4MB3A

Crystal structure of e153q mutant of cold-adapted chitinase from moritella marina
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
528
structure length
528
Chain Sequence
GTITSQDDNVVVGYWHNWCDGRGYQGGNAPCVELKTVNPQYNVVNISFMKVYDIAEGRIPTFKLDPTIALSEAEFIAQIDTLNSQGRSVLIALGGADAHIELTRGDEDALAAEIIRLTDLYGFDGLDIDLQQAAITAKDNQFVIPAALKMVKEHYRKTGDNFMITMAPEFPYLTANGAYTPYLTELDGYYDFINPQFYNQGGDGLWIEGVGWIAQNNDALKEEFIYYIADSLINGTRNYHKIPHDKLVFGLPSNIDAAATGYIQDPQDLYKAFDRLKAQGQPLRGVMTWSVNWDMGTDAANNSYNQQFIKDYGNFIHNQLPPVTDMTPTLSGIVDTRVELDSHFDPLIGITAKDYQGNDITADVTVSGSVNTNQVGDYLLTYSVSSDDETTNQPRKITVYEILPAFTGITDTTVVIDSEFDPMQGVSASHPTQGDLTANITVTGEVDTNVVGVYELTYQLFYGQDNQQNMTDKRIVTVVTDAVSDDDWQVGSTYVKDDKVTHNGATWTAQWWTKGEEPGTTGEWGVWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chitinase 60
publication title Crystal structures of substrate-bound chitinase from the psychrophilic bacterium Moritella marina and its structure in solution
pubmed doi rcsb
source organism Moritella marina
molecule tags Hydrolase
total genus 173
structure length 528
sequence length 528
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
A PF16403 DUF5011 Domain of unknown function (DUF5011)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.20 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Carbohydrate-binding module superfamily 5/12 4mb3A04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb3A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mb3A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4mb3A01
1W9XA 4XBEL 5E2UL 4F79A 1JGUL 4Y4FC 1PZ5A 4UTBL 1JGDA 1IGTA 3LMJL 4GQ9H 4R27A 2D31B 5HHPA 3U0TA 5JLZB 1C7TA 2Q8BL 4L4JA 3QXDA 3FB8A 4IMKC 2B1AH 5F9OL 4YWGL 3DI3B 1U33A 5KS9F 2JEPA 2QADD 4JO3L 4NP4H 3PQYD 4OZFB 1JHTA 1IC5L 4XBGB 4FQLH 4EI6A 4P3CL 3WDIA 5I6XB 3W28A 4GG6A 3BZDA 5D5MF 1T5XA 4GRWH 5HPCA 2RGLA 1T2QH 4O58L 5HJ3B 4PJDF 3RWDB 3TIEB 3F7VB 1CTOA 4GS7B 1KV3A 1YY8A 4RISL 5I2UA 3IFNL 3L4XA 3V4UL 5LA2A 3NN8A 3ULUD 1F3DH 1M7DA 3MR9A 1N64L 5B38G 1VEOA 3RVWC 3BPNC 2DSZA 3S37X 2G3JA 1NFKA 2B7DT 5E5MA 3BAJA 2QQKH 3GSNH 3DV6A 4CUCA 1FP8A 1NUGA 5E9DA 5C07D 1A6TB 1JWMA 4JFWA 3WO4B 3CFJA 4JRXB 3BKML 4ACZB 3VIKA 3BKYH 5T1LD 2KH2B 1J05A 1HCFX 4M7LL 4POYA 1YMHB 1SJHA 1L7IH 4PJ7F 4QRQB 1HJSA 2Y5TA 4UINH 4OFKA 2JIEA 2E6PA 2WZHA 5EZOH 1C08B 4Z0XB 3HNSH 5IHUH 2V2XA 4CL7A 5FF6A 3MUGB 3WN5A 5JR1H 2O5ZH 5ITFB 5HHQB 3GSXA 4FXKA 4JPIA 3ECQA 3GTNA 1TLKA 3CXHK 1QACA 2UY7A 5TF1H 1KJMB 2YDRA 4ELKB 3VG0H 3QOMA 4PP1C 1BYAA 3AB0C 3MLUH 5D7SL 2OTUB 5FKYA 4ZUSA 1KUMA 4FS0A 4LHUB 1ECEA 3BVNA 1Q9KA 4EZMA 4AZ5A 1KENH 1OQOA 2PF0A 5B8CC 1FIGL 1BBDH 1I3RA 5DSCA 4QOKE 4RBPH 4MZ2A 1QRNB 4QYOA 3ZOAA 2AV1B 1DBKH 1CDCA 3QG7L 4WCYL 1TFVA 4PBGA 1B2WH 4HFUH 1GOGA 1M53A 2BSRB 4F37F 5CIPB 1CFQB 3OGSA 1BECA 3GMOB 4WTZG 5I1LA 3S9DB 4BFIB 3L5WB 1LO3H 1S3KL 3D2UD 4PJEB 3GJFA 3D69A 4NQEE 1RIUL 4Z7OE 4RFEB 2D2OA 4P2QA 1G7HB 4DWHA 2J7FA 2DIJA 4KMTL 2R4RH 3C8KA 4YDKL 3TN0C 3VILA 4IRSD 5F96L 1BYBA 5KG9A 3UYRH 2YRZA 3I6GB 3H8NA 3BO8A 3QJHA 4HUXA 5E24E 2R0ZH 3WO3B 4Y5VB 1UR0A 3VFNB 5M94B 3U0PA 3WD3A 4BFEA 3RWEB 3VRJB 5GSVB 3VD7A 2EEXA 1D9KD 1M04A 1A9BB 1DWAM 3FFCD 4TSCL 2AP2A 5E2VL 5EC1A 1MHHA 2ZCHL 3OGOE 5SWSD 1H3UA 2ESVD 2W0LA 2P49B 4EQ3A 1IGYA 1FG2B 5GS2H 3WIHA 5J3HC 1I1RA 1RJLB 4JY5L 2WUCL 2GFTA 1LGVA 4U7MA 3STBA 1Y18B 4EN3C 2R23A 4ETQA 1UH3A 3PL6B 2NT0A 3HR6A 1Z3GH 3KPSB 4AEIH 1V02E 1W9PA 5HHMD 4CU6A 1GZJA 2Y7QB 3I3DA 3MRRB 1QLRB 5EUKA 2WWKO 3NSXA 5EBGA 4LSSL 1ZWIA 2Q20A 4DKFL 1ROWA 4EUPA 4LSRH 5JHLH 1JWSA 4XVTL 4YXKL 4MXVE 5C0GB 3TBVA 5JNYB 2XNAB 1QFUH 3G5VB 1RUMH 4ZXBD 2DBJA 3KLAA 1B88A 4YHYB 3ZT7A 1WCBA 3QQNA 1IT9L 2VL5B 4BQBA 1MLCA 2OSWA 1YY9C 2NY6C 2DYPB 2UY3A 1EIBA 3DXAB 4QTIH 2C9AA 1K8IB 2ZUMA 5H37H 2ZJSL 3MRMA 5HPMB 4P2RD 4R4FL 4G9FB 2FJHB 1T04B 4ALAH 2EDOA 3JWOC 5FYKH 3ALXA 2GFBB 2C1OB 4U1SA 4ZSOB 4OZ4A 1HNYA 5D7LB 1LQSR 5C9JA 2HVJA 3HG1D 4EI5A 5E09A 2ZCLL 1RHHA 1HDMA 2DTSA 2J1KA 4BKLA 3TFKC 3U30B 1KTKE 4XWOC 1RP9A 1WZLA 2GSJA 2H2SC 3F6LA 1VEMA 1EJOH 4ODHL 4HJ0C 5BZDA 2RGSA 5HGDB 4EI5B 3IS0X 2A6DA 4W8AA 3PP4L 2K7QA 1BQUA 4L9DA 1ZHLA 3LKQB 2RR3A 4KJWC 2ZX9A 1CD8A 4HWBH 3ARQA 1BVLB 4FQIH 3GXFA 2XG4A 2IXUA 1CBVH 1BEYH 1GQLA 3ARRA 3O9WB 1X3DA 1PX4A 3WJLA 4XPHH 1T83A 1W0WA 4WW1A 5LGJB 5HHOB 3N11A 5DK0A 2P5WE 3RM8A 1J0HA 1ND0B 1NWUA 1H5VA 1BIIA 3AY4C 2M8XA 2LU3A 2Q3ZA 4KK5C 2D31A 1TJHH 3QUKA 4M48L 1RUPL 1CBGA 5JLZA 3B4NA 4FRWA 1S9YA 4UQ2A 4CD5A 4QGTA 1U3HD 5D6DC 4KMQA 2CQVA 4MD5B 2ICWB 5ACMA 1E1FA 4KDTA 3VX0A 2ADJB 4YHEA 4PRIA 2AAVA 5EWIH 2QLYA 3WQ8A 3QDJE 1WBYB 4FLOA 1GUVA 3IVKB 4AD4A 5A2CA 3G6AA 3SGDI 3KR3H 1N8ZB 3F7VA 3VMPA 2AJSH 3AI0A 1DP0A 2ORBL 1HE7A 2XZZA 5EUOE 1C8PA 3RPIB 2APTA 1XCTB 4JHWL 3KWWB 1KIUA 2ITDB 2I9LB 4BQ9A 4XBPA 3S7GA 1S78D 1A6WL 3VTRA 1OCQA 3IYLW 3C5ZD 4LLMB 4PV9B 2HA1A 4UBDC 3UBXA 1D3CA 5EIVA 3W0WE 4Q22A 4R96B 1KLUB 3KGRA 3CXDL 4JVWA 4UT9L 2YK1H 4Z0XA 3NDZA 1JRHH 3MUGA 3DVGB 1I3GL 1DANT 3N1MC 3WF4A 3N1FC 2IMMA 5HHQA 1FFPB 1OWQA 1HNFA 1A7RH 5JW5A 2A9MH 3ZKND 1UR2A 1KJMA 4NZUL 2DLTA 4Y1AB 3MRGA 3SE9H 3Q48A 3M1BB 2PN5A 3VXRB 2YXFA 4U6XB 1BAFL 5CILL 5A8QA 4XUYA 4YPGA 1BGAA 3VXUB 3L7FB 5D8JH 1HQ4B 2YD3A 3KS0H 4X9HA 3MRIA 5FYJL 3WJJC 1OB0A 2A74A 4MAUL 3V4VL 1WDQA 4LHUA 4PB0H 1HSBA 2HT2C 5I1JL 4WEMB 2DEPA 2V2TB 5DMGD 4OLZL 3KYMB 4DUWA 1LE9A 1MWOA 5I18H 2VXUH 4QO1A 5F6HJ 2EQDA 3KPNB 5DZOA 5J6GB 1UYQA 4GAGL 1QRNA 3LKPA 1RZ8B 3OG4B 4RGMB 1PYWB 4ZEPA 2CERA 5DGRA 3CZKA 1Q1JH 3FO2B 2BSRA 1CFQA 4A6YL 2VX7A 4JGUA 4KY1L 3RA7H 1MJUL 3EZJB 2CHOA 1SY6A 1UZ4A 3ISWA 4Z78B 3AXLB 5FO7B 4PJEA 2OTWA 3T2PA 4JDVB 2MTPA 4RFEA 1H0GA 4HZ7A 1S7SA 2R2BA 3AS2A 4HTYA 1D5XA 4ACPA 1NMCB 2WAGA 2IC2A 4S1DC 4FTVE 1R0AL 2F19L 4URIA 1BD2B 4M8VA 4NPYB 4ONFL 4UQBA 4JFUA 4KHXH 4I48A 1CDJA 3HRPA 3H42L 4ZUUB 4OZFG 4Y5YB 5I1EH 2OJEA 3C2AL 2GDUA 1KJ2B 4DGVH 2LV4A 2X44D 3AMLA 1KQYA 2DKMA 2EDXA 2OZ4H 3QIBA 1QLEL 4ETYA 3F4VA 1Q9OB 1GNXA 5CCKH 3PL6A 1NCTA 1JG9A 2XG5A 3AZRA 1RJYB 2NZIA 1UD6A 4GXUM 1F42A 3IJSA 1A5FL 4Y2DC 2W0PA 2Y7QA 1QLRA 5IM7B 4AMKH 4FLSA 1CWYA 2CBIA 2FB4L 1VPOH 1WEJL 4UILL 1EDTA 3QCVL 5BS0A 2XNAA 5DVLA 3MNZA 3HNTH 2XVNA 2MQCA 2NMSA 4LMQI 4HFWB 1A3LL 3DC0A 3SDAB 2VL5A 1KCLA 3K0WA 5IFHH 5D70H 2IPTL 4Q6IC 1BQHA 4HXAL 1L0YA 1HVXA 2DYPA 3X11A 4PRBB 2WC7A 2UYLB 3HE7C 2FYYB 2HMIC 4ZXLA 4R26H 4NN7C 3T1FA 4APQD 4KROC 5HPMA 4U1IA 4G9FA 3MRKB 4AW7A 3MBED 2GFBA 4TOYH 4LGPB 2YMXL 3ARDB 3L6FB 4M00A 3QNXB 1VGKA 1H15B 5C08B 3O2LA 1KBBA 1MIEH 2FIKB 4WHYG 3U2SB 2O92A 4P7QA 2F54E 4OLUH 1S7RB 3UO1L 5TF0A 4F33B 4BS0A 3MLZL 4I2XB 4NZRL 1RUAL 1CGYA 1XEDA 4PRPD 2ZOKB 1UEMA 2CKBA 4RQQB 2NYYC 4EDWH 1EDGA 4Z2LA 4XCCL 1E27B 1QBMH 4CRPA 5E6IB 1GONA 4LHUG 3BXNA 5K59F 4G8IB 1B0WA 1KB9K 2X0HA 1X5IA 5IVOA 3ZDZF 4TTUA 3O9WA 1O7SA 4NNYA 1FHDA 3T0EE 3RVTD 3V5KB 3OKEA 4PY7A 4Y16D 4MWFA 3IFPB 1JI1A 3GI9H 1HHIB 4HUMB 3BDYH 3TCLA 1OAZL 1P69B 1C8YA 5KN5B 4S1SL 4D6CA 4OM0H 1IGJA 1R7OA 3IU3B 2NY4D 4ELMB 5ICZA 3DNKA 4BQ5A 4UV4L 2ADJA 3WS6A 1MJ7L 5D9SA 2IXVA 2H6PB 3UJIL 1GOWA 1QSEE 2A6JB 1D5ZB 1MFEL 4LEOB 3EYFB 3M8OH 2P24A 3IVKA 1KT2B 4QNPE 4BA8A 3QFJA 3VXQB 3BZFB 1MRFH 3VFSB 1N8ZA 1JGLH 1NSNL 5AWNH 4WU5B 3IDNB 4KJYB 3ARFB 4WO4D 5MI0C 4MQXC 1KWGA 4O51B 5E0QA 2YUXA 5IK3B 4X98B 2PXYD 5M7QA 2DQTL 3PJSA 1CTNA 3NIFF 1OINA 3FCTB 1J8HD 4N8VB 5E94B 1FRGL 4HWBA 2NLJA 2CMRL 3OBAA 2Y07H 3W25A 3MXVL 4TUOB 1BZQK 5GPRA 4YE4L 4PV9A 1Z9SA 4I77L 4OCXH 4FQXD 2WWDA 3PP3K 3VRIB 1OIFA 5DEFA 4R9HA 4R96A 4NQSB 1XV8A 3SURA 3C5SA 4OCLC 4YHPB 4Z77A 2AS5M 3CXHJ 1B2YA 2R4SL 2DAVA 1NDMB 3BAEL 5ADPH 3LCYA 4PTWA 4IMLB 3FOLA 1FFPA 4AZIA 3KDMA 3QHOA 5EFDA 3VI3F 3EUUA 5CMAB 1OP3K 1IGML 4Y1AA 4L3EE 4YPJA 3TGXA 4JFDD 4PMYA 3QJFB 2DLIA 1KIRB 3VXUA 4XP9H 2J78A 4KHTH 3TWCH 1YEJH 3BAIA 1HQ4A 4MCZA 2JCCA 1XH0A 5T5NG 3QEQE 1Q0XL 2DSWA 2WVSA 4OF0A 5E8NB 4DWSB 1I75A 1CG9B 2D24A 1CENA 5GJTL 3L5XH 3MRCB 4M1DL 4QCIB 4U5IA 5IV2B 2VX5A 2R56H 3PWPB 4M7JH 5J6GA 1OAUL 3NCYS 2UZIL 3IDMA 1JPTL 3B2UC 1PYWA 1V3MA 3OA5A 4LCIL 3NFSH 1FVCA 4ONHA 2CRZA 2HVMA 2ADFL 1LD9B 4LDEB 3S3JA 5DK2A 5IMLB 3W4RA 1CLZH 5BZWB 4UR9A 2YPVL 3M17B 3X13B 3O3BB 5DHVB 4CN6A 5FO7A 1WP6A 1SJEB 1AIWA 4WW2B 4UIMA 3RVUC 3GSWA 4HLZG 1KJ3H 3OQ3B 3TA3A 4H8UA 1P53A 2XIIA 1OP5H 3R1GL 1QFWI 1H3PL 3HS0A 2X8RA 3CVHB 1V03A 4NHCL 4P7OA 4Y4KA 5LCVL 4NPYA 4D0DA 4YHNB 3EJYC 4OF6A 4RAUB 4HX1B 2NW0A 3ZZ1A 2D9QB 2P8MA 5H37G 2N1KA 3AMGA 3R0NA 1F8TL 5C0BE 3MO4A 2Q86A 2GJJA 2V5MA 3WNKA 1YPZB 5FM8A 1NGWA 2V6HA 5I8CA 1WT5C 4LU5L 3L4VA 1MIML 4LPVA 4PRHD 2YRLA 4NNPL 2R0LH 1OQXA 2D4DA 2WINB 4KWUA 1DVFA 1UD8A 1RJYA 4JZJC 2CIPA 3U7AA 5C0CB 4YK4B 2VOTA 2IALB 3RAJL 3UC0L 3ULVE 1PSKL 1SQ2N 3GSVA 4X8XA 1FZKA 3GSRB 1A3HA 3FQRB 1WCQA 5L2JB 2XM2A 2GSIB 4FHBD 4KXZH 5A2FA 1KGUA 3TT3H 4UFKA 3U79A 5KSAB 4HFWA 5D7IB 5DJ2A 2XTJC 4P9HC 1TZGH 4DAGL 4OTXL 3RVVC 1Y0LA 4D1JA 2WLZA 2UUDH 1QKZL 3SOBL 5DD1L 2UYLA 2FYYA 3BZEB 2NY1C 3EJZC 1J18A 2ZUVA 2XQBL 5I76B 1R3LB 5DUBB 5EFIA 2M2DA 2C3GA 3JWOH 3L6FA 3CBWA 1MCOH 3QNZA 5C08A 1H15A 5JHDE 1JMXA 1LF1A 2DQHL 5D1ZC 2OI9B 4NO5A 1FAIL 4FQJH 1V0MA 4UZUA 1GJUA 1JDDA 3MTRA 1SJVA 4I2XA 1I1YB 1RPQA 4M1GH 2GCYA 1I8IA 3VXNA 4Y4HC 1BVNP 3OB0K 3ZT5A 2ZOKA 4RQQA 5C0AE 4CCEA 3UR7A 1E27A 4N0RA 2OZ4A 1F97A 2MCPH 5F7DB 1IC4H 2FH8A 4ODUA 1F6FB 5A43C 2LVCA 4L4OA 4HBCL 2VRJA 2HISA 3OXRA 4YHKL 5FDYA 3U83A 5FGCE 3MV9A 1N2RB 2VSCA 3BH9B 3VGGA 5DMIH 2PBGA 5FCZA 6A3HA 1AP2A 2QADC 4NGHL 5LXGH 5ALBL 1BFOA 1HHIA 1OTSD 3BKCH 3Q1SH 1MCRA 4ORZC 4NSKA 2JIWA 5KN5A 3SN6N 1C93A 3P4NA 4PJIF 1P6FA 4Y19B 4WNQA 4OM1L 3FQXA 5AC5A 5K9JH 1WWAX 5E2TL 2A6JA 3ULUC 1D5ZA 4LEOA 4Q2ZB 1AHWB 2DLFL 4WV1B 3S8WA 4NN6C 4ONGL 1V0NA 1W8OA 3QIUD 5MEPB 1ISZA 4DN3L 4OLWL 3VXQA 3BZFA 1F00I 2AVGA 1HVQA 4PB9H 2J77A 2J88H 4POUB 1I3VA 3QXAB 3ARFA 5E8DL 5GGQL 1E3XA 1MW0A 2OBGA 4NN5B 4O51A 5DJAA 2X10A 3DX7A 1UD2A 1NBZA 5CINH 5HY9B 1YEIL 3U7WL 1QBAA 4XV0A 4GRLB 4D9QE 4NQDE 1Y6MR 2ID5A 5F70A 3TNNA 3UCRA 1UWUA 4TUOA 4OGAD 1ISXA 3EDEA 1MVUB 4KV5E 4TTGA 4OCWL 3GMNB 2AI0H 4ORGA 3BN3B 4HS3B 1UZ1A 3HNVH 5JW4Q 3TF7C 2R0WH 3NACH 4PR5B 1FGVH 3WCYA 3QDJA 2ZXAA 1G1CA 1AGFA 2YZ8A 1KBGH 4L4PA 3GJEA 5D7JD 2XXMB 3H9SD 5ALCL 3O45B 1WO2A 4FP8L 1IV8A 1H5BC 4NKOB 3A67L 1ZXQA 3I6KB 2RQ8A 1RZ7H 3W9EA 4BZ1L 2B0SH 1EV2E 3H9YA 4LLYA 2VWEC 1CFSB 4NKQB 4HHAB 3BWUC 1HINL 5F44A 1JZ7A 2E8ZA 5FOOA 2PNDA 5EN2A 4XHQA 4JFFB 3BAXA 4QEGA 4L9LB 4MA7H 3BC9A 3W0WA 1CG9A 1YZZA 2R1YA 4Q74A 3ZE2E 5L88L 3RI5F 4K94C 3PWPA 2DLHA 4NYLA 4ZUVA 4ACYA 1KGXA 2WHMA 4O00A 2CK0H 5DA4A 1H0DB 3WL9A 3GH4A 1I9JH 3LH2L 2GK2A 5B39B 4XVSH 2WVTA 5MERA 1I8LA 1GPFA 4LCWB 3PZIA 3B8SA 5TE6H 3RL1B 2OQJB 3Q6FB 1MY5A 4IRSC 4ZO8A 5DDHA 4F15B 5ICYA 1OAYH 1QSFB 2YWZA 3QDAA 1I8KB 3REWA 1E4IA 3ZE1E 3RWCB 2R29L 4HGMA 3ZJKA 2GTWB 5LGHH 3UCQA 1D9KC 3QHNA 2CGRH 1MLBA 1R5WA 2ZG1A 3CSPA 3CVHA 4DW2L 3L1OH 3LIZL 3JV6A 2HRPH 5KANI 3V52L 3ULVH 2XA8H 4NCC2 4P5TD 1RULH 5BRZA 1GOKA 1YPZA 2BVDA 5C6TH 4IM4A 2ZZUT 4K3DL 2F8QA 2XPGB 3IDYB 1HZHH 2BVQA 4K68A 5CHNB 1H9VA 5D2NB 1HOCA 2Z4QA 3C6LD 4H04A 3VWKD 3TZVA 2IALA 3SDCA 2HT3D 3T2NL 4PTXA 4PG9A 3BIAX 2QBWA 1MCKA 1JZ5A 4FTVA 2GSIA 2VDPH 1WVZA 1PY4A 5JUEH 4HF5L 2DI7A 4N8VG 1JGVL 1XMWA 1KEGH 4XPAL 1DLFL 3DROA 2YKLH 1HCVA 1R5IA 1EFQA 5DJ6A 3SJVB 1NOUA 4HZLB 4XGZA 1FE8H 5AUMB 4R3SB 3NZ8A 3ALGA 4Z7WA 5I76A 4R0LC 4Q0XL 4QXGH 3D85A 1AE6H 4UFHA 4QKXB 3AS0A 2OR9H 1CR9L 1WF5A 2XTJE 5A2KH 1CICA 5KW9L 2C3XA 3SKUD 2NX5E 4CD4A 3GBDA 2X7LB 4CNIB 4ODWB 4KJPD 3D3VB 3LQMA 1K8DB 5M5DA 3G04A 5JORB 3NH7L 4ZAKA 4G6KH 1KB9J 2VXTH 1OAQH 1IZJA 4ZFZA 5F7DA 5DT5A 4LFHG 3HE6D 4IRJB 2EDYA 4ZQKB 4J12A 2XKNA 3D1MC 3CX2A 2JJUA 4RA3A 1LE5B 1CGUA 5GGSY 5F7WC 5E2UH 1BJ1J 5IOPA 1N2RA 5ILTH 1KIPA 1U3HC 4H20L 3FRPG 3LMJH 2F61A 5GS0D 1FYTB 2B2XH 3VINA 1G7QB 2F54A 5J7CC 2PW2B 1T0PB 3WHE1 4OB5H 4ZYKB 4G43A 2PR4L 1CZ8H 1G9EA 4H8HA 1TVPA 2WB5A 5I5RA 5DFAA 1AO7D 4F7TA 1CXKA 1K3IA 1MCSA 2DQUL 1TTUA 4ODSH 4JM2B 3PZNA 1FZJB 3AXHA 3MS8A 1IC5H 3DHJA 4UU9B 1J8KA 4IIQB 4AIZA 3UX9B 1GAFH 4LRIC 1XF5B 1KPRA 1Z9OA 2Q76A 4V1DD 4D94A 1EX0A 2JF7A 1K9EA 2NXZD 3V4UH 5IKCB 5HYSB 4JN2B 1U9KA 2BSSB 1G5AA 3T0EA 3N50A 1DJSA 2MKWA 1CFTA 1S78C 2G3NA 3MLXH 4L4TA 1GQJA 3PWLB 4O2EA 3C5ZC 3P4MB 2ZOXA 2BNQE 3DUUB 1M03A 1CGTA 3OLGA 4YC2C 5I19L 1U95B 1MI5B 2MNUA 1AKJD 3BKMH 5C0IB 3FT3B 5CAYB 2VLJA 5L2KD 3LQAC 5HVFB 1LWJA 1OT1A 4Z7VB 5GRYA 4UT6H 5C09D 2AABH 4UUJB 1EEZA 4NBZB 2R15A 1A1MA 5C07E 1QSEA 2CDEB 3ZKNC 2VRKA 1ORSA 3TH2T 3S37H 5CPSA 3B9KA 3OR7B 3SCVA 4L29B 4OZIB 1Q0YH 5AYBA 2XRAL 3TNMB 4KTDL 2Y24A 3C60D 4NKOA 4GZIA 3MQIA 1KBKA 2W38A 1FORH 3U9PH 3FY1A 1J1OL 2W65A 4KDWA 1CXIA 3MMEB 5DMGC 2ZCKH 2DD8H 4M1CD 1WWCA 2DRUA 1UWEL 5DUMH 3QI9A 3RDTA 4RX4A 3O2DL 3O8XD 2IG2L 1EEUA 1FNEB 3FRUB 2WHJA 1OAXL 5SX5H 5A69A 4JHOA 2I5YL 5SV4A 1E6XM 2EICA 3D87B 4PTVA 1QI0A 2QSVA 7A3HA 5KSVB 5E99L 1EGJA 1Q9WB 3C2SA 3VFMA 3QEUA 4UT7L 2XOTA 5FYJE 1W9DM 3MSGA 1QPPA 5GNZA 4HW6A 5B39A 1DWHM 3A4AA 1A6AB 2J7HA 4HCRH 3H3PH 4ZNCD 8FABA 2A6KB 5C0RL 3T65A 2X4QB 2PYFA 3HLAA 2PO6D 4L3EA 3UDWA 2P7TB 1UM6H 3LPGA 5JW4N 3PIQB 5BV7C 4ZTOL 4OCSH 4KMTH 1PLGL 5TE4L 4P2OD 3VJ6B 1I8KA 5E2JA 4PLOB 5F96H 3RWCA 2CJUL 2BFVH 1AGBB 1FN4A 3VWJB 1IARB 3QEQA 3SDXB 5D1QA 4IISA 3ARBB 4JVPA 5FFLA 2G5BA 4YDLC 4X4YA 4LSQH 5A6BD 3WDQA 4FZ8L 1ZA3B 2CLVA 3KG5A 5FA4B 1E3ZA 5E2VH 2WSPA 3CO4A 2C3VB 3CLEL 1J1PH 1QVOB 5IMOB 2ZXDA 4U3AA 4TX8A 4E2OA 1TIUA 2XPGA 4R7DA 1BQCA 1YMMB 2GI7A 2HJLB 4EXKA 1GPOL 3BKJL 5GXBB 3QIWB 1MPAL 1I7TB 1MCWW 3C87A 4KKAD 4QXWA 3FFCE 4NRZA 4LSSH 5HI3C 1N6UA 5TGBA 5AAMA 5SWSE 2OTPA 3CDGA 2ESVE 5SX4H 2VC2L 2OK0H 4ZFGL 4TYUA 4PRWA 5F71A 1ZMYA 2PC8A 4X6BA 1CN4A 1Q94B 2VIRB 4APQC 1PW3A 1MFAH 3P9WB 4MSWB 1IAKA 3GI8L 2P8LA 3MBEC 4S2SA 1S8DB 2P48B 1FCCA 4P9HH 5C0BA 4HH9B 2H41A 1JI2A 4HZLA 1NL0H 3TPKA 3THMH 4OV5B 3UMTA 1XF4B 5AUMA 3LN4B 5C3LD 3Q6GH 2VC9A 3HC0A 2BNJA 4RL3A 4GW5B 1I7UA 4O4YH 4FQ2L 3ILPA 4U1GC 2X89A 2PWFA 3EDJA 1K4DA 4L8DA 5FECB 3LOWA 4P2RE 2D22A 2NXYD 3V0WL 1W0VB 1RZGB 4IDLA 4F66A 2APBA 3T3MF 1HKLH 2NZ9D 2BXZA 1M6OA 3ESUF 3PP4H 2JJSC 1A7QH 1IJ9A 3P3YA 4TVPL 3WD5L 5KVFH 3RPKA 5JMRA 2XYCA 1KPUB 3RVTC 1AI1L 3DRTA 1CQKA 3H7BB 4Y16C 2BERA 1FH5H 2FWOB 3V5HB 1I1CA 3ZE0E 3KPPB 3DVNB 4WGVB 4ZQKA 3LDBC 5DD3L 1PVHA 3NA9H 5DF0A 1ZBVA 2NT1A 4OKVB 4OFIA 4OF8A 5A2IH 3BQUB 3MUAA 2YA2A 1FYTA 5B39G 3MA7A 2NY4C 5E4EB 3HMCA 1WQVT 4FQHB 4ZYKA 1GOQA 4PJ5D 2V3FA 2J8UB 3HTLX 4BF7A 5MEOB 1KXTB 3ROLA 3MLYL 5GGVL 3WFZA 4DEPC 4AT6B 2HVKA 1UACH 5BW7A 4IIQA 5T1MB 2TAAA 4H1LH 4RAVB 1TZIB 2MWCA 1XF5A 4WO4C 4ATDA 3OZOA 5DZLA 3FQWA 2PXYC 5MHSD 2VZ1A 5L7XH 4PMUA 1QBLL 5IKCA 1MCJA 5FL1A 3FQTA 1UADC 1UJ3C 4Q9BA 3QUXD 5JOPD 4RGOH 1BBJB 4CVWA 3DUUA 3HMWL 1X1NA 4FQXC 4Y7MA 2YIHA 1HWHB 2X1WL 4OCRL 4Z7QF 4U05A 4JE4B 3GSNB 3U36A 4LCCB 3FT3A 2WAHA 3FB5A 4ELMF 5I1IL 4JZNA 3BPLC 1AXIB 4J23A 1UR8A 1G9MH 1AQDB 1KFAL 4IBLT 4W81A 1YQ2A 2ZUQC 5CEYA 3LKRB 1NQBA 4D1IA 4LOUC 3BH8B 3L3HB 2XVPA 1BQSA 3MANA 4MA1B 3M07A 4FABH 1I3GH 4UQ3A 4OFPA 1F6LL 3D18B 2HJKA 5DQDH 4FQCL 5TDNA 3TNMA 4NZUH 3BP7B 4BQ6A 3TBWA 5JPNA 4OQTL 4F8QA 4AJ0A 4I18B 4L8SA 4MQ7A 3WMSA 1FFNB 2W07A 4I0PD 3VXMD 5IEKB 5FYJH 3VDAA 3ARGD 4L1HA 4NQDA 3NCEB 1A14H 4NO0A 5GQBA 5LVEA 1GOIA 3OKKA 5E00B 3S36X 3MGTA 4W70A 3BCFA 5KEZA 3FRUA 3PHSA 1RAMA 4JFYB 1QFHA 1F4WH 1WAAE 1EFXB 1I1AB 1A6VH 1Q9WA 4Y8AA 3SHSA 3L5HA 4A6YH 4KY1H 1MJUH 4B3KA 1XR8B 2HWZL 4MZ3A 1WC7B 4M81A 4GBXB 5LA0A 1NAKH 5M3WA 1VDGA 3C6SB 2A6KA 4I5BA 1MUJA 4IDJL 1NCNA 1QYGL 4NQXB 4LNVA 5K93A 1VKXA 2H32H 3LS5H 1GIGL 1F11A 1YYMH 1AQHA 1G6RH 4JJ5B 3S36L 5SWZB 2PF6A 3RNKB 3CFDA 4WUKH 4P23B 2AJYH 2R2EB 1AGBA 4KK8D 3BDXA 3VWJA 4KUCD 1TJIH 3EDKA 1IEHA 1NWRA 4NKIH 2A9NH 2FL5B 5DJ8A 1ZKAA 4UB0H 2FATL 4M6ML 3MJ7A 5GHWL 3GM8A 5FA4A 4J3XA 1D5IL 2CLRB 4P8VA 5HVGB 1C5DB 3PZQA 3D3AA 4WTXA 4EOWH 1HH9B 5F1KC 1S7UB 1CL7I 1QLEH 3OV6A 4XAWL 4Q58C 5GGTL 2EDBA 4QF1A 3DPBA 1WFUA 1ZTXL 2HJLA 4DKDC 5LQBH 1DANU 4WW2F 1A7OH 1Q6EA 1OAKL 3QIWA 2WV3A 4H2CA 3UG3A 1A5FH 3WF1A 4ZS6D 4PSPA 1IAII 1E4XL 5IGXH 3VFWB 3POHA 2FB4H 1WEJH 3QCVH 1DEDA 3DV4A 1CFVH 5IBTL 1CLCA 3L3IA 4MNQD 3AIQA 5I71C 3LN9A 2WYSA 1HHJA 4HGKC 3FB7B 4RAHA 4L5FH 4HCRA 3HUJE 4DGYL 1VFBA 1NUFA 2QTEA 2VERN 4P4KA 2V17H 1MWAL 4HS8H 2X42A 3BN9D 2HYMA 1W8NA 3CFKA 2Y6SD 5EBAA 5DZNA 2VITA 4KK9D 2X9YA 4RNRB 3BP5B 5HTSA 4JKLA 4MNLA 3UETA 3MFFA 1QTYT 4I4WB 4XMKL 5I30L 2YL6A 3NTCL 5JW4M 4YHZL 1RVFH 5ANMB 4GKZB 2EECA 1T2JA 3BEVA 3QUYB 4OUOA 5FECA 2VRQA 3HI5L 3MLZH 4NZRH 4M6OH 1RUAH 1AGDB 1RZGA 4PGDB 1FDLL 3CMOL 4Z7UB 2Y8VA 5I2IB 3S96B 3ULUL 3WIJA 5D7IF 5JPMB 1GQIA 1PG7L 2VKXA 3IKKA 4F7PB 2VDQH 5BXFA 1A7BA 2J2ZA 1D5BB 1INDH 4NQUA 2KL6A 5TDOB 3WFBL 4NRYA 3MCLL 1S7TA 4X6CE 1I1WA 3H7BA 1A0QH 3QDMB 4DCQA 4M02A 4BELD 5T3ZD 1OTSC 4PRDA 3N13A 3NCMA 2CUMA 2AV7B 4DFHA 4OFYA 4YHLL 4FFZL 4MX7B 1G7JA 5IF0A 1XCXA 4YN5A 3SKOB 2YEZA 4CJ1A 4PJBF 3NGBB 1H0IA 1LP9E 2JK5B 5BVPH 4H8WH 1JWUB 3FB6A 4S1SH 3MSDA 1WIPA 2XVKA 1D5MA 5E9DD 1NGQL 3RUGE 4MAYB 1B3ZA 2XFFA 4P0DA 5MP6H 2MPAH 2FJFB 5GGUB 2J4GA 2VZUA 5IHRA 4RAVA 1EEYB 5A6MA 4ZFFB 4HPHA 2VSDA 4JDTH 4EDXB 4OI9A 2QHRL 1EJ6A 2HLAB 3ZYOA 3D25A 3SCMB 3AREA 3VFOB 3IFOB 4PRNA 5F93C 4ZFOL 4OGAC 2E7MA 2E7LC 2WHLA 1BBJA 2XFXB 1FRGH 4OZOA 3ESVF 1RZJC 4OCNC 1AR2A 2CMRH 1KB5H 2X1PA 3G9AB 2ERJB 3MOQA 4C4KO 5B3JE 3KYKH 1KJVB 4K94L 4LCCA 5DQJA 4AZHA 4KQ4L 4P2CG 1CLXA 3VXSE 3BIBX 2IUZA 2XWBB 5D7JC 1XRVA 2CSPA 4U6YB 3CZGA 2YL9A 1J8HE 3S34H 1YN6B 1NMAH 4G5ZH 2K1MA 3WSQH 5DJ0B 2ICEB 3QBTB 4G9DB 3HZKA 2Q87A 3BAEH 4F7CB 1EXPA 1BWWA 4WI4A 5C7XH 1FG9C 3D18A 4LKCB 2F5BH 3LEVL 3RBGA 1E6JL 3WE6B 4AEFA 3BP7A 3CNKA 5J06A 7FABL 3DVIA 3GKWL 2OSLB 5I1GL 3CFCL 4U1MB 1VAHA 4WEBH 2BNQA 1VFAB 2DQJL 4H1LA 5T33H 2AMGA 4JKPH 1IGFH 3EBVA 2E27L 5CJQL 2VDKL 12E8L 5C2BL 4P2QD 3NPSB 1X5XA 4JANB 2OR8A 3FN3A 25C8H 3QPXL 1T7ZA 2WIMA 2Z31B 4NNXA 4NRXA 2WBJA 1UWQA 1WJ3A 1T80A 3KXFE 2UZIH 5KZ6A 3FFDA 4G8FB 3L5JA 5ESAA 3MLVL 3MRFA 1RUQH 1AH1A 1EHNA 5KZCB 5JOEA 1ZHBB 2I9TA 1XR8A 4M43H 4JFOB 3C6SA 4P59H 2P42B 1GC1C 4PYGA 1IGCH 5EPMB 4ODVH 4A2LA 2A38A 4JJ5A 4M5YL 4NJAH 4XCYA 5SWZA 4XP1H 3RNKA 3TVMC 2EDTA 2R2EA 3NVQA 4HXBH 3V6ZB 1TVBB 3E2HB 3MRNA 5EBWA 2OWCA 4MJIB 35C8H 2UZXB 5LCVH 5IIEA 2JFEX 1NFDE 1UYWL 4CVXA 3MMDA 2X1IA 4LARH 1JXJA 3L3JB 4KJQC 3DECA 3WV0A 4X0KA 3U7YL 2OJZL 2HTLD 5BQ7A 1WFNA 1E56A 1HH9A 3C6LC 4WHCA 1MIMH 3VWKC 4NF7A 3E3QE 4HKXA 1N0XL 2OR7A 1S7UA 2HT3C 3LRHA 1CGXA 4ZNEA 3DX8B 5I15L 3PHOA 3BUYB 1TG7A 3P11L 2JJVA 4GQPH 4YBLB 3X14B 2A73A 5JQ6L 4OGXL 5ICXA 3VFWA 4Y5XA 3BLKA 2OCFD 1ZLSL 4TUKH 1E72M 4L3CB 4PV8A 4WKFA 4PRHE 1LDSA 1NPUA 2DDQH 3A6CL 1LO5A 3RY6C 1GW1A 4A6YA 4CW1B 1UWIA 2XKSA 5FIPA 4OTXH 1I9EA 4RWYL 4LLVB 2IQ9L 4KPHL 5DD1H 4JKWA 3F12B 4F7EA 3GEWB 5H94A 2H32A 2DT1A 2XSBA 3BAYA 1VENA 2G75A 4IRZL 2XQBH 3LRSA 4PJAE 5HGAB 2WZEA 2V5TA 4WDIB 1GOMA 1DQTA 4UTAL 3WLWD 4GINA 2AEPH 3BP5A 4CN4A 3MLSH 5T1KA 3LHPH 3RX5A 1FIEA 4HKZA 2VZTA 3N9GH 1JNHA 1ZVSB 2FH6A 5CWSB 2A77H 4HPGA 2ICWI 5SWSA 4QXTB 3JTTB 4PGBA 3T04D 5I8OL 1JDCA 4LMQE 3WH6A 4C56B 1JBJA 4Z7UA 5D2LE 4HEME 5I2IA 1NLBL 3T08A 3S96A 3HE6C 4H1LG 1W72H 2RIKA 2ZIDA 1KN2L 4EKJA 5FO8B 1MFUA 3Q3GA 2P5WB 3UG4A 3W24A 1MCWM 1DQDH 3PGCA 2E3VA 2Z0BA 1L9NA 4PRID 2C7UB 3DURB 4JLRB 5GS0C 3QDMA 1OSPL 4ZXBA 3TA9A 2D7NA 2NW3A 3G6JB 2WVVA 2AV7A 4JHZA 4MX7A 5DT1L 4BM7A 3MRJB 3SKJL 1HJWA 3LQAL 5FM5M 1TA3A 4Y4FB 5TE7L 3MUHL 2EDHA 1CXEA 1JWUA 2GQHA 1R3KB 4BSJA 5CBAA 1X5HA 3E6FB 1UFUA 5C0EB 1ZVYA 2FGWH 3DUSB 1B30A 5D71L 2B1HL 2NXZC 4I3RH 4JZ5A 4U0QB 5E2TH 1ZANL 2DQEH 2A1WH 2WVUA 5CJOL 5GRUL 4BQ4A 3PF2A 3WQVA 5GJSH 3GNPA 4ERSL 4TULL 5FXCH 1WDRA 1V3KA 2DQFA 4X5WB 5MENE 1UM5L 2CEQA 3D0VB 3SCMA 1K4CA 3VFOA 4LKXB 4D8PB 2VUYA 3IFOA 1Q9LB 1ED3B 3WUFA 4M7KL 3SGDH 2J6EL 3DSNA 3HZVB 3A4WA 4NZCA 4LIQE 4PJ9C 3WEMA 4GKOA 1TCRB 2XFXA 2WUBL 4R6UA 2JELL 1UENA 4H5SB 3NCJL 4XB3A 3CHFA 3C09C 2DJ4A 3BPNB 2CPCA 3T1WA 1A6UH 5GGSB 3WFCL 4LHUD 4TTDD 4GMSL 4KTYA 2WMJA 1Z2KA 2Q1EA 5EU7E 3C60C 5DJ0A 2Z8WC 4G9DA 3TONA 5IT2L 4P46B 3MNVA 2ZUXA 1QRND 3CH1A 5E8EB 4LASL 3AM8C 4FP8H 4M93C 4FK9A 3VOCA 2EO7A 2IBZX 2C1PA 2IGFH 3VRLE 3IJ8A 4A2MA 4M1CC 4PJFE 4QRTB 4X6DE 3RIAF 2L0DA 1XSKA 1VACB 3U5YA 1UVQB 4WKAA 3W27A 3O8XC 5DJDB 3D0LB 4U7KA 2BOCB 1EVUA 3H9SE 1XH3A 5J12B 4P99A 3TBTA 4R7NA 4E0RA 4GPNA 3AB0B 4GZEA 5E1AB 4Z7VF 1KG0A 3MUZ1 4OZGE 3ULSA 1J9YA 3PUCA 3TJHD 3P0YL 1HH6B 3GBEA 3QHFL 5C0ND 5L0QC 5ABFB 2FX8L 4JHAH 5B8CB 4DJMA 1RZFL 2QF8A 4P2OC 1ZHBA 4LPTA 2KPNA 4MTVA 1V6WA 3O2VL 5B4MD 4XCFH 1ZGLP 3VFGL 4GKSB 3QIBD 3QR2A 1X5AA 4NWUH 2IH3A 5EPMA 3EJJX 4N8CL 2RTSA 3PL6D 3CFEB 4KRLB 4J2XA 2ZNXA 1T21B 1DBJL 2WBGA 1KF9B 1OARL 3V5DA 3V6ZA 2XJ7A 1HF6A 1HHHA 1SHMA 3SE3A 5F88A 3KJ6L 3LIZH 4U2YA 5CZVL 5A8PA 5BS0D 4H25B 1T7YA 5IHZB 3FN0L 2EC8A 5DD0H 3L3JA 4EIZC 5IB2B 4MB4A 1OGSA 3GRWH 5IEHA 4XAKD 2DYPD 4KKAC 4M6AA 5HYJB 4AIUA 2CD0A 4LVNC 1J9CT 3LEYL 4WWKA 3W39B 1CI5A 4YNYB 3OAZH 4G9FD 1XGQB 1JNJA 5IROA 3DX8A 1F4XH 5CS7A 1W1VA 3N18A 3WFHA 1MJ8H 3GMRB 1V7MH 5FIEA 3QO1B 3JVGC 1N5AB 3T2NH 4U1LB 5J57B 1CL7L 5BO1L 4EN3B 3GB7B 2DM2A 3L7EB 3T8XA 3SDXF 4L3CA 3QRGL 3ARTA 3O3DB 4OGYL 4XP5L 3QCTL 1WCGA 4KTEL 4W89A 1DEEA 2IQAB 1JGVH 4HQQH 1I9IH 4JPKH 1OD9A 4XPAH 2EXOA 1V05A 1I4FB 1MFVA 1DUZB 4R8WL 1FBIH 4LLVA 3CH9A 1BQLL 3LKSB 1WITA 5CJXC 5BVJB 5D7KD 2X9WA 4E42B 3V7AE 4ZPVB 1V7NL 5IVXE 1A7NL 4LLDA 2AJ3B 3TYGL 3CC5A 3BHBB 3CZFB 2NXYC 5I8KH 3K4DA 3TV3L 4P3WA 1TE1A 1ZHKA 3O9WD 4JPVH 2NZ9C 5CJ5A 2OL3H 4OIIH 2WIIB 3UYOD 2XZQH 1TNNA 3KL5A 2OYKA 3MSPA 5HYQB 2EIDA 1YDPA 1P4BH 3JTTA 5CEZL 1CK0H 1IQDA 3GH7A 4DGIH 3IDIA 4M7ZC 4ENEC 3PWNB 2AOSA 3G5YA 1V3IA 4P5KA 2MHAB 5E7FA 5I9QC 4S1RH 5FO8A 4DUXA 1XGTA 4E5XA 3O81A 1G94A 5IB4B 4OLYL 4GQRA 3DURA 2C7UA 2YR3A 3K8MA 1MCDA 4FQPA 2YD2A 4OV6F 5CSZA 2DWEA 3SUWA 4MDIA 1LEKB 1ODZA 3HFML 3QFJD 4IS6A 5FUZL 2XIDA 4WI3A 3U46B 1F4YL 43CAB 3BI9X 3OTTA 3PTQA 4LLWB 3IRPX 3MRJA 4TVPE 4PJ7E 4MXQC 4Y4FA 3DX6B 3D9AH 1EA9C 2GUOA 2W9EH 3CUPB 1I8MA 3E6FA 3GSQB 3HAEB 3V4PL 1AXSB 3W11D 4CMHC 4O2CA 3IJYB 2QQNL 4PJCB 2X4UA 4CD6A 2WP3O 4LIQH 5IBLD 1J0JA 2H2PD 2CR6A 3U0WL 3FONB 4U3CA 3WXVL 1V6VA 3IF1B 4PGCB 3PV6B 4BQ8A 4X6CA 1AO7E 5A95A 3QUXC 5IHSA 1QFPA 2FX7H 3FQNA 3VW3L 1IM3B 2C3HA 1IBGL 2NY5H 4AXNA 3HRZB 3D0VA 5IQ7L 4MAZA 1QO3B 1TJGL 1SEQL 2AXFB 4YBQD 4UOJA 1EBPA 4ZTPL 4K7FB 1W72A 5A16A 5IB1A 5I19H 4Y1AD 5IFTA 7CGTA 4UV7L 4XPFH 4H5SA 4PMDA 3VXRD 4HDIA 2JB5H 2QMJA 5C0JB 5LA1A 1OGGA 3VH8B 3MV11 4N9GB 3L4ZA 1JYWA 3VXUD 3RUGA 2ICWJ 4YZFF 4PJXF 1CE6B 4CKQA 3SDYH 4HIEA 2BOBB 3VFPB 1F90H 4CVUA 4F2MB 4YO0A 5DMKB 3JV5A 2C4XA 4WJ5B 3QH3B 5IJKC 3W81A 3BYTA 1MJJB 4RFOH 3GHEH 1YNLH 2YD1A 3GMQB 3K2UH 4N68A 4XNXH 4P46A 4KZEH 2O9TA 5BRQA 4B50A 3VIOA 5L2KE 5JBDA 2H1PH 4ODTL 4QRPA 4I0PC 3QFDB 3GSOB 3UTTB 5CQ1A 3NMEA 5C09E 1KCVH 3ARGC 4ZFMA 4AZCA 3K2MC 4LRNL 4QRTA 2P8PA 1XIWB 1VACA 4JFQB 4K07A 3GXIA 3EFDL 2OX5A 4WLCA 3VXPA 1ZA6B 4OBRA 2GJ6A 3NFPA 5EOQL 1GOOA 2BOCA 3OKMB 5TH2A 8CGTA 3BX7C 3MZGB 5D9PA 1BG9A 1PIGA 3MRHB 2WMHA 5C8JA 4EKXA 3VXSA 2VLRB 3MJ6A 2A0LD 5BMFL 4LPCA 4Y4KD 4Q6YA 3T77A 3SGKA 2Q8AL 4TN9A 4MJ5B 3N85L 3EYSL 4LLAA 3IDGA 2O9OA 4UT7H 3VA6A 2WNWA 2O5YH 3PZMA 2HKHL 3GGWA 4LF3B 1A6ZA 1D6VL 4UNUA 1PBYA 3QQ4B 4KK8C 2WZIA 5IB3A 1QNZH 4ZTOH 3F7RA 1GC1H 3G9VA 1MHCB 1EZVX 1VJZA 1VADB 3CFEA 1AVAA 1B6DA 3O6ML 3F62A 3R4DA 2E5EA 3VGAC 1BTCA 3KE0A 4HWNA 1UWXH 1S7QB 3CLFH 2MQ3A 1I9RL 3O6LL 3O4OC 3H3KA 4F9LA 1UKTA 1QFWH 1XGZA 1BFTA 3KXFA 1X44A 1NCAL 1JYVA 1CF8H 1TETL 2JEQA 2FO4B 3QEHB 1I1XA 4OJFH 4G80A 2ATPA 5HYJA 1DBMH 4ZS6C 3LKNA 4LDOB 1JK8A 1QR1B 3WFDL 4YNYA 1YC7A 1MPAH 3STZA 1LEGA 4KVNH 3KPQB 2F58L 2VXQH 3GMRA 4WFFE 3INUL 4Z5RA 4LYRA 5C08D 2G2RA 4OUUA 4MJ4A 2DT0A 1PEWA 3L7EA 4RCAA 1HP5A 3RRQA 1S5HA 1JHLL 3BN9C 2QQQA 3BIKB 1GHSA 3NUKA 1MQQA 2XY2A 4KK9C 3OXSB 3MV8E 5SWQA 3NBNA 3IGAB 3UJJL 1JD7A 1RUKH 3KPRB 5JO5B 1YN7B 2XTKA 2IH1B 5DQ9A 2WMGA 3N1PC 3NCOA 2XZCH 2OSYA 4Z95L 3W6LA 1QQDA 4E42A 3F7YB 4JCMA 4ZPVA 4X99B 5HHNA 2J79A 1MCNA 5DO8A 4F8TA 3F7PC 1EMTL 2AJ3A 5AC4A 1ZE3C 3HE7B 2JE8A 3BHBA 3CZFA 4BH8A 3F5KA 3L4WA 4JN1H 2F74B 3HB3D 4NN7B 2DSVA 4UQAA 2J8FA 3MV9D 4KROB 1B3VA 1UZ8A 4FMFA 4PFEA 3WLBB 3W38A 5EOCJ 4YQXL 5KAQG 5DURB 3GHBH 4HIJA 1H41A 4N42A 5GIRB 1KSRA 3GRWA 3O11B 4M4PA 3VGFA 3OGCB 5JXAH 4RIRB 3FO0H 1NC4A 4TVPH 3WD5H 1T1WA 1U8QB 2LFGA 3VFRA 1S7VB 3WIFA 3N0PB 1MNUH 3AC0A 1XAUA 5A8NA 1HQRB 4JGJA 3BLPX 2CO7B 1RMFL 4NBXB 5DD3H 5GS0H 5GRWA 3MRDB 1RZJL 2ZX5A 3WHXA 5KS9B 4XXDB 4ZS7L 3U46A 2XPKA 3B9DA 4O9HH 5TQ2L 4LLWA 1BGGA 3ARFD 3PWVB 4FQQB 1QZ1A 3OKDA 1FV1B 2AEQL 3DX6A 1RZKC 5GGVH 4X7TB 3CUPA 1E0VA 2BS9A 3QWRA 2VN7A 2FO1A 1AXSA 4PJDB 1R8LA 3IJ9A 3GO1L 1FLRL 5GISH 1T7VA 4OD2B 5ID1A 3BGAA 1T3FB 4QFUA 2DM3A 4PJ5E 3WN5C 1EERB 1TZ7A 4B5EA 3F5WA 2OL3A 3EIFA 2G4FA 1M71B 2BY0A 4W87A 1RP8A 3OG6B 1YYLH 1RJCA 1OBAA 1CGSH 2X4RA 5KTEH 5I1AA 3T0XA 3T4YA 2GIYA 3ZTNL 4XPTH 4XWGL 4G7YH 1QO3A 4P4RA 1PAMA 1EO8L 1E4KA 1P9MA 1QR4A 2YKKA 1U92B 2QHAA 3A0OA 3KAAA 4K7FA 4S11A 3U4EB 2GITB 5IFAL 4OCRH 3HA0A 2IFGA 5MI0B 1ZBCA 1FH9A 2N4IA 2DIBA 4XNZC 1II4E 3JWDC 4JM4H 5IFJB 1FQ9C 2YUZA 3CK0L 5JOPE 1H3XA 5HDRA 2GT9B 1AJ7L 5DMKA 4F2MA 3W0WD 3HKFA 3QH3A 2PKDA 2PCPB 4F57H 3LEXB 1QP1A 5FV1L 2R1WA 1NWTA 4W86A 2E9IA 1GZPA 3QXVA 1MJJA 3B8YA 3V79C 1Z0NA 3KYNB 5TQ0L 3BRFA 5DFTA 3PWPD 4OZHE 2W63A 1IMHC 4YHMH 5MENA 1BX2B 2O5XH 4POZD 2CUIA 1IFHL 3MLRH 5CSUA 3GXMA 2XZAL 5CP7B 1XIWA 3WFLA 2D3VA 2D0GA 4M5ZL 3VCLB 1XGPA 1MRCH 1ZSDB 4QHUA 1FO0H 3RIAK 5GRXG 3U7BA 4F7MB 1RJZA 4PMQA 4C83B 4LSPL 4GXVH 2LU7A 2BDNH 1Z0MA 4O2FB 2ADIA 1WNOA 3RJXA 3SDDA 3VXOB 1U8OB 2ITCB 2UVFA 4J1UA 2VLRA 3QA3A 1RURH 1DSFL 4GG8B 1DN2A 1RK0B 1YNKH 3HZYA 5E1HB 1VFUA 4AG4H 1BZ7A 4GAJL 1KJ2L 3F58L 2HWZH 4EQ2A 4H0IA 3PXJA 4XNUH 5BRZD 2ICCA 1FZMB 4Q7NA 1FVEB 4PJFA 4K3JL 3OKNA 1OTUD 3GYCA 1SFSA 1DE4B 3AUVA 1VSCA 1PQZB 1UXWB 1NGYB 1OF2B 1RFDH 5T1DL 1DLHB 3RX8A 3H9SA 4NC0B 4OIBA 5EOCL 3WFEL 5C0CD 2X2YA 3SCSA 3SDCD 1HIML 1FCGA 1WZ1H 2EDRA 2CIIA 4GZJA 5K9OA 4FTVD 4OZGA 3RWHA 4X7SH 4M6NL 4FLQA 4Z7OF 4N5UA 1GVYA 5KSAD 5I73C 2ZWYA 3HAEG 1U93B 5HGHA 4RMQA 2FO4A 5I78A 4XMPL 1FC2D 3X3FL 1R5VA 4G8GB 5DVNA 5DXWA 4NQCB 3GBMH 3O2DA 5DS8A 2KKQA 4ZO6A 1OSZA 2P5EE 5J6HB 1RIVH 1NBQA 3D85D 1YEHL 4DVRL 5IBTH 3PHQB 3MJGX 5A6LA 5EZIL 4UDTA 4TRPH 4JZJB 1CICD 3ZDZE 4NQTA 3HMXH 2FBJH 4D3CH 3EOBB 1IKNA 1MWAH 3MUJA 5ENWA 3WLWC 4PTUA 2IH1A 1TMCB 2E9BA 1KCUH 3FXYA 2O9PA 3WJLC 4U1HB 4MNQE 4LXFA 1T83C 2XTJB 5E2WH 4TX6A 1YUHA 3ARYA 3F7YA 2QKIB 2NX5B 3SY0A 5HDBE 4OCMC 1A4JB 4LPUA 2H9GA 2NY1B 3NTCH 1OHQA 1P7QB 4P5TA 4PY8I 5DJZA 1E15A 4BSVB 2F54D 1ZT4B 4D6EA 5F3BB 4ISVB 3QHTC 1JN6A 3VI4E 1WBZA 4KDTC 2D49A 1AD0B 1BVKB 2G9HA 2D7PA 5EDXA 2F15A 3OGCA 3NJ3A 5F7LB 4C4KT 4GXPA 5I6XC 1NCWL 3UJTL 3L9RB 3PGFL 3QUMH 1T4KB 4QXUH 2YN5A 1JNDA 2IEPA 2VRAA 3MCLH 4Y4HB 1HYSD 5KOVC 5F97E 3P0VL 3VX1A 1U6AL 5TFSL 2OMBA 1U41A 3NIFE 3CCHA 3PABA 1DQJB 2HFFB 5ITBH 1W1YA 1YQVH 1A4KB 4CCCA 4JQXA 2LTQC 4XXDA 5DLMH 3TOPA 3T0ED 3VDCA 2BJMH 4XB7A 4JIEA 2UV3A 4GG6E 4L4TD 1E4WH 4IOIB 4MNJA 1FV1A 1NCCH 2QADB 1LILA 5D5MA 2PB1A 3PQYB 3SKNA 4GRLD 5LBSL 3SQOL 1MFCL 1S9KC 3LS4L 2VLJD 2R0KL 5D1XA 1N5YH 2FR4B 2C7FA 5DO2D 3OKLA 5JBFA 2EH8H 5E9DE 1QSED 5FK9B 3G6JF 2JJTA 1KTLA 3U6RA 3DARA 4H88L 1V8HA 1JNNH 4ZE5A 3O6KL 5I1KH 1PG7W 4WU7A 1U92A 4Y2OA 1N4XH 4PJ7A 4I3SL 2K9UA 4TTDC 2IBBA 3MJ9L 3R0MA 4TPRL 4QRUA 1L8NA 2HG5B 1DWFM 3MROB 5DTFB 3OB8A 1ZB5A 4HBQA 4JAMA 5DRWB 3QI9D 5INCB 5EUOF 1U8KB 4Z18A 3S5LA 4DVBA 3CSYB 3RDTD 5K9KA 2GT9A 4RX4D 3MRLB 4TSBL 2JJWA 2VO5A 2CYGA 3CMJA 1NAMH 2PCPA 4P8WA 3LAFA 4XHJD 2WMKA 4B0MM 3UZEA 2XYLA 3QWOB 2GJZA 5CGYD 1LMKA 2UY5A 1AXTL 3V6FB 1C92A 3GKWH 1H1NA 3CFCH 3PWUB 1V3JA 4JGMA 3SKMA 3G6DL 2RBLA 5LAXA 1J12A 4JRYE 3QULA 4FZEH 2NPLX 3BISA 4OKDA 4DN4L 4L3ED 1H5BB 4PN2A 1ZSDA 3NZHH 2FHCA 1P7KA 4CGTA 1KGWA 2X0YA 1CDUA 2YBRA 2Q6WA 5CEXB 4F7MA 1RU9H 4C83A 1UQSB 1MCPH 1QSFD 2XKUA 3UERA 5C0NC 1ACYH 1XCQB 4TUJB 2J5LC 5GRJH 2J47A 2YZ1A 4K9EL 1B0RA 3QEQD 4JJHA 1UCBH 2B4CH 5D1QD 4IHOB 4ZFOB 1TDQA 3PNWA 3MLVH 4DM2A 4PYSA 3GNML 3NA4A 5B4MC 3DI2B 3A6BL 1SM3L 1MRDH 3OPZL 3QIBC 3BPOC 1INEH 3WUWB 5L2KA 4KRMB 2W59A 4NZTL 1NMBL 4MDOA 1FVEA 1P2CA 4P49A 1EHLH 3I9GH 1DE4A 1MEXL 4G42B 2XWJB 3FT2A 1OF2A 3DYPA 1DCLA 3FO9B 3VFVB 1RQ5A 1FZOB 3DHMA 3DSFH 3IXAB 3MREB 4NZJA 5JXEA 2VCAA 4NUGL 2XQYK 4HS6A 4BA0A 4Z2JA 3P0GB 5KSBB 2YL5A 2AEIT 1XSJA 4OLVL 4OQTA 1FNGA 2AJXL 3TESA 1G0CA 2QSQA 2X4TB 4LLQB 4XRCB 3U7YH 2EYRA 2VXSH 4C57C 2ZG2A 1CD9B 3IT8D 4MJ6B 4RBPK 5FYKU 5C0BD 4F3FA 1N0XH 1CS6A 5GS1A 2CDFA 3KL0A 1ZS8B 1CLOH 5ID0B 4Q97A 5HHMB 2R8SH 3KL3A 4OGXH 2XY1A 1ZLSH 5EC2A 4AQOA 2BVOA 5KVGH 2VISB 2D20A 2X89D 3PDOB 5AYIA 3UYPA 5A2BA 3U9UB 4ZOEA 3EGSA 3MV7E 4Q9QL 1A9EA 1VFFA 4TQEL 3KLHD 4LSUL 3T4AA 3D3VD 5FAAA 1DFBH 1NLDL 1Q6DA 3RJDA 2Q7YB 2GUYA 3RO8A 2WCAA 3O9WC 2V5SA 2FX9L 5ADOH 4R90H 4P2RB 4D9LL 4YHIB 4YIQB 4DQOH 5EU5B 2CLZA 2OP4H 2ZG3A 1QA9B 3FAWA 3RMEA 3HG1B 4KRUA 1NEZB 1UA7A 4YFDB 3GDBA 5E8OA 1U0QA 4LAQL 2IAMA 1ISWA 2W61A 3VFUA 3BW9B 1UQZA 4BSVA 2DQIH 4JRWA 1FYTD 3D39B 3FT4A 1NLBH 3ROOB 4LCYA 4R4BB 3QUZA 1ZHNA 4ISVA 5M95B 2G8ZA 5HBFA 1U36A 4HIHA 1AD0A 3WS6C 3ZYJA 1AQ0A 2IADA 3MV8A 1M1SA 1X7QA 4JM2D 2VXVL 3CVIL 1HXMB 2YL8A 5SV3A 2V7NB 5KVEH 5IWLA 2WCSA 3I50H 5ACZA 1KNOB 3I2CH 3I85A 4JPWL 4QWWD 4PUBL 5FKPA 3PTKA 1ONQB 3MLWH 4KGJA 1KCKA 1U8LB 4V2CB 4XNMB 5L9DH 1DQJA 3GH5A 5LWYL 1HHGB 4PGZA 1U8JB 2A6IB 2Z35B 3ZT6A 1B1YA 3CU7A 4HUWB 3SKJH 3TT1L 3W11C 1MWAA 2X4SB 1BF2A 3HC4H 4PRIE 3TPUA 4F9JA 1U3HB 4JG0H 2H2PC 5DVMA 2PYEB 2VDNH 3QQ9D 1S9VB 1PKQB 1EXUA 5HSFA 5D71H 2XVGA 1GGCH 5ABDE 4X80H 2FJGA 2Z93B 1YHTA 1CIUA 4YDIL 3FAXA 1W2KT 5CJOH 4ZO9A 2FR4A 4ERSH 4KVCH 3NFNB 4YBQC 1UZ6F 5F7NC 5FCUL 3EOTL 4LNRB 2WWMD 1CFNA 4UDUA 4N9OB 2VABA 2YPLB 3ELAT 2IFFL 4JFZL 2ZSVA 3MZTA 4LQFL 2Z8RA 4JRXE 5EU4A 5EZJB 5DJYA 2O93L 1SBSL 3QZWB 1NQ6A 3WN6A 5E8PA 2Z1KA 5F89B 5ELIA 2JELH 3C9NB 1CD1B 1KC5L 2VR4A 1M05A 1U8NB 1NGZB 5A2AA 4QNPF 4BH7B 3C5ZB 5DTFA 2GK1A 4PJCF 5IG7B 4D9QD 4NQDD 1I1FA 2BCKA 4YC2B 1GGBL 4NO0D 3WF2A 5DRWA 3JWDH 3O3AB 3GMMB 4I0CC 5E9AA 1AQKL 3MRLA 3QR3A 4PRAA 5IT2H 2VZ3A 3RKDD 1QNPA 3UEZA 3V0AC 4GI9A 1ETZB 3V6FA 1QPXA 3MNWB 3GJFH 1LO0H 3ZR5A 3TA3C 3PZUA 3FN9A 3PWUA 4KMLB 1N7MH 3VM5A 4HAFA 1QRNE 3C8HA 1YEGL 1UWSA 1BAGA 5IVZA 1EO5A 4Y4KC 4RRPA 3MRQB 2WHKA 4M1RA 2DQDL 1NM9A 4LEXL 4AENB 4J6RL 5I1HL 3WL0A 3OZ9L 4MA3A 4TUJA 1G0XA 2AGJL 5JW3H 4K7PL 3VWJD 4MPKA 4D0BA 4MD0B 4PJEE 2IANB 1P4LB 4KI5D 4ZUTA 5HNNA 2HJFA 4E8CA 2R2HB 4W6YB 3T0WA 3DX9A 1PX8A 4ZUWA 3MRPA 1JIBA 1QNRA 1CDHA 3WIHH 4PS4H 3WUWA 4J28A 3MBXL 1MAML 1DVFC 2VCCA 2I24N 3QHZL 1B3WA 3WIIH 3ZKMD 3RX7A 4OCYL 1UQYA 2XWJA 1IKFL 1OGAB 1N59B 5FUOH 3QIWD 1MHPH 2G5RA 3FO9A 3RL2B 1FZOA 1WICA 3P4OA 4C54A 3KJ6H 5BV7B 1DBAL 3WKNA 3BJLA 4L3AA 1HEZB 2OXGA 3DMMB 2KDGA 3LN5B 1VHPA 5DI8A 5HDOA 3KPSE 3X3GL 2AXGB 4YDLB 4P4KD 4Z0BL 3WD1A 2ADGA 1J87A 3RP1A 1G1YA 2Y06L 2YPKA 3AMDA 4OT1H 2BNUA 5BS0E 1U8IA 1QG3A 3HI6H 4FG6D 1LNUB 2O9RA 2D4FA 3KPOA 5AZEL 4AEHL 5ID0A 5H2BB 4NM4L 1CL7H 4WI6A 4DKEH 4XAKE 2DM4A 3G5XB 3DXAE 4YXHL 5CZXC 3PDOA 1YJDL 5T3ZL 3U9UA 1KN4L 1J10A 3S35X 4X6EA 4XH2A 1IAIH 4G9FE 3AICA 3RWJB 3TCXA 4P8UA 1FJ1B 5FGRA 4ZSOE 5I1CH 2QV4A 2VQUA 4AL8L 3N17A 4QTHB 5D7LE 1BQLH 4CAGA 3ULVF 2WP3T 1VB9A 3GK8L 3P2TA 3HB3C 4CJ0A 4APQB 1MXDA 1B3XA 1EBAA 4V27A 4O5LL 3TYGH 5IW6B 4XVUD 1CE1H 1IZKA 1YECL 3P9LA 5D4QA 5MEQB 1UH4A 3SCOA 1T2XA 4HJGB 3O2WH 5TDPB 2VDLL 1P1ZA 1QA9A 3IDXH 5DA0B 2YC1B 2P5EA 2GSGB 3RWFB 3S35L 4K71C 4OFYD 1U8HA 5D7KE 4OAWB 4QY8B 1T1YB 5IHBA 3WBAA 1F58L 1PZ3A 3PZVA 4G7VL 1LK3L 2V7HB 3D39A 1MHEA 4U1GB 1HX0A 1TR1A 3ROOA 4R4BA 3SPVA 4PRPB 2J7EA 4OZFH 1OD8A 5C1MB 3BZ4A 1NCBL 3MOAH 3B9EA 5HHOE 2YD6A 1W1PA 2FLBT 4RRPG 1HXMA 2V7NA 2R1XB 4HPOL 1LP9B 4S1QH 4CADA 4GUPB 2BRQA 2WBKA 1ONQA 4XNMA 5HHVL 1JV5B 3ARFC 4YX2L 3K46A 4YR6A 3U1SL 3VXTB 4YGVB 2D9CA 4E41B 2Z35A 2VKWA 4HMDA 2F53B 4HUWA 3CUGA 3WUWG 4AZBA 2X4SA 5FO9B 3G5ZA 2GJXB 3P30H 2H3NA 2ARWA 3QQ3B 4HU0A 2QQNH 2EE3A 1ERNA 1UB5B 4DOHB 1JJUA 1MFBL 4OLXH 4L8BB 1QW9A 5DFWH 3BT2L 5DRXA 2BVYA 3DBXA 2RGMA 3TO4B 1MAKA 4V2BA 2RJMA 1KCRH 1TPXC 1TQBC 4WHYH 3OR6B 4LNRA 1S9WA 1IBGH 3RBSA 3TC9A 1CGWA 2YPLA 1MAJA 5HD8C 3P9MA 5F6HI 4ZTPH 4WO4B 3FOMB 1J5OL 2V3DA 1NKRA 2J7DA 2PXYB 1WZKA 5DRNB 3QCUL 5F89A 1J8HB 4CD8A 4HIXH 1U8NA 1UJ3B 1KEML 1BHGA 2BNQD 4ZD3L 1KPVB 1NP0A 3VVGA 5GGRA 1LK2B 5IG7A 3EMCA 1OL0A 2CRYA 4UOQA 1A8JH 4PG2A 1ZS2A 1EAJA 1JF5A 5CUSL 3OX8A 4Y1AE 3CPUA 1S7XB 2WW5A 3VXRE 2WBJD 3BPLB 1SMAA 4POZC 1I8LC 3VXUE 3QNYA 4XPBL 2DL9A 5CIPH 1IQWL 2ZUQB 4QRSA 3VGDA 3NAAL 1EK3A 1UA6L 2JCCE 1XGUB 5BXRA 1Q72L 1R24B 1SY6H 4KV5F 4XP6H 2XFYA 3I75A 2FDMA 3MNWA 3FQUA 3ARWA 4JFDB 5DD6B 1F3DJ 3EFDH 1J1XL 3MOBH 4RZCB 4Q9CA 5T5FL 1NC2A 3VMNA 4NKMB 4Z9KB 1MH5A 4KC3B 5INDB 4N1HB 1WE5A 3LQZB 1HJXA 3OJDA 3RWGA 4LCUB 1NEZG 5SWZD 4KKNA 2KQNA 4AENA 1AFVH 4K7PY 4P23D 5IW1A 3IXTB 5EORL 1YEDA 1ZT7A 3SGJA 2IANA 1MREH 1NCDH 3MACL 4O02L 3VE0B 2K7PA 4GRMB 1D6EA 1RSFA 1OTUC 3BD4A 4GXUN 1OD0A 3A6OA 4X8JB 1MCCA 2MOVA 3KLDA 5DFVD 1OPGH 1BD2E 1FOBA 5FYJD 4WK9A 5F3HA 1G7MA 3TZVC 1NFDB 5D9MA 3APGA 3SDCC 4JRYA 3PE9A 1J0KA 1FGNL 1BM3H 4AH2B 3IANA 1TXKA 3O6MH 1CCZA 3WUGA 2XWEA 3MXWL 4C58B 5J9PA 1UWTA 3CZLA 1CVSC 3O6LH 2EBNA 3UTSA 4NBYB 1A1OA 5GZNC 3PTMA 4B3LA 2VAAB 1HEZA 3DMMA 3LN5A 1TETH 3ZE1F 2AXGA 3BE1L 5KVDL 5I1DA 5ESQB 3EYUL 5DWUH 4AZ8A 5E5RB 3T3ME 4J8RA 1WPCA 4HOXA 32C2B 1UT9A 2OI9C 3WEXB 5T1KD 3DGCR 3WKMH 1CICC 1GHFL 4JHBA 2BP3A 5DRZB 5EZLB 4BK5A 4HUVB 2RFXB 3AMKA 4NOFA 3NSMA 1DQMH 5IESL 1HI6A 4MDJB 4PJAB 4GAYA 3QZWG 4ZAKC 2ZSWA 2CKBH 2X4PA 2GY5A 4N0FA 1OP5K 2YDSA 1W3LA 5DR5H 2D7TH 3NIDE 5C08E 1T89A 1LO4H 4M9OA 3WUEA 2O61A 2CETA 4GJTB 4UOZA 5A40E 4W8BA 1EMTH 4I2XE 4W84A 4HLZH 4UIKL 5DMYA 1AR1C 3AS3A 3PGDB 4L4VA 3QDMD 3WNPA 4PBVC 4HJGA 3W9DA 4YDVA 5TDPA 3N06B 4DZBB 1S5IL 2YC1A 4HA1A 1CNVA 2OYMA 4PMNA 1AD9A 3RWFA 3PG2A 4YQXH 4QY8A 1T1YA 1F4AA 4JB9L 1YEEH 3IJHA 2BNRB 4ONOA 4ZO7A 1TMQA 3TTYA 4GQ9L 2V7HA 4MNGB 4FOMA 2D0HA 1X5GA 2Y25A 3MV7A 1HYSC 2E9MA 1XGRA 5I66B 5EOTA 3STLA 2B1AL 5T3XE 3MV9E 4NJ9H 5IB5B 3PDDA 3MJ8A 4NP4L 5FM4A 3DYOA 3EDDA 4X5LA 1RIHL 3KYOA 2QSTA 4FQLL 3T0EC 1DBBH 3FJTA 4NO3B 3OJMB 1XF3A 4HJJH 2EH7H 1T2QL 1L6ZA 4E41A 4WFED 3S3PA 3TH3T 4ELME 3SCMD 1IL1B 3ES6A 3MCKA 2W9DH 4MLSA 4U1JA 4PJIA 4YGAB 1ZLWH 1JYNA 2HFEB 2E8YA 2FSEA 3LKOA 1A21A 4U6VL 2X05A 4W8LA 4W7VA 1US2A 2DSUA 2VT0A 3NCCB 3EYPA 3GSNL 4OLEA 5DO2C 3RZCB 3RY4A 1FLRH 5JUVA 2BC4A 4X9IA 3LB6D 4XC1H 3BKYL 2DQGL 3TO4A 3IS1X 4P9ML 5L8LB 4J7RA 3B9KC 3CU1A 1L7IL 4C59B 3R06B 4C7DA 5F7HA 4UINL 5J1TC 2Z91B 5F7EH 5EZOL 2I26N 3HNSL 1BLIA 1ZEAH 2A3CA 5JR1L 2O5ZL 3BWAB 2CR3A 4OZFA 1VGEL 4G6MH 4JO1H 3OMZA 3GBNH 4XBGA 1DWIM 5TF1L 4M56A 3VG0L 2PWHA 3QI9C 1HSAB 4MA8L 2P1YA 3RDTC 4LPWA 3MLUL 1KPVA 5HJ3A 3RWDA 1OCWL 3U57A 3TIEA 4EBQH 4XHJC 3L2MA 3AFBA 5KOMC 4X6DB 1XFPA 2DBLH 5F9JB 4NRRA 1BFVH 2Z31D 1OTTD 1KENL 5DHYB 4JY4B 1BBDL 4I9WE 5J4MA 2H8PB 5D7JB 1DZBA 4G3YL 4U6HB 3QOKA 4YEFA 1A6TA 3ULUF 1DBKL 3ZTJG 1R24A 1B2WL 2X40A 1IFHH 4HFUL 2NY0D 4JRXA 3UDWC 4F80A 4ACZA 4PJGB 2BSTB 1YMHA 1NCUA 4QRQA 1NBVH 3ZM8A 4YFLF 3RJQB 4C7GA 3PWPE 1UR1A 1LO3L 5INDA 3L4UA 5D1QC 1C08A 2EEBA 4RDQG 4S3JA 2NR6D 3HR5B 3AVEA 3D5OF 2YHGA 1YC8A 5ITFA 1LJYA 4XZBA 3ZKQD 1Z9MA 4E9LA 5CGMA 2R4RL 4KH2A 2W91A 1RI8A 4ELKA 3W2DH 3TM6A 4MJID 3B6SB 2E9JA 1R87A 3FZUD 3LSOB 1GGIH 2FRGP 3WNLA 2OTUA 1KJ2H 5L8JB 3K80A 4HUNB 2B5IC 1FFOB 3V0VB 1Z5LB 5AYQA 4OI7A 5EBMB 3VMOA 1CXHA 4WWKD 4Z7NE 4JO4H 5I23A 1G7IB 2AV1A 4AEIL 1Z3GL 4MMZC 5HGBB 3WEOA 2ARJQ 4ZDHB 1K9TA 5EIQA 5BRZE 3KS0J 1YPZE 2W60B 1KACB 5CIPA 3R8BB 4LSRL 3GMOA 3C08H 1MELA 3TVMB 3FTGB 4NOBA 5E03A 1QFUL 1RUML 3L5WA 4BFIA 2VAAA 5J0BA 3VDHA 1MCQA 3UG5A 2MJWA 5C0CE 4FMKA 1G7HA 5LGKA 3X3FH 4QTIL 1MQKH 3MPCA 2HLFD 2HH0H 3I6GA 3AIRA 1U2HA 1UH2A 5HI4D 32C2A 4ALAL 1MVYA 6FABH 4Y5VA 5FYKL 3ULVC 5EIIB 3VFNA 1WIUA 5TPWH 2UWEB 5HDQH 4BZ2H 1YEHH 5DRZA 3F5LA 4JDZB 3RWEA 3FO1B 3VRJA 5GSVA 3IFLH 4RE2A 3KLHC 1C1EH 4PJHB 1A9BA 2GK0B 1T1ZB 4HGWB 5KSBF 2WWCA 4W88A 4GSDH 1T0MB 4Z7WE 3ZHDA 1FG2A 3RNQB 1PX3A 1RJLA 4K3EL 1EJOL 2LABA 1Y18A 4RMUA 4X4ME 1A22B 3KPSA 5F7KC 3MRRA 1E6SM 1E43A 3M46A 2AJVL 3AIWA 1IGIH 1Q6FA 4HWBL 1KLGB 4FQIL 5T3XH 3CD4A 5C0GA 3ZQ9A 5JNYA 2BXYA 2FD6L 3G5VA 1CBVL 3BP4B 4EAMA 3L95B 4XPHL 4WY7H 5IR1B 2ARJB 3IDJB 3DXAA 1K8IA 1QEWB 3Q5YA 1TJHL 5BW7C 4Z2GA 4Y4FD 4IIQC 2FJHA 1T04A 2V2WB 4NT6B 5C6PB 5KJRH 3UJTH 5I66A 2P44B 2X5PA 4P57B 4QWWC 2C1OA 2CH8A 4ZSOA 3OAUL 1EUTA 4AYFA 5D7LA 3DUHA 3HE6B 4BSWB 1G01A 4Z8FH 4KZDH 5EWIL 5EBLB 1OWWA 4NO3A 2NQCA 1R85A 1QVBA 5AZ2H 2FNBA 2AK1H 1BZ9B 4Q9RH 4K3GA 5HGDA 3OF6A 2FBOJ 2FECI 1MOEA 3KR3L 4IJ3C 1JPFB 4K8RL 3QQ9C 4IUGA 4Y19E 2AJSL 1IL1A 4NUJB 2EO9A 4QRRB 3VGEA 2VYRE 3EYOB 2XN9B 3EHBD 5GSRB 3LKQA 1HILB 1BVLA 3E8UH 3OL2A 3ZE0F 1X4YA 1Q38A 2BRRH 3I3BA 3RZCA 1J0IA 5J56B 2ZX6A 3T0AA 2B20A 4N0UB 4HLJA 5LGJA 5FHBH 5HHOA 3ECBB 5HOSA 1ND0A 5J13C 4L4TE 1B4JH 4V1DB 4JEGB 2NXZB 4HIIB 2XA3A 2DQCH 4QP0A 2EEDA 2YK1L 4P46D 1JRHL 4G6FB 4N0CD 5HPOA 2BY2A 4L8SC 1C5CH 3BWAA 2VLJE 4MD5A 2ICWA 4QRPD 5D6CB 2DT2A 2A9ML 4LSTH 3MA9L 2YLLA 4AIOA 3SE9L 4PMXA 3ZL4H 1F02I 1AKJB 1WBYA 5L6YH 3ME0A 3AU1B 5FA3B 1WBXB 4PJ9B 3NDYA 2GJ6D 3TTOA 5D8JL 5CSYA 1AY1H 3RKDC 4FNLH 3LZFH 1GZQB 3C09B 5HHXH 3VU2A 4PB0L 4PLNC 3VXSD 4P8XA 3RPIA 4JY4A 1XCTA 3KWWA 5I18L 2ITDA 1FNSH 2I9LA 1L0XA 1K6QH 1EGZA 3LPWA 1IC7H 4JFFE 4YXLH 2EPMX 1JFHA 3QDGB 4LLMA 5DHVH 4NM8H 1Q1JL 4NCDA 4PUEA 4UQDA 4LHQB 3W26A 4M93B 5I17B 4TSAL 3RA7L 5HVHC 1KLUA 3VWJC 1E70M 2Y1VA 4RMSA 3J8F7 3BRDA 1QI3A 3DVGA 1D2KA 1CIDA 2AJZB 3O8XB 3LMYA 3CVHH 3W53A 1SEBB 4D0CB 3L3KB 1OT2A 2MQ0A 4LCWE 1DQLH 2DMKA 5D93C 2EYTB 2J75A 4M8QB 1HXYB 3GNMH 3M1BA 3VXRA 5IMMB 3L3OB 4U6XA 2V3GA 1SM3H 1QSFE 2UZYB 3OPZH 4KHXL 2EDLA 2FHFA 3KXFD 3LD8C 3L7FA 1CZ1A 1YNTB 1GH7A 4K23L 2F8XC 15C8H 3UTQB 2XWTB 4D71A 5I0DA 5L0QB 3QIWC 5I1EL 4DGVL 5HYJD 1MEXH 4MXWH 2V2TA 2V9TA 3KYMA 1CU4H 4AK1A 4P2OB 5BRPA 3ARUA 4QT5B 3KPNA 1NGPH 3O6AA 1E1EA 1WAAF 2WMIB 2EKSB 5CCKL 4ZODA 1G7IA 1RZ8A 2NY7H 3KNBB 5JBEA 4QHLB 4NFCA 1T1XB 2C3WA 3BGMB 1ITXA 4AMKL 2Q8XA 3FO2A 4EN3D 4P4KC 3W0KA 4YHGA 1VPOL 4BQ3A 5A3HA 2DJUA 3MV01 5IJVB 3ZDXE 5D2NE 4Z78A 2FEDD 3HNTL 1DN0B 3AXLA 1FA2A 4JDVA 5SX5K 5IFHL 5D70L 1URLA 3VIHA 4UOW0 1ZBWA 4MVBD 2HFGH 1ADQL 4R26L 1BD2A 1YEKH 4XCNB 1SYSB 1JP5A 3EMZA 5BOPA 2QQLH 1G9NH 4TOYL 4LVNB 5EO1B 3I84A 4TVDA 3BSZL 3T0DA 1MIEL 2X1XR 4ZUUA 1T1ZA 4Y5YA 4OLUL 5DD5L 4Q9QH 1KJ2A 5EA0L 3G08B 4KAQH 1UR4A 3AYSA 4JR9H 4XVUC 1I7RB 1Q9OA 3H7LA 2VLME 4EDWL 1NC4D 3VG9C 4M61B 5IM7A 2GTZB 1WIOA 1IC1A 2NY3B 3IU4H 3D3VE 2OWWA 3HUJF 1RZIB 3BP4A 1MCFA 4KJWD 5DYOB 1MQ8A 3SDAA 1BGXL 1C5BH 3AAZB 1JYXA 1P4IH 4PRBA 1T03H 1QEWA 4W4NA 4ZOCA 1AGCB 1JZ8A 5A6AA 4AD5A 1TZHB 3MRKA 3BDYL 4HWEH 4P57A 4W7WA 1T6WA 4N0YH 3ARDA 3QWRD 4KK5D 1O7AA 4OM0L 1AGEB 3QNXA 2HKFH 4NKDB 4M7ZB 2ZPKH 3RWIB 2FIKA 1FYTE 3U2SA 4JFEB 2YBUA 5E6ZA 3QUMB 4PUBH 1S7RA 5I9QB 3AREC 3KPMB 4F33A 4HKBB 4PJBB 3P77B 3CGTA 2AJUH 3M8OL 4RDQF 3MYZA 4A3HA 1U30A 1JFQH 1JGLL 3VIFA 5AWNL 5E6IA 1AIFB 4QRRA 1CYGA 2XN9A 4G8IA 4LCCC 2QR0B 5E08H 1HILA 1FL5B 4UTFA 3DYMA 4HP5A 4XNQB 3A4XA 1X6LA 2LQRA 4G8EB 2Y07L 4YDIH 3OGVA 4N0UA 2Y36H 4MA1C 3V5KA 3BFOA 4R97B 5FB8B 3IFPA 1N26A 5CD3B 4CMHB 1LP9F 4OCXL 4PJ8B 2YUVA 1YEFH 1MI5E 4LQFH 3AROA 4UBDD 2VL4A 1KIQB 3HCVB 3JZ7A 3EO1B 3THCA 1QW8A 5ADPL 3IU3A 4ELMA 3QUXB 5MEND 3UTTD 1KC5H 2A83B 4Z7VE 3AJ7A 5FYJU 3WH8A 1MY7A 2H6PA 5FOJA 2NW2B 1XIWD 3I02B 3EYFA 3F65A 5TJWK 1CT8B 5F9AC 4OZHB 1WBXA 4PJ9A 1KT2A 2WBJC 4XP9L 4OZIE 4KHTL 3TWCL 3VFSA 2ZWZA 3O4LB 2OS7A 2VDMH 3IDNA 4OD3H 4WU5A 3SDDD 4KJYA 2DLEA 2VDOH 2C4FT 5IK3A 4X98A 1KELH 2VLRD 1EGJH 5H35B 3L5XL 1BMGA 4PPTA 4DK6A 3FCTA 4CU7A 1SYVB 4N8VA 5E94A 4M7JL 4WUUB 2D03H 3TBSB 2ZUTA 5CP3H 2ZOLB 1G9MC 4PREB 3H9HB 1H3GA 3NFSL 1I3UA 3QDGA 1OOAA 4P7NA 3UZVB 3VRIA 4I8DA 4I0PB 3VXMB 1KXQA 5CBEB 3PZOA 2PUQT 4NQSA 3ARGB 4GAFB 4YHPA 5C86A 4JG1L 2DQDH 5I1HH 2ZUNA 4GMTH 1KJ3L 1NDMA 7TAAA 2COQA 2OYPA 4IMLA 2ESCA 1IT0A 5M17A 3H9ZA 1SEBA 3REVB 4D0CA 5I75C 3U4BH 5HYFA 5CMAA 4B9YA 2V5RA 3KVQA 4NDMB 5DFVC 3QJFA 3KJ4C 3MJ9A 1KIRA 3MYJB 4JVUA 4RGNB 2QSCH 4AM0B 2CNCA 1YNTA 2EE6A 3CHEA 1R3JB 5E8NA 4DWSA 2HTKD 3DGGB 4J3VA 3SO3C 1JE6A 4KI5E 4Y5XC 4PMVA 1UG6A 3MRCA 4QCIA 5IV2A 4QT5A 3M7SA 1KB3A 2R0LL 1I7ZB 1FVDB 4NQVB 2EKSA 4LLUB 4HUUB 1UR9A 1NKOA 3FRPA 1T1XA 4QHLA 4XPGH 1AMYA 4W68A 3BGMA 3OLDA 1LG1A 1LD9A 2VJXA 5IMLA 5BZWA 1YMME 3HI1B 3M17A 5IJVA 3X13A 3K7UA 3O3BA 5DHVA 3TT3L 1DN0A 1JHKH 1SJEA 3BPCB 4WW2A 1FNAA 3KPRD 1TZGL 5B3NA 2Y06H 3IB4A 3LPPA 3O0RH 4AEHH 1NFDF 3SUUA 4IOFD 1K85A 4W85A 1T20B 4YHNA 4RAUA 5CGTA 2UWFA 3JWOL 4HX1A 5EO1A 3TP4A 1U3ZA 1YJDH 4QLLA 1FNFA 4P5MB 4FQJL 1KWKA 1T22B 1E4XI 1ZGLM 4YUEH 2DDXA 1W91A 2CBUA 2I07B 2WINA 4ZXBC 3LV3B 2VDRH 4O5LH 5ESVB 5C0CA 1H8OA 3KHQA 4M61A 4B9ZA 1U58B 2MCPL 3JUGA 1IC4L 3WUZA 3GSRA 3FQRA 2AXJA 5L2JA 1H11A 3PZ9A 1ITCA 5CJXA 5J1SC 4M29A 1MFDH 5KSAA 4JQIH 2EO1A 5D7IA 5DYOA 4XMLH 2Z9TA 1F58H 3AAZA 5DMIL 1IGTB 1LK3H 3TTSA 5HHPB 4GW4B 3U0TB 4PJAF 3AS1A 4M80A 3BDBA 3BZEA 1QFWM 1Q6CA 3QXDB 3BKCL 1HYRC 4K2UH 1L4IA 1R3LA 5DUBA 3QSKB 1DL7L 3RU8L 4D9RD 1AGEA 4X4MA 2AK4B 3RWIA 3TJEH 4CCDA 3QO0B 4HPOH 5AYUH 4P7LA 1TUXA 4GG6B 2VI0A 1WISA 5D1XD 3SCMC 1T5XB 3KPMA 5D2LF 3WBDA 5K9JL 5J11B 2XT1B 1I1YA 2J8UE 4YFLI 2VZOA 2WQRA 3B5GA 4FFVD 1YY8B 2L7UA 4KUZH 3NN8B 4PB9L 4PGJA 2J88L 1PKOA 5E5MB 1SR0A 3DV6B 3CH8A 4TVPD 2FECL 4X7FC 5E9DB 4KRPB 1NWSA 5CINL 1MFBH 4XBEH 5I16B 4WF7A 3CFJB 4FLRA 1JGUH 4UTBH 1ULVA 1H49A 1L9MA 3BH9A 3OAYH 1SJHB 4LVEA 5FKAB 3PZGA 4LVOB 1GORA 1GJIA 2Q8BH 4H8WC 4PJ8A 2AI0L 1LDPL 5F9OH 4YWGH 3DTXB 3NACL 2V2XB 1FGVL 3WN5B 4JO3H 1KBGL 3GSXB 4JPIB 5J1AB 1ZLVH 4Y19A 2D1ZA 1A7PL 1GGUA 4P3CH 2RB8A 5F8RC 3EMQA 3VIPA 1RZ7L 3NPSC 4YAQB 2B0SL 2J7LA 2NW2A 2DL2A 2ZWLT 4O58H 4Q2ZA 3V8OA 4ZUSB 1AHWA