4MB7A

Crystal structure of a viral dna glycosylase
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
273
structure length
273
Chain Sequence
b'VEAPRIRITYEKIRHTKNHRIVSISGPSYKRMNVDLIDYIIRKWWFAGKYIYLMLISSNKPTYVIRTHMMMHGRILVGNQDSPTKRAFMIIQLDNDIVLRWYRSQITLLDPNCLAEIKTNYTICTTRQAIMDSIKLMKYDLSNNRFDYNLFQSHLKNGINIHSSEIITDFLLDQEYFPGVGNILQQEALYDCKILPLKKVQDIDEPMFDCLCNSLKKIIDLLYESYKFRESGKEFGPILRIYRKSLCPLGHKTIRKKIGLRNRMTTWCPVCQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endonuclease 8-like L720
publication title Structural investigation of a viral ortholog of human NEIL2/3 DNA glycosylases.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Hydrolase
total genus 87
structure length 273
sequence length 273
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4mb7A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 4mb7A01
1XNQM 3GP1A 3U6EA 1IBMM 1N32M 4B3TM 2UU9M 3JR4A 3JAMS 2F5OA 3T1YM 4DV4M 1IBKM 4DV3M 2UUBM 4NRVA 2VQFM 4LF8M 2XZFA 4PD2A 3U6CA 3A45A 1XC8A 3GQ3A 4DR2M 4JI6M 4DV0M 1FJGM 4B3RM 2ZBKB 1Z59A 4OX9M 5ITXA 4DV7M 1Z5BA 4DR4M 1K82A 2OPFA 4DV5M 4JV5M 1HNXM 1PM5A 4JI1M 5ITRA 1N33M 3SAVA 4DV2M 4JI5M 1Q3BA 3SAWA 5IT9S 1IBLM 5ITQA 4JI7M 4LF5M 4G4RA 4X65M 5LMNM 1I94M 1R2YA 2UUCM 4YY3M 3SBJA 1Q3CA 3U6DA 4DR1M 3A46A 4G4OA 4PDGA 4DR3M 1Z5AA 5FLXS 2XZUA 1XMOM 4JI0M 4DV6M 4X62M 3SATA 3SAUA 3U6OA 4JI4M 3GO8A 3JR5A 1Z5CA 4YHHM 3TWLA 4CISA 4NXNM 4X64M 3J80S 4G4QA 5LMUM 4X66M 3SARA 1R2ZA 2VQEM 1N34M 2HHHM 1PJJA 4JYAM 2UXCM 3W0FA 3J7AS 1PJIA 3OTOM 4JI2M 2UXDM 1L2CA 3GPXA 4B3MM 3U6MA 4NRWA 1L2DA 1MX0A 2F5SA 4DR7M 4LFBM 3TWKA 1EE8A 2E5LM 5IWAM 4DR5M 4LF4M 4LF7M 2ZM6M 3VK8A 4LF9M 1MU5A 2UXBM 4DUYM 4MB7A 5ITYA 4NXMM 3SASA 5ITUA 2HKJA 1J5EM 1L1TA 5ITTA 3J81S 4LF6M 3GPYA 1TDHA 1L2BA 1HNWM 1XNRM 4G4NA 1XMQM 2F5QA 3C58A 4JI8M 4DR6M 2Q2EB 3TWMA 1N36M 4GKJM 3T1HM 4AQYM 2EA0A 1Q39A 4GKKM 2OQ4A 4PCZA 1KFVA 4LFAM 1HR0M 2F5PA 2UUAM 3GPUA 4ITQA 3A42A 5A2QS 4DV1M 1K3XA 4B3SM 4K0KM 4LFCM 1TDZA 3U6SA 3GPPA 2F4VM 4KHPM 1K3WA 1L1ZA 3DOAA 3VK7A 1HNZM 3GQ4A 5BR8M 5ITXE 4JI3M 1NNJA 3U6QA 3U6LA 3U6PA 4DUZM 3GQ5A 2F5NA 4PDIA
chains in the Genus database with same CATH superfamily
4QHTA 3M7GA 1EFUB 3GLGA 2CP8A 3Q8XA 4MGYE 4FVMA 1G59A 2QNJA 3F92A 3GLIE 3KDSE 3U6EA 2QSFX 5DFLA 5EXPA 3AOGA 3PNYA 1G3IA 4IBIA 5BPVA 3FRHA 3JR4A 2ERCA 4M0WA 3AJIB 3MJ5A 2CHVA 1PRBA 4GC5A 2EO2A 1IBKM 4LZJA 1YLAA 1VQ1A 1HQCA 2HL7A 2ZTDA 1T43A 4NRVA 1GL7A 2BNKA 2XFSA 4LRSA 1P3QQ 4MH0E 4LF8M 4F1IA 3U6CA 4DR2M 2ZAMA 4JI6M 3I4VA 3B7QA 3DZDA 1FJGM 1S3SA 1XXHA 3R9XB 3EIEA 2LWXA 2OOBA 3A98B 3K9OA 2LH0A 3GLHA 4DBGB 2JY7A 3TPZA 4I4LA 4GC9A 1PM5A 4QOSA 1WR1B 1R4GA 1C1KA 5DYGA 2DZLA 2KXEA 1DGGA 4I5SA 5KQDA 1R7RA 1SXJB 1TF0B 4LGYA 4G4RA 1GABA 4X65M 4AKHA 2KHHA 3FTEA 1DGHB 1IXZA 2RGHA 4IIWA 3TL4X 1R2YA 3SBJA 2MH8A 4DR1M 1PJQA 2Y0QA 2R62A 3HX3A 1WJ7A 4NOOB 4OW0A 3W67A 3HU3A 2XZUA 3FTDA 4B08A 3TQSA 1XMOM 4X62M 3SATA 2C99A 4NC6A 3SAUA 4LJAA 4GIPA 1R6BX 4JI4M 4CHTB 3JR5A 2FE8A 3Q8GA 2FOIC 4IJEA 4P17A 4MGKE 3D8BA 4AKGA 1VEJA 3SHFA 2KNVA 4WURA 1DO0A 2JZ0A 4BBAA 1TR8A 1XWIA 2WSFF 2VQEM 1R2ZA 2ZTCA 1N34M 2CV1A 3K8ZA 3LMMA 1IXRC 3B7ZA 1JQJC 2Z8YM 4JV5M 2KRKA 1L2CA 5E6JA 3NBXX 1PGYA 4L16A 4NRWA 3KOWE 3UMMA 4DR7M 4CJ6A 4AZFA 3QAUA 1CUKA 3AKZA 4DR5M 3HHZA 3VKHA 2DENA 2MROB 3AV0A 3FUXA 2ZM6M 2QQ8A 1D0KA 3K92A 5ITYA 4NXMM 2KNAA 3SASA 4NL4H 1JR3E 2C98A 3GRVA 1IQPA 1T3TA 3J81S 3E9SA 4LJ9A 2C5RA 4LF6M 4IBGA 3CF2A 1TDHA 2MJ5B 1L2BA 1OQYA 1HNWM 1SXJE 1XNRM 3C9PA 3HHXA 5EP2A 2DWZB 1IM2A 2R0IA 2WSEF 2Q2EB 3C58A 4DR6M 4GKJM 1A5TA 2CUZA 2L6OA 3T1HM 2DHYA 1NY6A 2BWEA 4HLQA 4IBJA 4JXJA 2L7IA 5KQ8A 2YNMD 1GJTA 2D7EA 3FD9A 3U5ZB 2UUAM 4ITQA 2DZNB 3A42A 2VF8A 5EXSA 3BXWA 5E26A 5EQTA 4CIZA 3U6SA 4PT5A 3LQRA 2Z4SA 2VF7A 1W5TA 3UK6A 2I7PA 3HU2A 2CWBA 2KRUA 3HJ8A 3DOAA 1N78A 2VDBB 4WP2A 2LTUA 1F4IA 2Z4RA 4GMQA 1J7KA 2CHQA 3UGJA 2JNHA 3AFHA 2APLA 3AOEC 4DUZM 1K82A 3SYLA 1TH2A 3RGPA 4PDIA 2KNZA 2DWLA 2XLJA 1GVNA 3I04M 1DGFA 1NJFA 1QAOA 3AOEA 1XNQM 3QYBA 1YSYA 3IG5A 3BOSA 1IBMM 1N32M 1XB2B 3J27B 2FH0A 1WXQA 3EIHA 2CE7A 2DNAA 3MHVC 1IFYA 3FE3A 4DV3M 4OVZA 2XZFA 4PD2A 2L7HA 1ZAEA 2DAIA 1XC8A 3GQ3A 4LCBA 3TE6A 4DV0M 4B3RM 3CF6E 4OX9M 1Z59A 2BJVA 1GL6A 3GLFA 2R6FA 2JP7A 2XGNA 3UZUA 1Z5BA 3CTWB 1IXSB 2FNAA 2GNOA 1Y8GA 1IY1A 2JY5A 1NV9A 2DI0A 1HNXM 3AL0C 1NV8A 1VDLA 1GJSA 2G5GX 1N33M 4DV2M 3E46A 1IBLM 4LG2A 3L25A 4R7GA 2HCBA 2DKLA 3IHPA 5FTMA 1WGLA 4AG5A 1BVSA 4GHAA 2Z7JA 1G41A 3A46A 4LJ5A 1NSFA 4G4OA 2DWNA 2LVPC 2FS1A 4DV6M 3HKPA 3PXGA 2LBCA 4MGHA 3GO8A 4NSOB 1ZMWA 2R65A 3DA1A 1V34A 4YHHM 3TWLA 3T15A 3SMSA 4CISA 4B7FA 2XSZA 4X64M 3L2AA 3U60A 4BB9A 4M9SA 1OFIA 3I4YA 3GLGE 2CRUA 2HHHM 1PJJA 4UN2B 3HHYA 1OAOC 2Z3XA 3KW6A 4IJFA 1T6OA 1OIPA 4FCTA 4M9ZA 1VEGA 3U6MA 1IY2A 1MX0A 3HJSA 3VFDA 4TUWA 1EE8A 4KT0F 2KZUA 4CGYB 5IWAM 2NQ8C 3B9PA 2YFQA 4EIWA 2LVOC 4DUYM 3U61A 1E32A 4M9XA 1XXHE 2HAKA 4XGIA 2V1CA 1L1TA 5ITTA 2LHCA 3KFUG 3GLHE 3GPYA 5FTKA 1D0LA 3GRYA 2C9OA 4G4NA 2DVWB 1XMQM 2C96A 1HT2E 3TWMA 1NNUC 4KLNA 1SG9A 3PNVA 4L78A 1N36M 2A5YB 3GRUA 2EA0A 3GRRA 2OQ4A 1DGBA 5GKNA 2LHGA 1Z6TA 4IBDA 4IBFA 1NVMA 3HU1A 4FW9A 1IN6A 4HEOA 5KO3A 2M60A 1NJGA 4I8OA 2XSZD 4K0KM 2D7HA 4LFCM 3T38A 2DAEA 4IBKA 2LXEA 2QBYB 2RRUA 5BR8M 2OO9A 2O25A 5ITXE 1DV0A 1SXJC 3ZC7B 3U6QA 3FRIA 1QUSA 4R3DA 1SXJA 4MM3B 3KP1E 2F5NA 1DGHA 2OOAA 3GP1A 3HZJA 1V92A 4B3TM 2UU9M 3KOZE 3JAMS 3T1YM 4AKIA 4D82A 1MN3A 2QPAA 4DV4M 2H1RA 1VDDA 4GEWA 5KPZA 2DXIA 3NBIA 1NY5A 3CGWA 5DNYA 2KEBA 3L26A 2UUBM 3J7BA 1IN5A 2V6ZM 5H37D 4LJ8A 5KPTA 2L2DA 4OVZB 2JUJA 5F3WA 1MJGM 2EJSA 2ZBKB 2M5ZA 4AG6A 1X37A 4L4UA 4DV7M 3THGA 4DR4M 2DZOB 4IBEA 2OPFA 3FTFA 4GHLA 2FFJA 4JI1M 4R71A 3L28A 3SAVA 2D7GA 3SAWA 4G3OA 2R44A 1QZMA 4JI7M 4LF5M 4I81A 5LMNM 3GLGB 5EXTA 2UUCM 1FNNA 4YY3M 2Y20A 1Q3CA 3RFWA 3VLFB 1W5SA 1IN8A 1N75A 3C3EA 3U6DA 1OAIA 2CV0A 1UM8A 3LQQA 8CATA 4S12A 4QNMA 5FLXS 4JI0M 3KS8A 1D0MA 1QDTA 1NO1A 3U6OA 3M0EA 2JA2A 3W0LB 5C18A 4LJ6A 1ORYB 3H4MA 1D2NA 2MGWA 1NHGC 1ZQ9A 1Q02A 2O01F 4II7A 4NSRA 3I51A 3J80S 1XXHB 3RE8A 2O5RA 3GLHB 5EP3A 5FTLA 3U60B 4Z6YA 4RF1A 1ZMUA 2UXCM 1OJLA 2QHOB 3J7AS 1WGNA 2RGOA 3LW5F 3GLIA 4XK8F 1G8PA 2L4FA 3U5ZA 2JY8A 1PJIA 4JI2M 2UXDM 1G4AE 2LVAA 2AHMA 4L6V6 1L2DA 3K2LA 5IREB 3V76A 2F5SA 2K9DA 1HT1E 4LFBM 2EKKA 3LCUA 5FTJA 3SMPA 2E5LM 3FYCA 5EXXA 1HJPA 3CF0A 2KW0A 2KZSA 4LF7M 5EP1A 4LF9M 2UXBM 4Z8XA 4L8RC 1IY0A 4MB7A 2JXNA 3NWLA 2HKJA 3ILKA 5ITUA 3GLFE 1J5EM 1DO2A 1OKSA 4FWDA 3RGSA 2YR0A 4REZA 4A3VB 4MGZE 2F5QA 2WSCF 1QVRA 2W82A 4AQYM 2HWJA 3PFIA 1AIPC 4JN6A 4GKKM 1YUBA 4PCZA 5JI2E 4FWHA 2DAMA 2R46A 4LFAM 7CATA 4LY6A 1HR0M 2F5PA 3ZQJA 3GPUA 1OIZA 3T6PA 2G3QA 4B7GA 1JB0F 4F2LA 5A2QS 4DV1M 1K3XA 4B3SM 2R4EA 2DAKA 3GPPA 3K1JA 3E4RA 4KHPM 1QDRA 3FUVA 4G6ZA 1NHWC 2WZJA 1L1ZA 1WIVA 1IXSA 1HNZM 4LJ7A 3KOYE 3KXEC 2L09A 3B7NA 3U6LA 2R18A 3M6AA 1H6UA 3HGIA 3GQ5A 1J09A 2C9CA 5EP4A 1KYIA 5C1BA 1V33A 3SYKA 2YQZA 3H4JA 1OTRA 5FSWA 4W5WA 3E21A 3FUTA 1ZV1A 1PJTA 5EJCA 1QUTA 4FWGA 4WW0A 1QQWA 2F5OA 4B7HA 1LV7A 4RF0A 1GO5A 1C7YA 3IECA 1QAMA 3BBZA 2LVNC 3QYEA 5KPRA 2G8LA 3C3DA 3FTCA 2VQFM 2J7NA 3VKGA 3WHKA 1ZMVA 3A45A 1OFHA 1QZEA 1RU3A 2JWSA 4D81A 1XHBA 3SC3A 5ITXA 1JR3A 1VEKA 3KSJA 2J7OA 2RKOA 3FKEA 4DV5M 2QCUA 2EKFA 2CHGA 4LZZA 5ITRA 3KSXA 2DAGA 3MK6A 3UJNA 1Q3BA 4P16A 4JI5M 5IT9S 1QYRA 3LCVB 3MMPA 4GITA 2XH9A 5ITQA 1I94M 2R4JA 2P5TA 3LVWA 1HQYE 4Q7JA 4AI6A 1WHCA 3ZCBB 4RNAA 1TTEA 2LNHC 3SFZA 3I01M 3HJQA 1QANA 2Y0TA 2KA6B 4PDGA 4DR3M 1TH4A 1Z5AA 1VG5A 3QWLA 4L15A 2JY6B 3R8FA 2MR9A 4FD2A 4MGIE 2BJWA 4QHSA 2H5XA 2LVQD 2EUCA 4XBOA 1I4WA 5L8RF 4RKUF 1Z5CA 2DHRA 4IBBA 4KODA 1E94E 2K6BA 1E9RA 3ZH9B 4NXNM 3VDUA 4G4QA 2BWBA 2GQFA 3GLFB 4QNRA 3L27A 5LMUM 3HY5A 4X66M 3SARA 4HL4A 3J2PB 3DFZA 4LGMA 4JYAM 1LTMA 3W0FA 2DWMA 3OTOM 1QAQA 2L4EA 3VDPA 3GPXA 4B3MM 3WHLA 3GLIB 4Y28F 1JR3D 3FUUA 4M0DA 2JZ1A 3TWKA 2QBYA 2K0BX 3B74A 5IZ7D 4FCVA 2ZANA 2XF3A 3W68A 4AW4A 3D8LA 4LF4M 1SXJD 5JI3E 3VK8A 1MU5A 3KS4A 1IN4A 2I7NA 2X49A 4FCWA 3KOXE 1TH3A 3IG8A 3L29A 4LRTA 2XEPA 3FUWA 2QENA 2QP9X 4KO8A 4GRIA 2X4AA 2CV2A 1N77A 3PVSA 4JI8M 1IN7A 3KVWA 2KDLA 2VIIA 2B3TA 3B89A 4QOZC 1PJSA 1Q39A 4LJ4A 4ZPXA 1R5LA 1KFVA 2N35A 3K9PA 2X8AA 4OU7A 1KSFX 4ANRA 2R45A 2ZAOA 1GKIA 4D80A 1YE9A 1AUAA 2K47A 3FYDA 3HHWA 2CEAA 2Y21A 1TDZA 1UFZA 3HWSA 3SHGB 2F4VM 1L8QA 1K3WA 1EIJA 5DYIA 5FTNA 4BLCA 2V1UA 2CFOA 3VK7A 3GQ4A 2XFTA 3KP0E 4IBCA 1E9SA 2QZ4A 1G71A 2J5YA 4JI3M 4GH9A 1NNJA 3U61B 1TGUA 3LVVA 3U6PA 1GLNA
chains in the Genus database with same CATH topology
4QHTA 3M7GA 3GLGA 3Q8XA 4MGYE 4FVMA 1G59A 3KDSE 3U6EA 5EXPA 3AOGA 3PNYA 1G3IA 4IBIA 5BPVA 3JR4A 2ERCA 4M0WA 3AJIB 3MJ5A 2CHVA 4GC5A 2EO2A 1IBKM 4LZJA 2HL7A 1HQCA 4NRVA 1GL7A 2BNKA 2XFSA 4LRSA 4MH0E 4LF8M 3U6CA 4DR2M 2ZAMA 4JI6M 3I4VA 3DZDA 1FJGM 1S3SA 1XXHA 3R9XB 3EIEA 2LWXA 3A98B 2LH0A 3GLHA 3TPZA 4I4LA 4GC9A 1PM5A 4QOSA 1C1KA 5DYGA 2KXEA 1DGGA 4I5SA 5KQDA 1R7RA 1SXJB 4LGYA 4G4RA 4X65M 4AKHA 3FTEA 1DGHB 1IXZA 2RGHA 4IIWA 3TL4X 1R2YA 3SBJA 4DR1M 2Y0QA 2R62A 4NOOB 4OW0A 3HU3A 2XZUA 3FTDA 4B08A 3TQSA 1XMOM 4X62M 3SATA 2C99A 3SAUA 4LJAA 4GIPA 1R6BX 4JI4M 4CHTB 3JR5A 2FE8A 4IJEA 2FOIC 4AKGA 4MGKE 3D8BA 3SHFA 4WURA 1DO0A 4BBAA 1XWIA 1R2ZA 2VQEM 1N34M 2CV1A 3K8ZA 3LMMA 1IXRC 1JQJC 2KRKA 1L2CA 5E6JA 4L16A 4NRWA 3KOWE 3UMMA 4DR7M 4AZFA 3QAUA 3AKZA 4DR5M 3HHZA 3VKHA 3AV0A 3FUXA 2ZM6M 3K92A 5ITYA 4NXMM 3SASA 4NL4H 2C98A 3GRVA 1IQPA 1T3TA 3J81S 3E9SA 4LJ9A 2C5RA 4LF6M 4IBGA 3CF2A 1TDHA 1L2BA 1HNWM 1XNRM 1SXJE 3HHXA 5EP2A 2DWZB 1IM2A 3C58A 4DR6M 2Q2EB 4GKJM 2CUZA 2L6OA 3T1HM 1NY6A 4HLQA 4IBJA 4JXJA 2L7IA 5KQ8A 2YNMD 3U5ZB 2D7EA 3FD9A 2UUAM 4ITQA 2DZNB 3A42A 5EXSA 5E26A 5EQTA 3U6SA 4PT5A 3LQRA 2Z4SA 1W5TA 3UK6A 2I7PA 3HU2A 2KRUA 3HJ8A 1N78A 3DOAA 2Z4RA 4GMQA 1J7KA 2CHQA 3UGJA 3AFHA 3AOEC 4DUZM 1K82A 3SYLA 1TH2A 3RGPA 4PDIA 2DWLA 4LF7M 2XLJA 1GVNA 1XNQM 1DGFA 1NJFA 1QAOA 3AOEA 1YSYA 3IG5A 3BOSA 1IBMM 1N32M 3J27B 1WXQA 3EIHA 2CE7A 3MHVC 4DV3M 4OVZA 2XZFA 4PD2A 2L7HA 1ZAEA 1XC8A 3GQ3A 4LCBA 3TE6A 4DV0M 4B3RM 3CF6E 4OX9M 1Z59A 2BJVA 1GL6A 3GLFA 2XGNA 3UZUA 1Z5BA 3CTWB 1IXSB 2FNAA 4JV5M 1HNXM 1IY1A 3AL0C 2G5GX 1N33M 4DV2M 1IBLM 4LG2A 3L25A 4R7GA 2HCBA 5FTMA 4AG5A 4GHAA 2Z7JA 1G41A 3A46A 4LJ5A 1NSFA 4G4OA 2DWNA 4DV6M 3HKPA 3PXGA 4MGHA 3GO8A 4NSOB 2R65A 3DA1A 4YHHM 3TWLA 3T15A 3SMSA 4CISA 4B7FA 2XSZA 4X64M 3L2AA 3U60A 4BB9A 4M9SA 1OFIA 3I4YA 2HHHM 1PJJA 3HHYA 2Z3XA 3KW6A 4IJFA 4FCTA 4M9ZA 3U6MA 1IY2A 1MX0A 3HJSA 3VFDA 4TUWA 1EE8A 2KZUA 4CGYB 5IWAM 2NQ8C 3B9PA 2YFQA 4EIWA 4DUYM 3U61A 1E32A 4M9XA 4XGIA 2V1CA 1L1TA 5ITTA 3KFUG 3GPYA 5FTKA 3GRYA 2C9OA 4G4NA 2DVWB 1XMQM 2C96A 1HT2E 3TWMA 1NNUC 4KLNA 3PNVA 4L78A 1N36M 2A5YB 3GRUA 2EA0A 3GRRA 2OQ4A 1DGBA 5GKNA 1Z6TA 4IBDA 4IBFA 1NVMA 3HU1A 4FW9A 1IN6A 5KO3A 2M60A 1NJGA 4I8OA 2XSZD 4K0KM 2D7HA 4LFCM 3T38A 4IBKA 2LXEA 2QBYB 5BR8M 5ITXE 1SXJC 3ZC7B 3U6QA 4R3DA 1SXJA 4MM3B 3KP1E 2F5NA 1DGHA 3GP1A 4B3TM 2UU9M 3KOZE 3JAMS 3T1YM 4AKIA 4D82A 2QPAA 4DV4M 2H1RA 1VDDA 5KPZA 2DXIA 3NBIA 1NY5A 5DNYA 2KEBA 3L26A 2UUBM 3J7BA 1IN5A 2V6ZM 5H37D 4LJ8A 5KPTA 4OVZB 5F3WA 4AG6A 2ZBKB 2M5ZA 1X37A 4L4UA 4DV7M 3THGA 4DR4M 2DZOB 4IBEA 2OPFA 3FTFA 4GHLA 2FFJA 4JI1M 3L28A 3SAVA 2D7GA 3SAWA 1QZMA 4JI7M 4LF5M 4I81A 5LMNM 3GLGB 5EXTA 2UUCM 1FNNA 4YY3M 2Y20A 1Q3CA 3RFWA 3VLFB 1W5SA 1IN8A 1N75A 3U6DA 2CV0A 1UM8A 3LQQA 8CATA 4S12A 4QNMA 5FLXS 4JI0M 3KS8A 3U6OA 3M0EA 2JA2A 3W0LB 5C18A 4LJ6A 1ORYB 3H4MA 1D2NA 1NHGC 1ZQ9A 4II7A 4NSRA 3I51A 3J80S 1XXHB 3RE8A 2O5RA 3GLHB 5EP3A 5FTLA 3U60B 4Z6YA 4RF1A 2UXCM 1OJLA 3J7AS 2RGOA 1PJIA 3GLIA 3U5ZA 1G8PA 4JI2M 2UXDM 1G4AE 2AHMA 1L2DA 3K2LA 5IREB 2F5SA 4LFBM 1HT1E 5FTJA 3SMPA 2E5LM 3FYCA 5EXXA 3CF0A 2KW0A 2KZSA 5EP1A 4LF9M 2UXBM 4Z8XA 4L8RC 1IY0A 4MB7A 3NWLA 5ITUA 2HKJA 3ILKA 1J5EM 1DO2A 4FWDA 3RGSA 2YR0A 4REZA 4A3VB 4MGZE 2F5QA 1QVRA 2W82A 4AQYM 3PFIA 4JN6A 4GKKM 1YUBA 4PCZA 5JI2E 4FWHA 4LFAM 2R46A 7CATA 4LY6A 1HR0M 2F5PA 3GPUA 4B7GA 5A2QS 4DV1M 1K3XA 4B3SM 2R4EA 3GPPA 3K1JA 3E4RA 4KHPM 3FUVA 4G6ZA 1NHWC 1L1ZA 1HNZM 4LJ7A 3KOYE 3KXEC 2L09A 3U6LA 2R18A 3M6AA 3HGIA 1H6UA 3GQ5A 1J09A 2C9CA 5EP4A 1KYIA 5C1BA 3SYKA 2YQZA 5FSWA 4W5WA 3FUTA 5EJCA 4FWGA 4WW0A 1QQWA 2F5OA 4B7HA 1LV7A 4RF0A 1QAMA 5KPRA 2G8LA 3FTCA 2VQFM 2J7NA 3VKGA 3WHKA 3A45A 1OFHA 4D81A 1XHBA 3SC3A 5ITXA 1JR3A 3KSJA 2J7OA 2RKOA 3FKEA 4DV5M 2QCUA 5ITRA 2CHGA 4LZZA 3KSXA 3MK6A 3UJNA 4JI5M 1Q3BA 4P16A 5IT9S 1QYRA 4GITA 2XH9A 5ITQA 1I94M 2R4JA 2P5TA 3LVWA 1HQYE 4AI6A 3ZCBB 4RNAA 3SFZA 2LNHC 3HJQA 1QANA 2Y0TA 2KA6B 4PDGA 4DR3M 1TH4A 1Z5AA 4L15A 3QWLA 3R8FA 4FD2A 4MGIE 2BJWA 4QHSA 2EUCA 4XBOA 1I4WA 1Z5CA 2DHRA 4IBBA 4KODA 1E94E 1E9RA 3ZH9B 4NXNM 3VDUA 4G4QA 3GLFB 4QNRA 3L27A 5LMUM 4X66M 3SARA 4HL4A 3J2PB 3DFZA 4LGMA 4JYAM 3W0FA 2DWMA 3OTOM 1QAQA 3GPXA 3VDPA 4B3MM 3WHLA 3GLIB 1JR3D 3FUUA 4M0DA 3TWKA 2QBYA 5IZ7D 4AW4A 4FCVA 2ZANA 2XF3A 4LF4M 3D8LA 1SXJD 5JI3E 3VK8A 1MU5A 3KS4A 1IN4A 2I7NA 2X49A 4FCWA 3KOXE 1TH3A 3IG8A 3L29A 4LRTA 2XEPA 3FUWA 2QENA 2QP9X 4KO8A 4GRIA 2X4AA 2CV2A 1N77A 3PVSA 4JI8M 1IN7A 3KVWA 2VIIA 4QOZC 1Q39A 4LJ4A 4ZPXA 1KFVA 2X8AA 4OU7A 1KSFX 2R45A 2ZAOA 1GKIA 4D80A 1YE9A 3FYDA 2K47A 3HHWA 2CEAA 2Y21A 1TDZA 3HWSA 3SHGB 2F4VM 1L8QA 1K3WA 5DYIA 5FTNA 4BLCA 2V1UA 2CFOA 3VK7A 3GQ4A 2XFTA 3KP0E 4IBCA 1E9SA 2QZ4A 4JI3M 4GH9A 1NNJA 3U61B 1TGUA 3LVVA 3U6PA 1GLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ M;  3GP1 A;  3U6E A;  1IBM M;  1N32 M;  4B3T M;  2UU9 M;  3JR4 A;  3JAM S;  2F5O A;  3T1Y M;  4DV4 M;  1IBK M;  4DV3 M;  2UUB M;  4NRV A;  2VQF M;  4LF8 M;  2XZF A;  4PD2 A;  3U6C A;  3A45 A;  1XC8 A;  3GQ3 A;  4DR2 M;  4JI6 M;  4DV0 M;  1FJG M;  4B3R M;  2ZBK B;  1Z59 A;  4OX9 M;  5ITX A;  4DV7 M;  1Z5B A;  4DR4 M;  1K82 A;  2OPF A;  4DV5 M;  4JV5 M;  1HNX M;  1PM5 A;  4JI1 M;  5ITR A;  1N33 M;  3SAV A;  4DV2 M;  4JI5 M;  1Q3B A;  3SAW A;  5IT9 S;  1IBL M;  5ITQ A;  4JI7 M;  4LF5 M;  4G4R A;  4X65 M;  5LMN M;  1I94 M;  1R2Y A;  2UUC M;  4YY3 M;  3SBJ A;  1Q3C A;  3U6D A;  4DR1 M;  3A46 A;  4G4O A;  4PDG A;  4DR3 M;  1Z5A A;  5FLX S;  2XZU A;  1XMO M;  4JI0 M;  4DV6 M;  4X62 M;  3SAT A;  3SAU A;  3U6O A;  4JI4 M;  3GO8 A;  3JR5 A;  1Z5C A;  4YHH M;  3TWL A;  4CIS A;  4NXN M;  4X64 M;  3J80 S;  4G4Q A;  5LMU M;  4X66 M;  3SAR A;  1R2Z A;  2VQE M;  1N34 M;  2HHH M;  1PJJ A;  4JYA M;  2UXC M;  3W0F A;  3J7A S;  1PJI A;  3OTO M;  4JI2 M;  2UXD M;  1L2C A;  3GPX A;  4B3M M;  3U6M A;  4NRW A;  1L2D A;  1MX0 A;  2F5S A;  4DR7 M;  4LFB M;  3TWK A;  1EE8 A;  2E5L M;  5IWA M;  4DR5 M;  4LF4 M;  4LF7 M;  2ZM6 M;  3VK8 A;  4LF9 M;  1MU5 A;  2UXB M;  4DUY M;  4MB7 A;  5ITY A;  4NXM M;  3SAS A;  5ITU A;  2HKJ A;  1J5E M;  1L1T A;  5ITT A;  3J81 S;  4LF6 M;  3GPY A;  1TDH A;  1L2B A;  1HNW M;  1XNR M;  4G4N A;  1XMQ M;  2F5Q A;  3C58 A;  4JI8 M;  4DR6 M;  2Q2E B;  3TWM A;  1N36 M;  4GKJ M;  3T1H M;  4AQY M;  2EA0 A;  1Q39 A;  4GKK M;  2OQ4 A;  4PCZ A;  1KFV A;  4LFA M;  1HR0 M;  2F5P A;  2UUA M;  3GPU A;  4ITQ A;  3A42 A;  5A2Q S;  4DV1 M;  1K3X A;  4B3S M;  4K0K M;  4LFC M;  1TDZ A;  3U6S A;  3GPP A;  2F4V M;  4KHP M;  1K3W A;  1L1Z A;  3DOA A;  3VK7 A;  1HNZ M;  3GQ4 A;  5BR8 M;  5ITX E;  4JI3 M;  1NNJ A;  3U6Q A;  3U6L A;  3U6P A;  4DUZ M;  3GQ5 A;  2F5N A;  4PDI A; 
#chains in the Genus database with same CATH topology
 4QHT A;  3M7G A;  1EFU B;  3GLG A;  2CP8 A;  3Q8X A;  4MGY E;  4FVM A;  1G59 A;  2QNJ A;  3F92 A;  3GLI E;  3KDS E;  3U6E A;  2QSF X;  5DFL A;  5EXP A;  3AOG A;  3PNY A;  1G3I A;  4IBI A;  5BPV A;  3FRH A;  3JR4 A;  2ERC A;  4M0W A;  3AJI B;  3MJ5 A;  2CHV A;  1PRB A;  4GC5 A;  2EO2 A;  1IBK M;  4LZJ A;  1YLA A;  1VQ1 A;  1HQC A;  2HL7 A;  2ZTD A;  1T43 A;  4NRV A;  1GL7 A;  2BNK A;  2XFS A;  4LRS A;  1P3Q Q;  4MH0 E;  4LF8 M;  4F1I A;  3U6C A;  4DR2 M;  2ZAM A;  4JI6 M;  3I4V A;  3B7Q A;  3DZD A;  1FJG M;  1S3S A;  1XXH A;  3R9X B;  3EIE A;  2LWX A;  2OOB A;  3A98 B;  3K9O A;  2LH0 A;  3GLH A;  4DBG B;  2JY7 A;  3TPZ A;  4I4L A;  4GC9 A;  1PM5 A;  4QOS A;  1WR1 B;  1R4G A;  1C1K A;  5DYG A;  2DZL A;  2KXE A;  1DGG A;  4I5S A;  5KQD A;  1R7R A;  1SXJ B;  1TF0 B;  4LGY A;  4G4R A;  1GAB A;  4X65 M;  4AKH A;  2KHH A;  3FTE A;  1DGH B;  1IXZ A;  2RGH A;  4IIW A;  3TL4 X;  1R2Y A;  3SBJ A;  2MH8 A;  4DR1 M;  1PJQ A;  2Y0Q A;  2R62 A;  3HX3 A;  1WJ7 A;  4NOO B;  4OW0 A;  3W67 A;  3HU3 A;  2XZU A;  3FTD A;  4B08 A;  3TQS A;  1XMO M;  4X62 M;  3SAT A;  2C99 A;  4NC6 A;  3SAU A;  4LJA A;  4GIP A;  1R6B X;  4JI4 M;  4CHT B;  3JR5 A;  2FE8 A;  3Q8G A;  2FOI C;  4IJE A;  4P17 A;  4MGK E;  3D8B A;  4AKG A;  1VEJ A;  3SHF A;  2KNV A;  4WUR A;  1DO0 A;  2JZ0 A;  4BBA A;  1TR8 A;  1XWI A;  2WSF F;  2VQE M;  1R2Z A;  2ZTC A;  1N34 M;  2CV1 A;  3K8Z A;  3LMM A;  1IXR C;  3B7Z A;  1JQJ C;  2Z8Y M;  4JV5 M;  2KRK A;  1L2C A;  5E6J A;  3NBX X;  1PGY A;  4L16 A;  4NRW A;  3KOW E;  3UMM A;  4DR7 M;  4CJ6 A;  4AZF A;  3QAU A;  1CUK A;  3AKZ A;  4DR5 M;  3HHZ A;  3VKH A;  2DEN A;  2MRO B;  3AV0 A;  3FUX A;  2ZM6 M;  2QQ8 A;  1D0K A;  3K92 A;  5ITY A;  4NXM M;  2KNA A;  3SAS A;  4NL4 H;  1JR3 E;  2C98 A;  3GRV A;  1IQP A;  1T3T A;  3J81 S;  3E9S A;  4LJ9 A;  2C5R A;  4LF6 M;  4IBG A;  3CF2 A;  1TDH A;  2MJ5 B;  1L2B A;  1OQY A;  1HNW M;  1SXJ E;  1XNR M;  3C9P A;  3HHX A;  5EP2 A;  2DWZ B;  1IM2 A;  2R0I A;  2WSE F;  2Q2E B;  3C58 A;  4DR6 M;  4GKJ M;  1A5T A;  2CUZ A;  2L6O A;  3T1H M;  2DHY A;  1NY6 A;  2BWE A;  4HLQ A;  4IBJ A;  4JXJ A;  2L7I A;  5KQ8 A;  2YNM D;  1GJT A;  2D7E A;  3FD9 A;  3U5Z B;  2UUA M;  4ITQ A;  2DZN B;  3A42 A;  2VF8 A;  5EXS A;  3BXW A;  5E26 A;  5EQT A;  4CIZ A;  3U6S A;  4PT5 A;  3LQR A;  2Z4S A;  2VF7 A;  1W5T A;  3UK6 A;  2I7P A;  3HU2 A;  2CWB A;  2KRU A;  3HJ8 A;  3DOA A;  1N78 A;  2VDB B;  4WP2 A;  2LTU A;  1F4I A;  2Z4R A;  4GMQ A;  1J7K A;  2CHQ A;  3UGJ A;  2JNH A;  3AFH A;  2APL A;  3AOE C;  4DUZ M;  1K82 A;  3SYL A;  1TH2 A;  3RGP A;  4PDI A;  2KNZ A;  2DWL A;  2XLJ A;  1GVN A;  3I04 M;  1DGF A;  1NJF A;  1QAO A;  3AOE A;  1XNQ M;  3QYB A;  1YSY A;  3IG5 A;  3BOS A;  1IBM M;  1N32 M;  1XB2 B;  3J27 B;  2FH0 A;  1WXQ A;  3EIH A;  2CE7 A;  2DNA A;  3MHV C;  1IFY A;  3FE3 A;  4DV3 M;  4OVZ A;  2XZF A;  4PD2 A;  2L7H A;  1ZAE A;  2DAI A;  1XC8 A;  3GQ3 A;  4LCB A;  3TE6 A;  4DV0 M;  4B3R M;  3CF6 E;  4OX9 M;  1Z59 A;  2BJV A;  1GL6 A;  3GLF A;  2R6F A;  2JP7 A;  2XGN A;  3UZU A;  1Z5B A;  3CTW B;  1IXS B;  2FNA A;  2GNO A;  1Y8G A;  1IY1 A;  2JY5 A;  1NV9 A;  2DI0 A;  1HNX M;  3AL0 C;  1NV8 A;  1VDL A;  1GJS A;  2G5G X;  1N33 M;  4DV2 M;  3E46 A;  1IBL M;  4LG2 A;  3L25 A;  4R7G A;  2HCB A;  2DKL A;  3IHP A;  5FTM A;  1WGL A;  4AG5 A;  1BVS A;  4GHA A;  2Z7J A;  1G41 A;  3A46 A;  4LJ5 A;  1NSF A;  4G4O A;  2DWN A;  2LVP C;  2FS1 A;  4DV6 M;  3HKP A;  3PXG A;  2LBC A;  4MGH A;  3GO8 A;  4NSO B;  1ZMW A;  2R65 A;  3DA1 A;  1V34 A;  4YHH M;  3TWL A;  3T15 A;  3SMS A;  4CIS A;  4B7F A;  2XSZ A;  4X64 M;  3L2A A;  3U60 A;  4BB9 A;  4M9S A;  1OFI A;  3I4Y A;  3GLG E;  2CRU A;  2HHH M;  1PJJ A;  4UN2 B;  3HHY A;  1OAO C;  2Z3X A;  3KW6 A;  4IJF A;  1T6O A;  1OIP A;  4FCT A;  4M9Z A;  1VEG A;  3U6M A;  1IY2 A;  1MX0 A;  3HJS A;  3VFD A;  4TUW A;  1EE8 A;  4KT0 F;  2KZU A;  4CGY B;  5IWA M;  2NQ8 C;  3B9P A;  2YFQ A;  4EIW A;  2LVO C;  4DUY M;  3U61 A;  1E32 A;  4M9X A;  1XXH E;  2HAK A;  4XGI A;  2V1C A;  1L1T A;  5ITT A;  2LHC A;  3KFU G;  3GLH E;  3GPY A;  5FTK A;  1D0L A;  3GRY A;  2C9O A;  4G4N A;  2DVW B;  1XMQ M;  2C96 A;  1HT2 E;  3TWM A;  1NNU C;  4KLN A;  1SG9 A;  3PNV A;  4L78 A;  1N36 M;  2A5Y B;  3GRU A;  2EA0 A;  3GRR A;  2OQ4 A;  1DGB A;  5GKN A;  2LHG A;  1Z6T A;  4IBD A;  4IBF A;  1NVM A;  3HU1 A;  4FW9 A;  1IN6 A;  4HEO A;  5KO3 A;  2M60 A;  1NJG A;  4I8O A;  2XSZ D;  4K0K M;  2D7H A;  4LFC M;  3T38 A;  2DAE A;  4IBK A;  2LXE A;  2QBY B;  2RRU A;  5BR8 M;  2OO9 A;  2O25 A;  5ITX E;  1DV0 A;  1SXJ C;  3ZC7 B;  3U6Q A;  3FRI A;  1QUS A;  4R3D A;  1SXJ A;  4MM3 B;  3KP1 E;  2F5N A;  1DGH A;  2OOA A;  3GP1 A;  3HZJ A;  1V92 A;  4B3T M;  2UU9 M;  3KOZ E;  3JAM S;  3T1Y M;  4AKI A;  4D82 A;  1MN3 A;  2QPA A;  4DV4 M;  2H1R A;  1VDD A;  4GEW A;  5KPZ A;  2DXI A;  3NBI A;  1NY5 A;  3CGW A;  5DNY A;  2KEB A;  3L26 A;  2UUB M;  3J7B A;  1IN5 A;  2V6Z M;  5H37 D;  4LJ8 A;  5KPT A;  2L2D A;  4OVZ B;  2JUJ A;  5F3W A;  1MJG M;  2EJS A;  2ZBK B;  2M5Z A;  4AG6 A;  1X37 A;  4L4U A;  4DV7 M;  3THG A;  4DR4 M;  2DZO B;  4IBE A;  2OPF A;  3FTF A;  4GHL A;  2FFJ A;  4JI1 M;  4R71 A;  3L28 A;  3SAV A;  2D7G A;  3SAW A;  4G3O A;  2R44 A;  1QZM A;  4JI7 M;  4LF5 M;  4I81 A;  5LMN M;  3GLG B;  5EXT A;  2UUC M;  1FNN A;  4YY3 M;  2Y20 A;  1Q3C A;  3RFW A;  3VLF B;  1W5S A;  1IN8 A;  1N75 A;  3C3E A;  3U6D A;  1OAI A;  2CV0 A;  1UM8 A;  3LQQ A;  8CAT A;  4S12 A;  4QNM A;  5FLX S;  4JI0 M;  3KS8 A;  1D0M A;  1QDT A;  1NO1 A;  3U6O A;  3M0E A;  2JA2 A;  3W0L B;  5C18 A;  4LJ6 A;  1ORY B;  3H4M A;  1D2N A;  2MGW A;  1NHG C;  1ZQ9 A;  1Q02 A;  2O01 F;  4II7 A;  4NSR A;  3I51 A;  3J80 S;  1XXH B;  3RE8 A;  2O5R A;  3GLH B;  5EP3 A;  5FTL A;  3U60 B;  4Z6Y A;  4RF1 A;  1ZMU A;  2UXC M;  1OJL A;  2QHO B;  3J7A S;  1WGN A;  2RGO A;  3LW5 F;  3GLI A;  4XK8 F;  1G8P A;  2L4F A;  3U5Z A;  2JY8 A;  1PJI A;  4JI2 M;  2UXD M;  1G4A E;  2LVA A;  2AHM A;  4L6V 6;  1L2D A;  3K2L A;  5IRE B;  3V76 A;  2F5S A;  2K9D A;  1HT1 E;  4LFB M;  2EKK A;  3LCU A;  5FTJ A;  3SMP A;  2E5L M;  3FYC A;  5EXX A;  1HJP A;  3CF0 A;  2KW0 A;  2KZS A;  4LF7 M;  5EP1 A;  4LF9 M;  2UXB M;  4Z8X A;  4L8R C;  1IY0 A;  4MB7 A;  2JXN A;  3NWL A;  2HKJ A;  3ILK A;  5ITU A;  3GLF E;  1J5E M;  1DO2 A;  1OKS A;  4FWD A;  3RGS A;  2YR0 A;  4REZ A;  4A3V B;  4MGZ E;  2F5Q A;  2WSC F;  1QVR A;  2W82 A;  4AQY M;  2HWJ A;  3PFI A;  1AIP C;  4JN6 A;  4GKK M;  1YUB A;  4PCZ A;  5JI2 E;  4FWH A;  2DAM A;  2R46 A;  4LFA M;  7CAT A;  4LY6 A;  1HR0 M;  2F5P A;  3ZQJ A;  3GPU A;  1OIZ A;  3T6P A;  2G3Q A;  4B7G A;  1JB0 F;  4F2L A;  5A2Q S;  4DV1 M;  1K3X A;  4B3S M;  2R4E A;  2DAK A;  3GPP A;  3K1J A;  3E4R A;  4KHP M;  1QDR A;  3FUV A;  4G6Z A;  1NHW C;  2WZJ A;  1L1Z A;  1WIV A;  1IXS A;  1HNZ M;  4LJ7 A;  3KOY E;  3KXE C;  2L09 A;  3B7N A;  3U6L A;  2R18 A;  3M6A A;  1H6U A;  3HGI A;  3GQ5 A;  1J09 A;  2C9C A;  5EP4 A;  1KYI A;  5C1B A;  1V33 A;  3SYK A;  2YQZ A;  3H4J A;  1OTR A;  5FSW A;  4W5W A;  3E21 A;  3FUT A;  1ZV1 A;  1PJT A;  5EJC A;  1QUT A;  4FWG A;  4WW0 A;  1QQW A;  2F5O A;  4B7H A;  1LV7 A;  4RF0 A;  1GO5 A;  1C7Y A;  3IEC A;  1QAM A;  3BBZ A;  2LVN C;  3QYE A;  5KPR A;  2G8L A;  3C3D A;  3FTC A;  2VQF M;  2J7N A;  3VKG A;  3WHK A;  1ZMV A;  3A45 A;  1OFH A;  1QZE A;  1RU3 A;  2JWS A;  4D81 A;  1XHB A;  3SC3 A;  5ITX A;  1JR3 A;  1VEK A;  3KSJ A;  2J7O A;  2RKO A;  3FKE A;  4DV5 M;  2QCU A;  2EKF A;  2CHG A;  4LZZ A;  5ITR A;  3KSX A;  2DAG A;  3MK6 A;  3UJN A;  1Q3B A;  4P16 A;  4JI5 M;  5IT9 S;  1QYR A;  3LCV B;  3MMP A;  4GIT A;  2XH9 A;  5ITQ A;  1I94 M;  2R4J A;  2P5T A;  3LVW A;  1HQY E;  4Q7J A;  4AI6 A;  1WHC A;  3ZCB B;  4RNA A;  1TTE A;  2LNH C;  3SFZ A;  3I01 M;  3HJQ A;  1QAN A;  2Y0T A;  2KA6 B;  4PDG A;  4DR3 M;  1TH4 A;  1Z5A A;  1VG5 A;  3QWL A;  4L15 A;  2JY6 B;  3R8F A;  2MR9 A;  4FD2 A;  4MGI E;  2BJW A;  4QHS A;  2H5X A;  2LVQ D;  2EUC A;  4XBO A;  1I4W A;  5L8R F;  4RKU F;  1Z5C A;  2DHR A;  4IBB A;  4KOD A;  1E94 E;  2K6B A;  1E9R A;  3ZH9 B;  4NXN M;  3VDU A;  4G4Q A;  2BWB A;  2GQF A;  3GLF B;  4QNR A;  3L27 A;  5LMU M;  3HY5 A;  4X66 M;  3SAR A;  4HL4 A;  3J2P B;  3DFZ A;  4LGM A;  4JYA M;  1LTM A;  3W0F A;  2DWM A;  3OTO M;  1QAQ A;  2L4E A;  3VDP A;  3GPX A;  4B3M M;  3WHL A;  3GLI B;  4Y28 F;  1JR3 D;  3FUU A;  4M0D A;  2JZ1 A;  3TWK A;  2QBY A;  2K0B X;  3B74 A;  5IZ7 D;  4FCV A;  2ZAN A;  2XF3 A;  3W68 A;  4AW4 A;  3D8L A;  4LF4 M;  1SXJ D;  5JI3 E;  3VK8 A;  1MU5 A;  3KS4 A;  1IN4 A;  2I7N A;  2X49 A;  4FCW A;  3KOX E;  1TH3 A;  3IG8 A;  3L29 A;  4LRT A;  2XEP A;  3FUW A;  2QEN A;  2QP9 X;  4KO8 A;  4GRI A;  2X4A A;  2CV2 A;  1N77 A;  3PVS A;  4JI8 M;  1IN7 A;  3KVW A;  2KDL A;  2VII A;  2B3T A;  3B89 A;  4QOZ C;  1PJS A;  1Q39 A;  4LJ4 A;  4ZPX A;  1R5L A;  1KFV A;  2N35 A;  3K9P A;  2X8A A;  4OU7 A;  1KSF X;  4ANR A;  2R45 A;  2ZAO A;  1GKI A;  4D80 A;  1YE9 A;  1AUA A;  2K47 A;  3FYD A;  3HHW A;  2CEA A;  2Y21 A;  1TDZ A;  1UFZ A;  3HWS A;  3SHG B;  2F4V M;  1L8Q A;  1K3W A;  1EIJ A;  5DYI A;  5FTN A;  4BLC A;  2V1U A;  2CFO A;  3VK7 A;  3GQ4 A;  2XFT A;  3KP0 E;  4IBC A;  1E9S A;  2QZ4 A;  1G71 A;  2J5Y A;  4JI3 M;  4GH9 A;  1NNJ A;  3U61 B;  1TGU A;  3LVV A;  3U6P A;  1GLN A; 
#chains in the Genus database with same CATH homology
 4QHT A;  3M7G A;  3GLG A;  3Q8X A;  4MGY E;  4FVM A;  1G59 A;  3KDS E;  3U6E A;  5EXP A;  3AOG A;  3PNY A;  1G3I A;  4IBI A;  5BPV A;  3JR4 A;  2ERC A;  4M0W A;  3AJI B;  3MJ5 A;  2CHV A;  4GC5 A;  2EO2 A;  1IBK M;  4LZJ A;  2HL7 A;  1HQC A;  4NRV A;  1GL7 A;  2BNK A;  2XFS A;  4LRS A;  4MH0 E;  4LF8 M;  3U6C A;  4DR2 M;  2ZAM A;  4JI6 M;  3I4V A;  3DZD A;  1FJG M;  1S3S A;  1XXH A;  3R9X B;  3EIE A;  2LWX A;  3A98 B;  2LH0 A;  3GLH A;  3TPZ A;  4I4L A;  4GC9 A;  1PM5 A;  4QOS A;  1C1K A;  5DYG A;  2KXE A;  1DGG A;  4I5S A;  5KQD A;  1R7R A;  1SXJ B;  4LGY A;  4G4R A;  4X65 M;  4AKH A;  3FTE A;  1DGH B;  1IXZ A;  2RGH A;  4IIW A;  3TL4 X;  1R2Y A;  3SBJ A;  4DR1 M;  2Y0Q A;  2R62 A;  4NOO B;  4OW0 A;  3HU3 A;  2XZU A;  3FTD A;  4B08 A;  3TQS A;  1XMO M;  4X62 M;  3SAT A;  2C99 A;  3SAU A;  4LJA A;  4GIP A;  1R6B X;  4JI4 M;  4CHT B;  3JR5 A;  2FE8 A;  4IJE A;  2FOI C;  4AKG A;  4MGK E;  3D8B A;  3SHF A;  4WUR A;  1DO0 A;  4BBA A;  1XWI A;  1R2Z A;  2VQE M;  1N34 M;  2CV1 A;  3K8Z A;  3LMM A;  1IXR C;  1JQJ C;  2KRK A;  1L2C A;  5E6J A;  4L16 A;  4NRW A;  3KOW E;  3UMM A;  4DR7 M;  4AZF A;  3QAU A;  3AKZ A;  4DR5 M;  3HHZ A;  3VKH A;  3AV0 A;  3FUX A;  2ZM6 M;  3K92 A;  5ITY A;  4NXM M;  3SAS A;  4NL4 H;  2C98 A;  3GRV A;  1IQP A;  1T3T A;  3J81 S;  3E9S A;  4LJ9 A;  2C5R A;  4LF6 M;  4IBG A;  3CF2 A;  1TDH A;  1L2B A;  1HNW M;  1XNR M;  1SXJ E;  3HHX A;  5EP2 A;  2DWZ B;  1IM2 A;  3C58 A;  4DR6 M;  2Q2E B;  4GKJ M;  2CUZ A;  2L6O A;  3T1H M;  1NY6 A;  4HLQ A;  4IBJ A;  4JXJ A;  2L7I A;  5KQ8 A;  2YNM D;  3U5Z B;  2D7E A;  3FD9 A;  2UUA M;  4ITQ A;  2DZN B;  3A42 A;  5EXS A;  5E26 A;  5EQT A;  3U6S A;  4PT5 A;  3LQR A;  2Z4S A;  1W5T A;  3UK6 A;  2I7P A;  3HU2 A;  2KRU A;  3HJ8 A;  1N78 A;  3DOA A;  2Z4R A;  4GMQ A;  1J7K A;  2CHQ A;  3UGJ A;  3AFH A;  3AOE C;  4DUZ M;  1K82 A;  3SYL A;  1TH2 A;  3RGP A;  4PDI A;  2DWL A;  4LF7 M;  2XLJ A;  1GVN A;  1XNQ M;  1DGF A;  1NJF A;  1QAO A;  3AOE A;  1YSY A;  3IG5 A;  3BOS A;  1IBM M;  1N32 M;  3J27 B;  1WXQ A;  3EIH A;  2CE7 A;  3MHV C;  4DV3 M;  4OVZ A;  2XZF A;  4PD2 A;  2L7H A;  1ZAE A;  1XC8 A;  3GQ3 A;  4LCB A;  3TE6 A;  4DV0 M;  4B3R M;  3CF6 E;  4OX9 M;  1Z59 A;  2BJV A;  1GL6 A;  3GLF A;  2XGN A;  3UZU A;  1Z5B A;  3CTW B;  1IXS B;  2FNA A;  4JV5 M;  1HNX M;  1IY1 A;  3AL0 C;  2G5G X;  1N33 M;  4DV2 M;  1IBL M;  4LG2 A;  3L25 A;  4R7G A;  2HCB A;  5FTM A;  4AG5 A;  4GHA A;  2Z7J A;  1G41 A;  3A46 A;  4LJ5 A;  1NSF A;  4G4O A;  2DWN A;  4DV6 M;  3HKP A;  3PXG A;  4MGH A;  3GO8 A;  4NSO B;  2R65 A;  3DA1 A;  4YHH M;  3TWL A;  3T15 A;  3SMS A;  4CIS A;  4B7F A;  2XSZ A;  4X64 M;  3L2A A;  3U60 A;  4BB9 A;  4M9S A;  1OFI A;  3I4Y A;  2HHH M;  1PJJ A;  3HHY A;  2Z3X A;  3KW6 A;  4IJF A;  4FCT A;  4M9Z A;  3U6M A;  1IY2 A;  1MX0 A;  3HJS A;  3VFD A;  4TUW A;  1EE8 A;  2KZU A;  4CGY B;  5IWA M;  2NQ8 C;  3B9P A;  2YFQ A;  4EIW A;  4DUY M;  3U61 A;  1E32 A;  4M9X A;  4XGI A;  2V1C A;  1L1T A;  5ITT A;  3KFU G;  3GPY A;  5FTK A;  3GRY A;  2C9O A;  4G4N A;  2DVW B;  1XMQ M;  2C96 A;  1HT2 E;  3TWM A;  1NNU C;  4KLN A;  3PNV A;  4L78 A;  1N36 M;  2A5Y B;  3GRU A;  2EA0 A;  3GRR A;  2OQ4 A;  1DGB A;  5GKN A;  1Z6T A;  4IBD A;  4IBF A;  1NVM A;  3HU1 A;  4FW9 A;  1IN6 A;  5KO3 A;  2M60 A;  1NJG A;  4I8O A;  2XSZ D;  4K0K M;  2D7H A;  4LFC M;  3T38 A;  4IBK A;  2LXE A;  2QBY B;  5BR8 M;  5ITX E;  1SXJ C;  3ZC7 B;  3U6Q A;  4R3D A;  1SXJ A;  4MM3 B;  3KP1 E;  2F5N A;  1DGH A;  3GP1 A;  4B3T M;  2UU9 M;  3KOZ E;  3JAM S;  3T1Y M;  4AKI A;  4D82 A;  2QPA A;  4DV4 M;  2H1R A;  1VDD A;  5KPZ A;  2DXI A;  3NBI A;  1NY5 A;  5DNY A;  2KEB A;  3L26 A;  2UUB M;  3J7B A;  1IN5 A;  2V6Z M;  5H37 D;  4LJ8 A;  5KPT A;  4OVZ B;  5F3W A;  4AG6 A;  2ZBK B;  2M5Z A;  1X37 A;  4L4U A;  4DV7 M;  3THG A;  4DR4 M;  2DZO B;  4IBE A;  2OPF A;  3FTF A;  4GHL A;  2FFJ A;  4JI1 M;  3L28 A;  3SAV A;  2D7G A;  3SAW A;  1QZM A;  4JI7 M;  4LF5 M;  4I81 A;  5LMN M;  3GLG B;  5EXT A;  2UUC M;  1FNN A;  4YY3 M;  2Y20 A;  1Q3C A;  3RFW A;  3VLF B;  1W5S A;  1IN8 A;  1N75 A;  3U6D A;  2CV0 A;  1UM8 A;  3LQQ A;  8CAT A;  4S12 A;  4QNM A;  5FLX S;  4JI0 M;  3KS8 A;  3U6O A;  3M0E A;  2JA2 A;  3W0L B;  5C18 A;  4LJ6 A;  1ORY B;  3H4M A;  1D2N A;  1NHG C;  1ZQ9 A;  4II7 A;  4NSR A;  3I51 A;  3J80 S;  1XXH B;  3RE8 A;  2O5R A;  3GLH B;  5EP3 A;  5FTL A;  3U60 B;  4Z6Y A;  4RF1 A;  2UXC M;  1OJL A;  3J7A S;  2RGO A;  1PJI A;  3GLI A;  3U5Z A;  1G8P A;  4JI2 M;  2UXD M;  1G4A E;  2AHM A;  1L2D A;  3K2L A;  5IRE B;  2F5S A;  4LFB M;  1HT1 E;  5FTJ A;  3SMP A;  2E5L M;  3FYC A;  5EXX A;  3CF0 A;  2KW0 A;  2KZS A;  5EP1 A;  4LF9 M;  2UXB M;  4Z8X A;  4L8R C;  1IY0 A;  4MB7 A;  3NWL A;  5ITU A;  2HKJ A;  3ILK A;  1J5E M;  1DO2 A;  4FWD A;  3RGS A;  2YR0 A;  4REZ A;  4A3V B;  4MGZ E;  2F5Q A;  1QVR A;  2W82 A;  4AQY M;  3PFI A;  4JN6 A;  4GKK M;  1YUB A;  4PCZ A;  5JI2 E;  4FWH A;  4LFA M;  2R46 A;  7CAT A;  4LY6 A;  1HR0 M;  2F5P A;  3GPU A;  4B7G A;  5A2Q S;  4DV1 M;  1K3X A;  4B3S M;  2R4E A;  3GPP A;  3K1J A;  3E4R A;  4KHP M;  3FUV A;  4G6Z A;  1NHW C;  1L1Z A;  1HNZ M;  4LJ7 A;  3KOY E;  3KXE C;  2L09 A;  3U6L A;  2R18 A;  3M6A A;  3HGI A;  1H6U A;  3GQ5 A;  1J09 A;  2C9C A;  5EP4 A;  1KYI A;  5C1B A;  3SYK A;  2YQZ A;  5FSW A;  4W5W A;  3FUT A;  5EJC A;  4FWG A;  4WW0 A;  1QQW A;  2F5O A;  4B7H A;  1LV7 A;  4RF0 A;  1QAM A;  5KPR A;  2G8L A;  3FTC A;  2VQF M;  2J7N A;  3VKG A;  3WHK A;  3A45 A;  1OFH A;  4D81 A;  1XHB A;  3SC3 A;  5ITX A;  1JR3 A;  3KSJ A;  2J7O A;  2RKO A;  3FKE A;  4DV5 M;  2QCU A;  5ITR A;  2CHG A;  4LZZ A;  3KSX A;  3MK6 A;  3UJN A;  4JI5 M;  1Q3B A;  4P16 A;  5IT9 S;  1QYR A;  4GIT A;  2XH9 A;  5ITQ A;  1I94 M;  2R4J A;  2P5T A;  3LVW A;  1HQY E;  4AI6 A;  3ZCB B;  4RNA A;  3SFZ A;  2LNH C;  3HJQ A;  1QAN A;  2Y0T A;  2KA6 B;  4PDG A;  4DR3 M;  1TH4 A;  1Z5A A;  4L15 A;  3QWL A;  3R8F A;  4FD2 A;  4MGI E;  2BJW A;  4QHS A;  2EUC A;  4XBO A;  1I4W A;  1Z5C A;  2DHR A;  4IBB A;  4KOD A;  1E94 E;  1E9R A;  3ZH9 B;  4NXN M;  3VDU A;  4G4Q A;  3GLF B;  4QNR A;  3L27 A;  5LMU M;  4X66 M;  3SAR A;  4HL4 A;  3J2P B;  3DFZ A;  4LGM A;  4JYA M;  3W0F A;  2DWM A;  3OTO M;  1QAQ A;  3GPX A;  3VDP A;  4B3M M;  3WHL A;  3GLI B;  1JR3 D;  3FUU A;  4M0D A;  3TWK A;  2QBY A;  5IZ7 D;  4AW4 A;  4FCV A;  2ZAN A;  2XF3 A;  4LF4 M;  3D8L A;  1SXJ D;  5JI3 E;  3VK8 A;  1MU5 A;  3KS4 A;  1IN4 A;  2I7N A;  2X49 A;  4FCW A;  3KOX E;  1TH3 A;  3IG8 A;  3L29 A;  4LRT A;  2XEP A;  3FUW A;  2QEN A;  2QP9 X;  4KO8 A;  4GRI A;  2X4A A;  2CV2 A;  1N77 A;  3PVS A;  4JI8 M;  1IN7 A;  3KVW A;  2VII A;  4QOZ C;  1Q39 A;  4LJ4 A;  4ZPX A;  1KFV A;  2X8A A;  4OU7 A;  1KSF X;  2R45 A;  2ZAO A;  1GKI A;  4D80 A;  1YE9 A;  3FYD A;  2K47 A;  3HHW A;  2CEA A;  2Y21 A;  1TDZ A;  3HWS A;  3SHG B;  2F4V M;  1L8Q A;  1K3W A;  5DYI A;  5FTN A;  4BLC A;  2V1U A;  2CFO A;  3VK7 A;  3GQ4 A;  2XFT A;  3KP0 E;  4IBC A;  1E9S A;  2QZ4 A;  4JI3 M;  4GH9 A;  1NNJ A;  3U61 B;  1TGU A;  3LVV A;  3U6P A;  1GLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...