4MB7A

Crystal structure of a viral dna glycosylase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
273
structure length
273
Chain Sequence
VEAPRIRITYEKIRHTKNHRIVSISGPSYKRMNVDLIDYIIRKWWFAGKYIYLMLISSNKPTYVIRTHMMMHGRILVGNQDSPTKRAFMIIQLDNDIVLRWYRSQITLLDPNCLAEIKTNYTICTTRQAIMDSIKLMKYDLSNNRFDYNLFQSHLKNGINIHSSEIITDFLLDQEYFPGVGNILQQEALYDCKILPLKKVQDIDEPMFDCLCNSLKKIIDLLYESYKFRESGKEFGPILRIYRKSLCPLGHKTIRKKIGLRNRMTTWCPVCQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural investigation of a viral ortholog of human NEIL2/3 DNA glycosylases.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Hydrolase
molecule keywords Endonuclease 8-like L720
total genus 87
structure length 273
sequence length 273
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4mb7A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 4mb7A01
5ITUA 3U6PA 4DV1M 4DR6M 4G4RA 3U6LA 4PDGA 1L1TA 1Z59A 4CISA 1Q39A 1L2BA 3SAWA 1I94M 4JI6M 4DV2M 4PD2A 2UUCM 4GKKM 1Z5CA 3VK7A 1HR0M 4DV4M 3TWKA 4JI3M 5A2QS 3GQ5A 5ITRA 5ITXE 5IWAM 4DR3M 1KFVA 1XMOM 4DV5M 4B3MM 1FJGM 4LF9M 4DR5M 4JI4M 2EA0A 1TDZA 2ZBKB 4DUZM 4JI1M 4X64M 2UU9M 1PM5A 1J5EM 3SASA 1L1ZA 4PDIA 1XNQM 3U6OA 4B3SM 4DR4M 1HNXM 4K0KM 3JAMS 3JR4A 1Q3BA 4LF5M 4B3TM 2VQEM 4JI2M 4LFBM 2XZUA 2HHHM 4KHPM 2UXBM 5ITQA 2ZM6M 4ITQA 4LFCM 1EE8A 3J80S 4JYAM 4LF8M 1XNRM 2XZFA 4X65M 1R2YA 1PJIA 3GPXA 3SAUA 1MU5A 5LMUM 3J81S 5ITYA 3TWMA 3U6DA 3SBJA 4YY3M 4GKJM 2F4VM 4JV5M 4MB7A 2VQFM 4DR2M 3SAVA 3DOAA 4LF7M 1N32M 5BR8M 3U6QA 3VK8A 3U6EA 4DV6M 3SATA 3A42A 4G4QA 5FLXS 2UUAM 5IT9S 1IBKM 1Z5AA 4B3RM 3A46A 3GO8A 1IBLM 1L2CA 4YHHM 4NXMM 3JR5A 4JI8M 3GP1A 2Q2EB 2E5LM 4JI7M 4DR7M 2UXCM 4G4OA 5ITTA 3OTOM 3GQ3A 1N33M 4OX9M 4X66M 4X62M 1HNZM 3J7AS 3U6MA 1NNJA 2F5SA 1HNWM 4AQYM 1IBMM 2OPFA 3GPPA 1K3XA 3GPUA 4NRVA 3C58A 4NRWA 3T1YM 2HKJA 5LMNM 1K82A 4LF6M 1MX0A 2F5QA 1TDHA 4JI0M 4JI5M 2F5PA 4DUYM 4LF4M 1PJJA 1XMQM 4DV3M 3U6CA 1R2ZA 4G4NA 3TWLA 3W0FA 3U6SA 2UXDM 4LFAM 3SARA 3T1HM 3GQ4A 4DR1M 1XC8A 2OQ4A 1N36M 1L2DA 3A45A 1K3WA 3GPYA 2F5NA 1Z5BA 5ITXA 4NXNM 4DV0M 2UUBM 1N34M 4PCZA 4DV7M 1Q3CA 2F5OA
chains in the Genus database with same CATH superfamily
1D2NA 1L8QA 2K0BX 4DV1M 1IN7A 1GL7A 1RU3A 2A5YB 4IBJA 2L6OA 1IN8A 4LGYA 2Y0TA 4PDGA 4G4RA 1T3TA 1Z59A 1Q39A 1VEGA 1L2BA 5H37D 1IFYA 1I94M 1EFUB 2CP8A 4DV2M 1AUAA 4BLCA 1X37A 3L2AA 4B7FA 1GJSA 4DV4M 4D80A 4JI3M 2ERCA 4KO8A 3FYCA 1KSFX 3L29A 3T15A 3ZQJA 2CV0A 3AV0A 4M9XA 4R71A 5IWAM 4REZA 2DNAA 1IN4A 3HHZA 1R6BX 1IY2A 4B3MM 2QNJA 1FJGM 3Q8GA 3E4RA 4LF9M 4BB9A 4DR5M 1P3QQ 1UFZA 2FOIC 3RGPA 1TDZA 1WGNA 1DO0A 2CEAA 1YSYA 5DYGA 3GLIB 4JI1M 4GC9A 2J7OA 3NBXX 4CGYB 4X64M 1WR1B 5GKNA 1GO5A 2CHVA 1KYIA 3IG8A 3U6OA 2DI0A 4A3VB 3C9PA 4BBAA 4TUWA 5EXPA 3PNVA 4WURA 1HNXM 4I81A 3KVWA 1OTRA 3FUWA 2G3QA 1IY1A 2DHYA 2JA2A 3CF6E 4F1IA 1UM8A 2H5XA 3K92A 1EE8A 3FTDA 4M9ZA 3SHFA 1TGUA 4XGIA 4LF8M 4G6ZA 2R18A 2JY7A 2XZFA 4FWGA 2ZTDA 2JZ0A 4IBCA 2JXNA 3SAUA 1PJIA 3J81S 1G71A 1TH3A 2CV2A 1J7KA 4JN6A 3WHLA 3TWMA 4M0DA 1NHGC 4W5WA 4JV5M 2XFSA 2VQFM 3FUXA 4IIWA 3T6PA 1IY0A 3THGA 4LF7M 1N32M 2Z4RA 2DAEA 3VK8A 3AOGA 3CF0A 3J7BA 5FTJA 3ZC7B 3UJNA 4L8RC 4KLNA 1PGYA 2UUAM 4IJEA 4KT0F 1D0KA 4B3RM 3ILKA 3K2LA 4R7GA 5KPTA 3A98B 3GO8A 2R62A 1L2CA 1I4WA 1OIPA 1PRBA 2KEBA 3UMMA 3JR5A 1R7RA 2DWMA 2E5LM 1XWIA 3E21A 2O01F 5ITTA 3GLFE 3H4MA 3GQ3A 1SXJE 2KZSA 3FTCA 5KO3A 1E94E 4OX9M 2LH0A 1WGLA 3C3EA 4I8OA 1HNZM 2QQ8A 1NV9A 3HY5A 5EP3A 1MN3A 1S3SA 2AHMA 2N35A 2R0IA 3M6AA 2KXEA 4L16A 2F5OA 3SHGB 1DGHA 3MHVC 2K47A 3HX3A 3C58A 3HHYA 5FTLA 2DXIA 3RE8A 2O5RA 2DZNB 3T1YM 3LVVA 4M9SA 5LMNM 1MX0A 1IQPA 2OOAA 3LCUA 1YUBA 2KRUA 4JI0M 1TTEA 1NY5A 3I04M 5JI2E 3FD9A 1R2ZA 5FTMA 4DV3M 4QOSA 1IM2A 3U6SA 1GVNA 1XXHE 2JP7A 4GITA 3HJSA 3SARA 3U5ZB 1G4AE 2F5NA 1Z5BA 2Y21A 2LVQD 3AL0C 3KOWE 5EP2A 4OVZA 4CIZA 1GLNA 3KDSE 5ITUA 2M60A 4LCBA 2MGWA 1GABA 1N75A 3KFUG 4FWHA 1VDLA 2GNOA 1QDTA 4I4LA 3TL4X 3KOXE 4FWDA 1SXJD 4ANRA 3QYEA 4AG5A 3KSJA 4LJ7A 5KPRA 4NSOB 1WJ7A 3DZDA 2CFOA 3C3DA 3KXEC 4G3OA 3MMPA 3HU3A 1Z5CA 5EXSA 1WHCA 1FNNA 4RF1A 4AKIA 1NJFA 2Z7JA 5ITRA 5ITXE 4MM3B 3B74A 3EIHA 3R9XB 2L09A 1XHBA 2CE7A 2OO9A 1OQYA 3L26A 2HL7A 1L1ZA 2QZ4A 4PDIA 1OFHA 4DR4M 3U61B 2R4EA 3HKPA 4OU7A 3GRVA 4LFBM 3QYBA 3HJQA 1QZEA 1JB0F 1E9SA 2ZM6M 4B7HA 3M0EA 4AKHA 3B7NA 4JYAM 3LQQA 1XNRM 3UGJA 2VF8A 1R2YA 2LNHC 1MU5A 3FUTA 4OW0A 5ITYA 4IBDA 4II7A 3R8FA 4GKJM 3QWLA 4Z6YA 1SXJB 4MB7A 3K9PA 4DR2M 1W5SA 2LHCA 3DOAA 3TPZA 1NSFA 4DV6M 3SATA 4IBIA 3A42A 4G4QA 2CUZA 3SC3A 3V76A 2BJWA 2KHHA 2Z4SA 5FLXS 4LZJA 1TH2A 1IBKM 1ZV1A 1OIZA 4CHTB 4GHLA 3GLGE 3I4VA 4LRTA 4MGYE 2JY8A 2LWXA 5IREB 3ZCBB 4NXMM 1JQJC 1T6OA 1XXHA 4JI8M 4FCTA 2W82A 1IXZA 2RRUA 4JI7M 4P17A 3PFIA 3FTFA 3OTOM 1NJGA 3E9SA 4IBEA 3MK6A 3J27B 3LQRA 1H6UA 1VG5A 4X62M 3KW6A 2CRUA 2FH0A 1PJTA 4LJAA 3W68A 3I4YA 3KS4A 3K8ZA 3FRIA 2FNAA 2F5SA 4AQYM 4LGMA 1IBMM 2KNVA 2OPFA 1LV7A 3QAUA 2V1UA 2LVOC 1IN5A 4KODA 1K3XA 4AG6A 2ZAOA 3D8LA 3PVSA 4NRVA 1N78A 3VKGA 4Z8XA 1AIPC 2HKJA 1IXSA 2JNHA 1QQWA 2G8LA 2WZJA 3KP0E 3L28A 4XBOA 1IN6A 4LY6A 3LW5F 4XK8F 3CF2A 2D7EA 4QHTA 1ZMVA 4PT5A 3GLFB 4MGKE 2J5YA 5C1BA 5IZ7D 2I7NA 3SYLA 2CHGA 3E46A 4LF4M 1PJJA 3HWSA 4FVMA 4QOZC 3FUVA 3PNYA 2DZOB 3TWLA 2UXDM 2FS1A 3GQ4A 1XC8A 2V1CA 2OQ4A 1N36M 1QUTA 5EJCA 4S12A 3L25A 2LHGA 3A45A 2ZAMA 3GPYA 3W67A 3GLFA 2EUCA 2LVPC 2QP9X 2WSFF 4NXNM 1QUSA 2UUBM 4DV7M 1Q3CA 4GH9A 4GC5A 3U6PA 3GLHA 3VDPA 3U6LA 1G3IA 2BJVA 1L1TA 1HQYE 2K6BA 4DBGB 2LVAA 2R46A 3SAWA 2JZ1A 5KQDA 2XSZA 2DVWB 1LTMA 2BNKA 4MGIE 1E32A 2R6FA 2CHQA 2R4JA 3HHWA 4WW0A 3PXGA 2O25A 3J2PB 3B7QA 3VK7A 3GLHE 4FW9A 4GKKM 2D7GA 4WP2A 2I7PA 3GQ5A 2LTUA 2DWZB 3UK6A 1KFVA 4DR3M 5JI3E 3AJIB 1NY6A 4RKUF 3SFZA 1BVSA 4LG2A 1QANA 3HJ8A 4Y28F 2DWLA 2HAKA 2JWSA 3F92A 2UU9M 1PM5A 1J5EM 2EO2A 3HHXA 3SMSA 4D82A 4B3SM 3LVWA 4M0WA 3GLIE 2HWJA 2XFTA 2J7NA 2QCUA 3JAMS 2DAIA 3JR4A 1Q3BA 4B3TM 2NQ8C 1WXQA 1Z6TA 2XZUA 3WHKA 1WIVA 2QENA 2G5GX 4ITQA 4LFCM 3AFHA 2DAMA 2MROB 2R44A 3SYKA 2K9DA 4X65M 4QHSA 4GIPA 4JXJA 2DHRA 2ZTCA 4EIWA 2Z8YM 5EP1A 4L15A 1V33A 3U6DA 2KNZA 2C98A 2F4VM 2QSFX 2Y0QA 3B9PA 1TH4A 3TE6A 1EIJA 1DO2A 4ZPXA 1OJLA 4MGHA 5BR8M 4HEOA 3U6QA 1DGHB 1C1KA 5C18A 1W5TA 1DGBA 2X8AA 3HZJA 3U6EA 4FD2A 4UN2B 2BWEA 2YFQA 1R4GA 3AOEA 3CGWA 2V6ZM 1Z5AA 1NNUC 3A46A 2EJSA 2CWBA 3I01M 3VLFB 1NV8A 2EKKA 2KRKA 4YHHM 3FRHA 2C99A 4HL4A 1QDRA 2APLA 3IHPA 4OVZB 4G4OA 4F2LA 1N33M 4X66M 1HJPA 1QAMA 2DAKA 2DKLA 1Y8GA 3KOYE 3J7AS 1IXRC 3DFZA 3U6MA 4Q7JA 1NNJA 1Q02A 1HNWM 3BXWA 1ORYB 3GPPA 1A5TA 3NWLA 4D81A 3GPUA 5E26A 4FCVA 4LJ8A 4NRWA 1NVMA 2XGNA 1CUKA 4MGZE 3BBZA 1J09A 3CTWB 4LF6M 4RNAA 2Z3XA 2F5QA 1QAOA 5FTNA 2VIIA 3RGSA 2DAGA 3GRRA 3L27A 4NOOB 3GLIA 3KS8A 4JI5M 1VEKA 2F5PA 4LRSA 2P5TA 3IECA 3LMMA 1SG9A 2L4EA 3H4JA 5EXTA 2QPAA 4G4NA 1G59A 3W0FA 3LCVB 4LZZA 2LBCA 3GLGB 4LFAM 2L7IA 3D8BA 4QNMA 3T38A 4DR1M 2LXEA 1L2DA 4LJ5A 4L6V6 2OOBA 1QZMA 2KDLA 2DZLA 5ITXA 2C9OA 4DV0M 4PCZA 5KQ8A 2X4AA 1ZQ9A 1ZMWA 1ZAEA 3FUUA 3B89A 3K1JA 3M7GA 3TQSA 4DR6M 1VDDA 4AW4A 4CISA 1VEJA 2R45A 2EKFA 2Y20A 2CV1A 4JI6M 3Q8XA 1N77A 3FTEA 3MJ5A 4LJ6A 4PD2A 4GHAA 1NHWC 1HR0M 3TWKA 1MJGM 2DWNA 5A2QS 2KW0A 1E9RA 1HT2E 5L8RF 5DYIA 5FSWA 4DV5M 2C5RA 1XMOM 5FTKA 2JUJA 1HT1E 4JI4M 4GMQA 2EA0A 4NC6A 2C96A 4FCWA 2ZBKB 3KSXA 4CJ6A 4DUZM 2MJ5B 3VKHA 3SASA 3HGIA 7CATA 3I51A 3RFWA 3K9OA 1XNQM 3GRYA 4K0KM 1VQ1A 2M5ZA 4QNRA 1GL6A 3U61A 1G8PA 4LF5M 2MH8A 3FYDA 2VQEM 1ZMUA 3DA1A 2L2DA 4IBFA 4JI2M 2VDBB 2HHHM 4KHPM 3U60B 5E6JA 2UXBM 5ITQA 2L7HA 2ZANA 3J80S 1V34A 2RKOA 2RGHA 3NBIA 3GPXA 5LMUM 2XEPA 3SBJA 4YY3M 2WSEF 3BOSA 2H1RA 4IBGA 3U60A 3SAVA 2KNAA 3HU1A 1OAOC 1DGGA 1SXJA 1GKIA 2FFJA 1QVRA 4IBKA 4AZFA 2YNMD 3IG5A 2XLJA 5DNYA 4IBBA 5IT9S 1DV0A 2XH9A 4P16A 3KOZE 5F3WA 2JY6B 4MH0E 1JR3E 2B3TA 1XXHB 3VFDA 3U5ZA 3GRUA 1IBLM 2JY5A 4L4UA 1DGFA 4NL4H 5EXXA 2YR0A 4NSRA 1OAIA 2Q2EB 2GQFA 4B08A 4HLQA 4B7GA 3GP1A 4DR7M 1D0LA 1PJSA 3KP1E 5EQTA 2UXCM 4AKGA 3AOEC 1XB2B 4RF0A 1V92A 3GLGA 1YLAA 3ZH9B 2DENA 2WSCF 1JR3A 3EIEA 4AI6A 1TF0B 1SXJC 1PJQA 4LJ9A 5KPZA 3FKEA 1GJTA 4I5SA 1NO1A 2XSZD 1OFIA 2YQZA 4IJFA 2HCBA 5BPVA 2LVNC 1QYRA 1IXSB 3FE3A 1C7YA 2QBYB 1D0MA 3UZUA 2KZUA 2FE8A 1K82A 8CATA 2MR9A 2L4FA 3HU2A 2C9CA 2X49A 1TDHA 2RGOA 4GRIA 1G41A 1YE9A 2BWBA 2D7HA 3VDUA 3B7ZA 2QHOB 4GEWA 4L78A 1R5LA 4DUYM 2R65A 2QBYA 1F4IA 1QAQA 4R3DA 3U6CA 1XMQM 3W0LB 1HQCA 3T1HM 2KA6B 3SMPA 2VF7A 1TR8A 5DFLA 1OKSA 5EP4A 1K3WA 1T43A 1JR3D 3AKZA 3GLHB 1N34M 4LJ4A 2UUCM 2XF3A
chains in the Genus database with same CATH topology
1D2NA 1L8QA 4DV1M 1IN7A 1GL7A 2A5YB 4IBJA 4LGYA 2L6OA 1IN8A 4G4RA 2Y0TA 4PDGA 1T3TA 1Z59A 1Q39A 1L2BA 5H37D 1I94M 4DV2M 4BLCA 1X37A 3L2AA 4B7FA 4DV4M 4D80A 4JI3M 2ERCA 4KO8A 3FYCA 1KSFX 3L29A 3T15A 2CV0A 3AV0A 4M9XA 5IWAM 4REZA 3HHZA 1IN4A 1R6BX 1IY2A 4B3MM 1FJGM 3E4RA 4LF9M 4BB9A 4DR5M 2FOIC 3RGPA 1TDZA 2CEAA 1DO0A 5DYGA 1YSYA 3GLIB 4JI1M 4GC9A 2J7OA 4CGYB 4X64M 5GKNA 2CHVA 1KYIA 3IG8A 3U6OA 4A3VB 4TUWA 4BBAA 5EXPA 3PNVA 4WURA 1HNXM 4I81A 3KVWA 3FUWA 1IY1A 2JA2A 3CF6E 1UM8A 3K92A 1EE8A 3FTDA 4M9ZA 3SHFA 1TGUA 4XGIA 4LF8M 4G6ZA 2R18A 2CV2A 2XZFA 4FWGA 4IBCA 1PJIA 3SAUA 3J81S 1TH3A 1J7KA 4JN6A 3WHLA 3TWMA 4M0DA 1NHGC 4W5WA 4JV5M 2XFSA 2VQFM 3FUXA 4IIWA 1IY0A 3THGA 4LF7M 1N32M 2Z4RA 3VK8A 3AOGA 3CF0A 3J7BA 5FTJA 3ZC7B 3UJNA 4L8RC 4KLNA 2UUAM 4IJEA 4B3RM 3ILKA 3K2LA 4R7GA 5KPTA 3A98B 3GO8A 2R62A 1L2CA 1I4WA 3UMMA 2KEBA 3JR5A 1R7RA 2DWMA 2E5LM 1XWIA 5ITTA 3H4MA 3GQ3A 1SXJE 2KZSA 3FTCA 5KO3A 1E94E 4OX9M 2LH0A 4I8OA 1HNZM 5EP3A 1S3SA 2AHMA 3M6AA 2KXEA 4L16A 2F5OA 3SHGB 1DGHA 3MHVC 2K47A 3C58A 3HHYA 5FTLA 2DXIA 3RE8A 2DZNB 2O5RA 3T1YM 3LVVA 4M9SA 5LMNM 1MX0A 1IQPA 1YUBA 2KRUA 4JI0M 1NY5A 5JI2E 3FD9A 1R2ZA 5FTMA 4DV3M 4QOSA 1IM2A 3U6SA 1GVNA 4GITA 3HJSA 3SARA 3U5ZB 1G4AE 2F5NA 1Z5BA 2Y21A 3AL0C 3KOWE 5EP2A 4OVZA 1GLNA 3KDSE 5ITUA 2M60A 4LCBA 1N75A 3KFUG 4FWHA 4I4LA 3TL4X 3KOXE 4FWDA 1SXJD 4AG5A 3KSJA 4LJ7A 5KPRA 4NSOB 3DZDA 2CFOA 3KXEC 3HU3A 1Z5CA 5EXSA 1FNNA 4RF1A 4AKIA 1NJFA 2Z7JA 5ITRA 5ITXE 4MM3B 3EIHA 3R9XB 2L09A 1XHBA 2CE7A 3L26A 2HL7A 1L1ZA 2QZ4A 4PDIA 1OFHA 4DR4M 3U61B 2R4EA 3HKPA 4OU7A 3GRVA 4LFBM 3HJQA 1E9SA 2ZM6M 4B7HA 3M0EA 4AKHA 4JYAM 3LQQA 1XNRM 3UGJA 1R2YA 2LNHC 1MU5A 3FUTA 4OW0A 5ITYA 4IBDA 4II7A 3R8FA 4GKJM 3QWLA 4Z6YA 1SXJB 4MB7A 4DR2M 1W5SA 3DOAA 3TPZA 1NSFA 4DV6M 3SATA 4IBIA 3A42A 4G4QA 2CUZA 3SC3A 5FLXS 2BJWA 2Z4SA 4LZJA 1TH2A 1IBKM 4CHTB 4GHLA 3I4VA 4LRTA 4MGYE 5IREB 2LWXA 3ZCBB 4NXMM 1JQJC 4JI8M 1XXHA 4FCTA 2W82A 1IXZA 4JI7M 3PFIA 3FTFA 3OTOM 1NJGA 3E9SA 4IBEA 3MK6A 3J27B 3LQRA 1H6UA 4X62M 3KW6A 4LJAA 3I4YA 3KS4A 3K8ZA 2F5SA 2FNAA 4AQYM 4LGMA 1IBMM 2OPFA 2V1UA 1LV7A 3QAUA 1IN5A 4KODA 1K3XA 4AG6A 2ZAOA 3D8LA 3PVSA 4NRVA 1N78A 3VKGA 4Z8XA 2HKJA 3KP0E 4XBOA 1QQWA 2G8LA 3L28A 1IN6A 4LY6A 3CF2A 2D7EA 4QHTA 4PT5A 3GLFB 4MGKE 5C1BA 5IZ7D 2I7NA 3SYLA 2CHGA 4LF4M 1PJJA 3HWSA 4FVMA 4QOZC 3FUVA 3PNYA 2DZOB 3TWLA 2UXDM 3GQ4A 1XC8A 2V1CA 2OQ4A 1N36M 5EJCA 4S12A 3L25A 3A45A 2ZAMA 3GPYA 3GLFA 2EUCA 4NXNM 2QP9X 2UUBM 4DV7M 1Q3CA 4GH9A 4GC5A 3U6PA 3GLHA 3VDPA 3U6LA 1G3IA 2BJVA 1L1TA 1HQYE 2R46A 3SAWA 5KQDA 2XSZA 2DVWB 4MGIE 2BNKA 1E32A 4WW0A 2CHQA 2R4JA 3HHWA 3PXGA 3J2PB 4GKKM 3VK7A 4FW9A 2D7GA 2I7PA 3GQ5A 2DWZB 3UK6A 1KFVA 4DR3M 5JI3E 3AJIB 1NY6A 3SFZA 4LG2A 1QANA 3HJ8A 2DWLA 2UU9M 1PM5A 1J5EM 2EO2A 3HHXA 3SMSA 4D82A 4B3SM 3LVWA 4M0WA 2XFTA 2J7NA 2QCUA 3JAMS 3JR4A 1Q3BA 4B3TM 2NQ8C 1WXQA 1Z6TA 2XZUA 3WHKA 2QENA 2G5GX 4ITQA 4LFCM 3AFHA 3SYKA 4X65M 4QHSA 4GIPA 4JXJA 2DHRA 4EIWA 5EP1A 4L15A 3U6DA 2C98A 2F4VM 2Y0QA 3B9PA 1TH4A 3TE6A 1DO2A 4ZPXA 1OJLA 4MGHA 5BR8M 3U6QA 1DGHB 1C1KA 5C18A 1W5TA 1DGBA 2X8AA 3U6EA 4FD2A 2YFQA 3AOEA 2V6ZM 1Z5AA 1NNUC 3A46A 3VLFB 2KRKA 4YHHM 2C99A 4HL4A 4OVZB 4G4OA 1N33M 4X66M 1QAMA 3KOYE 3J7AS 1IXRC 3DFZA 3U6MA 1NNJA 1HNWM 1ORYB 3GPPA 3NWLA 4D81A 3GPUA 5E26A 4FCVA 4LJ8A 4NRWA 1NVMA 2XGNA 4MGZE 1J09A 3CTWB 4LF6M 4RNAA 2Z3XA 2F5QA 1QAOA 5FTNA 2VIIA 3RGSA 3L27A 3GRRA 4NOOB 3GLIA 3KS8A 4JI5M 2F5PA 4LRSA 2P5TA 3LMMA 5EXTA 2QPAA 4G4NA 1G59A 3W0FA 4LZZA 3GLGB 4LFAM 2L7IA 3D8BA 4QNMA 3T38A 4DR1M 2LXEA 1L2DA 4LJ5A 1QZMA 5ITXA 2C9OA 4DV0M 4PCZA 5KQ8A 2X4AA 1ZQ9A 1ZAEA 3FUUA 3TQSA 3K1JA 3M7GA 4DR6M 1VDDA 4AW4A 4CISA 2R45A 2Y20A 2CV1A 4JI6M 3Q8XA 1N77A 3FTEA 3MJ5A 4LJ6A 4PD2A 4GHAA 1NHWC 1HR0M 3TWKA 2DWNA 5A2QS 2KW0A 1E9RA 1HT2E 5DYIA 5FSWA 4DV5M 2C5RA 1XMOM 5FTKA 1HT1E 4JI4M 4GMQA 2EA0A 2C96A 4FCWA 2ZBKB 3KSXA 4DUZM 3VKHA 3SASA 3HGIA 7CATA 3I51A 3RFWA 1XNQM 3GRYA 4K0KM 4QNRA 2M5ZA 1GL6A 3U61A 1G8PA 4LF5M 3FYDA 2VQEM 4JI2M 3DA1A 4IBFA 2HHHM 4KHPM 3U60B 5E6JA 2UXBM 5ITQA 2L7HA 2ZANA 3J80S 2RKOA 2RGHA 3NBIA 3GPXA 5LMUM 2XEPA 3SBJA 4YY3M 3BOSA 2H1RA 4IBGA 3U60A 3SAVA 3HU1A 1DGGA 1SXJA 1GKIA 2FFJA 1QVRA 4IBKA 4AZFA 2YNMD 3IG5A 2XLJA 5DNYA 4IBBA 5IT9S 2XH9A 4P16A 3KOZE 5F3WA 4MH0E 1XXHB 3VFDA 3U5ZA 3GRUA 1IBLM 4L4UA 1DGFA 4NL4H 5EXXA 2YR0A 4NSRA 4B08A 2Q2EB 3GP1A 4DR7M 4HLQA 4B7GA 4AKGA 5EQTA 2UXCM 3KP1E 3AOEC 4RF0A 3GLGA 3ZH9B 4AI6A 1JR3A 3EIEA 1SXJC 4LJ9A 5KPZA 3FKEA 4I5SA 2XSZD 2YQZA 1OFIA 4IJFA 2HCBA 5BPVA 2QBYB 1QYRA 1IXSB 3UZUA 2KZUA 2FE8A 1K82A 8CATA 3HU2A 2C9CA 2X49A 1TDHA 2RGOA 4GRIA 1G41A 1YE9A 2D7HA 3VDUA 4L78A 4DUYM 2R65A 2QBYA 1QAQA 4R3DA 3U6CA 1XMQM 3W0LB 1HQCA 3T1HM 2KA6B 3SMPA 5EP4A 1K3WA 1JR3D 3AKZA 3GLHB 1N34M 4LJ4A 2UUCM 2XF3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITU A;  3U6P A;  4DV1 M;  4DR6 M;  4G4R A;  3U6L A;  4PDG A;  1L1T A;  1Z59 A;  4CIS A;  1Q39 A;  1L2B A;  3SAW A;  1I94 M;  4JI6 M;  4DV2 M;  4PD2 A;  2UUC M;  4GKK M;  1Z5C A;  3VK7 A;  1HR0 M;  4DV4 M;  3TWK A;  4JI3 M;  5A2Q S;  3GQ5 A;  5ITR A;  5ITX E;  5IWA M;  4DR3 M;  1KFV A;  1XMO M;  4DV5 M;  4B3M M;  1FJG M;  4LF9 M;  4DR5 M;  4JI4 M;  2EA0 A;  1TDZ A;  2ZBK B;  4DUZ M;  4JI1 M;  4X64 M;  2UU9 M;  1PM5 A;  1J5E M;  3SAS A;  1L1Z A;  4PDI A;  1XNQ M;  3U6O A;  4B3S M;  4DR4 M;  1HNX M;  4K0K M;  3JAM S;  3JR4 A;  1Q3B A;  4LF5 M;  4B3T M;  2VQE M;  4JI2 M;  4LFB M;  2XZU A;  2HHH M;  4KHP M;  2UXB M;  5ITQ A;  2ZM6 M;  4ITQ A;  4LFC M;  1EE8 A;  3J80 S;  4JYA M;  4LF8 M;  1XNR M;  2XZF A;  4X65 M;  1R2Y A;  1PJI A;  3GPX A;  3SAU A;  1MU5 A;  5LMU M;  3J81 S;  5ITY A;  3TWM A;  3U6D A;  3SBJ A;  4YY3 M;  4GKJ M;  2F4V M;  4JV5 M;  4MB7 A;  2VQF M;  4DR2 M;  3SAV A;  3DOA A;  4LF7 M;  1N32 M;  5BR8 M;  3U6Q A;  3VK8 A;  3U6E A;  4DV6 M;  3SAT A;  3A42 A;  4G4Q A;  5FLX S;  2UUA M;  5IT9 S;  1IBK M;  1Z5A A;  4B3R M;  3A46 A;  3GO8 A;  1IBL M;  1L2C A;  4YHH M;  4NXM M;  3JR5 A;  4JI8 M;  3GP1 A;  2Q2E B;  2E5L M;  4JI7 M;  4DR7 M;  2UXC M;  4G4O A;  5ITT A;  3OTO M;  3GQ3 A;  1N33 M;  4OX9 M;  4X66 M;  4X62 M;  1HNZ M;  3J7A S;  3U6M A;  1NNJ A;  2F5S A;  1HNW M;  4AQY M;  1IBM M;  2OPF A;  3GPP A;  1K3X A;  3GPU A;  4NRV A;  3C58 A;  4NRW A;  3T1Y M;  2HKJ A;  5LMN M;  1K82 A;  4LF6 M;  1MX0 A;  2F5Q A;  1TDH A;  4JI0 M;  4JI5 M;  2F5P A;  4DUY M;  4LF4 M;  1PJJ A;  1XMQ M;  4DV3 M;  3U6C A;  1R2Z A;  4G4N A;  3TWL A;  3W0F A;  3U6S A;  2UXD M;  4LFA M;  3SAR A;  3T1H M;  3GQ4 A;  4DR1 M;  1XC8 A;  2OQ4 A;  1N36 M;  1L2D A;  3A45 A;  1K3W A;  3GPY A;  2F5N A;  1Z5B A;  5ITX A;  4NXN M;  4DV0 M;  2UUB M;  1N34 M;  4PCZ A;  4DV7 M;  1Q3C A;  2F5O A; 
#chains in the Genus database with same CATH topology
 1D2N A;  1L8Q A;  2K0B X;  4DV1 M;  1IN7 A;  1GL7 A;  1RU3 A;  2A5Y B;  4IBJ A;  2L6O A;  1IN8 A;  4LGY A;  2Y0T A;  4PDG A;  4G4R A;  1T3T A;  1Z59 A;  1Q39 A;  1VEG A;  1L2B A;  5H37 D;  1IFY A;  1I94 M;  1EFU B;  2CP8 A;  4DV2 M;  1AUA A;  4BLC A;  1X37 A;  3L2A A;  4B7F A;  1GJS A;  4DV4 M;  4D80 A;  4JI3 M;  2ERC A;  4KO8 A;  3FYC A;  1KSF X;  3L29 A;  3T15 A;  3ZQJ A;  2CV0 A;  3AV0 A;  4M9X A;  4R71 A;  5IWA M;  4REZ A;  2DNA A;  1IN4 A;  3HHZ A;  1R6B X;  1IY2 A;  4B3M M;  2QNJ A;  1FJG M;  3Q8G A;  3E4R A;  4LF9 M;  4BB9 A;  4DR5 M;  1P3Q Q;  1UFZ A;  2FOI C;  3RGP A;  1TDZ A;  1WGN A;  1DO0 A;  2CEA A;  1YSY A;  5DYG A;  3GLI B;  4JI1 M;  4GC9 A;  2J7O A;  3NBX X;  4CGY B;  4X64 M;  1WR1 B;  5GKN A;  1GO5 A;  2CHV A;  1KYI A;  3IG8 A;  3U6O A;  2DI0 A;  4A3V B;  3C9P A;  4BBA A;  4TUW A;  5EXP A;  3PNV A;  4WUR A;  1HNX M;  4I81 A;  3KVW A;  1OTR A;  3FUW A;  2G3Q A;  1IY1 A;  2DHY A;  2JA2 A;  3CF6 E;  4F1I A;  1UM8 A;  2H5X A;  3K92 A;  1EE8 A;  3FTD A;  4M9Z A;  3SHF A;  1TGU A;  4XGI A;  4LF8 M;  4G6Z A;  2R18 A;  2JY7 A;  2XZF A;  4FWG A;  2ZTD A;  2JZ0 A;  4IBC A;  2JXN A;  3SAU A;  1PJI A;  3J81 S;  1G71 A;  1TH3 A;  2CV2 A;  1J7K A;  4JN6 A;  3WHL A;  3TWM A;  4M0D A;  1NHG C;  4W5W A;  4JV5 M;  2XFS A;  2VQF M;  3FUX A;  4IIW A;  3T6P A;  1IY0 A;  3THG A;  4LF7 M;  1N32 M;  2Z4R A;  2DAE A;  3VK8 A;  3AOG A;  3CF0 A;  3J7B A;  5FTJ A;  3ZC7 B;  3UJN A;  4L8R C;  4KLN A;  1PGY A;  2UUA M;  4IJE A;  4KT0 F;  1D0K A;  4B3R M;  3ILK A;  3K2L A;  4R7G A;  5KPT A;  3A98 B;  3GO8 A;  2R62 A;  1L2C A;  1I4W A;  1OIP A;  1PRB A;  2KEB A;  3UMM A;  3JR5 A;  1R7R A;  2DWM A;  2E5L M;  1XWI A;  3E21 A;  2O01 F;  5ITT A;  3GLF E;  3H4M A;  3GQ3 A;  1SXJ E;  2KZS A;  3FTC A;  5KO3 A;  1E94 E;  4OX9 M;  2LH0 A;  1WGL A;  3C3E A;  4I8O A;  1HNZ M;  2QQ8 A;  1NV9 A;  3HY5 A;  5EP3 A;  1MN3 A;  1S3S A;  2AHM A;  2N35 A;  2R0I A;  3M6A A;  2KXE A;  4L16 A;  2F5O A;  3SHG B;  1DGH A;  3MHV C;  2K47 A;  3HX3 A;  3C58 A;  3HHY A;  5FTL A;  2DXI A;  3RE8 A;  2O5R A;  2DZN B;  3T1Y M;  3LVV A;  4M9S A;  5LMN M;  1MX0 A;  1IQP A;  2OOA A;  3LCU A;  1YUB A;  2KRU A;  4JI0 M;  1TTE A;  1NY5 A;  3I04 M;  5JI2 E;  3FD9 A;  1R2Z A;  5FTM A;  4DV3 M;  4QOS A;  1IM2 A;  3U6S A;  1GVN A;  1XXH E;  2JP7 A;  4GIT A;  3HJS A;  3SAR A;  3U5Z B;  1G4A E;  2F5N A;  1Z5B A;  2Y21 A;  2LVQ D;  3AL0 C;  3KOW E;  5EP2 A;  4OVZ A;  4CIZ A;  1GLN A;  3KDS E;  5ITU A;  2M60 A;  4LCB A;  2MGW A;  1GAB A;  1N75 A;  3KFU G;  4FWH A;  1VDL A;  2GNO A;  1QDT A;  4I4L A;  3TL4 X;  3KOX E;  4FWD A;  1SXJ D;  4ANR A;  3QYE A;  4AG5 A;  3KSJ A;  4LJ7 A;  5KPR A;  4NSO B;  1WJ7 A;  3DZD A;  2CFO A;  3C3D A;  3KXE C;  4G3O A;  3MMP A;  3HU3 A;  1Z5C A;  5EXS A;  1WHC A;  1FNN A;  4RF1 A;  4AKI A;  1NJF A;  2Z7J A;  5ITR A;  5ITX E;  4MM3 B;  3B74 A;  3EIH A;  3R9X B;  2L09 A;  1XHB A;  2CE7 A;  2OO9 A;  1OQY A;  3L26 A;  2HL7 A;  1L1Z A;  2QZ4 A;  4PDI A;  1OFH A;  4DR4 M;  3U61 B;  2R4E A;  3HKP A;  4OU7 A;  3GRV A;  4LFB M;  3QYB A;  3HJQ A;  1QZE A;  1JB0 F;  1E9S A;  2ZM6 M;  4B7H A;  3M0E A;  4AKH A;  3B7N A;  4JYA M;  3LQQ A;  1XNR M;  3UGJ A;  2VF8 A;  1R2Y A;  2LNH C;  1MU5 A;  3FUT A;  4OW0 A;  5ITY A;  4IBD A;  4II7 A;  3R8F A;  4GKJ M;  3QWL A;  4Z6Y A;  1SXJ B;  4MB7 A;  3K9P A;  4DR2 M;  1W5S A;  2LHC A;  3DOA A;  3TPZ A;  1NSF A;  4DV6 M;  3SAT A;  4IBI A;  3A42 A;  4G4Q A;  2CUZ A;  3SC3 A;  3V76 A;  2BJW A;  2KHH A;  2Z4S A;  5FLX S;  4LZJ A;  1TH2 A;  1IBK M;  1ZV1 A;  1OIZ A;  4CHT B;  4GHL A;  3GLG E;  3I4V A;  4LRT A;  4MGY E;  2JY8 A;  2LWX A;  5IRE B;  3ZCB B;  4NXM M;  1JQJ C;  1T6O A;  1XXH A;  4JI8 M;  4FCT A;  2W82 A;  1IXZ A;  2RRU A;  4JI7 M;  4P17 A;  3PFI A;  3FTF A;  3OTO M;  1NJG A;  3E9S A;  4IBE A;  3MK6 A;  3J27 B;  3LQR A;  1H6U A;  1VG5 A;  4X62 M;  3KW6 A;  2CRU A;  2FH0 A;  1PJT A;  4LJA A;  3W68 A;  3I4Y A;  3KS4 A;  3K8Z A;  3FRI A;  2FNA A;  2F5S A;  4AQY M;  4LGM A;  1IBM M;  2KNV A;  2OPF A;  1LV7 A;  3QAU A;  2V1U A;  2LVO C;  1IN5 A;  4KOD A;  1K3X A;  4AG6 A;  2ZAO A;  3D8L A;  3PVS A;  4NRV A;  1N78 A;  3VKG A;  4Z8X A;  1AIP C;  2HKJ A;  1IXS A;  2JNH A;  1QQW A;  2G8L A;  2WZJ A;  3KP0 E;  3L28 A;  4XBO A;  1IN6 A;  4LY6 A;  3LW5 F;  4XK8 F;  3CF2 A;  2D7E A;  4QHT A;  1ZMV A;  4PT5 A;  3GLF B;  4MGK E;  2J5Y A;  5C1B A;  5IZ7 D;  2I7N A;  3SYL A;  2CHG A;  3E46 A;  4LF4 M;  1PJJ A;  3HWS A;  4FVM A;  4QOZ C;  3FUV A;  3PNY A;  2DZO B;  3TWL A;  2UXD M;  2FS1 A;  3GQ4 A;  1XC8 A;  2V1C A;  2OQ4 A;  1N36 M;  1QUT A;  5EJC A;  4S12 A;  3L25 A;  2LHG A;  3A45 A;  2ZAM A;  3GPY A;  3W67 A;  3GLF A;  2EUC A;  2LVP C;  2QP9 X;  2WSF F;  4NXN M;  1QUS A;  2UUB M;  4DV7 M;  1Q3C A;  4GH9 A;  4GC5 A;  3U6P A;  3GLH A;  3VDP A;  3U6L A;  1G3I A;  2BJV A;  1L1T A;  1HQY E;  2K6B A;  4DBG B;  2LVA A;  2R46 A;  3SAW A;  2JZ1 A;  5KQD A;  2XSZ A;  2DVW B;  1LTM A;  2BNK A;  4MGI E;  1E32 A;  2R6F A;  2CHQ A;  2R4J A;  3HHW A;  4WW0 A;  3PXG A;  2O25 A;  3J2P B;  3B7Q A;  3VK7 A;  3GLH E;  4FW9 A;  4GKK M;  2D7G A;  4WP2 A;  2I7P A;  3GQ5 A;  2LTU A;  2DWZ B;  3UK6 A;  1KFV A;  4DR3 M;  5JI3 E;  3AJI B;  1NY6 A;  4RKU F;  3SFZ A;  1BVS A;  4LG2 A;  1QAN A;  3HJ8 A;  4Y28 F;  2DWL A;  2HAK A;  2JWS A;  3F92 A;  2UU9 M;  1PM5 A;  1J5E M;  2EO2 A;  3HHX A;  3SMS A;  4D82 A;  4B3S M;  3LVW A;  4M0W A;  3GLI E;  2HWJ A;  2XFT A;  2J7N A;  2QCU A;  3JAM S;  2DAI A;  3JR4 A;  1Q3B A;  4B3T M;  2NQ8 C;  1WXQ A;  1Z6T A;  2XZU A;  3WHK A;  1WIV A;  2QEN A;  2G5G X;  4ITQ A;  4LFC M;  3AFH A;  2DAM A;  2MRO B;  2R44 A;  3SYK A;  2K9D A;  4X65 M;  4QHS A;  4GIP A;  4JXJ A;  2DHR A;  2ZTC A;  4EIW A;  2Z8Y M;  5EP1 A;  4L15 A;  1V33 A;  3U6D A;  2KNZ A;  2C98 A;  2F4V M;  2QSF X;  2Y0Q A;  3B9P A;  1TH4 A;  3TE6 A;  1EIJ A;  1DO2 A;  4ZPX A;  1OJL A;  4MGH A;  5BR8 M;  4HEO A;  3U6Q A;  1DGH B;  1C1K A;  5C18 A;  1W5T A;  1DGB A;  2X8A A;  3HZJ A;  3U6E A;  4FD2 A;  4UN2 B;  2BWE A;  2YFQ A;  1R4G A;  3AOE A;  3CGW A;  2V6Z M;  1Z5A A;  1NNU C;  3A46 A;  2EJS A;  2CWB A;  3I01 M;  3VLF B;  1NV8 A;  2EKK A;  2KRK A;  4YHH M;  3FRH A;  2C99 A;  4HL4 A;  1QDR A;  2APL A;  3IHP A;  4OVZ B;  4G4O A;  4F2L A;  1N33 M;  4X66 M;  1HJP A;  1QAM A;  2DAK A;  2DKL A;  1Y8G A;  3KOY E;  3J7A S;  1IXR C;  3DFZ A;  3U6M A;  4Q7J A;  1NNJ A;  1Q02 A;  1HNW M;  3BXW A;  1ORY B;  3GPP A;  1A5T A;  3NWL A;  4D81 A;  3GPU A;  5E26 A;  4FCV A;  4LJ8 A;  4NRW A;  1NVM A;  2XGN A;  1CUK A;  4MGZ E;  3BBZ A;  1J09 A;  3CTW B;  4LF6 M;  4RNA A;  2Z3X A;  2F5Q A;  1QAO A;  5FTN A;  2VII A;  3RGS A;  2DAG A;  3GRR A;  3L27 A;  4NOO B;  3GLI A;  3KS8 A;  4JI5 M;  1VEK A;  2F5P A;  4LRS A;  2P5T A;  3IEC A;  3LMM A;  1SG9 A;  2L4E A;  3H4J A;  5EXT A;  2QPA A;  4G4N A;  1G59 A;  3W0F A;  3LCV B;  4LZZ A;  2LBC A;  3GLG B;  4LFA M;  2L7I A;  3D8B A;  4QNM A;  3T38 A;  4DR1 M;  2LXE A;  1L2D A;  4LJ5 A;  4L6V 6;  2OOB A;  1QZM A;  2KDL A;  2DZL A;  5ITX A;  2C9O A;  4DV0 M;  4PCZ A;  5KQ8 A;  2X4A A;  1ZQ9 A;  1ZMW A;  1ZAE A;  3FUU A;  3B89 A;  3K1J A;  3M7G A;  3TQS A;  4DR6 M;  1VDD A;  4AW4 A;  4CIS A;  1VEJ A;  2R45 A;  2EKF A;  2Y20 A;  2CV1 A;  4JI6 M;  3Q8X A;  1N77 A;  3FTE A;  3MJ5 A;  4LJ6 A;  4PD2 A;  4GHA A;  1NHW C;  1HR0 M;  3TWK A;  1MJG M;  2DWN A;  5A2Q S;  2KW0 A;  1E9R A;  1HT2 E;  5L8R F;  5DYI A;  5FSW A;  4DV5 M;  2C5R A;  1XMO M;  5FTK A;  2JUJ A;  1HT1 E;  4JI4 M;  4GMQ A;  2EA0 A;  4NC6 A;  2C96 A;  4FCW A;  2ZBK B;  3KSX A;  4CJ6 A;  4DUZ M;  2MJ5 B;  3VKH A;  3SAS A;  3HGI A;  7CAT A;  3I51 A;  3RFW A;  3K9O A;  1XNQ M;  3GRY A;  4K0K M;  1VQ1 A;  2M5Z A;  4QNR A;  1GL6 A;  3U61 A;  1G8P A;  4LF5 M;  2MH8 A;  3FYD A;  2VQE M;  1ZMU A;  3DA1 A;  2L2D A;  4IBF A;  4JI2 M;  2VDB B;  2HHH M;  4KHP M;  3U60 B;  5E6J A;  2UXB M;  5ITQ A;  2L7H A;  2ZAN A;  3J80 S;  1V34 A;  2RKO A;  2RGH A;  3NBI A;  3GPX A;  5LMU M;  2XEP A;  3SBJ A;  4YY3 M;  2WSE F;  3BOS A;  2H1R A;  4IBG A;  3U60 A;  3SAV A;  2KNA A;  3HU1 A;  1OAO C;  1DGG A;  1SXJ A;  1GKI A;  2FFJ A;  1QVR A;  4IBK A;  4AZF A;  2YNM D;  3IG5 A;  2XLJ A;  5DNY A;  4IBB A;  5IT9 S;  1DV0 A;  2XH9 A;  4P16 A;  3KOZ E;  5F3W A;  2JY6 B;  4MH0 E;  1JR3 E;  2B3T A;  1XXH B;  3VFD A;  3U5Z A;  3GRU A;  1IBL M;  2JY5 A;  4L4U A;  1DGF A;  4NL4 H;  5EXX A;  2YR0 A;  4NSR A;  1OAI A;  2Q2E B;  2GQF A;  4B08 A;  4HLQ A;  4B7G A;  3GP1 A;  4DR7 M;  1D0L A;  1PJS A;  3KP1 E;  5EQT A;  2UXC M;  4AKG A;  3AOE C;  1XB2 B;  4RF0 A;  1V92 A;  3GLG A;  1YLA A;  3ZH9 B;  2DEN A;  2WSC F;  1JR3 A;  3EIE A;  4AI6 A;  1TF0 B;  1SXJ C;  1PJQ A;  4LJ9 A;  5KPZ A;  3FKE A;  1GJT A;  4I5S A;  1NO1 A;  2XSZ D;  1OFI A;  2YQZ A;  4IJF A;  2HCB A;  5BPV A;  2LVN C;  1QYR A;  1IXS B;  3FE3 A;  1C7Y A;  2QBY B;  1D0M A;  3UZU A;  2KZU A;  2FE8 A;  1K82 A;  8CAT A;  2MR9 A;  2L4F A;  3HU2 A;  2C9C A;  2X49 A;  1TDH A;  2RGO A;  4GRI A;  1G41 A;  1YE9 A;  2BWB A;  2D7H A;  3VDU A;  3B7Z A;  2QHO B;  4GEW A;  4L78 A;  1R5L A;  4DUY M;  2R65 A;  2QBY A;  1F4I A;  1QAQ A;  4R3D A;  3U6C A;  1XMQ M;  3W0L B;  1HQC A;  3T1H M;  2KA6 B;  3SMP A;  2VF7 A;  1TR8 A;  5DFL A;  1OKS A;  5EP4 A;  1K3W A;  1T43 A;  1JR3 D;  3AKZ A;  3GLH B;  1N34 M;  4LJ4 A;  2UUC M;  2XF3 A; 
#chains in the Genus database with same CATH homology
 1D2N A;  1L8Q A;  4DV1 M;  1IN7 A;  1GL7 A;  2A5Y B;  4IBJ A;  4LGY A;  2L6O A;  1IN8 A;  4G4R A;  2Y0T A;  4PDG A;  1T3T A;  1Z59 A;  1Q39 A;  1L2B A;  5H37 D;  1I94 M;  4DV2 M;  4BLC A;  1X37 A;  3L2A A;  4B7F A;  4DV4 M;  4D80 A;  4JI3 M;  2ERC A;  4KO8 A;  3FYC A;  1KSF X;  3L29 A;  3T15 A;  2CV0 A;  3AV0 A;  4M9X A;  5IWA M;  4REZ A;  3HHZ A;  1IN4 A;  1R6B X;  1IY2 A;  4B3M M;  1FJG M;  3E4R A;  4LF9 M;  4BB9 A;  4DR5 M;  2FOI C;  3RGP A;  1TDZ A;  2CEA A;  1DO0 A;  5DYG A;  1YSY A;  3GLI B;  4JI1 M;  4GC9 A;  2J7O A;  4CGY B;  4X64 M;  5GKN A;  2CHV A;  1KYI A;  3IG8 A;  3U6O A;  4A3V B;  4TUW A;  4BBA A;  5EXP A;  3PNV A;  4WUR A;  1HNX M;  4I81 A;  3KVW A;  3FUW A;  1IY1 A;  2JA2 A;  3CF6 E;  1UM8 A;  3K92 A;  1EE8 A;  3FTD A;  4M9Z A;  3SHF A;  1TGU A;  4XGI A;  4LF8 M;  4G6Z A;  2R18 A;  2CV2 A;  2XZF A;  4FWG A;  4IBC A;  1PJI A;  3SAU A;  3J81 S;  1TH3 A;  1J7K A;  4JN6 A;  3WHL A;  3TWM A;  4M0D A;  1NHG C;  4W5W A;  4JV5 M;  2XFS A;  2VQF M;  3FUX A;  4IIW A;  1IY0 A;  3THG A;  4LF7 M;  1N32 M;  2Z4R A;  3VK8 A;  3AOG A;  3CF0 A;  3J7B A;  5FTJ A;  3ZC7 B;  3UJN A;  4L8R C;  4KLN A;  2UUA M;  4IJE A;  4B3R M;  3ILK A;  3K2L A;  4R7G A;  5KPT A;  3A98 B;  3GO8 A;  2R62 A;  1L2C A;  1I4W A;  3UMM A;  2KEB A;  3JR5 A;  1R7R A;  2DWM A;  2E5L M;  1XWI A;  5ITT A;  3H4M A;  3GQ3 A;  1SXJ E;  2KZS A;  3FTC A;  5KO3 A;  1E94 E;  4OX9 M;  2LH0 A;  4I8O A;  1HNZ M;  5EP3 A;  1S3S A;  2AHM A;  3M6A A;  2KXE A;  4L16 A;  2F5O A;  3SHG B;  1DGH A;  3MHV C;  2K47 A;  3C58 A;  3HHY A;  5FTL A;  2DXI A;  3RE8 A;  2DZN B;  2O5R A;  3T1Y M;  3LVV A;  4M9S A;  5LMN M;  1MX0 A;  1IQP A;  1YUB A;  2KRU A;  4JI0 M;  1NY5 A;  5JI2 E;  3FD9 A;  1R2Z A;  5FTM A;  4DV3 M;  4QOS A;  1IM2 A;  3U6S A;  1GVN A;  4GIT A;  3HJS A;  3SAR A;  3U5Z B;  1G4A E;  2F5N A;  1Z5B A;  2Y21 A;  3AL0 C;  3KOW E;  5EP2 A;  4OVZ A;  1GLN A;  3KDS E;  5ITU A;  2M60 A;  4LCB A;  1N75 A;  3KFU G;  4FWH A;  4I4L A;  3TL4 X;  3KOX E;  4FWD A;  1SXJ D;  4AG5 A;  3KSJ A;  4LJ7 A;  5KPR A;  4NSO B;  3DZD A;  2CFO A;  3KXE C;  3HU3 A;  1Z5C A;  5EXS A;  1FNN A;  4RF1 A;  4AKI A;  1NJF A;  2Z7J A;  5ITR A;  5ITX E;  4MM3 B;  3EIH A;  3R9X B;  2L09 A;  1XHB A;  2CE7 A;  3L26 A;  2HL7 A;  1L1Z A;  2QZ4 A;  4PDI A;  1OFH A;  4DR4 M;  3U61 B;  2R4E A;  3HKP A;  4OU7 A;  3GRV A;  4LFB M;  3HJQ A;  1E9S A;  2ZM6 M;  4B7H A;  3M0E A;  4AKH A;  4JYA M;  3LQQ A;  1XNR M;  3UGJ A;  1R2Y A;  2LNH C;  1MU5 A;  3FUT A;  4OW0 A;  5ITY A;  4IBD A;  4II7 A;  3R8F A;  4GKJ M;  3QWL A;  4Z6Y A;  1SXJ B;  4MB7 A;  4DR2 M;  1W5S A;  3DOA A;  3TPZ A;  1NSF A;  4DV6 M;  3SAT A;  4IBI A;  3A42 A;  4G4Q A;  2CUZ A;  3SC3 A;  5FLX S;  2BJW A;  2Z4S A;  4LZJ A;  1TH2 A;  1IBK M;  4CHT B;  4GHL A;  3I4V A;  4LRT A;  4MGY E;  5IRE B;  2LWX A;  3ZCB B;  4NXM M;  1JQJ C;  4JI8 M;  1XXH A;  4FCT A;  2W82 A;  1IXZ A;  4JI7 M;  3PFI A;  3FTF A;  3OTO M;  1NJG A;  3E9S A;  4IBE A;  3MK6 A;  3J27 B;  3LQR A;  1H6U A;  4X62 M;  3KW6 A;  4LJA A;  3I4Y A;  3KS4 A;  3K8Z A;  2F5S A;  2FNA A;  4AQY M;  4LGM A;  1IBM M;  2OPF A;  2V1U A;  1LV7 A;  3QAU A;  1IN5 A;  4KOD A;  1K3X A;  4AG6 A;  2ZAO A;  3D8L A;  3PVS A;  4NRV A;  1N78 A;  3VKG A;  4Z8X A;  2HKJ A;  3KP0 E;  4XBO A;  1QQW A;  2G8L A;  3L28 A;  1IN6 A;  4LY6 A;  3CF2 A;  2D7E A;  4QHT A;  4PT5 A;  3GLF B;  4MGK E;  5C1B A;  5IZ7 D;  2I7N A;  3SYL A;  2CHG A;  4LF4 M;  1PJJ A;  3HWS A;  4FVM A;  4QOZ C;  3FUV A;  3PNY A;  2DZO B;  3TWL A;  2UXD M;  3GQ4 A;  1XC8 A;  2V1C A;  2OQ4 A;  1N36 M;  5EJC A;  4S12 A;  3L25 A;  3A45 A;  2ZAM A;  3GPY A;  3GLF A;  2EUC A;  4NXN M;  2QP9 X;  2UUB M;  4DV7 M;  1Q3C A;  4GH9 A;  4GC5 A;  3U6P A;  3GLH A;  3VDP A;  3U6L A;  1G3I A;  2BJV A;  1L1T A;  1HQY E;  2R46 A;  3SAW A;  5KQD A;  2XSZ A;  2DVW B;  4MGI E;  2BNK A;  1E32 A;  4WW0 A;  2CHQ A;  2R4J A;  3HHW A;  3PXG A;  3J2P B;  4GKK M;  3VK7 A;  4FW9 A;  2D7G A;  2I7P A;  3GQ5 A;  2DWZ B;  3UK6 A;  1KFV A;  4DR3 M;  5JI3 E;  3AJI B;  1NY6 A;  3SFZ A;  4LG2 A;  1QAN A;  3HJ8 A;  2DWL A;  2UU9 M;  1PM5 A;  1J5E M;  2EO2 A;  3HHX A;  3SMS A;  4D82 A;  4B3S M;  3LVW A;  4M0W A;  2XFT A;  2J7N A;  2QCU A;  3JAM S;  3JR4 A;  1Q3B A;  4B3T M;  2NQ8 C;  1WXQ A;  1Z6T A;  2XZU A;  3WHK A;  2QEN A;  2G5G X;  4ITQ A;  4LFC M;  3AFH A;  3SYK A;  4X65 M;  4QHS A;  4GIP A;  4JXJ A;  2DHR A;  4EIW A;  5EP1 A;  4L15 A;  3U6D A;  2C98 A;  2F4V M;  2Y0Q A;  3B9P A;  1TH4 A;  3TE6 A;  1DO2 A;  4ZPX A;  1OJL A;  4MGH A;  5BR8 M;  3U6Q A;  1DGH B;  1C1K A;  5C18 A;  1W5T A;  1DGB A;  2X8A A;  3U6E A;  4FD2 A;  2YFQ A;  3AOE A;  2V6Z M;  1Z5A A;  1NNU C;  3A46 A;  3VLF B;  2KRK A;  4YHH M;  2C99 A;  4HL4 A;  4OVZ B;  4G4O A;  1N33 M;  4X66 M;  1QAM A;  3KOY E;  3J7A S;  1IXR C;  3DFZ A;  3U6M A;  1NNJ A;  1HNW M;  1ORY B;  3GPP A;  3NWL A;  4D81 A;  3GPU A;  5E26 A;  4FCV A;  4LJ8 A;  4NRW A;  1NVM A;  2XGN A;  4MGZ E;  1J09 A;  3CTW B;  4LF6 M;  4RNA A;  2Z3X A;  2F5Q A;  1QAO A;  5FTN A;  2VII A;  3RGS A;  3L27 A;  3GRR A;  4NOO B;  3GLI A;  3KS8 A;  4JI5 M;  2F5P A;  4LRS A;  2P5T A;  3LMM A;  5EXT A;  2QPA A;  4G4N A;  1G59 A;  3W0F A;  4LZZ A;  3GLG B;  4LFA M;  2L7I A;  3D8B A;  4QNM A;  3T38 A;  4DR1 M;  2LXE A;  1L2D A;  4LJ5 A;  1QZM A;  5ITX A;  2C9O A;  4DV0 M;  4PCZ A;  5KQ8 A;  2X4A A;  1ZQ9 A;  1ZAE A;  3FUU A;  3TQS A;  3K1J A;  3M7G A;  4DR6 M;  1VDD A;  4AW4 A;  4CIS A;  2R45 A;  2Y20 A;  2CV1 A;  4JI6 M;  3Q8X A;  1N77 A;  3FTE A;  3MJ5 A;  4LJ6 A;  4PD2 A;  4GHA A;  1NHW C;  1HR0 M;  3TWK A;  2DWN A;  5A2Q S;  2KW0 A;  1E9R A;  1HT2 E;  5DYI A;  5FSW A;  4DV5 M;  2C5R A;  1XMO M;  5FTK A;  1HT1 E;  4JI4 M;  4GMQ A;  2EA0 A;  2C96 A;  4FCW A;  2ZBK B;  3KSX A;  4DUZ M;  3VKH A;  3SAS A;  3HGI A;  7CAT A;  3I51 A;  3RFW A;  1XNQ M;  3GRY A;  4K0K M;  4QNR A;  2M5Z A;  1GL6 A;  3U61 A;  1G8P A;  4LF5 M;  3FYD A;  2VQE M;  4JI2 M;  3DA1 A;  4IBF A;  2HHH M;  4KHP M;  3U60 B;  5E6J A;  2UXB M;  5ITQ A;  2L7H A;  2ZAN A;  3J80 S;  2RKO A;  2RGH A;  3NBI A;  3GPX A;  5LMU M;  2XEP A;  3SBJ A;  4YY3 M;  3BOS A;  2H1R A;  4IBG A;  3U60 A;  3SAV A;  3HU1 A;  1DGG A;  1SXJ A;  1GKI A;  2FFJ A;  1QVR A;  4IBK A;  4AZF A;  2YNM D;  3IG5 A;  2XLJ A;  5DNY A;  4IBB A;  5IT9 S;  2XH9 A;  4P16 A;  3KOZ E;  5F3W A;  4MH0 E;  1XXH B;  3VFD A;  3U5Z A;  3GRU A;  1IBL M;  4L4U A;  1DGF A;  4NL4 H;  5EXX A;  2YR0 A;  4NSR A;  4B08 A;  2Q2E B;  3GP1 A;  4DR7 M;  4HLQ A;  4B7G A;  4AKG A;  5EQT A;  2UXC M;  3KP1 E;  3AOE C;  4RF0 A;  3GLG A;  3ZH9 B;  4AI6 A;  1JR3 A;  3EIE A;  1SXJ C;  4LJ9 A;  5KPZ A;  3FKE A;  4I5S A;  2XSZ D;  2YQZ A;  1OFI A;  4IJF A;  2HCB A;  5BPV A;  2QBY B;  1QYR A;  1IXS B;  3UZU A;  2KZU A;  2FE8 A;  1K82 A;  8CAT A;  3HU2 A;  2C9C A;  2X49 A;  1TDH A;  2RGO A;  4GRI A;  1G41 A;  1YE9 A;  2D7H A;  3VDU A;  4L78 A;  4DUY M;  2R65 A;  2QBY A;  1QAQ A;  4R3D A;  3U6C A;  1XMQ M;  3W0L B;  1HQC A;  3T1H M;  2KA6 B;  3SMP A;  5EP4 A;  1K3W A;  1JR3 D;  3AKZ A;  3GLH B;  1N34 M;  4LJ4 A;  2UUC M;  2XF3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...