4MB7A

Crystal structure of a viral dna glycosylase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
273
structure length
273
Chain Sequence
VEAPRIRITYEKIRHTKNHRIVSISGPSYKRMNVDLIDYIIRKWWFAGKYIYLMLISSNKPTYVIRTHMMMHGRILVGNQDSPTKRAFMIIQLDNDIVLRWYRSQITLLDPNCLAEIKTNYTICTTRQAIMDSIKLMKYDLSNNRFDYNLFQSHLKNGINIHSSEIITDFLLDQEYFPGVGNILQQEALYDCKILPLKKVQDIDEPMFDCLCNSLKKIIDLLYESYKFRESGKEFGPILRIYRKSLCPLGHKTIRKKIGLRNRMTTWCPVCQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endonuclease 8-like L720
publication title Structural investigation of a viral ortholog of human NEIL2/3 DNA glycosylases.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Hydrolase
total genus 87
structure length 273
sequence length 273
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4mb7A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 4mb7A01
3U6DA 4PDGA 1J5EM 5FLXS 4DV1M 4LFAM 3SAWA 1K82A 4OX9M 3VK8A 4JI0M 3U6OA 4G4NA 4DR4M 3W0FA 3J80S 1Z5CA 2ZBKB 4DR1M 5ITTA 4LFBM 2UXDM 4B3RM 3A46A 4JI2M 2HKJA 1HNXM 1L1ZA 3A42A 3GQ3A 3SARA 4LF8M 2Q2EB 1EE8A 3U6SA 4DV5M 4DUZM 4DV3M 1HNWM 4YHHM 3GPPA 2ZM6M 2HHHM 4G4QA 3U6EA 3J81S 3JR5A 4DR5M 3SAUA 1N33M 4LFCM 5ITRA 2F5QA 2F5PA 4JI5M 1Q39A 1Z5BA 1Q3BA 4JI4M 1Q3CA 1L2CA 1K3XA 1K3WA 4CISA 2UUBM 3JAMS 5BR8M 4K0KM 4KHPM 4NXNM 2VQEM 3GPXA 5IWAM 4YY3M 4ITQA 3SBJA 1XNRM 1PJIA 1MX0A 4LF6M 2EA0A 1TDZA 2UU9M 4X65M 3TWKA 4GKKM 3GQ4A 1Z59A 4G4OA 1HR0M 5LMUM 1N36M 4X64M 1TDHA 4NRVA 2OQ4A 3T1YM 4LF9M 5ITXE 3GQ5A 4JI3M 4AQYM 1IBMM 4B3MM 3SAVA 1XC8A 1NNJA 5ITQA 1PJJA 1I94M 3TWMA 3SASA 1MU5A 4X66M 3VK7A 4NXMM 4DV6M 2VQFM 2XZFA 2UUAM 4JI7M 4PCZA 4DV7M 2XZUA 4DR6M 4JI6M 4LF7M 1N34M 3DOAA 4DR2M 1L1TA 3TWLA 3U6QA 4MB7A 5ITUA 1L2DA 3GP1A 1XMQM 2E5LM 3OTOM 4JYAM 5ITXA 4DV4M 4G4RA 4X62M 4DV0M 2F5SA 4PD2A 3C58A 4B3SM 4DR3M 1R2ZA 3U6LA 1L2BA 1IBLM 3T1HM 1KFVA 3J7AS 3GPUA 4JV5M 4B3TM 1N32M 1XMOM 2F5NA 4JI1M 3U6CA 2OPFA 3SATA 4DV2M 2F4VM 4NRWA 3U6PA 3GO8A 1HNZM 2UXCM 2UUCM 1FJGM 1Z5AA 3U6MA 3A45A 3JR4A 1IBKM 5LMNM 4LF4M 2UXBM 5IT9S 1PM5A 5ITYA 4PDIA 4DUYM 5A2QS 2F5OA 4GKJM 4JI8M 1R2YA 4LF5M 1XNQM 4DR7M 3GPYA
chains in the Genus database with same CATH superfamily
4QNMA 1J5EM 2EJSA 3QAUA 2WZJA 3UZUA 3THGA 4LGYA 4GIPA 4CIZA 5JI2E 3AL0C 4JI0M 1NSFA 3U6OA 1OFHA 2DWZB 5C1BA 3R8FA 4DR4M 2MGWA 2N35A 3RE8A 1Z5CA 4MGHA 3FRHA 3Q8GA 2O5RA 3NBXX 1QAOA 2EKFA 4CJ6A 3GLGB 2JA2A 2HKJA 2KXEA 1E32A 2M60A 2XGNA 4IBJA 3U6SA 3LCUA 1IY0A 2RGOA 1ZQ9A 4FCTA 4IJFA 4DUZM 2G3QA 1OIPA 1TF0B 4FWGA 1QDTA 4TUWA 1N78A 1DGGA 4LJ9A 2DENA 1V92A 3JR5A 3SAUA 3WHLA 1G8PA 2CP8A 3KOZE 3FYDA 4IBBA 4L78A 3KSXA 2F5QA 2R18A 3FUTA 1Q39A 1Q3BA 3HX3A 2XSZD 3K2LA 4II7A 5C18A 2C98A 1F4IA 1Q3CA 3FUVA 3T6PA 1L2CA 3LVWA 2FS1A 2XLJA 2UUBM 3GLHA 2K6BA 3C3DA 4NXNM 1P3QQ 1ZMWA 1SXJC 1QUSA 3FE3A 5JI3E 2KHHA 3W68A 4ITQA 3B89A 4CHTB 1ZV1A 3BXWA 3TE6A 2R4JA 1TH2A 3HHWA 3FTEA 1IY2A 3W0LB 3SYLA 1IN8A 4GITA 5FTMA 2Y21A 1D0LA 1NJGA 1OFIA 3KW6A 4Q7JA 4F2LA 1HR0M 4LJ5A 3PFIA 1ORYB 4S12A 4Z6YA 3ZC7B 1QYRA 5EXXA 4LF9M 4LJ7A 3HJ8A 2C99A 2QBYB 1GJSA 5IZ7D 1E9RA 3SAVA 2APLA 2J5YA 2JY6B 3E9SA 2CHGA 2Y0QA 2V6ZM 1R7RA 4RKUF 1JR3E 1UFZA 1SXJD 1VEKA 1XXHE 3LMMA 2RKOA 2KA6B 4PCZA 1IXSA 4DV7M 4MGZE 4JI6M 1TH3A 3HJQA 1R6BX 2VIIA 4GHAA 3T15A 3B7NA 1HT2E 2L09A 3HY5A 3HU2A 1G3IA 2KW0A 3PVSA 2R45A 4MGYE 2V1CA 1PJTA 4R7GA 3OTOM 2E5LM 2G8LA 2KNVA 3L28A 4PD2A 1OQYA 1QUTA 4AKIA 4HEOA 1TR8A 1DO0A 4HLQA 1IBLM 1WIVA 2LTUA 2G5GX 4MGIE 1GLNA 2K9DA 2QCUA 1E9SA 2DAKA 4I8OA 3B74A 1DV0A 1IN6A 2MH8A 1DGBA 2QQ8A 2F4VM 4CGYB 4NRWA 4XBOA 5EXTA 2DKLA 2YFQA 2XFTA 3QYEA 2CV2A 1QAQA 3GLIE 3GLIB 3CGWA 3JR4A 3VDUA 5LMNM 5FTKA 4GHLA 1PM5A 3KS8A 3EIEA 1QVRA 3U5ZB 4P16A 1SXJA 1R2YA 4DR7M 4K0KM 2LVPC 2J7OA 3U6DA 2OO9A 3FUUA 3L29A 3SAWA 4BBAA 1HQCA 2QHOB 4G4NA 4M9SA 1GKIA 4P17A 3J80S 2CE7A 3K92A 5KPTA 4M0WA 4AKHA 1OAOC 2CFOA 2KNAA 4B3RM 4JI2M 2RGHA 1HT1E 3U61A 3I4VA 4MGKE 3SARA 4AG6A 3M7GA 4L15A 4GMQA 3CTWB 3GLFE 2DVWB 1TH4A 2R0IA 3FUWA 4JXJA 3QYBA 2ZM6M 3AOEC 2HHHM 5FTJA 1AUAA 2HL7A 2Z3XA 3U6EA 3UK6A 1VEGA 2JY7A 1HQYE 2LH0A 5ITRA 2F5PA 2W82A 4KO8A 1AIPC 4BB9A 2HCBA 2Y20A 3KOWE 2CEAA 2VF8A 4CISA 1L8QA 1K3WA 3H4JA 4D82A 1YSYA 1NV8A 5BPVA 5KQ8A 2Z8YM 2DWMA 2DNAA 4QOSA 1MJGM 2R4EA 3HKPA 4KHPM 4IJEA 4YY3M 2R65A 2Z7JA 4WP2A 3GLGE 2BWBA 5DFLA 7CATA 1PJIA 3VDPA 3L2AA 2WSFF 4FD2A 4KODA 2DZOB 1MX0A 4LF6M 2EKKA 1Y8GA 3J7BA 4GC5A 2JZ0A 1G59A 2CRUA 1G4AE 1DO2A 1NV9A 4OVZB 5EP3A 4A3VB 4B7HA 1JR3D 2UU9M 3I51A 3GQ4A 4GEWA 4G4OA 5LMUM 3KDSE 1N36M 1QDRA 4X64M 4NRVA 2O01F 3T1YM 4AKGA 5ITXE 2H5XA 1OKSA 1WJ7A 3CF6E 4JI3M 1IBMM 3LW5F 1XC8A 3L25A 2VDBB 2LVNC 4QNRA 2DZNB 3KVWA 3I01M 4AZFA 3FD9A 1I94M 5KPRA 4LZZA 3TWMA 3SASA 1MU5A 1OAIA 3VFDA 4DV6M 1N77A 2VQFM 3TPZA 2UUAM 1DGHB 1GJTA 1WHCA 4QHSA 1G41A 4NOOB 3LQQA 1Z6TA 3AV0A 1N34M 2LXEA 1L1TA 3TWLA 3ZCBB 2DWNA 2FFJA 4JYAM 1D0MA 3HWSA 4G4RA 1X37A 2QP9X 5EJCA 4BLCA 1NVMA 4DV0M 3I4YA 2F5SA 1QANA 4LRTA 4B3SM 2ZAOA 3SHFA 2I7PA 2MROB 1DGFA 1RU3A 1IN7A 2MR9A 4G6ZA 1L2BA 2DXIA 3FUXA 2DHRA 2JP7A 1NHGC 3AOEA 4L8RC 4LRSA 3T38A 1XXHA 2D7EA 3FTDA 1N32M 1XMOM 1IN4A 3IG8A 3NWLA 1V34A 1PJQA 2D7HA 1IXRC 2R6FA 2J7NA 3H4MA 3HU1A 3KP0E 2OPFA 2Z4SA 4DV2M 3MMPA 3ZQJA 2KEBA 2XSZA 3KSJA 5DYGA 3GO8A 3U60A 2Y0TA 1J7KA 2ZANA 3TQSA 1FJGM 2UXCM 1ZMUA 2FH0A 4I81A 1Z5AA 3U6MA 2YR0A 3A45A 3C3EA 4LF4M 2RRUA 4FW9A 1GVNA 3DA1A 3E46A 4FCVA 4DUYM 3M6AA 2F5OA 4GKJM 4UN2B 4LF5M 1XNQM 3M0EA 1GL7A 4DR2M 2FE8A 3CF0A 4QOZC 4LY6A 3SMPA 4PDGA 5FLXS 4DV1M 4OX9M 4IBGA 1T6OA 3VK8A 3SYKA 3D8BA 4IIWA 1VEJA 2BJVA 3RGPA 2ZBKB 3IHPA 1IXZA 1NO1A 3AOGA 4LFBM 2C96A 3A46A 4GH9A 4I4LA 3B9PA 4OU7A 1L1ZA 1J09A 3A42A 3KOYE 2FNAA 4LF8M 1FNNA 4W5WA 2Q2EB 1EE8A 1TTEA 3GRYA 1HNWM 1IXSB 1MN3A 3GPPA 2A5YB 1WGNA 2CHVA 3FRIA 1HJPA 2C9OA 3SC3A 4LFCM 1D0KA 2JY8A 2LBCA 2ZTDA 3KXEC 1JB0F 4IBFA 2LNHC 2NQ8C 1T43A 3JAMS 3HHYA 2GQFA 1C7YA 2EO2A 1VDDA 5IWAM 4FVMA 1IFYA 4NSRA 2QPAA 2BNKA 3HHXA 3SBJA 1XNRM 1D2NA 1YE9A 2D7GA 3RGSA 5KO3A 3GLFA 2BJWA 3D8LA 4D80A 2XF3A 1Q02A 4R3DA 2V1UA 1XWIA 2KRUA 2EA0A 4AI6A 1TDZA 1CUKA 2FOIC 1R5LA 2MJ5B 3F92A 2X4AA 1W5TA 2QZ4A 3C9PA 2YNMD 3TWKA 4X65M 4GKKM 3ZH9B 5DNYA 2M5ZA 1XHBA 2WSEF 3K9OA 1TDHA 3RFWA 3IG5A 3A98B 5E6JA 1SXJB 3KFUG 4MH0E 4B3MM 1NNJA 3LVVA 2BWEA 3HGIA 4NSOB 5ITQA 3VLFB 4GRIA 3GLGA 1TGUA 1PJJA 3DZDA 3LQRA 3PNYA 4NXMM 1NY6A 2AHMA 4IBDA 3DFZA 3MHVC 4B7FA 3UGJA 2QNJA 3HJSA 1I4WA 4REZA 4OVZA 8CATA 1ZMVA 5KQDA 1KSFX 2XZUA 4DR6M 2LWXA 3QWLA 4D81A 2XEPA 1S3SA 2YQZA 4IBEA 3U6QA 4MB7A 3I04M 5ITUA 4EIWA 1L2DA 3GP1A 2R46A 5ITXA 3BOSA 4X62M 2JXNA 4M9XA 1H6UA 3FTCA 3K9PA 4FCWA 5EP4A 1PGYA 3C58A 3HHZA 4DR3M 4QHTA 3U6LA 2CV1A 1BVSA 1VG5A 1ZAEA 3SFZA 1GL6A 4LGMA 1KFVA 2JZ1A 3GPUA 1DGHA 2EUCA 1WR1B 4B3TM 2JUJA 4RF0A 2F5NA 4JI1M 3MK6A 4FWDA 3W67A 2QENA 2DZLA 4L4UA 4L6V6 5EXPA 4ANRA 1IQPA 2UUCM 5KPZA 4B7GA 2OOAA 2L4FA 1VQ1A 3ILKA 5F3WA 5IT9S 1IBKM 2K0BX 4IBIA 1G71A 2LVOC 4ZPXA 1E94E 2WSCF 1GO5A 4JI8M 2B3TA 4PT5A 4AG5A 2C5RA 1W5SA 3GPYA 2QBYA 3PNVA 4WW0A 3WHKA 2Z4RA 5E26A 2KNZA 4LJ4A 4LFAM 1K82A 1QZMA 1VDLA 3J2PB 1LTMA 2CWBA 4M0DA 3LCVB 2KZUA 2XH9A 4G3OA 1JR3A 1A5TA 3W0FA 4DR1M 3SHGB 2X8AA 5FTNA 1QZEA 5ITTA 3GLHE 3HZJA 4IBKA 2UXDM 3GLHB 2DAGA 2XFSA 3BBZA 1HNXM 3E21A 4RNAA 3GQ3A 5EP1A 1WXQA 2GNOA 4DV5M 5H37D 1PRBA 4DV3M 2DWLA 3FYCA 4MM3B 4YHHM 2L7IA 4LG2A 4F1IA 2X49A 4G4QA 1NHWC 4NL4H 2DAEA 3J81S 2ERCA 4DR5M 1N33M 5EP2A 2JY5A 1NJFA 4JI5M 3AFHA 4M9ZA 1OJLA 1Z5BA 5EXSA 3PXGA 2L7HA 4AW4A 4RF1A 4JI4M 3UMMA 1PJSA 1N75A 1K3XA 1OTRA 1SG9A 5BR8M 2KDLA 4LJ8A 3E4RA 2KRKA 2KZSA 3GRRA 4NC6A 4WURA 4XK8F 2O25A 3GRVA 2LVQD 3GPXA 2VQEM 3VKGA 1EIJA 4HL4A 1NY5A 1XXHB 2CUZA 2LHGA 1WGLA 4DBGB 2I7NA 1EFUB 3GLIA 2DI0A 2LVAA 1UM8A 2C9CA 3U5ZA 3KP1E 1IY1A 4Z8XA 3MJ5A 3U60B 4LCBA 3L27A 1IM2A 2ZTCA 4GC9A 2QSFX 1Z59A 2OQ4A 4L16A 3HU3A 2L6OA 3GQ5A 4AQYM 3UJNA 3AJIB 3K8ZA 3Q8XA 1YUBA 3B7ZA 4OW0A 1GABA 2H1RA 1QAMA 5IREB 3VK7A 4X66M 4LZJA 2HWJA 3V76A 2LHCA 3AKZA 2XZFA 3CF2A 2JNHA 1LV7A 4I5SA 4JI7M 3TL4X 4LF7M 3FKEA 3DOAA 3IECA 1XB2B 4R71A 3L26A 3NBIA 3SMSA 3FTFA 4LJAA 1XMQM 2HAKA 2CHQA 4DV4M 4IBCA 2OOBA 3GRUA 2DAIA 1KYIA 2VF7A 3B7QA 1SXJE 1R2ZA 3R9XB 2L4EA 2ZAMA 5GKNA 4Y28F 1V33A 1T3TA 3T1HM 3KOXE 3KS4A 3J7AS 4JV5M 1R4GA 3K1JA 4XGIA 1NNUC 5L8RF 1IN5A 2L2DA 3U6CA 3SATA 5FTLA 1OIZA 3EIHA 2CV0A 3U6PA 2DAMA 2DHYA 4JN6A 4KLNA 5DYIA 5FSWA 1HNZM 3GLFB 4LJ6A 2R62A 4KT0F 3U61B 2UXBM 4B08A 1JQJC 1YLAA 1QQWA 2JWSA 2R44A 1C1KA 4FWHA 5ITYA 4PDIA 5EQTA 5A2QS 2P5TA 2K47A 3J27B 3VKHA
chains in the Genus database with same CATH topology
4QNMA 1J5EM 3QAUA 3UZUA 5JI2E 3THGA 4LGYA 4GIPA 3AL0C 4JI0M 1NSFA 3U6OA 1OFHA 2DWZB 5C1BA 3R8FA 4DR4M 3RE8A 1Z5CA 4MGHA 2O5RA 1QAOA 3GLGB 2JA2A 2HKJA 2KXEA 1E32A 2M60A 2XGNA 4IBJA 3U6SA 1IY0A 2RGOA 1ZQ9A 4FCTA 4IJFA 4DUZM 4FWGA 4TUWA 1N78A 1DGGA 4LJ9A 3SAUA 3JR5A 3WHLA 1G8PA 3KOZE 3FYDA 4IBBA 4L78A 3KSXA 2F5QA 2R18A 3FUTA 1Q39A 1Q3BA 4II7A 2XSZD 3K2LA 5C18A 2C98A 1Q3CA 3FUVA 1L2CA 3LVWA 2XLJA 2UUBM 3GLHA 4NXNM 1SXJC 5JI3E 4ITQA 4CHTB 3TE6A 2R4JA 1TH2A 3HHWA 3FTEA 1IY2A 3W0LB 3SYLA 1IN8A 4GITA 5FTMA 2Y21A 1NJGA 1OFIA 3KW6A 1HR0M 4LJ5A 3PFIA 1ORYB 4S12A 4Z6YA 3ZC7B 1QYRA 5EXXA 4LF9M 4LJ7A 3HJ8A 2C99A 2QBYB 5IZ7D 1E9RA 3SAVA 3E9SA 2CHGA 2Y0QA 2V6ZM 1R7RA 1SXJD 3LMMA 2RKOA 2KA6B 4PCZA 4DV7M 4MGZE 4JI6M 3HJQA 1TH3A 1R6BX 2VIIA 4GHAA 3T15A 1HT2E 2L09A 3HU2A 1G3IA 2KW0A 3PVSA 2R45A 4MGYE 2V1CA 4R7GA 3OTOM 2E5LM 2G8LA 3L28A 4PD2A 4AKIA 1DO0A 4HLQA 1IBLM 2G5GX 4MGIE 1GLNA 2QCUA 1E9SA 4I8OA 1IN6A 1DGBA 2F4VM 4CGYB 4NRWA 4XBOA 5EXTA 2YFQA 2XFTA 2CV2A 1QAQA 3GLIB 3JR4A 3VDUA 5LMNM 5FTKA 4GHLA 1PM5A 3EIEA 1QVRA 3U5ZB 4P16A 1SXJA 1R2YA 4DR7M 2J7OA 3U6DA 3FUUA 3L29A 3SAWA 4BBAA 1HQCA 4G4NA 4M9SA 1GKIA 5KPTA 3J80S 2CE7A 3K92A 4M0WA 4AKHA 2CFOA 4B3RM 4JI2M 2RGHA 1HT1E 3U61A 3I4VA 4MGKE 3SARA 4AG6A 3M7GA 4L15A 4GMQA 3CTWB 2DVWB 1TH4A 3FUWA 4JXJA 2ZM6M 3AOEC 2HHHM 5FTJA 2Z3XA 2HL7A 3U6EA 3UK6A 1HQYE 2LH0A 5ITRA 2F5PA 2W82A 4KO8A 4BB9A 2HCBA 2Y20A 3KOWE 2CEAA 4CISA 1L8QA 1K3WA 4D82A 5KQ8A 1YSYA 5BPVA 2DWMA 4KHPM 4QOSA 2R4EA 3HKPA 4IJEA 4YY3M 2R65A 2Z7JA 7CATA 1PJIA 3VDPA 3L2AA 4FD2A 4KODA 2DZOB 1MX0A 4LF6M 4GC5A 3J7BA 1G59A 1G4AE 1DO2A 4OVZB 5EP3A 4A3VB 4B7HA 1JR3D 2UU9M 3I51A 3GQ4A 4G4OA 5LMUM 3KDSE 1N36M 4X64M 4NRVA 3T1YM 4AKGA 5ITXE 3CF6E 4JI3M 1IBMM 1XC8A 3L25A 4QNRA 2DZNB 3KVWA 4AZFA 3FD9A 1I94M 5KPRA 4LZZA 3TWMA 3SASA 1MU5A 3VFDA 4DV6M 2VQFM 3TPZA 2UUAM 1DGHB 4QHSA 1G41A 4NOOB 3LQQA 1Z6TA 3AV0A 1N34M 2LXEA 1L1TA 3TWLA 3ZCBB 2DWNA 2FFJA 4JYAM 3HWSA 4G4RA 1X37A 2QP9X 5EJCA 4BLCA 1NVMA 4DV0M 3I4YA 2F5SA 1QANA 4LRTA 4B3SM 2ZAOA 3SHFA 2I7PA 1DGFA 1L2BA 1IN7A 4G6ZA 2DXIA 3FUXA 2DHRA 1NHGC 3AOEA 4L8RC 4LRSA 3T38A 1XXHA 2D7EA 3FTDA 1N32M 1XMOM 1IN4A 3IG8A 3NWLA 2D7HA 3KS8A 1IXRC 3H4MA 2J7NA 3HU1A 3KP0E 2OPFA 2Z4SA 4DV2M 2KEBA 2XSZA 3KSJA 5DYGA 3GO8A 3U60A 2Y0TA 1J7KA 2ZANA 3TQSA 1FJGM 2UXCM 4I81A 1Z5AA 3U6MA 2YR0A 3A45A 4LF4M 4FW9A 1GVNA 3DA1A 4FCVA 4DUYM 3M6AA 2F5OA 4GKJM 4LF5M 1XNQM 3M0EA 1GL7A 4DR2M 2FE8A 3CF0A 4QOZC 4LY6A 3SMPA 4PDGA 5FLXS 4DV1M 4OX9M 4IBGA 3VK8A 3SYKA 3D8BA 4IIWA 2BJVA 3RGPA 2ZBKB 1IXZA 3AOGA 4LFBM 2C96A 3A46A 4GH9A 4I4LA 3B9PA 4OU7A 1L1ZA 1J09A 3A42A 3KOYE 2FNAA 4LF8M 1FNNA 4W5WA 2Q2EB 1EE8A 3GRYA 1HNWM 1IXSB 3GPPA 2A5YB 2CHVA 2C9OA 3SC3A 4LFCM 3KXEC 4IBFA 2LNHC 2NQ8C 3JAMS 3HHYA 2EO2A 1VDDA 5IWAM 4FVMA 4NSRA 2QPAA 2BNKA 3HHXA 3SBJA 1XNRM 1D2NA 1YE9A 2D7GA 3RGSA 5KO3A 3GLFA 2BJWA 3D8LA 4D80A 2XF3A 4R3DA 2V1UA 1XWIA 2KRUA 2EA0A 4AI6A 1TDZA 2FOIC 2X4AA 1W5TA 2QZ4A 3TWKA 2YNMD 4X65M 4GKKM 3ZH9B 5DNYA 2M5ZA 1XHBA 1TDHA 3RFWA 3IG5A 3A98B 5E6JA 1SXJB 3KFUG 4MH0E 4B3MM 1NNJA 3LVVA 3HGIA 4NSOB 5ITQA 3VLFB 4GRIA 3GLGA 1TGUA 1PJJA 3DZDA 3LQRA 3PNYA 4NXMM 1NY6A 2AHMA 4IBDA 3DFZA 3MHVC 4B7FA 3UGJA 3HJSA 1I4WA 4REZA 4OVZA 8CATA 5KQDA 1KSFX 2XZUA 4DR6M 2LWXA 3QWLA 4D81A 2XEPA 1S3SA 2YQZA 4IBEA 3U6QA 4MB7A 5ITUA 4EIWA 1L2DA 3GP1A 2R46A 5ITXA 3BOSA 4X62M 4M9XA 1H6UA 3FTCA 4FCWA 5EP4A 3C58A 3HHZA 4DR3M 4QHTA 3U6LA 2CV1A 1ZAEA 3SFZA 1GL6A 4LGMA 1KFVA 3GPUA 1DGHA 2EUCA 4B3TM 2F5NA 4RF0A 4JI1M 3MK6A 4FWDA 2QENA 4L4UA 5EXPA 1IQPA 2UUCM 5KPZA 4B7GA 3ILKA 5F3WA 5IT9S 1IBKM 4IBIA 4ZPXA 1E94E 4JI8M 4PT5A 4AG5A 2C5RA 1W5SA 3GPYA 2QBYA 3PNVA 4WW0A 3WHKA 2Z4RA 5E26A 4LJ4A 4LFAM 1K82A 1QZMA 3J2PB 4M0DA 2KZUA 2XH9A 1JR3A 3W0FA 4DR1M 3SHGB 2X8AA 5FTNA 5ITTA 2UXDM 4IBKA 3GLHB 2XFSA 1HNXM 4RNAA 3GQ3A 5EP1A 1WXQA 4DV5M 5H37D 4DV3M 2DWLA 3FYCA 4MM3B 4YHHM 2L7IA 4LG2A 2X49A 4G4QA 1NHWC 4NL4H 3J81S 4DR5M 2ERCA 1N33M 5EP2A 1NJFA 4JI5M 3AFHA 4M9ZA 1OJLA 1Z5BA 5EXSA 3PXGA 2L7HA 4AW4A 4RF1A 4JI4M 3UMMA 1N75A 1K3XA 5BR8M 1N77A 4LJ8A 3E4RA 2KRKA 2KZSA 3GRRA 4WURA 4K0KM 3GRVA 2VQEM 3GPXA 3VKGA 4HL4A 1NY5A 1XXHB 2CUZA 2I7NA 3GLIA 1UM8A 2C9CA 3U5ZA 3KP1E 1IY1A 4Z8XA 3MJ5A 3U60B 4LCBA 3L27A 1IM2A 4GC9A 1Z59A 2OQ4A 4L16A 3HU3A 2L6OA 3GQ5A 4AQYM 3UJNA 3AJIB 3K8ZA 3Q8XA 1YUBA 4OW0A 2H1RA 1QAMA 5IREB 3VK7A 4X66M 4LZJA 3AKZA 2XZFA 3CF2A 1LV7A 4I5SA 4JI7M 3TL4X 4LF7M 3FKEA 3DOAA 3L26A 3NBIA 3SMSA 3FTFA 4LJAA 1XMQM 2CHQA 4DV4M 4IBCA 3GRUA 1KYIA 1SXJE 1R2ZA 3R9XB 2ZAMA 5GKNA 1T3TA 3T1HM 3KOXE 3KS4A 3J7AS 4JV5M 3K1JA 4XGIA 1NNUC 1IN5A 3U6CA 3SATA 5FTLA 3EIHA 2CV0A 3U6PA 4JN6A 4KLNA 5DYIA 5FSWA 1HNZM 3GLFB 4LJ6A 2R62A 3U61B 2UXBM 4B08A 1JQJC 5ITYA 1QQWA 4PDIA 4FWHA 1C1KA 5A2QS 5EQTA 2P5TA 2K47A 3J27B 3VKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U6D A;  4PDG A;  1J5E M;  5FLX S;  4DV1 M;  4LFA M;  3SAW A;  1K82 A;  4OX9 M;  3VK8 A;  4JI0 M;  3U6O A;  4G4N A;  4DR4 M;  3W0F A;  3J80 S;  1Z5C A;  2ZBK B;  4DR1 M;  5ITT A;  4LFB M;  2UXD M;  4B3R M;  3A46 A;  4JI2 M;  2HKJ A;  1HNX M;  1L1Z A;  3A42 A;  3GQ3 A;  3SAR A;  4LF8 M;  2Q2E B;  1EE8 A;  3U6S A;  4DV5 M;  4DUZ M;  4DV3 M;  1HNW M;  4YHH M;  3GPP A;  2ZM6 M;  2HHH M;  4G4Q A;  3U6E A;  3J81 S;  3JR5 A;  4DR5 M;  3SAU A;  1N33 M;  4LFC M;  5ITR A;  2F5Q A;  2F5P A;  4JI5 M;  1Q39 A;  1Z5B A;  1Q3B A;  4JI4 M;  1Q3C A;  1L2C A;  1K3X A;  1K3W A;  4CIS A;  2UUB M;  3JAM S;  5BR8 M;  4K0K M;  4KHP M;  4NXN M;  2VQE M;  3GPX A;  5IWA M;  4YY3 M;  4ITQ A;  3SBJ A;  1XNR M;  1PJI A;  1MX0 A;  4LF6 M;  2EA0 A;  1TDZ A;  2UU9 M;  4X65 M;  3TWK A;  4GKK M;  3GQ4 A;  1Z59 A;  4G4O A;  1HR0 M;  5LMU M;  1N36 M;  4X64 M;  1TDH A;  4NRV A;  2OQ4 A;  3T1Y M;  4LF9 M;  5ITX E;  3GQ5 A;  4JI3 M;  4AQY M;  1IBM M;  4B3M M;  3SAV A;  1XC8 A;  1NNJ A;  5ITQ A;  1PJJ A;  1I94 M;  3TWM A;  3SAS A;  1MU5 A;  4X66 M;  3VK7 A;  4NXM M;  4DV6 M;  2VQF M;  2XZF A;  2UUA M;  4JI7 M;  4PCZ A;  4DV7 M;  2XZU A;  4DR6 M;  4JI6 M;  4LF7 M;  1N34 M;  3DOA A;  4DR2 M;  1L1T A;  3TWL A;  3U6Q A;  4MB7 A;  5ITU A;  1L2D A;  3GP1 A;  1XMQ M;  2E5L M;  3OTO M;  4JYA M;  5ITX A;  4DV4 M;  4G4R A;  4X62 M;  4DV0 M;  2F5S A;  4PD2 A;  3C58 A;  4B3S M;  4DR3 M;  1R2Z A;  3U6L A;  1L2B A;  1IBL M;  3T1H M;  1KFV A;  3J7A S;  3GPU A;  4JV5 M;  4B3T M;  1N32 M;  1XMO M;  2F5N A;  4JI1 M;  3U6C A;  2OPF A;  3SAT A;  4DV2 M;  2F4V M;  4NRW A;  3U6P A;  3GO8 A;  1HNZ M;  2UXC M;  2UUC M;  1FJG M;  1Z5A A;  3U6M A;  3A45 A;  3JR4 A;  1IBK M;  5LMN M;  4LF4 M;  2UXB M;  5IT9 S;  1PM5 A;  5ITY A;  4PDI A;  4DUY M;  5A2Q S;  2F5O A;  4GKJ M;  4JI8 M;  1R2Y A;  4LF5 M;  1XNQ M;  4DR7 M;  3GPY A; 
#chains in the Genus database with same CATH topology
 4QNM A;  1J5E M;  2EJS A;  3QAU A;  2WZJ A;  3UZU A;  3THG A;  4LGY A;  4GIP A;  4CIZ A;  5JI2 E;  3AL0 C;  4JI0 M;  1NSF A;  3U6O A;  1OFH A;  2DWZ B;  5C1B A;  3R8F A;  4DR4 M;  2MGW A;  2N35 A;  3RE8 A;  1Z5C A;  4MGH A;  3FRH A;  3Q8G A;  2O5R A;  3NBX X;  1QAO A;  2EKF A;  4CJ6 A;  3GLG B;  2JA2 A;  2HKJ A;  2KXE A;  1E32 A;  2M60 A;  2XGN A;  4IBJ A;  3U6S A;  3LCU A;  1IY0 A;  2RGO A;  1ZQ9 A;  4FCT A;  4IJF A;  4DUZ M;  2G3Q A;  1OIP A;  1TF0 B;  4FWG A;  1QDT A;  4TUW A;  1N78 A;  1DGG A;  4LJ9 A;  2DEN A;  1V92 A;  3JR5 A;  3SAU A;  3WHL A;  1G8P A;  2CP8 A;  3KOZ E;  3FYD A;  4IBB A;  4L78 A;  3KSX A;  2F5Q A;  2R18 A;  3FUT A;  1Q39 A;  1Q3B A;  3HX3 A;  2XSZ D;  3K2L A;  4II7 A;  5C18 A;  2C98 A;  1F4I A;  1Q3C A;  3FUV A;  3T6P A;  1L2C A;  3LVW A;  2FS1 A;  2XLJ A;  2UUB M;  3GLH A;  2K6B A;  3C3D A;  4NXN M;  1P3Q Q;  1ZMW A;  1SXJ C;  1QUS A;  3FE3 A;  5JI3 E;  2KHH A;  3W68 A;  4ITQ A;  3B89 A;  4CHT B;  1ZV1 A;  3BXW A;  3TE6 A;  2R4J A;  1TH2 A;  3HHW A;  3FTE A;  1IY2 A;  3W0L B;  3SYL A;  1IN8 A;  4GIT A;  5FTM A;  2Y21 A;  1D0L A;  1NJG A;  1OFI A;  3KW6 A;  4Q7J A;  4F2L A;  1HR0 M;  4LJ5 A;  3PFI A;  1ORY B;  4S12 A;  4Z6Y A;  3ZC7 B;  1QYR A;  5EXX A;  4LF9 M;  4LJ7 A;  3HJ8 A;  2C99 A;  2QBY B;  1GJS A;  5IZ7 D;  1E9R A;  3SAV A;  2APL A;  2J5Y A;  2JY6 B;  3E9S A;  2CHG A;  2Y0Q A;  2V6Z M;  1R7R A;  4RKU F;  1JR3 E;  1UFZ A;  1SXJ D;  1VEK A;  1XXH E;  3LMM A;  2RKO A;  2KA6 B;  4PCZ A;  1IXS A;  4DV7 M;  4MGZ E;  4JI6 M;  1TH3 A;  3HJQ A;  1R6B X;  2VII A;  4GHA A;  3T15 A;  3B7N A;  1HT2 E;  2L09 A;  3HY5 A;  3HU2 A;  1G3I A;  2KW0 A;  3PVS A;  2R45 A;  4MGY E;  2V1C A;  1PJT A;  4R7G A;  3OTO M;  2E5L M;  2G8L A;  2KNV A;  3L28 A;  4PD2 A;  1OQY A;  1QUT A;  4AKI A;  4HEO A;  1TR8 A;  1DO0 A;  4HLQ A;  1IBL M;  1WIV A;  2LTU A;  2G5G X;  4MGI E;  1GLN A;  2K9D A;  2QCU A;  1E9S A;  2DAK A;  4I8O A;  3B74 A;  1DV0 A;  1IN6 A;  2MH8 A;  1DGB A;  2QQ8 A;  2F4V M;  4CGY B;  4NRW A;  4XBO A;  5EXT A;  2DKL A;  2YFQ A;  2XFT A;  3QYE A;  2CV2 A;  1QAQ A;  3GLI E;  3GLI B;  3CGW A;  3JR4 A;  3VDU A;  5LMN M;  5FTK A;  4GHL A;  1PM5 A;  3KS8 A;  3EIE A;  1QVR A;  3U5Z B;  4P16 A;  1SXJ A;  1R2Y A;  4DR7 M;  4K0K M;  2LVP C;  2J7O A;  3U6D A;  2OO9 A;  3FUU A;  3L29 A;  3SAW A;  4BBA A;  1HQC A;  2QHO B;  4G4N A;  4M9S A;  1GKI A;  4P17 A;  3J80 S;  2CE7 A;  3K92 A;  5KPT A;  4M0W A;  4AKH A;  1OAO C;  2CFO A;  2KNA A;  4B3R M;  4JI2 M;  2RGH A;  1HT1 E;  3U61 A;  3I4V A;  4MGK E;  3SAR A;  4AG6 A;  3M7G A;  4L15 A;  4GMQ A;  3CTW B;  3GLF E;  2DVW B;  1TH4 A;  2R0I A;  3FUW A;  4JXJ A;  3QYB A;  2ZM6 M;  3AOE C;  2HHH M;  5FTJ A;  1AUA A;  2HL7 A;  2Z3X A;  3U6E A;  3UK6 A;  1VEG A;  2JY7 A;  1HQY E;  2LH0 A;  5ITR A;  2F5P A;  2W82 A;  4KO8 A;  1AIP C;  4BB9 A;  2HCB A;  2Y20 A;  3KOW E;  2CEA A;  2VF8 A;  4CIS A;  1L8Q A;  1K3W A;  3H4J A;  4D82 A;  1YSY A;  1NV8 A;  5BPV A;  5KQ8 A;  2Z8Y M;  2DWM A;  2DNA A;  4QOS A;  1MJG M;  2R4E A;  3HKP A;  4KHP M;  4IJE A;  4YY3 M;  2R65 A;  2Z7J A;  4WP2 A;  3GLG E;  2BWB A;  5DFL A;  7CAT A;  1PJI A;  3VDP A;  3L2A A;  2WSF F;  4FD2 A;  4KOD A;  2DZO B;  1MX0 A;  4LF6 M;  2EKK A;  1Y8G A;  3J7B A;  4GC5 A;  2JZ0 A;  1G59 A;  2CRU A;  1G4A E;  1DO2 A;  1NV9 A;  4OVZ B;  5EP3 A;  4A3V B;  4B7H A;  1JR3 D;  2UU9 M;  3I51 A;  3GQ4 A;  4GEW A;  4G4O A;  5LMU M;  3KDS E;  1N36 M;  1QDR A;  4X64 M;  4NRV A;  2O01 F;  3T1Y M;  4AKG A;  5ITX E;  2H5X A;  1OKS A;  1WJ7 A;  3CF6 E;  4JI3 M;  1IBM M;  3LW5 F;  1XC8 A;  3L25 A;  2VDB B;  2LVN C;  4QNR A;  2DZN B;  3KVW A;  3I01 M;  4AZF A;  3FD9 A;  1I94 M;  5KPR A;  4LZZ A;  3TWM A;  3SAS A;  1MU5 A;  1OAI A;  3VFD A;  4DV6 M;  1N77 A;  2VQF M;  3TPZ A;  2UUA M;  1DGH B;  1GJT A;  1WHC A;  4QHS A;  1G41 A;  4NOO B;  3LQQ A;  1Z6T A;  3AV0 A;  1N34 M;  2LXE A;  1L1T A;  3TWL A;  3ZCB B;  2DWN A;  2FFJ A;  4JYA M;  1D0M A;  3HWS A;  4G4R A;  1X37 A;  2QP9 X;  5EJC A;  4BLC A;  1NVM A;  4DV0 M;  3I4Y A;  2F5S A;  1QAN A;  4LRT A;  4B3S M;  2ZAO A;  3SHF A;  2I7P A;  2MRO B;  1DGF A;  1RU3 A;  1IN7 A;  2MR9 A;  4G6Z A;  1L2B A;  2DXI A;  3FUX A;  2DHR A;  2JP7 A;  1NHG C;  3AOE A;  4L8R C;  4LRS A;  3T38 A;  1XXH A;  2D7E A;  3FTD A;  1N32 M;  1XMO M;  1IN4 A;  3IG8 A;  3NWL A;  1V34 A;  1PJQ A;  2D7H A;  1IXR C;  2R6F A;  2J7N A;  3H4M A;  3HU1 A;  3KP0 E;  2OPF A;  2Z4S A;  4DV2 M;  3MMP A;  3ZQJ A;  2KEB A;  2XSZ A;  3KSJ A;  5DYG A;  3GO8 A;  3U60 A;  2Y0T A;  1J7K A;  2ZAN A;  3TQS A;  1FJG M;  2UXC M;  1ZMU A;  2FH0 A;  4I81 A;  1Z5A A;  3U6M A;  2YR0 A;  3A45 A;  3C3E A;  4LF4 M;  2RRU A;  4FW9 A;  1GVN A;  3DA1 A;  3E46 A;  4FCV A;  4DUY M;  3M6A A;  2F5O A;  4GKJ M;  4UN2 B;  4LF5 M;  1XNQ M;  3M0E A;  1GL7 A;  4DR2 M;  2FE8 A;  3CF0 A;  4QOZ C;  4LY6 A;  3SMP A;  4PDG A;  5FLX S;  4DV1 M;  4OX9 M;  4IBG A;  1T6O A;  3VK8 A;  3SYK A;  3D8B A;  4IIW A;  1VEJ A;  2BJV A;  3RGP A;  2ZBK B;  3IHP A;  1IXZ A;  1NO1 A;  3AOG A;  4LFB M;  2C96 A;  3A46 A;  4GH9 A;  4I4L A;  3B9P A;  4OU7 A;  1L1Z A;  1J09 A;  3A42 A;  3KOY E;  2FNA A;  4LF8 M;  1FNN A;  4W5W A;  2Q2E B;  1EE8 A;  1TTE A;  3GRY A;  1HNW M;  1IXS B;  1MN3 A;  3GPP A;  2A5Y B;  1WGN A;  2CHV A;  3FRI A;  1HJP A;  2C9O A;  3SC3 A;  4LFC M;  1D0K A;  2JY8 A;  2LBC A;  2ZTD A;  3KXE C;  1JB0 F;  4IBF A;  2LNH C;  2NQ8 C;  1T43 A;  3JAM S;  3HHY A;  2GQF A;  1C7Y A;  2EO2 A;  1VDD A;  5IWA M;  4FVM A;  1IFY A;  4NSR A;  2QPA A;  2BNK A;  3HHX A;  3SBJ A;  1XNR M;  1D2N A;  1YE9 A;  2D7G A;  3RGS A;  5KO3 A;  3GLF A;  2BJW A;  3D8L A;  4D80 A;  2XF3 A;  1Q02 A;  4R3D A;  2V1U A;  1XWI A;  2KRU A;  2EA0 A;  4AI6 A;  1TDZ A;  1CUK A;  2FOI C;  1R5L A;  2MJ5 B;  3F92 A;  2X4A A;  1W5T A;  2QZ4 A;  3C9P A;  2YNM D;  3TWK A;  4X65 M;  4GKK M;  3ZH9 B;  5DNY A;  2M5Z A;  1XHB A;  2WSE F;  3K9O A;  1TDH A;  3RFW A;  3IG5 A;  3A98 B;  5E6J A;  1SXJ B;  3KFU G;  4MH0 E;  4B3M M;  1NNJ A;  3LVV A;  2BWE A;  3HGI A;  4NSO B;  5ITQ A;  3VLF B;  4GRI A;  3GLG A;  1TGU A;  1PJJ A;  3DZD A;  3LQR A;  3PNY A;  4NXM M;  1NY6 A;  2AHM A;  4IBD A;  3DFZ A;  3MHV C;  4B7F A;  3UGJ A;  2QNJ A;  3HJS A;  1I4W A;  4REZ A;  4OVZ A;  8CAT A;  1ZMV A;  5KQD A;  1KSF X;  2XZU A;  4DR6 M;  2LWX A;  3QWL A;  4D81 A;  2XEP A;  1S3S A;  2YQZ A;  4IBE A;  3U6Q A;  4MB7 A;  3I04 M;  5ITU A;  4EIW A;  1L2D A;  3GP1 A;  2R46 A;  5ITX A;  3BOS A;  4X62 M;  2JXN A;  4M9X A;  1H6U A;  3FTC A;  3K9P A;  4FCW A;  5EP4 A;  1PGY A;  3C58 A;  3HHZ A;  4DR3 M;  4QHT A;  3U6L A;  2CV1 A;  1BVS A;  1VG5 A;  1ZAE A;  3SFZ A;  1GL6 A;  4LGM A;  1KFV A;  2JZ1 A;  3GPU A;  1DGH A;  2EUC A;  1WR1 B;  4B3T M;  2JUJ A;  4RF0 A;  2F5N A;  4JI1 M;  3MK6 A;  4FWD A;  3W67 A;  2QEN A;  2DZL A;  4L4U A;  4L6V 6;  5EXP A;  4ANR A;  1IQP A;  2UUC M;  5KPZ A;  4B7G A;  2OOA A;  2L4F A;  1VQ1 A;  3ILK A;  5F3W A;  5IT9 S;  1IBK M;  2K0B X;  4IBI A;  1G71 A;  2LVO C;  4ZPX A;  1E94 E;  2WSC F;  1GO5 A;  4JI8 M;  2B3T A;  4PT5 A;  4AG5 A;  2C5R A;  1W5S A;  3GPY A;  2QBY A;  3PNV A;  4WW0 A;  3WHK A;  2Z4R A;  5E26 A;  2KNZ A;  4LJ4 A;  4LFA M;  1K82 A;  1QZM A;  1VDL A;  3J2P B;  1LTM A;  2CWB A;  4M0D A;  3LCV B;  2KZU A;  2XH9 A;  4G3O A;  1JR3 A;  1A5T A;  3W0F A;  4DR1 M;  3SHG B;  2X8A A;  5FTN A;  1QZE A;  5ITT A;  3GLH E;  3HZJ A;  4IBK A;  2UXD M;  3GLH B;  2DAG A;  2XFS A;  3BBZ A;  1HNX M;  3E21 A;  4RNA A;  3GQ3 A;  5EP1 A;  1WXQ A;  2GNO A;  4DV5 M;  5H37 D;  1PRB A;  4DV3 M;  2DWL A;  3FYC A;  4MM3 B;  4YHH M;  2L7I A;  4LG2 A;  4F1I A;  2X49 A;  4G4Q A;  1NHW C;  4NL4 H;  2DAE A;  3J81 S;  2ERC A;  4DR5 M;  1N33 M;  5EP2 A;  2JY5 A;  1NJF A;  4JI5 M;  3AFH A;  4M9Z A;  1OJL A;  1Z5B A;  5EXS A;  3PXG A;  2L7H A;  4AW4 A;  4RF1 A;  4JI4 M;  3UMM A;  1PJS A;  1N75 A;  1K3X A;  1OTR A;  1SG9 A;  5BR8 M;  2KDL A;  4LJ8 A;  3E4R A;  2KRK A;  2KZS A;  3GRR A;  4NC6 A;  4WUR A;  4XK8 F;  2O25 A;  3GRV A;  2LVQ D;  3GPX A;  2VQE M;  3VKG A;  1EIJ A;  4HL4 A;  1NY5 A;  1XXH B;  2CUZ A;  2LHG A;  1WGL A;  4DBG B;  2I7N A;  1EFU B;  3GLI A;  2DI0 A;  2LVA A;  1UM8 A;  2C9C A;  3U5Z A;  3KP1 E;  1IY1 A;  4Z8X A;  3MJ5 A;  3U60 B;  4LCB A;  3L27 A;  1IM2 A;  2ZTC A;  4GC9 A;  2QSF X;  1Z59 A;  2OQ4 A;  4L16 A;  3HU3 A;  2L6O A;  3GQ5 A;  4AQY M;  3UJN A;  3AJI B;  3K8Z A;  3Q8X A;  1YUB A;  3B7Z A;  4OW0 A;  1GAB A;  2H1R A;  1QAM A;  5IRE B;  3VK7 A;  4X66 M;  4LZJ A;  2HWJ A;  3V76 A;  2LHC A;  3AKZ A;  2XZF A;  3CF2 A;  2JNH A;  1LV7 A;  4I5S A;  4JI7 M;  3TL4 X;  4LF7 M;  3FKE A;  3DOA A;  3IEC A;  1XB2 B;  4R71 A;  3L26 A;  3NBI A;  3SMS A;  3FTF A;  4LJA A;  1XMQ M;  2HAK A;  2CHQ A;  4DV4 M;  4IBC A;  2OOB A;  3GRU A;  2DAI A;  1KYI A;  2VF7 A;  3B7Q A;  1SXJ E;  1R2Z A;  3R9X B;  2L4E A;  2ZAM A;  5GKN A;  4Y28 F;  1V33 A;  1T3T A;  3T1H M;  3KOX E;  3KS4 A;  3J7A S;  4JV5 M;  1R4G A;  3K1J A;  4XGI A;  1NNU C;  5L8R F;  1IN5 A;  2L2D A;  3U6C A;  3SAT A;  5FTL A;  1OIZ A;  3EIH A;  2CV0 A;  3U6P A;  2DAM A;  2DHY A;  4JN6 A;  4KLN A;  5DYI A;  5FSW A;  1HNZ M;  3GLF B;  4LJ6 A;  2R62 A;  4KT0 F;  3U61 B;  2UXB M;  4B08 A;  1JQJ C;  1YLA A;  1QQW A;  2JWS A;  2R44 A;  1C1K A;  4FWH A;  5ITY A;  4PDI A;  5EQT A;  5A2Q S;  2P5T A;  2K47 A;  3J27 B;  3VKH A; 
#chains in the Genus database with same CATH homology
 4QNM A;  1J5E M;  3QAU A;  3UZU A;  5JI2 E;  3THG A;  4LGY A;  4GIP A;  3AL0 C;  4JI0 M;  1NSF A;  3U6O A;  1OFH A;  2DWZ B;  5C1B A;  3R8F A;  4DR4 M;  3RE8 A;  1Z5C A;  4MGH A;  2O5R A;  1QAO A;  3GLG B;  2JA2 A;  2HKJ A;  2KXE A;  1E32 A;  2M60 A;  2XGN A;  4IBJ A;  3U6S A;  1IY0 A;  2RGO A;  1ZQ9 A;  4FCT A;  4IJF A;  4DUZ M;  4FWG A;  4TUW A;  1N78 A;  1DGG A;  4LJ9 A;  3SAU A;  3JR5 A;  3WHL A;  1G8P A;  3KOZ E;  3FYD A;  4IBB A;  4L78 A;  3KSX A;  2F5Q A;  2R18 A;  3FUT A;  1Q39 A;  1Q3B A;  4II7 A;  2XSZ D;  3K2L A;  5C18 A;  2C98 A;  1Q3C A;  3FUV A;  1L2C A;  3LVW A;  2XLJ A;  2UUB M;  3GLH A;  4NXN M;  1SXJ C;  5JI3 E;  4ITQ A;  4CHT B;  3TE6 A;  2R4J A;  1TH2 A;  3HHW A;  3FTE A;  1IY2 A;  3W0L B;  3SYL A;  1IN8 A;  4GIT A;  5FTM A;  2Y21 A;  1NJG A;  1OFI A;  3KW6 A;  1HR0 M;  4LJ5 A;  3PFI A;  1ORY B;  4S12 A;  4Z6Y A;  3ZC7 B;  1QYR A;  5EXX A;  4LF9 M;  4LJ7 A;  3HJ8 A;  2C99 A;  2QBY B;  5IZ7 D;  1E9R A;  3SAV A;  3E9S A;  2CHG A;  2Y0Q A;  2V6Z M;  1R7R A;  1SXJ D;  3LMM A;  2RKO A;  2KA6 B;  4PCZ A;  4DV7 M;  4MGZ E;  4JI6 M;  3HJQ A;  1TH3 A;  1R6B X;  2VII A;  4GHA A;  3T15 A;  1HT2 E;  2L09 A;  3HU2 A;  1G3I A;  2KW0 A;  3PVS A;  2R45 A;  4MGY E;  2V1C A;  4R7G A;  3OTO M;  2E5L M;  2G8L A;  3L28 A;  4PD2 A;  4AKI A;  1DO0 A;  4HLQ A;  1IBL M;  2G5G X;  4MGI E;  1GLN A;  2QCU A;  1E9S A;  4I8O A;  1IN6 A;  1DGB A;  2F4V M;  4CGY B;  4NRW A;  4XBO A;  5EXT A;  2YFQ A;  2XFT A;  2CV2 A;  1QAQ A;  3GLI B;  3JR4 A;  3VDU A;  5LMN M;  5FTK A;  4GHL A;  1PM5 A;  3EIE A;  1QVR A;  3U5Z B;  4P16 A;  1SXJ A;  1R2Y A;  4DR7 M;  2J7O A;  3U6D A;  3FUU A;  3L29 A;  3SAW A;  4BBA A;  1HQC A;  4G4N A;  4M9S A;  1GKI A;  5KPT A;  3J80 S;  2CE7 A;  3K92 A;  4M0W A;  4AKH A;  2CFO A;  4B3R M;  4JI2 M;  2RGH A;  1HT1 E;  3U61 A;  3I4V A;  4MGK E;  3SAR A;  4AG6 A;  3M7G A;  4L15 A;  4GMQ A;  3CTW B;  2DVW B;  1TH4 A;  3FUW A;  4JXJ A;  2ZM6 M;  3AOE C;  2HHH M;  5FTJ A;  2Z3X A;  2HL7 A;  3U6E A;  3UK6 A;  1HQY E;  2LH0 A;  5ITR A;  2F5P A;  2W82 A;  4KO8 A;  4BB9 A;  2HCB A;  2Y20 A;  3KOW E;  2CEA A;  4CIS A;  1L8Q A;  1K3W A;  4D82 A;  5KQ8 A;  1YSY A;  5BPV A;  2DWM A;  4KHP M;  4QOS A;  2R4E A;  3HKP A;  4IJE A;  4YY3 M;  2R65 A;  2Z7J A;  7CAT A;  1PJI A;  3VDP A;  3L2A A;  4FD2 A;  4KOD A;  2DZO B;  1MX0 A;  4LF6 M;  4GC5 A;  3J7B A;  1G59 A;  1G4A E;  1DO2 A;  4OVZ B;  5EP3 A;  4A3V B;  4B7H A;  1JR3 D;  2UU9 M;  3I51 A;  3GQ4 A;  4G4O A;  5LMU M;  3KDS E;  1N36 M;  4X64 M;  4NRV A;  3T1Y M;  4AKG A;  5ITX E;  3CF6 E;  4JI3 M;  1IBM M;  1XC8 A;  3L25 A;  4QNR A;  2DZN B;  3KVW A;  4AZF A;  3FD9 A;  1I94 M;  5KPR A;  4LZZ A;  3TWM A;  3SAS A;  1MU5 A;  3VFD A;  4DV6 M;  2VQF M;  3TPZ A;  2UUA M;  1DGH B;  4QHS A;  1G41 A;  4NOO B;  3LQQ A;  1Z6T A;  3AV0 A;  1N34 M;  2LXE A;  1L1T A;  3TWL A;  3ZCB B;  2DWN A;  2FFJ A;  4JYA M;  3HWS A;  4G4R A;  1X37 A;  2QP9 X;  5EJC A;  4BLC A;  1NVM A;  4DV0 M;  3I4Y A;  2F5S A;  1QAN A;  4LRT A;  4B3S M;  2ZAO A;  3SHF A;  2I7P A;  1DGF A;  1L2B A;  1IN7 A;  4G6Z A;  2DXI A;  3FUX A;  2DHR A;  1NHG C;  3AOE A;  4L8R C;  4LRS A;  3T38 A;  1XXH A;  2D7E A;  3FTD A;  1N32 M;  1XMO M;  1IN4 A;  3IG8 A;  3NWL A;  2D7H A;  3KS8 A;  1IXR C;  3H4M A;  2J7N A;  3HU1 A;  3KP0 E;  2OPF A;  2Z4S A;  4DV2 M;  2KEB A;  2XSZ A;  3KSJ A;  5DYG A;  3GO8 A;  3U60 A;  2Y0T A;  1J7K A;  2ZAN A;  3TQS A;  1FJG M;  2UXC M;  4I81 A;  1Z5A A;  3U6M A;  2YR0 A;  3A45 A;  4LF4 M;  4FW9 A;  1GVN A;  3DA1 A;  4FCV A;  4DUY M;  3M6A A;  2F5O A;  4GKJ M;  4LF5 M;  1XNQ M;  3M0E A;  1GL7 A;  4DR2 M;  2FE8 A;  3CF0 A;  4QOZ C;  4LY6 A;  3SMP A;  4PDG A;  5FLX S;  4DV1 M;  4OX9 M;  4IBG A;  3VK8 A;  3SYK A;  3D8B A;  4IIW A;  2BJV A;  3RGP A;  2ZBK B;  1IXZ A;  3AOG A;  4LFB M;  2C96 A;  3A46 A;  4GH9 A;  4I4L A;  3B9P A;  4OU7 A;  1L1Z A;  1J09 A;  3A42 A;  3KOY E;  2FNA A;  4LF8 M;  1FNN A;  4W5W A;  2Q2E B;  1EE8 A;  3GRY A;  1HNW M;  1IXS B;  3GPP A;  2A5Y B;  2CHV A;  2C9O A;  3SC3 A;  4LFC M;  3KXE C;  4IBF A;  2LNH C;  2NQ8 C;  3JAM S;  3HHY A;  2EO2 A;  1VDD A;  5IWA M;  4FVM A;  4NSR A;  2QPA A;  2BNK A;  3HHX A;  3SBJ A;  1XNR M;  1D2N A;  1YE9 A;  2D7G A;  3RGS A;  5KO3 A;  3GLF A;  2BJW A;  3D8L A;  4D80 A;  2XF3 A;  4R3D A;  2V1U A;  1XWI A;  2KRU A;  2EA0 A;  4AI6 A;  1TDZ A;  2FOI C;  2X4A A;  1W5T A;  2QZ4 A;  3TWK A;  2YNM D;  4X65 M;  4GKK M;  3ZH9 B;  5DNY A;  2M5Z A;  1XHB A;  1TDH A;  3RFW A;  3IG5 A;  3A98 B;  5E6J A;  1SXJ B;  3KFU G;  4MH0 E;  4B3M M;  1NNJ A;  3LVV A;  3HGI A;  4NSO B;  5ITQ A;  3VLF B;  4GRI A;  3GLG A;  1TGU A;  1PJJ A;  3DZD A;  3LQR A;  3PNY A;  4NXM M;  1NY6 A;  2AHM A;  4IBD A;  3DFZ A;  3MHV C;  4B7F A;  3UGJ A;  3HJS A;  1I4W A;  4REZ A;  4OVZ A;  8CAT A;  5KQD A;  1KSF X;  2XZU A;  4DR6 M;  2LWX A;  3QWL A;  4D81 A;  2XEP A;  1S3S A;  2YQZ A;  4IBE A;  3U6Q A;  4MB7 A;  5ITU A;  4EIW A;  1L2D A;  3GP1 A;  2R46 A;  5ITX A;  3BOS A;  4X62 M;  4M9X A;  1H6U A;  3FTC A;  4FCW A;  5EP4 A;  3C58 A;  3HHZ A;  4DR3 M;  4QHT A;  3U6L A;  2CV1 A;  1ZAE A;  3SFZ A;  1GL6 A;  4LGM A;  1KFV A;  3GPU A;  1DGH A;  2EUC A;  4B3T M;  2F5N A;  4RF0 A;  4JI1 M;  3MK6 A;  4FWD A;  2QEN A;  4L4U A;  5EXP A;  1IQP A;  2UUC M;  5KPZ A;  4B7G A;  3ILK A;  5F3W A;  5IT9 S;  1IBK M;  4IBI A;  4ZPX A;  1E94 E;  4JI8 M;  4PT5 A;  4AG5 A;  2C5R A;  1W5S A;  3GPY A;  2QBY A;  3PNV A;  4WW0 A;  3WHK A;  2Z4R A;  5E26 A;  4LJ4 A;  4LFA M;  1K82 A;  1QZM A;  3J2P B;  4M0D A;  2KZU A;  2XH9 A;  1JR3 A;  3W0F A;  4DR1 M;  3SHG B;  2X8A A;  5FTN A;  5ITT A;  2UXD M;  4IBK A;  3GLH B;  2XFS A;  1HNX M;  4RNA A;  3GQ3 A;  5EP1 A;  1WXQ A;  4DV5 M;  5H37 D;  4DV3 M;  2DWL A;  3FYC A;  4MM3 B;  4YHH M;  2L7I A;  4LG2 A;  2X49 A;  4G4Q A;  1NHW C;  4NL4 H;  3J81 S;  4DR5 M;  2ERC A;  1N33 M;  5EP2 A;  1NJF A;  4JI5 M;  3AFH A;  4M9Z A;  1OJL A;  1Z5B A;  5EXS A;  3PXG A;  2L7H A;  4AW4 A;  4RF1 A;  4JI4 M;  3UMM A;  1N75 A;  1K3X A;  5BR8 M;  1N77 A;  4LJ8 A;  3E4R A;  2KRK A;  2KZS A;  3GRR A;  4WUR A;  4K0K M;  3GRV A;  2VQE M;  3GPX A;  3VKG A;  4HL4 A;  1NY5 A;  1XXH B;  2CUZ A;  2I7N A;  3GLI A;  1UM8 A;  2C9C A;  3U5Z A;  3KP1 E;  1IY1 A;  4Z8X A;  3MJ5 A;  3U60 B;  4LCB A;  3L27 A;  1IM2 A;  4GC9 A;  1Z59 A;  2OQ4 A;  4L16 A;  3HU3 A;  2L6O A;  3GQ5 A;  4AQY M;  3UJN A;  3AJI B;  3K8Z A;  3Q8X A;  1YUB A;  4OW0 A;  2H1R A;  1QAM A;  5IRE B;  3VK7 A;  4X66 M;  4LZJ A;  3AKZ A;  2XZF A;  3CF2 A;  1LV7 A;  4I5S A;  4JI7 M;  3TL4 X;  4LF7 M;  3FKE A;  3DOA A;  3L26 A;  3NBI A;  3SMS A;  3FTF A;  4LJA A;  1XMQ M;  2CHQ A;  4DV4 M;  4IBC A;  3GRU A;  1KYI A;  1SXJ E;  1R2Z A;  3R9X B;  2ZAM A;  5GKN A;  1T3T A;  3T1H M;  3KOX E;  3KS4 A;  3J7A S;  4JV5 M;  3K1J A;  4XGI A;  1NNU C;  1IN5 A;  3U6C A;  3SAT A;  5FTL A;  3EIH A;  2CV0 A;  3U6P A;  4JN6 A;  4KLN A;  5DYI A;  5FSW A;  1HNZ M;  3GLF B;  4LJ6 A;  2R62 A;  3U61 B;  2UXB M;  4B08 A;  1JQJ C;  5ITY A;  1QQW A;  4PDI A;  4FWH A;  1C1K A;  5A2Q S;  5EQT A;  2P5T A;  2K47 A;  3J27 B;  3VKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...