4MB7A

Crystal structure of a viral dna glycosylase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
273
structure length
273
Chain Sequence
VEAPRIRITYEKIRHTKNHRIVSISGPSYKRMNVDLIDYIIRKWWFAGKYIYLMLISSNKPTYVIRTHMMMHGRILVGNQDSPTKRAFMIIQLDNDIVLRWYRSQITLLDPNCLAEIKTNYTICTTRQAIMDSIKLMKYDLSNNRFDYNLFQSHLKNGINIHSSEIITDFLLDQEYFPGVGNILQQEALYDCKILPLKKVQDIDEPMFDCLCNSLKKIIDLLYESYKFRESGKEFGPILRIYRKSLCPLGHKTIRKKIGLRNRMTTWCPVCQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural investigation of a viral ortholog of human NEIL2/3 DNA glycosylases.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Hydrolase
molecule keywords Endonuclease 8-like L720
total genus 87
structure length 273
sequence length 273
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4mb7A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 4mb7A01
2VQEM 3SARA 4X66M 3U6SA 4PD2A 4DR3M 4PDGA 4K0KM 3TWLA 4JI0M 2UU9M 4LF9M 1IBLM 1IBKM 5ITRA 3GPXA 2E5LM 4JI8M 4LF8M 3DOAA 3J80S 4YY3M 4NRWA 3OTOM 3SAVA 4JI4M 4LF6M 4X62M 3GPYA 4NXMM 5ITTA 4B3TM 3J81S 3J7AS 3SASA 2UUCM 3U6LA 2F4VM 2UXBM 1K3WA 1XMQM 3U6DA 4ITQA 2UXDM 3A42A 3T1HM 3GPUA 4DV2M 4G4RA 3JR4A 4G4NA 4JI2M 4DR4M 2ZM6M 3VK8A 1HNXM 1NNJA 4DV5M 3GQ5A 1PJIA 1HNZM 3SBJA 1XMOM 3U6MA 4JI3M 5A2QS 1Q3BA 3U6CA 1PJJA 2Q2EB 3W0FA 2OPFA 4JI5M 3A45A 4DR6M 4JI6M 1XC8A 2HKJA 3JR5A 1Z5BA 1Z59A 4DV1M 3U6PA 3GPPA 3SATA 4LF7M 1HNWM 4DV4M 4DR5M 5LMNM 3VK7A 5ITUA 5IWAM 5FLXS 4B3SM 1TDHA 1FJGM 2OQ4A 4DUYM 3GQ4A 5ITQA 1EE8A 5BR8M 3TWMA 3U6OA 1K82A 2UXCM 1R2YA 4JI7M 3C58A 1R2ZA 3TWKA 3SAUA 4G4QA 4OX9M 4JI1M 1L2BA 5ITXE 3A46A 1HR0M 1XNQM 5LMUM 3U6QA 1L2DA 2F5SA 4NXNM 2ZBKB 4G4OA 4GKJM 2XZFA 1L1ZA 4LFAM 1L2CA 4NRVA 1MU5A 1K3XA 4DR7M 4LFBM 1N34M 4LFCM 2F5OA 3JAMS 4CISA 1N32M 1Z5AA 2VQFM 3GP1A 4DUZM 4DV6M 4B3RM 1XNRM 1IBMM 3GQ3A 5ITXA 4JYAM 5IT9S 4DR2M 2F5QA 4B3MM 2HHHM 1N33M 2F5PA 3SAWA 4PDIA 4YHHM 5ITYA 2UUAM 4MB7A 4AQYM 1I94M 1Z5CA 1KFVA 4X64M 1J5EM 4DV0M 2XZUA 4PCZA 2EA0A 1Q39A 4DV3M 1L1TA 2UUBM 1MX0A 4LF4M 1N36M 3GO8A 4DV7M 4JV5M 4DR1M 4LF5M 2F5NA 1PM5A 1Q3CA 4GKKM 3U6EA 1TDZA 4X65M 4KHPM 3T1YM
chains in the Genus database with same CATH superfamily
4AKHA 4X66M 3U6SA 4NSOB 2CFOA 4BB9A 3U5ZA 3HY5A 1XHBA 1ZMVA 2MGWA 2CRUA 1QVRA 3I04M 1OJLA 3EIHA 5EP3A 5L8RF 4LF8M 3J80S 4NRWA 1TGUA 2L7IA 2H5XA 2KNAA 2BJVA 1NNUC 3ZH9B 4QHSA 3OTOM 5KPZA 3SHGB 3GPYA 2RGHA 4AG6A 4M9SA 4F1IA 3UMMA 4BLCA 1UFZA 4L78A 2EUCA 5JI3E 2DWLA 2M5ZA 1WHCA 2R18A 1R4GA 1MJGM 3KP0E 3J7AS 3FYCA 3QYBA 4L16A 2QBYB 5DYGA 3GRUA 2WZJA 4GC5A 3A42A 2UXDM 3T1HM 3CF0A 2QENA 3W67A 3GPUA 4QHTA 2JY8A 1JR3D 3H4MA 3ZQJA 1SXJC 1NNJA 3GRVA 4GHLA 2JA2A 3SBJA 1QDTA 4OU7A 3GLIA 5JI2E 2Z4SA 3C3DA 3K9OA 3U6MA 3QWLA 2Q2EB 4WW0A 5E6JA 3KXEC 1JR3A 3KS4A 3B9PA 4JI5M 3A45A 1XB2B 4JI6M 3FKEA 1HJPA 4LJ9A 2LVOC 3BXWA 2Y0QA 4Z8XA 4NSRA 1Z5BA 1Z59A 3KP1E 1S3SA 3JR5A 4IBKA 3U6PA 2L09A 1OFHA 2DZNB 1HNWM 4LF7M 3D8LA 3J2PB 1QDRA 4KO8A 3VK7A 1DGHA 4B3SM 2DAGA 1DGGA 4GRIA 2OQ4A 4CIZA 3KW6A 3U6OA 2R0IA 4FD2A 4IBDA 2K9DA 1R2YA 1TR8A 1R2ZA 3SAUA 2FH0A 2VF8A 2OO9A 1P3QQ 1TF0B 1JB0F 3FTDA 2R4JA 2O01F 4MH0E 4MGHA 2KRKA 4A3VB 4GMQA 1IY1A 3HJ8A 5ITXE 3K8ZA 4P16A 2QHOB 2F5SA 1XWIA 3J7BA 2CP8A 2LTUA 3A46A 1HQYE 4L4UA 1K3XA 4LFBM 1OIPA 3QAUA 1PJSA 4FCTA 4MGYE 4IJFA 2JZ1A 1OTRA 2LXEA 4CISA 4JN6A 5EXPA 1VEKA 1Z5AA 4BBAA 5C18A 4IBBA 3SHFA 3AL0C 5DNYA 1DGFA 2Z4RA 5IZ7D 4DV6M 1LTMA 3GRRA 4REZA 2BNKA 4II7A 2DHYA 4XBOA 4FVMA 4GH9A 1MN3A 2O25A 4QOSA 2XGNA 2YFQA 3L27A 3RE8A 2XEPA 4HEOA 3VFDA 2I7NA 2KDLA 2F5PA 4R3DA 4Y28F 2XFSA 4D82A 4PDIA 4YHHM 1GL6A 5EP4A 4AQYM 1FNNA 1GL7A 1NV9A 3HHYA 1KFVA 3GRYA 1NHWC 2L6OA 3SMPA 1R6BX 1QUSA 2RKOA 2CHQA 1QAMA 2QQ8A 4MGIE 3C9PA 1F4IA 2LHCA 5FTJA 4R71A 3GLIB 2CUZA 1N36M 1NV8A 2R45A 1E94E 1E32A 2Y21A 1AUAA 4P17A 2D7GA 4FCVA 4GKKM 5FTMA 1TH4A 3T1YM 1N77A 3TPZA 3KSJA 2JNHA 4IBJA 1VEJA 3LCVB 2CEAA 4PDGA 4IBEA 4K0KM 1SXJA 1WGNA 4Q7JA 7CATA 5KPRA 4LF9M 1IBKM 3GPXA 3M0EA 3SFZA 1NSFA 3FTCA 1D0MA 1NY6A 3DFZA 1WR1B 1GKIA 3I01M 5BPVA 1HT1E 4OW0A 3TE6A 4AZFA 4I81A 5ITTA 4B3TM 4LCBA 3SASA 2ERCA 1PRBA 3FTFA 2CV0A 3U61B 1OIZA 1SXJB 3FUWA 3U5ZB 3E46A 3I4YA 1VG5A 4AW4A 3RFWA 4G4NA 3U60B 1R5LA 1V33A 3KS8A 1PJQA 3L25A 2DAKA 3MMPA 4RF1A 3Q8XA 4MM3B 1G3IA 3UJNA 3GQ5A 1T43A 1HNZM 1ZMUA 5A2QS 1Q3BA 3W0LB 2D7EA 3I51A 1WIVA 1PJTA 1A5TA 2XSZD 1X37A 2JY7A 2KNVA 4OVZB 3B74A 3K92A 4DV4M 4DR5M 3SATA 3B7NA 1JQJC 3HKPA 2LVQD 3NBXX 3PNVA 4WURA 5ITUA 5IWAM 1TDHA 1W5TA 1FJGM 3UGJA 2H1RA 5EXXA 2KRUA 5FTKA 5BR8M 1K82A 2EO2A 3EIEA 1YE9A 2I7PA 4JI7M 3E9SA 2QZ4A 4RNAA 2XFTA 2XF3A 2J7NA 5KQDA 2VIIA 1L2BA 3GLHA 2DHRA 2YR0A 1UM8A 2J5YA 2KXEA 2KW0A 1JR3E 1NJGA 1ORYB 2FS1A 2FFJA 2JWSA 2LHGA 1GVNA 5EP2A 3VKGA 2N35A 4CGYB 3PVSA 5DFLA 4M0DA 4LGYA 1E9SA 2DKLA 1CUKA 3AOEC 4IBIA 5F3WA 4LFCM 1GO5A 2DAIA 2DENA 3LVVA 1IQPA 3JAMS 5C1BA 1QQWA 2KHHA 2HWJA 3IG5A 3KVWA 2Z7JA 2QSFX 3FRHA 3HJSA 4AI6A 4W5WA 4LJ6A 1W5SA 3ZCBB 4B3RM 2WSFF 1IBMM 1BVSA 2X8AA 4LZZA 5ITXA 5IT9S 2F5QA 1AIPC 3LQRA 2HHHM 3HHZA 1N75A 3IECA 1DGHB 1IXSA 5ITYA 1DO2A 2DVWB 2R4EA 1I94M 2LH0A 4OVZA 2RGOA 5DYIA 1OAOC 2JY6B 4FCWA 1NY5A 4M9XA 2XZUA 2R46A 4LY6A 3SC3A 2EA0A 2GQFA 3B7ZA 3NBIA 2UUBM 1MX0A 4HL4A 2LVAA 4LJ8A 1G41A 3VLFB 4DV7M 2C96A 4G3OA 4JV5M 1WJ7A 3SYKA 3Q8GA 2CWBA 5GKNA 2L7HA 4Z6YA 1N78A 2QNJA 1R7RA 3U6EA 3LCUA 4L6V6 1TDZA 1OKSA 4X65M 4DR2M 2CV2A 4PD2A 2C9OA 4DR3M 3TWLA 1IY2A 3CTWB 4JI0M 2UU9M 2LVPC 2MH8A 3GLFA 3KOWE 5ITRA 1IN5A 3KDSE 3FE3A 4JI4M 3R9XB 4LF6M 1NJFA 3MK6A 1VEGA 3HHWA 2KZUA 2B3TA 2JP7A 2UUCM 2KZSA 2F4VM 2UXBM 1K3WA 3KOXE 4LGMA 4CJ6A 3U6DA 1XMQM 1NHGC 4GHAA 4DV2M 5FTNA 3M7GA 1J7KA 4G4RA 3PFIA 2JUJA 2ZM6M 1HNXM 2KNZA 2EKKA 2DI0A 3IHPA 1PJIA 3L2AA 2VDBB 4JI3M 1PJJA 3HZJA 4L15A 3RGSA 4IBGA 2JXNA 5FSWA 3VKHA 1YUBA 2DZOB 3HU2A 4DR6M 4GIPA 3PXGA 1D0KA 4MGKE 1XC8A 2HKJA 3QYEA 3E21A 5H37D 3GLGB 4LRSA 4TUWA 3F92A 3KSXA 1HQCA 2CHGA 2V6ZM 3FUUA 2L4EA 3MJ5A 1IXSB 2LVNC 2LWXA 1IN7A 1IN6A 2RRUA 4QNRA 4RF0A 4CHTB 5FLXS 1IXRC 3ZC7B 1ZQ9A 2ZTCA 1EE8A 1DV0A 1SXJD 3KOYE 2G8LA 2HCBA 3HWSA 2C98A 4EIWA 3CF6E 3FUVA 1QAQA 2CHVA 1XNQM 1HR0M 4LJ4A 4IIWA 3U6QA 2V1CA 1EFUB 4AKGA 2AHMA 4GITA 2MJ5B 4G4OA 2XZFA 4UN2B 3FRIA 4NRVA 3J27B 1MU5A 2ZTDA 3HJQA 2V1UA 1Q02A 3AOGA 4M0WA 4GEWA 2KEBA 2DWZB 4QNMA 2Z3XA 1N32M 3LMMA 2FE8A 1TTEA 2XLJA 3L26A 4GC9A 4AG5A 2M60A 1V92A 3T38A 4B7FA 1LV7A 4DUZM 3GLGE 2K47A 2WSCF 2HL7A 1XNRM 2R44A 2BJWA 1XXHA 1I4WA 2FOIC 2R65A 2OOAA 3WHLA 3GLHE 2C9CA 1TH2A 4L8RC 3HHXA 1VQ1A 1N33M 1QANA 3SAWA 2JZ0A 2APLA 3U61A 2MR9A 3B7QA 2UUAM 4PT5A 2K6BA 3AJIB 3AFHA 2A5YB 3T15A 1H6UA 1GABA 4ZPXA 3HX3A 1ZV1A 3H4JA 5KQ8A 1J5EM 3FD9A 2DWMA 1IN4A 2HAKA 1OQYA 1G4AE 3TL4X 3UK6A 3LVWA 5EJCA 4B7HA 1IM2A 4B08A 2LBCA 2L2DA 1G8PA 2QBYA 3VDPA 4LF4M 4FWGA 3MHVC 4IBFA 3TQSA 1J09A 2CE7A 3RGPA 3KOZE 4LF5M 3C3EA 2W82A 2F5NA 1PM5A 1G71A 3UZUA 2GNOA 1HT2E 3WHKA 4KHPM 3U60A 2L4FA 3K1JA 2VQEM 3SARA 4B3MM 1G59A 2DXIA 3D8BA 4R7GA 4NL4H 2NQ8C 3HGIA 3ILKA 1NO1A 1OFIA 4WP2A 1Z6TA 1EIJA 3DA1A 3V76A 1IBLM 3GLIE 2E5LM 4I4LA 4JI8M 3BOSA 2MROB 3DOAA 3K9PA 4YY3M 3SAVA 2XSZA 4X62M 3LW5F 4NXMM 4IJEA 3J81S 1GJTA 4F2LA 1OAIA 4HLQA 3U6LA 4QOZC 3B89A 3CGWA 2EJSA 4ITQA 1KYIA 1D2NA 5EXSA 1D0LA 2YQZA 4FWHA 3FYDA 3R8FA 3JR4A 4JI2M 4DR4M 3L29A 2LNHC 2Y20A 1L8QA 1T6OA 2J7OA 1QYRA 1XXHB 3AV0A 4XGIA 3GLFB 3VK8A 3CF2A 4DV5M 4KT0F 4D81A 3GLFE 3AOEA 2K0BX 3LQQA 1XMOM 2YNMD 3U6CA 4MGZE 1NVMA 3W0FA 2OPFA 3THGA 2D7HA 4XK8F 3SMSA 3T6PA 1ZAEA 4DV1M 1GLNA 4LJ5A 1C1KA 1KSFX 5EXTA 3GPPA 4I5SA 4RKUF 5KO3A 5LMNM 4ANRA 4G6ZA 1QZMA 4KODA 3M6AA 1YLAA 4I8OA 4M9ZA 2BWEA 3GQ4A 4DUYM 2ZAMA 4NC6A 5ITQA 3TWMA 1PGYA 3GLHB 2UXCM 3HU3A 1Y8GA 3FUXA 3C58A 3TWKA 2VF7A 1IY0A 4B7GA 1IN8A 5KPTA 4G4QA 2Z8YM 3KFUG 4OX9M 2QPAA 4JI1M 3SYLA 2CV1A 3FTEA 1IFYA 5LMUM 1L2DA 4NXNM 2ZBKB 1DGBA 4S12A 2G5GX 1E9RA 4GKJM 1L1ZA 4LFAM 5EQTA 2WSEF 1L2CA 2P5TA 2QCUA 2R62A 4DR7M 3HU1A 2ZAOA 3VDUA 1C7YA 2C5RA 2BWBA 1N34M 2F5OA 3L28A 4FW9A 3A98B 1WGLA 2EKFA 2VQFM 4LJ7A 4KLNA 1QZEA 3NWLA 3GP1A 2C99A 5FTLA 1DO0A 2QP9X 3DZDA 4NOOB 5IREB 4AKIA 4JXJA 3BBZA 2Y0TA 8CATA 2O5RA 3K2LA 4LG2A 1WXQA 4LRTA 1T3TA 3GQ3A 4JYAM 1QAOA 1TH3A 1VDLA 1SXJE 3IG8A 5EP1A 1GJSA 2DZLA 2X4AA 4LJAA 1Z5CA 4DBGB 1V34A 1IXZA 3E4RA 1RU3A 3FUTA 3W68A 4X64M 2G3QA 2KA6B 2R6FA 4DV0M 2ZANA 2FNAA 1SG9A 4PCZA 1Q39A 4D80A 4DV3M 4FWDA 1L1TA 1QUTA 3PNYA 4LZJA 2X49A 3GO8A 2OOBA 1ZMWA 3I4VA 2DWNA 3GLGA 1VDDA 2DAEA 2JY5A 4IBCA 4DR1M 5E26A 1YSYA 1Q3CA 2DNAA 1XXHE 2XH9A 2DAMA 4MB7A 3AKZA
chains in the Genus database with same CATH topology
4AKHA 4X66M 3U6SA 4NSOB 2CFOA 4BB9A 3U5ZA 1QVRA 5EP3A 1OJLA 3EIHA 4LF8M 3J80S 4NRWA 1TGUA 2L7IA 3ZH9B 3OTOM 2BJVA 1NNUC 4QHSA 5KPZA 3SHGB 3GPYA 2RGHA 4AG6A 4M9SA 2DWLA 3UMMA 4BLCA 4L78A 2EUCA 5JI3E 3J7AS 2M5ZA 2R18A 3KP0E 3FYCA 4L16A 2QBYB 5DYGA 3GRUA 4GC5A 2UXDM 3A42A 3T1HM 3CF0A 2QENA 3GPUA 4QHTA 1JR3D 3H4MA 1SXJC 1NNJA 3GRVA 4GHLA 2JA2A 3SBJA 4OU7A 3GLIA 5JI2E 2Z4SA 3U6MA 3QWLA 2Q2EB 4WW0A 5E6JA 3KXEC 1JR3A 3KS4A 3B9PA 4JI5M 3A45A 4JI6M 3FKEA 4LJ9A 4Z8XA 2Y0QA 3JR5A 4NSRA 1Z5BA 1Z59A 3KP1E 1S3SA 3U6PA 4IBKA 2L09A 1OFHA 2DZNB 1HNWM 4LF7M 3D8LA 3J2PB 4KO8A 3VK7A 1DGHA 4B3SM 1DGGA 4GRIA 2OQ4A 3KW6A 3U6OA 4FD2A 4IBDA 1R2YA 1R2ZA 3SAUA 3FTDA 4A3VB 2R4JA 5ITXE 4MH0E 4MGHA 2KRKA 3A46A 4GMQA 1IY1A 3HJ8A 3K8ZA 4P16A 2F5SA 1XWIA 3J7BA 1HQYE 4L4UA 1K3XA 4LFBM 3QAUA 4FCTA 4MGYE 4IJFA 2LXEA 4CISA 4JN6A 5EXPA 1Z5AA 4BBAA 5C18A 4IBBA 3SHFA 3AL0C 5DNYA 1DGFA 2Z4RA 5IZ7D 4DV6M 3GRRA 4REZA 2BNKA 4II7A 4DR2M 4XBOA 4FVMA 4GH9A 3RE8A 4QOSA 4B3MM 2XGNA 2YFQA 3L27A 2F5PA 2XEPA 3VFDA 2I7NA 4R3DA 2XFSA 4D82A 4PDIA 4YHHM 1GL6A 5EP4A 4AQYM 1FNNA 1GL7A 3HHYA 1KFVA 3GRYA 1NHWC 2L6OA 3SMPA 1R6BX 2RKOA 2CHQA 1QAMA 4MGIE 5FTJA 3GLIB 2CUZA 1N36M 2R45A 1E94E 1E32A 2Y21A 2D7GA 4FCVA 4GKKM 5FTMA 1TH4A 3T1YM 1N77A 3TPZA 3KSJA 4IBJA 2CEAA 4PDGA 4IBEA 4K0KM 1SXJA 7CATA 5KPRA 4LF9M 1IBKM 3GPXA 3M0EA 3SFZA 1NSFA 3FTCA 1NY6A 3DFZA 1GKIA 5BPVA 1HT1E 4OW0A 3TE6A 4AZFA 4I81A 5ITTA 4B3TM 4LCBA 3SASA 2ERCA 3FTFA 2CV0A 3U61B 1SXJB 3FUWA 3U5ZB 3I4YA 4AW4A 3RFWA 4G4NA 3U60B 3KS8A 3L25A 4RF1A 3Q8XA 4MM3B 1G3IA 3UJNA 3GQ5A 1HNZM 5A2QS 1Q3BA 3W0LB 2D7EA 3I51A 2XSZD 1X37A 4OVZB 3SATA 3K92A 4DV4M 4DR5M 1JQJC 3HKPA 3PNVA 4WURA 5ITUA 5IWAM 1TDHA 1W5TA 1FJGM 3UGJA 2H1RA 5EXXA 2KRUA 5FTKA 5BR8M 1K82A 2EO2A 3EIEA 1YE9A 2I7PA 4JI7M 3E9SA 2QZ4A 4RNAA 2XFTA 2XF3A 2J7NA 5KQDA 2VIIA 1L2BA 3GLHA 2DHRA 2YR0A 1UM8A 2KW0A 2KXEA 1NJGA 1ORYB 2FFJA 3VKGA 5EP2A 1GVNA 4CGYB 3PVSA 4M0DA 4LGYA 1E9SA 3AOEC 4IBIA 5F3WA 4LFCM 3LVVA 5C1BA 1IQPA 3JAMS 1QQWA 3KVWA 3IG5A 4AI6A 2Z7JA 3HJSA 4W5WA 4LJ6A 1W5SA 3ZCBB 4B3RM 1IBMM 2X8AA 4LZZA 5ITXA 5IT9S 2F5QA 3LQRA 2HHHM 3HHZA 1N75A 1DGHB 5ITYA 1DO2A 2DVWB 2R4EA 1I94M 2LH0A 4OVZA 2RGOA 5DYIA 4FCWA 1NY5A 4M9XA 2XZUA 2R46A 4LY6A 3SC3A 2EA0A 3NBIA 2UUBM 1MX0A 4HL4A 4LJ8A 1G41A 3VLFB 4DV7M 2C96A 4JV5M 3SYKA 5GKNA 2L7HA 4Z6YA 1N78A 1R7RA 3U6EA 1TDZA 4X65M 2CV2A 4PD2A 2C9OA 4DR3M 3TWLA 1IY2A 3CTWB 4JI0M 2UU9M 3GLFA 3KOWE 5ITRA 1IN5A 3KDSE 4JI4M 3R9XB 4LF6M 1NJFA 3MK6A 3HHWA 2KZUA 2UUCM 2KZSA 2F4VM 2UXBM 1K3WA 3KOXE 4LGMA 1XMQM 3U6DA 1NHGC 4GHAA 4DV2M 5FTNA 3M7GA 1J7KA 4G4RA 3PFIA 2ZM6M 1HNXM 1PJIA 3L2AA 4JI3M 1PJJA 4L15A 3RGSA 4IBGA 5FSWA 3VKHA 1YUBA 2DZOB 3HU2A 4DR6M 4GIPA 3PXGA 4MGKE 1XC8A 2HKJA 5H37D 3GLGB 4LRSA 4TUWA 3KSXA 1HQCA 2CHGA 2V6ZM 3FUUA 3MJ5A 1IXSB 2LWXA 5FLXS 1IN7A 1IN6A 4QNRA 4CHTB 4RF0A 1IXRC 3ZC7B 1ZQ9A 1EE8A 1SXJD 3KOYE 2G8LA 2HCBA 3HWSA 2C98A 4EIWA 3CF6E 3FUVA 1QAQA 2CHVA 1XNQM 1HR0M 4LJ4A 4IIWA 3U6QA 2V1CA 4AKGA 2AHMA 4GITA 4G4OA 2XZFA 4NRVA 3J27B 1MU5A 2V1UA 3HJQA 3AOGA 4M0WA 2KEBA 2DWZB 4QNMA 2Z3XA 1N32M 3LMMA 2FE8A 3L26A 2XLJA 4GC9A 4AG5A 2M60A 3T38A 4B7FA 1LV7A 4DUZM 2K47A 2HL7A 1XNRM 2BJWA 1XXHA 1I4WA 2FOIC 2R65A 3WHLA 4L8RC 2C9CA 1TH2A 3HHXA 1N33M 1QANA 3SAWA 3U61A 2UUAM 4PT5A 3AJIB 3AFHA 2A5YB 3T15A 1H6UA 4ZPXA 5KQ8A 1J5EM 2DWMA 3FD9A 1IN4A 3TL4X 1G4AE 3UK6A 3LVWA 5EJCA 4B7HA 1IM2A 4B08A 1G8PA 2QBYA 3VDPA 4LF4M 4FWGA 3MHVC 4IBFA 3TQSA 1J09A 2CE7A 3RGPA 3KOZE 4LF5M 2W82A 2F5NA 1PM5A 3UZUA 1HT2E 3WHKA 4KHPM 3U60A 3K1JA 2VQEM 3SARA 1G59A 2DXIA 3D8BA 4R7GA 4NL4H 2NQ8C 3HGIA 3ILKA 1OFIA 1Z6TA 3DA1A 1IBLM 2E5LM 4I4LA 4JI8M 3BOSA 3DOAA 4YY3M 3SAVA 2XSZA 4X62M 4NXMM 4IJEA 3J81S 4HLQA 3U6LA 4QOZC 4ITQA 1KYIA 1D2NA 5EXSA 2YQZA 4FWHA 3FYDA 3R8FA 3JR4A 4JI2M 4DR4M 3L29A 2LNHC 2Y20A 1L8QA 2J7OA 3AV0A 1QYRA 1XXHB 4XGIA 3GLFB 3VK8A 3CF2A 4DV5M 4D81A 3AOEA 1XMOM 3LQQA 2YNMD 3U6CA 4MGZE 1NVMA 3W0FA 2OPFA 3THGA 2D7HA 3SMSA 1ZAEA 4DV1M 1GLNA 4LJ5A 1C1KA 1KSFX 5EXTA 3GPPA 4I5SA 5KO3A 5LMNM 4G6ZA 1QZMA 4KODA 3M6AA 4I8OA 4M9ZA 4DUYM 3GQ4A 2ZAMA 5ITQA 3TWMA 3GLHB 2UXCM 3HU3A 3FUXA 3C58A 3TWKA 4B7GA 1IY0A 5KPTA 1IN8A 4G4QA 3KFUG 4OX9M 2QPAA 4JI1M 3SYLA 2CV1A 3FTEA 5LMUM 1L2DA 4NXNM 2ZBKB 1DGBA 4S12A 2G5GX 1E9RA 4GKJM 1L1ZA 4LFAM 5EQTA 1L2CA 2P5TA 2QCUA 2R62A 4DR7M 3HU1A 2ZAOA 3VDUA 2C5RA 1N34M 2F5OA 3L28A 4FW9A 3A98B 2VQFM 4LJ7A 4KLNA 3NWLA 3GP1A 2C99A 5FTLA 1DO0A 2QP9X 3DZDA 4NOOB 5IREB 4AKIA 4JXJA 2Y0TA 8CATA 2O5RA 3K2LA 4LG2A 1WXQA 4LRTA 1T3TA 3GQ3A 4JYAM 1QAOA 1TH3A 1SXJE 3IG8A 5EP1A 2X4AA 4LJAA 1Z5CA 1IXZA 3E4RA 3FUTA 4X64M 2KA6B 4DV0M 2ZANA 2FNAA 4PCZA 1Q39A 4D80A 4DV3M 4FWDA 1L1TA 3PNYA 4LZJA 2X49A 3GO8A 3I4VA 2DWNA 3GLGA 1VDDA 4IBCA 4DR1M 5E26A 1YSYA 1Q3CA 2XH9A 1XHBA 4MB7A 3AKZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQE M;  3SAR A;  4X66 M;  3U6S A;  4PD2 A;  4DR3 M;  4PDG A;  4K0K M;  3TWL A;  4JI0 M;  2UU9 M;  4LF9 M;  1IBL M;  1IBK M;  5ITR A;  3GPX A;  2E5L M;  4JI8 M;  4LF8 M;  3DOA A;  3J80 S;  4YY3 M;  4NRW A;  3OTO M;  3SAV A;  4JI4 M;  4LF6 M;  4X62 M;  3GPY A;  4NXM M;  5ITT A;  4B3T M;  3J81 S;  3J7A S;  3SAS A;  2UUC M;  3U6L A;  2F4V M;  2UXB M;  1K3W A;  1XMQ M;  3U6D A;  4ITQ A;  2UXD M;  3A42 A;  3T1H M;  3GPU A;  4DV2 M;  4G4R A;  3JR4 A;  4G4N A;  4JI2 M;  4DR4 M;  2ZM6 M;  3VK8 A;  1HNX M;  1NNJ A;  4DV5 M;  3GQ5 A;  1PJI A;  1HNZ M;  3SBJ A;  1XMO M;  3U6M A;  4JI3 M;  5A2Q S;  1Q3B A;  3U6C A;  1PJJ A;  2Q2E B;  3W0F A;  2OPF A;  4JI5 M;  3A45 A;  4DR6 M;  4JI6 M;  1XC8 A;  2HKJ A;  3JR5 A;  1Z5B A;  1Z59 A;  4DV1 M;  3U6P A;  3GPP A;  3SAT A;  4LF7 M;  1HNW M;  4DV4 M;  4DR5 M;  5LMN M;  3VK7 A;  5ITU A;  5IWA M;  5FLX S;  4B3S M;  1TDH A;  1FJG M;  2OQ4 A;  4DUY M;  3GQ4 A;  5ITQ A;  1EE8 A;  5BR8 M;  3TWM A;  3U6O A;  1K82 A;  2UXC M;  1R2Y A;  4JI7 M;  3C58 A;  1R2Z A;  3TWK A;  3SAU A;  4G4Q A;  4OX9 M;  4JI1 M;  1L2B A;  5ITX E;  3A46 A;  1HR0 M;  1XNQ M;  5LMU M;  3U6Q A;  1L2D A;  2F5S A;  4NXN M;  2ZBK B;  4G4O A;  4GKJ M;  2XZF A;  1L1Z A;  4LFA M;  1L2C A;  4NRV A;  1MU5 A;  1K3X A;  4DR7 M;  4LFB M;  1N34 M;  4LFC M;  2F5O A;  3JAM S;  4CIS A;  1N32 M;  1Z5A A;  2VQF M;  3GP1 A;  4DUZ M;  4DV6 M;  4B3R M;  1XNR M;  1IBM M;  3GQ3 A;  5ITX A;  4JYA M;  5IT9 S;  4DR2 M;  2F5Q A;  4B3M M;  2HHH M;  1N33 M;  2F5P A;  3SAW A;  4PDI A;  4YHH M;  5ITY A;  2UUA M;  4MB7 A;  4AQY M;  1I94 M;  1Z5C A;  1KFV A;  4X64 M;  1J5E M;  4DV0 M;  2XZU A;  4PCZ A;  2EA0 A;  1Q39 A;  4DV3 M;  1L1T A;  2UUB M;  1MX0 A;  4LF4 M;  1N36 M;  3GO8 A;  4DV7 M;  4JV5 M;  4DR1 M;  4LF5 M;  2F5N A;  1PM5 A;  1Q3C A;  4GKK M;  3U6E A;  1TDZ A;  4X65 M;  4KHP M;  3T1Y M; 
#chains in the Genus database with same CATH topology
 4AKH A;  4X66 M;  3U6S A;  4NSO B;  2CFO A;  4BB9 A;  3U5Z A;  3HY5 A;  1XHB A;  1ZMV A;  2MGW A;  2CRU A;  1QVR A;  3I04 M;  1OJL A;  3EIH A;  5EP3 A;  5L8R F;  4LF8 M;  3J80 S;  4NRW A;  1TGU A;  2L7I A;  2H5X A;  2KNA A;  2BJV A;  1NNU C;  3ZH9 B;  4QHS A;  3OTO M;  5KPZ A;  3SHG B;  3GPY A;  2RGH A;  4AG6 A;  4M9S A;  4F1I A;  3UMM A;  4BLC A;  1UFZ A;  4L78 A;  2EUC A;  5JI3 E;  2DWL A;  2M5Z A;  1WHC A;  2R18 A;  1R4G A;  1MJG M;  3KP0 E;  3J7A S;  3FYC A;  3QYB A;  4L16 A;  2QBY B;  5DYG A;  3GRU A;  2WZJ A;  4GC5 A;  3A42 A;  2UXD M;  3T1H M;  3CF0 A;  2QEN A;  3W67 A;  3GPU A;  4QHT A;  2JY8 A;  1JR3 D;  3H4M A;  3ZQJ A;  1SXJ C;  1NNJ A;  3GRV A;  4GHL A;  2JA2 A;  3SBJ A;  1QDT A;  4OU7 A;  3GLI A;  5JI2 E;  2Z4S A;  3C3D A;  3K9O A;  3U6M A;  3QWL A;  2Q2E B;  4WW0 A;  5E6J A;  3KXE C;  1JR3 A;  3KS4 A;  3B9P A;  4JI5 M;  3A45 A;  1XB2 B;  4JI6 M;  3FKE A;  1HJP A;  4LJ9 A;  2LVO C;  3BXW A;  2Y0Q A;  4Z8X A;  4NSR A;  1Z5B A;  1Z59 A;  3KP1 E;  1S3S A;  3JR5 A;  4IBK A;  3U6P A;  2L09 A;  1OFH A;  2DZN B;  1HNW M;  4LF7 M;  3D8L A;  3J2P B;  1QDR A;  4KO8 A;  3VK7 A;  1DGH A;  4B3S M;  2DAG A;  1DGG A;  4GRI A;  2OQ4 A;  4CIZ A;  3KW6 A;  3U6O A;  2R0I A;  4FD2 A;  4IBD A;  2K9D A;  1R2Y A;  1TR8 A;  1R2Z A;  3SAU A;  2FH0 A;  2VF8 A;  2OO9 A;  1P3Q Q;  1TF0 B;  1JB0 F;  3FTD A;  2R4J A;  2O01 F;  4MH0 E;  4MGH A;  2KRK A;  4A3V B;  4GMQ A;  1IY1 A;  3HJ8 A;  5ITX E;  3K8Z A;  4P16 A;  2QHO B;  2F5S A;  1XWI A;  3J7B A;  2CP8 A;  2LTU A;  3A46 A;  1HQY E;  4L4U A;  1K3X A;  4LFB M;  1OIP A;  3QAU A;  1PJS A;  4FCT A;  4MGY E;  4IJF A;  2JZ1 A;  1OTR A;  2LXE A;  4CIS A;  4JN6 A;  5EXP A;  1VEK A;  1Z5A A;  4BBA A;  5C18 A;  4IBB A;  3SHF A;  3AL0 C;  5DNY A;  1DGF A;  2Z4R A;  5IZ7 D;  4DV6 M;  1LTM A;  3GRR A;  4REZ A;  2BNK A;  4II7 A;  2DHY A;  4XBO A;  4FVM A;  4GH9 A;  1MN3 A;  2O25 A;  4QOS A;  2XGN A;  2YFQ A;  3L27 A;  3RE8 A;  2XEP A;  4HEO A;  3VFD A;  2I7N A;  2KDL A;  2F5P A;  4R3D A;  4Y28 F;  2XFS A;  4D82 A;  4PDI A;  4YHH M;  1GL6 A;  5EP4 A;  4AQY M;  1FNN A;  1GL7 A;  1NV9 A;  3HHY A;  1KFV A;  3GRY A;  1NHW C;  2L6O A;  3SMP A;  1R6B X;  1QUS A;  2RKO A;  2CHQ A;  1QAM A;  2QQ8 A;  4MGI E;  3C9P A;  1F4I A;  2LHC A;  5FTJ A;  4R71 A;  3GLI B;  2CUZ A;  1N36 M;  1NV8 A;  2R45 A;  1E94 E;  1E32 A;  2Y21 A;  1AUA A;  4P17 A;  2D7G A;  4FCV A;  4GKK M;  5FTM A;  1TH4 A;  3T1Y M;  1N77 A;  3TPZ A;  3KSJ A;  2JNH A;  4IBJ A;  1VEJ A;  3LCV B;  2CEA A;  4PDG A;  4IBE A;  4K0K M;  1SXJ A;  1WGN A;  4Q7J A;  7CAT A;  5KPR A;  4LF9 M;  1IBK M;  3GPX A;  3M0E A;  3SFZ A;  1NSF A;  3FTC A;  1D0M A;  1NY6 A;  3DFZ A;  1WR1 B;  1GKI A;  3I01 M;  5BPV A;  1HT1 E;  4OW0 A;  3TE6 A;  4AZF A;  4I81 A;  5ITT A;  4B3T M;  4LCB A;  3SAS A;  2ERC A;  1PRB A;  3FTF A;  2CV0 A;  3U61 B;  1OIZ A;  1SXJ B;  3FUW A;  3U5Z B;  3E46 A;  3I4Y A;  1VG5 A;  4AW4 A;  3RFW A;  4G4N A;  3U60 B;  1R5L A;  1V33 A;  3KS8 A;  1PJQ A;  3L25 A;  2DAK A;  3MMP A;  4RF1 A;  3Q8X A;  4MM3 B;  1G3I A;  3UJN A;  3GQ5 A;  1T43 A;  1HNZ M;  1ZMU A;  5A2Q S;  1Q3B A;  3W0L B;  2D7E A;  3I51 A;  1WIV A;  1PJT A;  1A5T A;  2XSZ D;  1X37 A;  2JY7 A;  2KNV A;  4OVZ B;  3B74 A;  3K92 A;  4DV4 M;  4DR5 M;  3SAT A;  3B7N A;  1JQJ C;  3HKP A;  2LVQ D;  3NBX X;  3PNV A;  4WUR A;  5ITU A;  5IWA M;  1TDH A;  1W5T A;  1FJG M;  3UGJ A;  2H1R A;  5EXX A;  2KRU A;  5FTK A;  5BR8 M;  1K82 A;  2EO2 A;  3EIE A;  1YE9 A;  2I7P A;  4JI7 M;  3E9S A;  2QZ4 A;  4RNA A;  2XFT A;  2XF3 A;  2J7N A;  5KQD A;  2VII A;  1L2B A;  3GLH A;  2DHR A;  2YR0 A;  1UM8 A;  2J5Y A;  2KXE A;  2KW0 A;  1JR3 E;  1NJG A;  1ORY B;  2FS1 A;  2FFJ A;  2JWS A;  2LHG A;  1GVN A;  5EP2 A;  3VKG A;  2N35 A;  4CGY B;  3PVS A;  5DFL A;  4M0D A;  4LGY A;  1E9S A;  2DKL A;  1CUK A;  3AOE C;  4IBI A;  5F3W A;  4LFC M;  1GO5 A;  2DAI A;  2DEN A;  3LVV A;  1IQP A;  3JAM S;  5C1B A;  1QQW A;  2KHH A;  2HWJ A;  3IG5 A;  3KVW A;  2Z7J A;  2QSF X;  3FRH A;  3HJS A;  4AI6 A;  4W5W A;  4LJ6 A;  1W5S A;  3ZCB B;  4B3R M;  2WSF F;  1IBM M;  1BVS A;  2X8A A;  4LZZ A;  5ITX A;  5IT9 S;  2F5Q A;  1AIP C;  3LQR A;  2HHH M;  3HHZ A;  1N75 A;  3IEC A;  1DGH B;  1IXS A;  5ITY A;  1DO2 A;  2DVW B;  2R4E A;  1I94 M;  2LH0 A;  4OVZ A;  2RGO A;  5DYI A;  1OAO C;  2JY6 B;  4FCW A;  1NY5 A;  4M9X A;  2XZU A;  2R46 A;  4LY6 A;  3SC3 A;  2EA0 A;  2GQF A;  3B7Z A;  3NBI A;  2UUB M;  1MX0 A;  4HL4 A;  2LVA A;  4LJ8 A;  1G41 A;  3VLF B;  4DV7 M;  2C96 A;  4G3O A;  4JV5 M;  1WJ7 A;  3SYK A;  3Q8G A;  2CWB A;  5GKN A;  2L7H A;  4Z6Y A;  1N78 A;  2QNJ A;  1R7R A;  3U6E A;  3LCU A;  4L6V 6;  1TDZ A;  1OKS A;  4X65 M;  4DR2 M;  2CV2 A;  4PD2 A;  2C9O A;  4DR3 M;  3TWL A;  1IY2 A;  3CTW B;  4JI0 M;  2UU9 M;  2LVP C;  2MH8 A;  3GLF A;  3KOW E;  5ITR A;  1IN5 A;  3KDS E;  3FE3 A;  4JI4 M;  3R9X B;  4LF6 M;  1NJF A;  3MK6 A;  1VEG A;  3HHW A;  2KZU A;  2B3T A;  2JP7 A;  2UUC M;  2KZS A;  2F4V M;  2UXB M;  1K3W A;  3KOX E;  4LGM A;  4CJ6 A;  3U6D A;  1XMQ M;  1NHG C;  4GHA A;  4DV2 M;  5FTN A;  3M7G A;  1J7K A;  4G4R A;  3PFI A;  2JUJ A;  2ZM6 M;  1HNX M;  2KNZ A;  2EKK A;  2DI0 A;  3IHP A;  1PJI A;  3L2A A;  2VDB B;  4JI3 M;  1PJJ A;  3HZJ A;  4L15 A;  3RGS A;  4IBG A;  2JXN A;  5FSW A;  3VKH A;  1YUB A;  2DZO B;  3HU2 A;  4DR6 M;  4GIP A;  3PXG A;  1D0K A;  4MGK E;  1XC8 A;  2HKJ A;  3QYE A;  3E21 A;  5H37 D;  3GLG B;  4LRS A;  4TUW A;  3F92 A;  3KSX A;  1HQC A;  2CHG A;  2V6Z M;  3FUU A;  2L4E A;  3MJ5 A;  1IXS B;  2LVN C;  2LWX A;  1IN7 A;  1IN6 A;  2RRU A;  4QNR A;  4RF0 A;  4CHT B;  5FLX S;  1IXR C;  3ZC7 B;  1ZQ9 A;  2ZTC A;  1EE8 A;  1DV0 A;  1SXJ D;  3KOY E;  2G8L A;  2HCB A;  3HWS A;  2C98 A;  4EIW A;  3CF6 E;  3FUV A;  1QAQ A;  2CHV A;  1XNQ M;  1HR0 M;  4LJ4 A;  4IIW A;  3U6Q A;  2V1C A;  1EFU B;  4AKG A;  2AHM A;  4GIT A;  2MJ5 B;  4G4O A;  2XZF A;  4UN2 B;  3FRI A;  4NRV A;  3J27 B;  1MU5 A;  2ZTD A;  3HJQ A;  2V1U A;  1Q02 A;  3AOG A;  4M0W A;  4GEW A;  2KEB A;  2DWZ B;  4QNM A;  2Z3X A;  1N32 M;  3LMM A;  2FE8 A;  1TTE A;  2XLJ A;  3L26 A;  4GC9 A;  4AG5 A;  2M60 A;  1V92 A;  3T38 A;  4B7F A;  1LV7 A;  4DUZ M;  3GLG E;  2K47 A;  2WSC F;  2HL7 A;  1XNR M;  2R44 A;  2BJW A;  1XXH A;  1I4W A;  2FOI C;  2R65 A;  2OOA A;  3WHL A;  3GLH E;  2C9C A;  1TH2 A;  4L8R C;  3HHX A;  1VQ1 A;  1N33 M;  1QAN A;  3SAW A;  2JZ0 A;  2APL A;  3U61 A;  2MR9 A;  3B7Q A;  2UUA M;  4PT5 A;  2K6B A;  3AJI B;  3AFH A;  2A5Y B;  3T15 A;  1H6U A;  1GAB A;  4ZPX A;  3HX3 A;  1ZV1 A;  3H4J A;  5KQ8 A;  1J5E M;  3FD9 A;  2DWM A;  1IN4 A;  2HAK A;  1OQY A;  1G4A E;  3TL4 X;  3UK6 A;  3LVW A;  5EJC A;  4B7H A;  1IM2 A;  4B08 A;  2LBC A;  2L2D A;  1G8P A;  2QBY A;  3VDP A;  4LF4 M;  4FWG A;  3MHV C;  4IBF A;  3TQS A;  1J09 A;  2CE7 A;  3RGP A;  3KOZ E;  4LF5 M;  3C3E A;  2W82 A;  2F5N A;  1PM5 A;  1G71 A;  3UZU A;  2GNO A;  1HT2 E;  3WHK A;  4KHP M;  3U60 A;  2L4F A;  3K1J A;  2VQE M;  3SAR A;  4B3M M;  1G59 A;  2DXI A;  3D8B A;  4R7G A;  4NL4 H;  2NQ8 C;  3HGI A;  3ILK A;  1NO1 A;  1OFI A;  4WP2 A;  1Z6T A;  1EIJ A;  3DA1 A;  3V76 A;  1IBL M;  3GLI E;  2E5L M;  4I4L A;  4JI8 M;  3BOS A;  2MRO B;  3DOA A;  3K9P A;  4YY3 M;  3SAV A;  2XSZ A;  4X62 M;  3LW5 F;  4NXM M;  4IJE A;  3J81 S;  1GJT A;  4F2L A;  1OAI A;  4HLQ A;  3U6L A;  4QOZ C;  3B89 A;  3CGW A;  2EJS A;  4ITQ A;  1KYI A;  1D2N A;  5EXS A;  1D0L A;  2YQZ A;  4FWH A;  3FYD A;  3R8F A;  3JR4 A;  4JI2 M;  4DR4 M;  3L29 A;  2LNH C;  2Y20 A;  1L8Q A;  1T6O A;  2J7O A;  1QYR A;  1XXH B;  3AV0 A;  4XGI A;  3GLF B;  3VK8 A;  3CF2 A;  4DV5 M;  4KT0 F;  4D81 A;  3GLF E;  3AOE A;  2K0B X;  3LQQ A;  1XMO M;  2YNM D;  3U6C A;  4MGZ E;  1NVM A;  3W0F A;  2OPF A;  3THG A;  2D7H A;  4XK8 F;  3SMS A;  3T6P A;  1ZAE A;  4DV1 M;  1GLN A;  4LJ5 A;  1C1K A;  1KSF X;  5EXT A;  3GPP A;  4I5S A;  4RKU F;  5KO3 A;  5LMN M;  4ANR A;  4G6Z A;  1QZM A;  4KOD A;  3M6A A;  1YLA A;  4I8O A;  4M9Z A;  2BWE A;  3GQ4 A;  4DUY M;  2ZAM A;  4NC6 A;  5ITQ A;  3TWM A;  1PGY A;  3GLH B;  2UXC M;  3HU3 A;  1Y8G A;  3FUX A;  3C58 A;  3TWK A;  2VF7 A;  1IY0 A;  4B7G A;  1IN8 A;  5KPT A;  4G4Q A;  2Z8Y M;  3KFU G;  4OX9 M;  2QPA A;  4JI1 M;  3SYL A;  2CV1 A;  3FTE A;  1IFY A;  5LMU M;  1L2D A;  4NXN M;  2ZBK B;  1DGB A;  4S12 A;  2G5G X;  1E9R A;  4GKJ M;  1L1Z A;  4LFA M;  5EQT A;  2WSE F;  1L2C A;  2P5T A;  2QCU A;  2R62 A;  4DR7 M;  3HU1 A;  2ZAO A;  3VDU A;  1C7Y A;  2C5R A;  2BWB A;  1N34 M;  2F5O A;  3L28 A;  4FW9 A;  3A98 B;  1WGL A;  2EKF A;  2VQF M;  4LJ7 A;  4KLN A;  1QZE A;  3NWL A;  3GP1 A;  2C99 A;  5FTL A;  1DO0 A;  2QP9 X;  3DZD A;  4NOO B;  5IRE B;  4AKI A;  4JXJ A;  3BBZ A;  2Y0T A;  8CAT A;  2O5R A;  3K2L A;  4LG2 A;  1WXQ A;  4LRT A;  1T3T A;  3GQ3 A;  4JYA M;  1QAO A;  1TH3 A;  1VDL A;  1SXJ E;  3IG8 A;  5EP1 A;  1GJS A;  2DZL A;  2X4A A;  4LJA A;  1Z5C A;  4DBG B;  1V34 A;  1IXZ A;  3E4R A;  1RU3 A;  3FUT A;  3W68 A;  4X64 M;  2G3Q A;  2KA6 B;  2R6F A;  4DV0 M;  2ZAN A;  2FNA A;  1SG9 A;  4PCZ A;  1Q39 A;  4D80 A;  4DV3 M;  4FWD A;  1L1T A;  1QUT A;  3PNY A;  4LZJ A;  2X49 A;  3GO8 A;  2OOB A;  1ZMW A;  3I4V A;  2DWN A;  3GLG A;  1VDD A;  2DAE A;  2JY5 A;  4IBC A;  4DR1 M;  5E26 A;  1YSY A;  1Q3C A;  2DNA A;  1XXH E;  2XH9 A;  2DAM A;  4MB7 A;  3AKZ A; 
#chains in the Genus database with same CATH homology
 4AKH A;  4X66 M;  3U6S A;  4NSO B;  2CFO A;  4BB9 A;  3U5Z A;  1QVR A;  5EP3 A;  1OJL A;  3EIH A;  4LF8 M;  3J80 S;  4NRW A;  1TGU A;  2L7I A;  3ZH9 B;  3OTO M;  2BJV A;  1NNU C;  4QHS A;  5KPZ A;  3SHG B;  3GPY A;  2RGH A;  4AG6 A;  4M9S A;  2DWL A;  3UMM A;  4BLC A;  4L78 A;  2EUC A;  5JI3 E;  3J7A S;  2M5Z A;  2R18 A;  3KP0 E;  3FYC A;  4L16 A;  2QBY B;  5DYG A;  3GRU A;  4GC5 A;  2UXD M;  3A42 A;  3T1H M;  3CF0 A;  2QEN A;  3GPU A;  4QHT A;  1JR3 D;  3H4M A;  1SXJ C;  1NNJ A;  3GRV A;  4GHL A;  2JA2 A;  3SBJ A;  4OU7 A;  3GLI A;  5JI2 E;  2Z4S A;  3U6M A;  3QWL A;  2Q2E B;  4WW0 A;  5E6J A;  3KXE C;  1JR3 A;  3KS4 A;  3B9P A;  4JI5 M;  3A45 A;  4JI6 M;  3FKE A;  4LJ9 A;  4Z8X A;  2Y0Q A;  3JR5 A;  4NSR A;  1Z5B A;  1Z59 A;  3KP1 E;  1S3S A;  3U6P A;  4IBK A;  2L09 A;  1OFH A;  2DZN B;  1HNW M;  4LF7 M;  3D8L A;  3J2P B;  4KO8 A;  3VK7 A;  1DGH A;  4B3S M;  1DGG A;  4GRI A;  2OQ4 A;  3KW6 A;  3U6O A;  4FD2 A;  4IBD A;  1R2Y A;  1R2Z A;  3SAU A;  3FTD A;  4A3V B;  2R4J A;  5ITX E;  4MH0 E;  4MGH A;  2KRK A;  3A46 A;  4GMQ A;  1IY1 A;  3HJ8 A;  3K8Z A;  4P16 A;  2F5S A;  1XWI A;  3J7B A;  1HQY E;  4L4U A;  1K3X A;  4LFB M;  3QAU A;  4FCT A;  4MGY E;  4IJF A;  2LXE A;  4CIS A;  4JN6 A;  5EXP A;  1Z5A A;  4BBA A;  5C18 A;  4IBB A;  3SHF A;  3AL0 C;  5DNY A;  1DGF A;  2Z4R A;  5IZ7 D;  4DV6 M;  3GRR A;  4REZ A;  2BNK A;  4II7 A;  4DR2 M;  4XBO A;  4FVM A;  4GH9 A;  3RE8 A;  4QOS A;  4B3M M;  2XGN A;  2YFQ A;  3L27 A;  2F5P A;  2XEP A;  3VFD A;  2I7N A;  4R3D A;  2XFS A;  4D82 A;  4PDI A;  4YHH M;  1GL6 A;  5EP4 A;  4AQY M;  1FNN A;  1GL7 A;  3HHY A;  1KFV A;  3GRY A;  1NHW C;  2L6O A;  3SMP A;  1R6B X;  2RKO A;  2CHQ A;  1QAM A;  4MGI E;  5FTJ A;  3GLI B;  2CUZ A;  1N36 M;  2R45 A;  1E94 E;  1E32 A;  2Y21 A;  2D7G A;  4FCV A;  4GKK M;  5FTM A;  1TH4 A;  3T1Y M;  1N77 A;  3TPZ A;  3KSJ A;  4IBJ A;  2CEA A;  4PDG A;  4IBE A;  4K0K M;  1SXJ A;  7CAT A;  5KPR A;  4LF9 M;  1IBK M;  3GPX A;  3M0E A;  3SFZ A;  1NSF A;  3FTC A;  1NY6 A;  3DFZ A;  1GKI A;  5BPV A;  1HT1 E;  4OW0 A;  3TE6 A;  4AZF A;  4I81 A;  5ITT A;  4B3T M;  4LCB A;  3SAS A;  2ERC A;  3FTF A;  2CV0 A;  3U61 B;  1SXJ B;  3FUW A;  3U5Z B;  3I4Y A;  4AW4 A;  3RFW A;  4G4N A;  3U60 B;  3KS8 A;  3L25 A;  4RF1 A;  3Q8X A;  4MM3 B;  1G3I A;  3UJN A;  3GQ5 A;  1HNZ M;  5A2Q S;  1Q3B A;  3W0L B;  2D7E A;  3I51 A;  2XSZ D;  1X37 A;  4OVZ B;  3SAT A;  3K92 A;  4DV4 M;  4DR5 M;  1JQJ C;  3HKP A;  3PNV A;  4WUR A;  5ITU A;  5IWA M;  1TDH A;  1W5T A;  1FJG M;  3UGJ A;  2H1R A;  5EXX A;  2KRU A;  5FTK A;  5BR8 M;  1K82 A;  2EO2 A;  3EIE A;  1YE9 A;  2I7P A;  4JI7 M;  3E9S A;  2QZ4 A;  4RNA A;  2XFT A;  2XF3 A;  2J7N A;  5KQD A;  2VII A;  1L2B A;  3GLH A;  2DHR A;  2YR0 A;  1UM8 A;  2KW0 A;  2KXE A;  1NJG A;  1ORY B;  2FFJ A;  3VKG A;  5EP2 A;  1GVN A;  4CGY B;  3PVS A;  4M0D A;  4LGY A;  1E9S A;  3AOE C;  4IBI A;  5F3W A;  4LFC M;  3LVV A;  5C1B A;  1IQP A;  3JAM S;  1QQW A;  3KVW A;  3IG5 A;  4AI6 A;  2Z7J A;  3HJS A;  4W5W A;  4LJ6 A;  1W5S A;  3ZCB B;  4B3R M;  1IBM M;  2X8A A;  4LZZ A;  5ITX A;  5IT9 S;  2F5Q A;  3LQR A;  2HHH M;  3HHZ A;  1N75 A;  1DGH B;  5ITY A;  1DO2 A;  2DVW B;  2R4E A;  1I94 M;  2LH0 A;  4OVZ A;  2RGO A;  5DYI A;  4FCW A;  1NY5 A;  4M9X A;  2XZU A;  2R46 A;  4LY6 A;  3SC3 A;  2EA0 A;  3NBI A;  2UUB M;  1MX0 A;  4HL4 A;  4LJ8 A;  1G41 A;  3VLF B;  4DV7 M;  2C96 A;  4JV5 M;  3SYK A;  5GKN A;  2L7H A;  4Z6Y A;  1N78 A;  1R7R A;  3U6E A;  1TDZ A;  4X65 M;  2CV2 A;  4PD2 A;  2C9O A;  4DR3 M;  3TWL A;  1IY2 A;  3CTW B;  4JI0 M;  2UU9 M;  3GLF A;  3KOW E;  5ITR A;  1IN5 A;  3KDS E;  4JI4 M;  3R9X B;  4LF6 M;  1NJF A;  3MK6 A;  3HHW A;  2KZU A;  2UUC M;  2KZS A;  2F4V M;  2UXB M;  1K3W A;  3KOX E;  4LGM A;  1XMQ M;  3U6D A;  1NHG C;  4GHA A;  4DV2 M;  5FTN A;  3M7G A;  1J7K A;  4G4R A;  3PFI A;  2ZM6 M;  1HNX M;  1PJI A;  3L2A A;  4JI3 M;  1PJJ A;  4L15 A;  3RGS A;  4IBG A;  5FSW A;  3VKH A;  1YUB A;  2DZO B;  3HU2 A;  4DR6 M;  4GIP A;  3PXG A;  4MGK E;  1XC8 A;  2HKJ A;  5H37 D;  3GLG B;  4LRS A;  4TUW A;  3KSX A;  1HQC A;  2CHG A;  2V6Z M;  3FUU A;  3MJ5 A;  1IXS B;  2LWX A;  5FLX S;  1IN7 A;  1IN6 A;  4QNR A;  4CHT B;  4RF0 A;  1IXR C;  3ZC7 B;  1ZQ9 A;  1EE8 A;  1SXJ D;  3KOY E;  2G8L A;  2HCB A;  3HWS A;  2C98 A;  4EIW A;  3CF6 E;  3FUV A;  1QAQ A;  2CHV A;  1XNQ M;  1HR0 M;  4LJ4 A;  4IIW A;  3U6Q A;  2V1C A;  4AKG A;  2AHM A;  4GIT A;  4G4O A;  2XZF A;  4NRV A;  3J27 B;  1MU5 A;  2V1U A;  3HJQ A;  3AOG A;  4M0W A;  2KEB A;  2DWZ B;  4QNM A;  2Z3X A;  1N32 M;  3LMM A;  2FE8 A;  3L26 A;  2XLJ A;  4GC9 A;  4AG5 A;  2M60 A;  3T38 A;  4B7F A;  1LV7 A;  4DUZ M;  2K47 A;  2HL7 A;  1XNR M;  2BJW A;  1XXH A;  1I4W A;  2FOI C;  2R65 A;  3WHL A;  4L8R C;  2C9C A;  1TH2 A;  3HHX A;  1N33 M;  1QAN A;  3SAW A;  3U61 A;  2UUA M;  4PT5 A;  3AJI B;  3AFH A;  2A5Y B;  3T15 A;  1H6U A;  4ZPX A;  5KQ8 A;  1J5E M;  2DWM A;  3FD9 A;  1IN4 A;  3TL4 X;  1G4A E;  3UK6 A;  3LVW A;  5EJC A;  4B7H A;  1IM2 A;  4B08 A;  1G8P A;  2QBY A;  3VDP A;  4LF4 M;  4FWG A;  3MHV C;  4IBF A;  3TQS A;  1J09 A;  2CE7 A;  3RGP A;  3KOZ E;  4LF5 M;  2W82 A;  2F5N A;  1PM5 A;  3UZU A;  1HT2 E;  3WHK A;  4KHP M;  3U60 A;  3K1J A;  2VQE M;  3SAR A;  1G59 A;  2DXI A;  3D8B A;  4R7G A;  4NL4 H;  2NQ8 C;  3HGI A;  3ILK A;  1OFI A;  1Z6T A;  3DA1 A;  1IBL M;  2E5L M;  4I4L A;  4JI8 M;  3BOS A;  3DOA A;  4YY3 M;  3SAV A;  2XSZ A;  4X62 M;  4NXM M;  4IJE A;  3J81 S;  4HLQ A;  3U6L A;  4QOZ C;  4ITQ A;  1KYI A;  1D2N A;  5EXS A;  2YQZ A;  4FWH A;  3FYD A;  3R8F A;  3JR4 A;  4JI2 M;  4DR4 M;  3L29 A;  2LNH C;  2Y20 A;  1L8Q A;  2J7O A;  3AV0 A;  1QYR A;  1XXH B;  4XGI A;  3GLF B;  3VK8 A;  3CF2 A;  4DV5 M;  4D81 A;  3AOE A;  1XMO M;  3LQQ A;  2YNM D;  3U6C A;  4MGZ E;  1NVM A;  3W0F A;  2OPF A;  3THG A;  2D7H A;  3SMS A;  1ZAE A;  4DV1 M;  1GLN A;  4LJ5 A;  1C1K A;  1KSF X;  5EXT A;  3GPP A;  4I5S A;  5KO3 A;  5LMN M;  4G6Z A;  1QZM A;  4KOD A;  3M6A A;  4I8O A;  4M9Z A;  4DUY M;  3GQ4 A;  2ZAM A;  5ITQ A;  3TWM A;  3GLH B;  2UXC M;  3HU3 A;  3FUX A;  3C58 A;  3TWK A;  4B7G A;  1IY0 A;  5KPT A;  1IN8 A;  4G4Q A;  3KFU G;  4OX9 M;  2QPA A;  4JI1 M;  3SYL A;  2CV1 A;  3FTE A;  5LMU M;  1L2D A;  4NXN M;  2ZBK B;  1DGB A;  4S12 A;  2G5G X;  1E9R A;  4GKJ M;  1L1Z A;  4LFA M;  5EQT A;  1L2C A;  2P5T A;  2QCU A;  2R62 A;  4DR7 M;  3HU1 A;  2ZAO A;  3VDU A;  2C5R A;  1N34 M;  2F5O A;  3L28 A;  4FW9 A;  3A98 B;  2VQF M;  4LJ7 A;  4KLN A;  3NWL A;  3GP1 A;  2C99 A;  5FTL A;  1DO0 A;  2QP9 X;  3DZD A;  4NOO B;  5IRE B;  4AKI A;  4JXJ A;  2Y0T A;  8CAT A;  2O5R A;  3K2L A;  4LG2 A;  1WXQ A;  4LRT A;  1T3T A;  3GQ3 A;  4JYA M;  1QAO A;  1TH3 A;  1SXJ E;  3IG8 A;  5EP1 A;  2X4A A;  4LJA A;  1Z5C A;  1IXZ A;  3E4R A;  3FUT A;  4X64 M;  2KA6 B;  4DV0 M;  2ZAN A;  2FNA A;  4PCZ A;  1Q39 A;  4D80 A;  4DV3 M;  4FWD A;  1L1T A;  3PNY A;  4LZJ A;  2X49 A;  3GO8 A;  3I4V A;  2DWN A;  3GLG A;  1VDD A;  4IBC A;  4DR1 M;  5E26 A;  1YSY A;  1Q3C A;  2XH9 A;  1XHB A;  4MB7 A;  3AKZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...