 4UI2A 3D87B 3UXFA 3IXTB 1KJ3H 1BHGA 5ICZB 1E6OL 1JPSH 4PJAB 1NM9A 1AIWA 4GSDL 4WW1A 3CSBA 4YHNB 3KPRD 4NO5B 3KXFE 5TQ0H 1U8PA 3SCWA 1YUHA 2HFGL 3DVIA 5ELIA 3WUWA 1Z3GL 2J74A 2HT2C 5CSGA 1G0CA 2HG5B 3BPLB 1Q94B 4Y5YB 1X9QA 4FQXB 2CD0A 5C0BD 3VIGA 4D72A 1RIHL 1VKXA 1CICB 4LCUA 2DJ4A 1WBXB 2FEDC 1B3YA 1W9VA 4W7UA 3N9KA 4IOFC 3MNZA 4DZBA 4YGVA 2PYFA 2A2QT 5A2IH 1W0VA 2MKLC 5EC2A 4GPNA 3VXUE 1ZJBA 3MUIA 1JFQL 5DS8B 4D0DB 3RGVD 2F58H 3CLEL 1I1FA 3DLQR 1F6AB 2H2SC 2C5DC 3QUZD 3RZCD 1AQDB 3BGAA 5IFAL 1G7LA 3VRLF 1HSAB 1T0PB 2WINA 4ZUVA 3T4AB 1ISYA 3SCNA 2VABB 1EEYA 4KDTA 4D6EA 3CVHL 1S9YA 3H9HA 3SDDB 1KLGA 5FUCC 3BP6B 5EO0B 1JYNA 1FGNL 4AG4H 3IU3B 1AD0A 3PUCA 2EXWD 3B3IB 3EAKA 4IOSD 3BP5B 2GSGA 4ODWA 1KB9J 2DMBA 1DE4A 2BFVL 5K93A 1A2YA 1RK1B 5F9DC 4MA7L 4PLKD 4ODHL 1UR9A 3FO0L 1XCTB 4Y16D 4W93A 4RGNC 3QIBA 1II4E 4AZBA 1KUMA 1V05A 4JFYA 4ZYKA 2HRPH 3GSOB 4MLSA 4CGTA 5CPQA 2WANA 3N0PB 1SYTA 1BBJA 4XP4L 3AXXA 2Y06H 3IDMA 4AZ5A 3P9MB 1A9EB 3PN8A 1W1TA 1VB9A 1CXHA 1OAYH 3D9AL 1KFAL 4H1LG 4S1QL 3WDJA 2VERN 5GQBA 3ZE1E 5GNZA 3VFSB 3ILPB 5KJRH 3DX7B 1QBAA 2EIZB 3N50A 5CJOL 1LO2L 1MCPL 1EAPA 1CK0L 2NY3B 1OB1A 4BJLA 8FABB 3WFCL 3KWXA 4Y89A 3FFDA 1Q72H 5D1XC 5GS0L 3AREB 2A6JA 4HIJA 3QWRD 4E4PA 1QG3A 2NR6D 2DBLL 4P4RA 5HBFA 3CFCL 2UY5A 3WUGA 4PR5B 3HC0A 4OLXH 3ARGC 1K2DB 3AIWA 1WEJL 3FB5B 3G5YA 1TJGL 2F53E 1F4HA 4POUB 4LVOB 1KOAA 4QXUL 1T2QH 2FL5B 4LPTA 4Q6YA 1NMBL 5GGRY 5FHBH 5SWZA 2G2RA 3NOIA 4IRSA 1JV5A 2GHWB 2IUZA 4BH7A 3OTTA 2MKWA 4GI8A 2B1AL 4MXVE 1UWEH 2CETA 4RL3A 4PY7B 5F7LB 3U9UB 1QSFD 2YPVL 4TVPH 4ZTPH 2GFTA 1KXQA 4Y2OA 5D5MF 4DVRL 5KW9H 2R2EB 1NJ9B 3ARTA 3W4RA 5JZ7C 1GOMA 5JLZB 1FG9C 3VO0A 4KQ4H 2CPCA 1OTUD 1TCRA 3TBSB 3HUJE 2D7QA 4FQPA 3N1FC 4MAUL 3T1FA 2VDLL 2UY7A 5L2KD 4PMVA 3QHZL 4WNQA 4PMQA 3M8OL 1UCBH 4BFBD 3DRTA 3AXLA 4NM4L 3GJEA 1F8TH 3F5JA 4JFVA 5BXSA 3HS0A 4UT7L 3FB7A 4YXHH 1IGYA 4RISH 5I16B 2FBJL 4YHLH 1TXKA 2BRQA 1R3LB 4OGAC 2ESCA 4GUPB 2GITB 4FZEH 3BGFB 1TLKA 1TZHB 1H5BB 3QWOA 3T3PF 1BFVH 2VE6A 4JN1L 4NP4H 3ZKND 4MQTB 3GRWA 4JCLA 4PJFF 5FOBA 2Z92A 2WVVA 1NAKH 3NCYS 1S8DB 5IF0B 2Z93A 1YN6B 3TLRA 1FH5H 3L1OH 4OLYH 4PJDB 3WBDA 4HMCA 1DQLH 1YQVL 1AGCA 3GIVA 1MRFH 1WDRA 3K80A 1FFOA 4IEFB 2K3TA 4JM2D 4GIAA 2EKSB 1QSVA 4OM0H 3HZYA 4PJCE 5JPNB 5IFHH 4CN4A 4HCRL 4PRIB 2NY3D 3QR2A 1CL7H 4QY8A 3WDHA 1D5XB 3ARED 4JRXB 4XB8A 1RZKH 4E42A 2O5ZL 4H0GA 4OZFB 5EPMB 3CMOL 2F5BH 3H3KA 5EO1A 2XA8H 5MEPA 4W5UA 4XH2B 4DCQA 5TDPA 5TD4A 5KAQF 1FNFA 4DFIA 1MJ7H 4PRBB 1AI1L 4XNZC 4X0NA 4BFIA 1M7XA 4XCCL 5E2VH 2GJPA 4I2XE 4K3GA 4U1SB 4L3CB 4W4OA 2KBGA 4FQCL 3TN0B 4LPYA 3UCRA 3OKDA 3S2CA 2IWGA 4KROB 1WIPA 1HKIA 5A2FA 3CFDA 3GBEA 2Z4QB 3UDWC 1T1XA 3PV7A 4LYQA 2ZPKH 4TNWF 5BCAA 4KTDH 2O61A 3V0VA 2P42B 2CKBB 4LFHG 4PRDA 4JN2A 3LKRA 4MXQD 3AIVA 5F3BA 3MBEB 4RX4A 3QNZB 3T0VA 1OPGL 5F9JB 5MI0C 3RWHB 4HT1H 1NSNL 1JYWA 2AQ3A 5KOVC 1KB9K 4PJIF 5HHXL 5J6HA 4JFDE 5CSZA 4C7GA 4K3JL 2I07B 2QQKH 3BH8A 1Y6NR 5I19H 1GOGA 2Z35A 4KK9C 4QRPA 2DT3A 4CDGC 4AIZB 3OR6B 4FXKA 4PJ5B 3HC3H 1OP3H 1TZ7A 5CILH 3IETB 2M8XA 4L29B 4XMLH 5DD3H 3BXNB 4NQEE 3HI1B 3O6KL 3R8BB 5JOFA 4X6EA 1JRHH 5FKYA 1DR9A 1BOGB 1VPOH 1CZ1A 1BD2D 1PIFA 5CIPB 3T2OA 2ESVE 2NXYB 1F4YH 3D0LB 3MOBL 4D1IA 3WDQA 3KXFA 2MHAA 4JPVH 3EYFA 2E9MA 2JFEX 2NTFA 5L6YH 4JKPL 5D7JC 3DO7A 4KI5C 5JORB 1VA9A 1DN0B 4UDUB 3EGSB 3WHE0 3MRRA 5I8KH 1JAKA 4P3DB 3CSPA 3L5HA 2BVTA 4X6CE 1GGIL 3CNKA 2DTMH 2ITCA 5DJ0B 4GG6E 3NMEA 3HC4L 1QFWM 3O8XD 3U7AA 4WK9A 2FRGP 4JRXD 4OAWB 3QHNA 4NO0D 3LV3B 4AL8L 3SKUD 4H0HB 1FDLH 4Z7UF 5FUZL 5IHUH 1TVNA 4E41D 2CLZB 5EUKB 4LLVA 3VD4A 5A6AA 3KYAA 2CJUL 3HE7B 1HI6A 3FN0L 4KPHL 3QCVL 3CFIC 5F9OL 1Q4NX 1CXEA 2F9BT 3ULUC 1NC4A 3PGCA 3TN0D 4KJYA 2WCSA 2NLJA 4ZFGL 3FL7A 4OLEA 2FZ3A 3AB0C 1I85A 3I9GL 3EOYG 1BQUA 3LKQB 2LAGB 4E5XB 2DLFH 2H26B 4XNXH 4LASH 5DWUH 3PZ9A 2IF7A 2QF8A 4FF5A 4FLRA 5CWSB 1GZPA 3S35X 3BSZL 5KVFL 5E95B 3V0AC 4OZHB 4PS4H 4Y4HC 2XIIA 3AMKA 2Y25A 2OSYA 4EQ2A 2AXGA 2CR6A 3P30L 3VW3H 1FH7A 1MCHA 4Z0XB 3LN9A 3MRNB 4KRPB 2FJFB 2G5BB 2I9TB 4OV6F 4FMFA 3ULVF 1HX0A 1U58A 1WLHA 1MFBL 1J1OL 5A8NA 2BOCA 3C09B 3P2TA 4U6YB 1BEYH 1NCAH 3GBMH 3K2UH 3C2AL 1JNLL 1CU4H 4HWBH 4I0PD 2Y07H 2Q6WA 4NJAH 4LHUB 1G9MH 4PJ5D 2V3DA 3MO1A 1FVCB 2ZJSH 4LSQH 2AJZA 1QPKA 1IAIL 2HTLC 3FQWB 1DWJM 4HP5A 3NZHL 1TJIH 3RX8A 4L4VE 4EI5D 1FNSL 1NFDE 1WCGA 5AG9A 1AH1A 4X4ME 2P45B 1KLUA 4P5TB 1SYVA 4IRJB 2QPSA 2E7CA 5DFAA 2R0WL 1R3IL 3SDXF 2NXYD 12E8L 1CDYA 1P84K 3MRMB 4HXBL 2P4AB 4O58L 1WWBX 1EHAA 2F53A 1GOIA 4RSVA 2W65A 5AWNL 4FNLL 4YHIB 2GJXB 2BDNH 3MV8D 1ZBVA 3LKSA 5IW3A 1HDMA 2JTDA 3WH5A 3WCYA 4WHTB 3QJFA 1QLFA 1E6XM 1TFHA 4WJ5A 1DEEA 2KUTA 3WIIL 4MD4A 4JY5L 4YZFE 2AAAA 3G6DH 1P4LA 3DMMC 1E6NA 3QAZC 1WVZA 1Z2KA 5INDA 4M6NL 5IVXE 1REIA 3QEHB 3EYSL 1FO0B 1AIFB 3BKML 3BW9B 5KSVB 3A6OA 1T6WA 4ZE4A 1BVLB 1U8IA 3ARDD 4HJJH 4P2RB 4U0QB 5EBWA 5C3LD 4K7PL 4U2ZA 1GGYA 4HS3A 4JO3H 4G80A 1WPCA 1QUNA 1HJXA 1KGXA 4N8VB 3ZKMC 1MY7A 2D0HA 2R2HA 4N0CD 3TJHD 3LN4B 5F1SA 3U0PB 5A8OA 1BREA 3AZSA 3BHBA 3IDIB 4JFOB 4JZOA 5CJQL 1BIIA 1NBQA 2A3HA 1W3KA 5I76B 1FP9A 2P5WD 2VQ1B 4GQRA 1JPFA 1DBJL 3K74B 4MHHI 4QCIA 3RBGA 5F1OB 1BAFL 5BRZE 1A6UL 3S36L 2MCG1 3UPRB 1EBPA 1UD3A 3GIZL 3V52H 1MHHB 5F7MC 3RIAK 3OXRB 4OZFH 1MWAH 2AJYL 1RURH 2XZQH 4NNYB 2FGWL 3D25A 5I18H 4G43A 4NHUB 2VL4A 4P2QD 4E2OA 1L0YA 3N17A 5L8JB 5ALBL 4POZD 5EN2B 2XACC 3O0RH 3OJDB 4S1SH 4JREC 1T0MB 3ZT7A 2BHZA 4DZ8B 4MD5B 5DVLA 4ONGH 4XP1H 1FZJA 3FZUD 3SOBH 4CUCA 4PJCA 1FJ1B 2X7LB 5D7IB 1XF1A 4OGYL 3RGHA 2HLAB 5CD5D 1BGAA 2WBJC 3Q3GA 2IPKA 1W8OA 2PWFA 3SCUA 2E8ZA 2X1QA 1JGUL 2IALA 4ZSOB 1GNXA 2CKBH 1IBGL 5T1KA 5KVGH 3MRQA 1UXWA 3FQUA 3EO0A 2OX5A 3OKYA 3FO9B 4KXZH 3U48A 4YHMH 1GJIA 1DLFH 4I2XA 2P49B 1NC2B 4I1NB 3S4SB 5FOOA 1VFAA 3IK2A 1WDQA 2CESA 4NQDE 1Q0YL 1KIPB 1JG9A 2K1MA 2DICA 3S3SA 3UR8A 5D8WA 1ZXQA 5A3HA 4JFZL 4OIAA 1OIMA 5EZLB 4WUKH 4OUUA 4CVZB 2FD6H 4YFLI 5E6YA 1RH9A 5KTEL 2WC7A 4BSWA 2DT1A 3HHRB 1XGYH 1BZ7A 1RULL 1NQBA 2YEZA 4HW6A 5HPMA 3WFLA 1EGJH 3VXRB 3ARFD 2J8UF 3KE0A 1C5DA 2JF1A 1U8OB 2V6HA 2UWEB 2D9QB 3QT2A 1F4XL 2BOBB 4HUWB 1JGDA 2X1OA 4LSSL 5HHME 1V6YA 3BZDA 4JFDA 3NABH 5DVMA 4O2FB 5E8DH 5KVEH 1ECEA 4G7VL 5CIPH 4M24A 4G42B 4MXWH 3HG1B 4XNUH 2J88L 4WUUD 2XWTB 2DQCL 2PWHA 4V2XA 3WQVA 4OD1H 3QRGH 5ICXB 2A77L 2BV9A 3RJDA 5H37H 4PUDA 2AQ2A 5CJ8A 5I6XB 3BDYL 2C3VA 3TGXA 1XIWB 1WICA 4PJEB 4NQEA 1MJJA 1NGQL 4OUEA 5IW6B 5FO9A 4F9PC 3A6BH 3Q1SH 4HGMA 4XWOD 1CDUA 4WW2F 1QP1A 2LU3A 1INEH 2W59A 43C9A 4XPTH 4WI9A 1U91A 1E6JL 3IAQA 1BF8A 3SCTA 4C57C 4ZE5A 2QL1A 4EN3A 4F2MB 2AERT 5DMGD 2GK0B 1L0XA 3X3GH 3HB3C 5DMKB 1MIML 3PP4L 3SCMB 2PXYA 4MMZC 3TH2T 1MQKH 3ELAT 1U8LA 3BAEH 3GJFB 4PJ9B 5DA4A 4ZXOA 2DQHH 2VX6A 1D5MA 1NCUA 5D2NC 1FL6A 2PW1B 3EYPA 3SE4A 4CW1A 1CL7I 1J05B 3CFKB 3QO1A 4X6CA 1NAMB 2Y9RT 5EBLB 4GG6A 3THDA 4UILL 1CE1L 3BP7B 3EO1B 2QSCH 5AUMB 5JR1L 3TT1L 2IBBA 2NX5E 3GSRA 3WL9A 5C07E 2E40A 3CH9A 4AEHL 3TJEL 5M3WA 3QXAB 4JHAL 4QHKJ 1JVKA 5GIRA 1QBLH 4X0KB 4PTVA 2J1KA 1NC2D 2AGJL 5IVZA 4D0BB 3WIFB 3WFHA 1MFAH 2FHCA 15C8L 3GMMA 3O41A 5F9WB 5KVDL 4Z78B 1N64H 2IFFH 4KKCC 2ICWB 4LKXB 1P6WA 4G8FA 2XG9A 4OIFA 2ICEB 1C16B 1FORL 2XZCL 1QW9A 1Q94A 5I71B 2A6IB 4CRPA 7FABH 2DQIH 3MLXH 1AY1H 1TQBC 1WBXA 4X80L 2XY1A 4KK8C 4DUVA 5HYSA 4DWSA 1KTLA 4A4AA 5D9PA 1BF2A 3QIBD 3L2LA 1PPIA 4YBHA 4OZ4B 4AIXA 3PNWA 5EU6B 4KJPC 2CKNA 5CHNA 2E7HA 3Q5TA 3KLAB 1XD0A 4BKLA 1KIUA 4HK0B 2AJ3A 5BW7A 3VUPA 5JUEH 1H0DB 5FYKH 2VDRL 4XMKL 1OP5K 3V5KA 2NXZD 3B8YA 4R4ND 1ZBKA 3BP6A 4Y0GA 4D3CL 4LCIH 3VFWB 1OAUH 1XIWD 2HJKB 1U3HC 2P8PA 3WFDL 3DETC 3HPLB 1JRHI 2E9WA 4L4VA 4MB1A 3OKLA 3C5JA 1DEDA 1NFDA 3NCJH 3PL6B 2YD5A 4X4MA 3D39E 2XPKA 1FO0H 4IUGA 5BOPA 3WDIA 2C8NA 3GI8H 3VIFA 1YYLL 1K6QL 1LO4L 3GRWL 1RAMA 3KPPB 4Y19B 3LQZA 4WWKB 3G9AB 2J4WH 1ND0B 3JTSB 4EOWL 2NY2B 2EDEA 1XF4B 3K8KA 1WB0A 4MX7B 1BFSA 1X7QB 2DB8A 3Q6FB 4IRSD 1OTTC 4HJ0C 3WO4B 3AS0A 3SDYL 5IG7B 5EBMB 4L8BB 2VDNL 5IVXA 3IJHA 1C5CL 1GL4B 2WSKA 3KYMA 4HUXB 4X7SH 4G6AD 3F5WB 4PRHE 2Q3AA 5C8JB 3NPZB 1JXKA 4PJFA 1NMCC 4OLZL 2XIBA 1JPST 5C6TH 1BFTA 2AK4B 2RJMA 4D9LL 3TO2A 5BXFA 4P4KC 5FYKE 5TDNA 2ZE0A 3QEQD 4Z18A 4MDIA 2ZUVA 2FLBT 5JBEA 2X4TA 1P4BH 1T03L 1EHLH 4MGXA 3U46B 1RMFH 4LGRB 1FE8L 1MCEA 2QSQA 3ZE2E 1VAHA 5J11B 1KPRB 2GY7B 1XAUA 4LKCA 1I3GH 4X8JB 1GC1H 4PP2B 1YEGH 4PTUA 4M6OL 5BRZA 3ZT6A 1NLBL 3PWVB 3FB6A 2AEWA 4BM7A 2I5YL 3P9LB 2BNRE 5D9SA 5B3JE 1P7HL 1HHKB 3PQYE 3TBSA 2E3ZA 2PBOA 2WZIA 3X12B 1F13A 3GH4A 3U30B 1AP2A 2HVMA 4YE4H 3L7FB 2OSLB 5E08L 1RZIA 2X4UB 2ERJB 1CDBA 4FMKA 4OLVL 3SJVE 4YNYA 4PV9B 3ZR6A 2DYPA 1MPAL 4TX8A 2QHLA 1E5NA 1N5YL 3EKCA 1JWMB 2W91A 1A7BA 3OKKB 2F5AL 4EXKA 2KL6A 5DJYA 4UQ9A 4WRLA 3DVNB 3X11B 5EU3A 4JVUA 3WFZA 3RTQA 1DDHA 3UTSB 3SEPA 1Q9KB 4HJGB 3BKYH 1RIUL 3GNPA 5JOEA 1OAXH 2DQJH 3LD8B 4S1RH 1LE9B 2GJZA 5IT2L 1T1YA 1B31A 1BQLL 1JNEA 3GXMA 1R3KA 2HTKC 3AAZA 4KMLB 2R1YA 5IJKC 5D6CA 4G8EA 3TZVB 4UZSA 1M4KA 3GM8A 4MAZA 4URIA 4NQDA 2CDGB 3LHPH 1S8DA 3TNNA 2DMKA 2G75A 1O0VA 2VOTA 4NN6B 1T0NA 4PJ8A 4PCSA 5GRUH 5D96C 2WM0A 1S9WB 4FTVB 4S10A 3RY6C 3G6JF 2ADFL 1HOCA 3C60D 5D7IE 5KSAC 3SDCC 2WZHA 5I1EL 1UZ1A 3LS4H 4RX4D 2W4XA 2DL9A 4IIQB 5LQBL 4LRIA 3P11H 2G4FA 2YD3A 3OXSA 1NL0H 3KJ6H 5EPMA 4AIOA 1MWAA 4DKEL 1QHOA 1OM0A 2XWJA 3HTLX 1I7TB 5C92A 3JV4B 3E6HA 2A3EA 3LQAH 3DROB 4I18C 1FVDB 2X1PA 2Y72A 1IKNC 1GPOH 4WHDA 1INQB 5C0DA 5B22A 2X6MA 4QRPD 4EUPA 4RGNE 1MW3A 5LG1A 3GJFH 1G7HA 2W0LA 4P46C 3VIOA 4WI8A 3I2CL 1WISA 2R56L 5D2LF 3GMLB 1I7RB 3QHFH 3UTQA 2P7TA 5ABFA 1NAMH 2AVGA 4L9LB 5CFHA 1KJ3L 2NYYC 2YPLB 5JNYB 4MJ5B 5CQ1A 1JPSL 3CX2A 1PFCA 3F7RA 3MBEA 3RL2A 4TSAH 3ULUF 2EH8H 3WF0A 2OI9C 4PJ7F 3I85A 3KYKH 5TQ0L 2KH2B 4LGSB 3MUGB 4UQCA 1DTUA 1UQYA 1DQQB 3KXFD 4V2BA 3OZPA 3SKJH 1YEEH 4P8UA 5HDQH 2I07A 3L3HB 2JJSC 4BELD 2NY5C 2C3WA 3K2MC 1A6ZA 2UWFA 5EFIB 1TUXA 3W6MA 3F65A 3OLIA 3U7YL 4I0CC 1X6NA 4IJ3B 4L29A 5LWYL 1AQMA 1EGJA 3HI1A 1UVQA 1ZA6B 2F58L 2MTPA 3VX1A 2NX5A 2CUMA 5C07A 4GXVL 3BOVA 3R06A 3TYFB 5HYJB 4JJ5B 4YXLL 4QAWA 1UG6A 4OFKA 2ZXDA 5AY7A 2YA0A 1OWRM 5J06A 1M03A 3QNXB 3W29A 5TQ2H 3I02B 4OSUH 3VFOB 1NMAH 1WJ3A 4K7PX 1NC4D 3K1KC 4XVSH 4ZDHA 3FOMB 1B0GB 3OR7B 4GLRH 5J6GA 2JB6B 3KAAA 3DV6B 5F7DB 4GW5B 3D85A 4RA3A 4TN9A 2EDYA 1EEUA 4N1CA 4L4TB 2V7NB 4HS6B 3MROB 2FECL 5CBEA 2H6PB 4F9JA 1I75A 1UQSA 2HWZH 4FXGA 1X4XA 3SDXA 3WMBA 4A2LA 2D3NA 1KEMH 1E70M 43CAB 4R96A 4OAWA 3D69A 2FATH 1ZGLM 5CPTA 2G9HA 5CINH 5LBSH 5F1NA 1CBVH 4AZIA 3PDOA 4Z8FL 2EO9A 2PCPB 3S5LB 3S36X 3RPKA 3HE7A 4H26B 3SGDH 3LOWA 5E2JA 5J1AB 4K71B 1ZWIA 1OAYL 2JCCE 2ILLA 2CK0H 4ODSL 3J8F7 4GS7C 4TYUA 3VXMB 1LDSA 4OT1L 1H09A 1E5JA 5KJRL 3M6DA 2BRRH 1SJEA 1S7VA 3AMGA 1H15A 2ZUSA 5JW4R 5KS9B 4AD1A 1D5BA 1Q9WB 4MCYB 3CUHA 1Q72L 5C0IA 2E7LA 2YPLD 5BWFA 1H3TA 1F58H 2VDPH 3D39A 4ZO8A 4G9FE 4CKQA 4JHWH 1P9MA 2ATKA 1B4RA 4OLXL 2TAAA 3AZRA 1PZ5A 3ME0A 1R8LA 1Q9OA 4YHOH 3SE9H 4KRLB 4C59B 1T2QL 2YD8A 4JGJA 2F53D 3ZDXF 2QHAA 2YRZA 2XTJD 3GMNA 5FHBL 1AGFA 3WYRA 1KCRL 4OLUL 5I1KL 3AS3A 2BK8A 3WLBB 4YHYC 2UY3A 5F72S 4OB5L 2E8YA 3TO4C 3KGRA 4J8RA 4P9MH 4HIEB 3IAGC 4MB4A 1UWEL 4RFEB 3GBLA 5M7QA 3LKPB 3BE1H 5ANMB 5B38B 1PSKH 3QQ3B 3WUFA 1ACYL 4OZIE 5KW9L 3AIRA 2X1IA 3CVIL 4PRHA 1RHHA 2GCYB 5ESQB 1NANH 3MLWH 3BPNB 3ESUF 4LF3A 1V5JA 3S8WA 5GSVB 1E9LA 2WKGA 4P5TA 4PLJD 3S7GA 1X1NA 4FZ8H 1KEGL 1JFXA 4LRNH 2EDXA 5F3HB 3MLVL 3ARZA 2JJVA 3KPQA 3DGGB 5IB5A 1OB0A 1UCBL 1BX2A 5IIEB 4NC1C 4ZAKA 2GJXA 1FV1B 5A43C 3AIEA 1MREH 2WW8A 4NNXA 1S7XB 4NSKA 2ATPA 4PJXE 4LGXA 1F8TL 2XTLA 5BS0D 4MCZB 1T89A 4YXHL 3GMRA 1PX3A 4LLWB 4GQQA 4RISL 3MLYH 4EIGB 2PETA 3LB6D 1A6TB 5T3ZH 5C08A 4I3SH 4N0FB 5I1IH 3WLWD 2CMRH 1R86A 4P8WA 4L8SA 4BF7A 4EBQH 4FZEL 3BQUB 1NGYA 1O5DT 4TUKH 4HC1H 2AMGA 4NP4L 2BNRA 2MOVA 1E40A 2DTSA 3PQYA 4NO2B 2UZYB 2B8OT 1UJ3B 4PGEA 4UTFA 2AK4E 3LCYA 3L1OL 1FH5L 2BSSA 4N8VA 4O4YH 4OLYL 3H7LA 1M71B 1DQLL 4QXWA 4X98A 1KJVA 4OZFG 2Q86A 1YC7A 3ZTJG 5FCUH 1LG2A 3ZQ9A 4PTMA 4U7SA 2R4SL 3ARBC 3SJVA 3GBDA 1YC8A 1P7QA 2OJZL 5IFHL 1OSZB 1CL7L 1KBKA 1UC6A 4JY6A 4JFOA 1ZLSL 4RCAA 3FQNB 2D31B 1G7JA 1U2YA 5DLMH 5C2UB 1GVIA 4KI5E 2F5BL 5FGCB 2XA8L 2WYSA 2GIYA 4AISA 4L9DA 3LSOB 4N1EA 5FKAB 1F42A 1MJ7L 1S7WB 3RVVD 2YC1B 5E2VL 1TZIA 1LP9E 4HGWA 2WUBL 3KPSE 4J4PC 4JFXB 4ZUUB 3VFGH 5F7FA 1P1ZB 2Q8XA 1JZ4A 4OCYL 4DK6A 4HXAH 4FFZH 3S3JA 2CUIA 5A2LH 4WEUD 4OCRL 1TVDA 2WIIB 1NKOA 2Z31B 3RWDB 5T3ZE 4MDOA 4G5ZH 1FZOA 4RDQG 3ULUE 4RGOH 4GT7A 5EIQA 4EDXB 1YECH 2XVKA 2DBJA 4HT1L 1IAMA 3TBWA 2D7OA 1N7MH 4PV8B 1CDIA 6TAAA 2VC9A 4XB7A 3MGOB 3VFPB 2QQKL 2PF6A 1FHLA 5KOMC 5I19L 1HT6A 5KBNC 5ISZE 4QOKB 3CU1A 3MRGB 1YNTA 5B39B 5CILL 4NYLA 1TVBB 2X4NA 2ITDA 4XMLL 4IRZH 1D9KD 3TIEB 5EZLA 5DD3L 5LXGH 4PRWA 3UPCA 5DFVC 4Z95H 4ZUWA 3GM0A 5D5MB 1FC1A 4GG8A 1MUJB 1PG7X 1JRHL 2P44B 5EFFA 3T3ME 3G5ZB 3O3BB 1VPOL 2NY4D 3ZOAA 5EO9B 1IL1B 1OARL 1F4YL 3DOSA 1BZQK 1U8OA 1N8ZB 4OF0A 3VJ6B 1WKYA 2G5RA 4JQIL 1BECA 5L6YL 4LQ1A 3QRFM 4HA1A 5HI5D 2F19H 4APQB 1JF1B 5LA2A 4FABH 5IEHA 2FX7H 2XWTA 2GTZA 5EOTA 3QFJB 3ARGA 2DTML 1FC2D 2O5YH 2FJGA 1HP4A 1FOBA 2OXGA 4WKAA 5KSUB 3WQ4A 1MRCH 2J4GA 3BDBA 5DEFA 4TOYH 1F6LL 5DJXB 3OPZH 3NDZA 4D6CA 5IHUL 1QQDA 3KR3H 1H3WM 4JFEB 4MS8D 4PFEA 2CCRA 4K68A 4K55A 5MP6H 4M9OA 5C09B 3ZHLA 2AXFA 4AEEA 5FECA 2GK0A 1ZU8A 4YPGB 2C1OB 3C8HA 5DMKA 1CNVA 4ZUTB 5LGKA 1E0VA 4XNXL 5DWUL 2OYMA 3HJEA 3HNVH 3S34H 4W85A 3TVMC 5H8DA 1QZ1A 2AABL 1MHCB 4Q2ZA 3UJIH 4F7CA 3CFKA 4UDTB 2D7PA 2YOCA 2XZAL 2ZUUA 4K7PY 1J8HE 2A83B 3KL0A 4DWSD 3F62A 4LHUG 4YIQA 3HCVA 5E1AB 5TDOB 3VFNB 1L0QA 2EYRB 4Z5RB 1A3RH 3QXAA 4BK5A 3RKDD 1JIBA 4V1DB 1CCZA 1G6RH 5AYQA 3UJJH 5TPWH 1JFHA 1AKJB 3GBML 1CU4L 2JCCA 2Y07L 4NJAL 5EOQL 4X9IA 1U0QA 1G9ML 2DWEA 1UR8A 2B1HH 2ZJSL 3MJ8B 4M1DH 1UKQA 3CX5J 2JIWA 3WV0A 5A94A 2W61A 3L95B 3VFMB 1TJIL 4Y7EA 1F3JB 5DGRA 1JGIA 4M5YH 1CIDA 5EZJB 1IE5A 2AOSA 5HDLA 1A6VH 1TZGH 4G9FA 4PJIB 2KZWA 2VITB 3MRDA 5EIIB 2J8HA 1I4FA 4MQXC 3IKKA 1LQ0A 2VLRB 1AGEB 5AAWA 4EDWH 2WMFA 2ZUNA 3EHBD 2BDNL 2X05A 2KQNA 2QLVB 2YDQA 3EYUL 4UQAA 1XGQA 3KLAA 4APQD 2BVOB 4Z2HA 1C1EL 5EWIH 1ROWA 1R3JA 2HVKA 3G6DL 4P7RA 1XYFA 2YWZA 1DQML 2VXSH 1GGCH 3KS0H 2VXQL 4N8VG 4R4BB 5LA1A 1BYBA 3T0BA 4EVNA 4XCYA 4XAWH 1XF5A 3QPQC 4OZIA 1PKQE 1WZLA 1I9IH 2FJHB 4HJJL 4HLJA 4JO3L 1V3KA 2ADIA 4P57A 1CFSB 5IWLC 4FQJH 2PWEA 3FONA 4LPCA 5TH2A 1SEBB 3UDWA 5GS0C 5GRVL 2DIEA 3O9NA 4OZGB 4YO0B 4JAMB 3QDAA 1W8NA 4R26H 3PF2A 1MCLA 5A1AA 4YDJB 4U2YA 3TFKC 3V95A 1F97A 4PJXA 5E8PA 3WD2A 2AQ1A 3A3HA 1VSCA 1MFDH 5T1LA 4HDIA 3W11C 1YNLL 3H9ZA 3SKMA 3PZMA 4PB0L 4AM0B 2ED7A 4Z7UB 5EBMA 1UGNA 4ZNCD 1QW8A 1OAQH 1U8JA 4P5KA 4ZPTB 35C8H 3V52L 1JHTB 5GSRB 3QUMB 3UAJD 2PO6C 1MLCB 5HGHB 3IDNB 2AJUH 1MWAL 1L9NA 3SGDI 1RURL 2XZQL 5J0BA 5I18L 4V1DD 4BQBA 5IMOA 1W3HA 1AKJD 3MACH 3OV6A 5I66A 4UQDA 3O0RL 4S1SL 5IV2B 3BKCH 4KDVA 5GGUA 3SDAB 3CC5B 3UP1A 1KPUB 1ZLWH 4BQ6A 4XP1L 2YXFA 4NUJB 3SOBL 5JXAH 2B5IC 2YSSA 2DYPD 2IADB 4AZCB 3G08B 1RIVL 1KJ2A 5C0EA 2F74A 3FO2B 4P2OC 3S4SG 1LD9B 1FFNA 1UA3A 2WC3A 4YH6A 4O51B 1RZGA 3RTQD 5CLTA 4Z7WE 5KVGL 3ARXA 5D2NE 5DEGB 3VIKA 4RIRA 1JN6A 5DHVB 2AXJA 4YHML 1DLFL 4HFWB 4GFTB 1US2A 1KR1A 5EB8A 1LP9A 4M1RA 1DUYB 3I75B 3KPSA 2X89A 1NUFA 1BAGA 4QHNB 1HEZB 1QSEE 1D5ZA 4NUGH 4F66A 4X4YB 3H9YA 3IS1X 3PWUA 3JUZA 4NQDD 5D70H 5E2WH 5IEKB 4PSPA 1E6RA 2CPUA 4NZTL 2FD6L 3S88H 4PJ8D 4ELMB 2QADC 3FFCB 5IW1B 4HD9A 2PTTA 5EFDA 2YKKA 1ZVHA 2C1PA 1XCQB 5FKPA 1EGJL 3MA9H 3KJ4C 3WQ5A 3V6OC 1T4KB 3BWAA 4JY4B 5GGVH 4M43H 2BP3A 1JNJA 5E8DL 5KVEL 3NABL 4LSDA 1B9ZA 1HCFX 5L8KB 5ABEA 4LNRB 5FYLH 3AC0A 4MXWL 5HHMD 4AXNA 3AY4A 1LE9A 5D8ZA 2VLLB 3U6RB 4XNUL 5IB3A 1RUQL 2OZ4H 4M48H 5ISZA 4OD1L 3QRGL 4J12A 4JQVC 4Y4HA 1HKLH 2P8LB 3LRSA 3RPIB 3T0WA 2BZDA 3C5SB 1G1CA 2CSPA 1S7SB 1ADQH 3QUKA 4M80A 4WI3A 2RFXB 5HHQB 1BYDA 3A6BL 3Q1SL 5FHAH 1P5UA 3LIZH 1U9KA 2GI7A 3W0KA 3VWKC 1INEL 1A7RH 2BHYA 3CX5K 4XPTL 4F7TB 4AYFA 2I9LA 2VH5H 3CFBB 3STLB 3VGBA 3RO8A 3X3GL 3QIUB 3C8KA 4RZCA 5DZNA 2HFEB 2A6DB 1E4KC 3CSYB 2EPKX 6FABH 1MQKL 2YUWA 2QKIA 2YL8A 3BAEL 3QJHA 1XD1A 1ZT4B 1KJMA 1FGVH 3SKNB 1SEQL 4WHYH 3UYRH 4PTXA 4OTXL 3BVNB 3EOBA 4M7JH 1OGSA 2KKQA 2XRAH 1ZA3B 2VLJA 1LL4A 2VDMH 2NT0A 3P9WB 4M61A 1BLNB 2QSCL 3HU7A 4XGZB 4Y4KB 4UFLA 3FB8B 3A4WA 1ZS2A 3ULVD 1A7NH 3W28A 3OJ2C 5HGAB 3TA3C 2IAMC 2NY6D 1JDDA 4MJ4A 1OP9A 3DMMA 1IAKA 7CGTA 4OCWH 4PMOA 1G5AA 3VMPA 4YHPA 1RJYB 2VURA 3AHVA 5IMLB 1N64L 3MRPB 2IFFL 4NCC2