4MBHA

Penam sulfone psr-3-226 bound to e166a variant of shv-1 beta-lactamase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
265
structure length
265
Chain Sequence
SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Penam sulfones and beta-lactamase inhibition: SA2-13 and the importance of the C2 side chain length and composition.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 98
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4mbhA00
4JF4A 4OOYA 5DF9A 1TDLA 2QPNA 1ONGA 3HUNA 2Y91A 5A91A 3NY4A 4DE3A 1E4DA 2WUQA 5KSHA 4JXGA 3NC8A 3IQAA 3N6IA 2WKIA 4JPMA 5FAQA 5E2EA 4WZ4A 3G32A 3IXDA 3ZG5A 1ZC2A 3ITAA 3VP0A 2FFYA 5CHUA 2EXBA 3G31A 4LV1A 2ZQ8A 3N7WA 4B88A 3V50A 3A3IA 1BUEA 4OP5A 3TG9A 1RGYA 4C75A 4OOMA 1U60A 3GVBA 3DWKA 2DRWA 5EVID 3HLCA 3PBSA 1XGJA 4EV4A 3A3FA 3FYZA 4X69A 1KVMA 1WYCA 5CGSA 4LCLA 3ZHHA 3C4OA 3CMZA 1MWSA 3IWIA 3VP1A 1BULA 4S2KA 1PZPA 5EE8A 5CTMA 4A5RA 1FCMA 1FSWA 2Y59A 1ZG6A 2R9WA 1XA7A 4DXCA 2DCFA 2ZC7A 3GSGA 3PAEA 1LI9A 1ES3A 3MKEA 3HVFA 5HAQA 4N1XA 5EVIA 3HLEA 4GZBA 5E2GA 4OH0A 2JE5A 4E3NA 4GB7A 3NI9A 5EOOA 1FR1A 4OKPA 3BFEA 4N9KA 1K6SA 4UAAA 2P9VA 3V5MA 4N9LA 4QU3A 5U47A 4KZBA 2Y2LA 3BECA 1MPLA 3N4IA 1XKZA 4S2OA 1CEFA 2ZQDA 3IXGA 4DXBA 2Y2OA 5A90A 1VM1A 5AQBA 4OQGA 3VSKA 4UA9A 4NK3A 4OPRA 3VMAA 1BLSA 4JF6A 5FQKA 1PZOA 4KZ8A 4ZTKA 3UNWA 5FI2A 1DJBA 5GHZA 3SH9A 5DTTA 4KZ5A 1K4EA 2P9VB 1E3UD 2ZQAA 1MWTA 4DE0A 3G2YA 2XD5A 3WS0A 1NRFA 2UWXA 2ZQ7A 3N8SA 1IYOA 5CERA 4N1HA 3WRZA 4L0LA 5A92A 3VOYA 2ZD8A 3NIAA 5TR7A 4PM7A 2XEPA 3PTEA 3TOIA 1BLPA 2OLUA 1IYSA 4BL2A 4OVDA 1H8ZA 4KENB 5F82A 1FSYA 5CRFA 3HUMA 2JBFA 4XXRA 4RX3A 3WS4A 4IBRA 3BFCA 4MLLA 1K55A 2ZMAA 1E3UA 1BLHA 1LL9A 2ZM8A 1L2SA 4LV0A 4OOLA 4X56A 1HD8A 4OLGA 2IWBA 4BD0A 3BFGA 5FI6A 5CECA 1YLPA 4WYYA 2XK1A 3GR2A 3HREA 5IHVA 1K4FA 2H0YA 1NZOA 4ZJ3A 2ZC5B 4Z9QA 3RXXA 3UO9A 1DY6A 1JTGA 4QB8A 4BENA 4WZ5A 3S22A 3ZG0A 1PI5A 1L0EA 1K54C 1EWZA 1K57C 2HDUA 3O86A 3EQVA 2V2FF 1HVBA 4X53A 1I2SA 4RX2A 2RCXA 1BZAA 3HLGA 4R3JA 4E3OA 1O07A 2WGVA 4UA6A 3BM6A 1JVJA 1K25A 3BLSA 3VOZA 1FCOA 3G35A 2OLVA 3ZNYA 1C3BA 1WYBA 2J9OA 3DW0A 2BG1A 1XP4A 4WM9A 1ERMA 1TDGA 4RVAA 1MXOA 4K0WA 3CJMA 1MKIA 3WS1A 1PW8A 5HX9A 1NXYA 2VGKA 2HPBA 2IWDA 5JYPA 3V39A 4FSFA 4DE1A 1JWVA 2A3UA 3HUOA 4OPQA 2WGWA 3NDEA 3LO7A 5KZHA 3W4QA 3FZCA 4C3QA 1TEMA 4GDBA 1YLTA 3IF5A 3OCNA 4WMCD 5HW3A 3G2ZA 1GCEA 3QHYA 2Y2PA 3G30A 1G68A 4UA7A 2HDRA 2HDQA 4LENA 3P98A 3WRTA 3Q7VA 2OV5A 4PPRA 1YT4A 2PBYA 3FKVA 3I7JA 3M6BA 4M3KA 1YMSA 1NJ4A 1SHVA 2WGWB 5CHMA 5I94A 1ES4A 1WE4A 4KZ4A 5E2HA 3WWXA 5DTSA 1HTZA 1ESUA 4S2LA 4DDYA 4Y0TA 4FH4A 4X55A 3LY4A 4S2IA 1FOFA 5TFQA 1Y54A 3PBNA 5CTNA 4U0TA 4S2JA 1AXBA 3G4PA 2EFXA 3SH7A 4OQ0A 5DTKA 2OSUA 4BLMA 1IKGA 3JYIA 2HP9A 4OQHA 1L0DA 3BEBA 3V3RA 4DE2A 5DF7A 1YQSA 2Y4AA 2H5SA 2XFTA 2Z2LB 2VGJA 3C7UA 4Q8IA 3CZDA 4WEJA 2I72A 2ZQ9A 3BFFA 5M19A 4U0XA 2XD1A 1JWZA 3VP3A 3IT9A 4DKIA 2PU4A 2WZXA 1YLZA 2RL3A 1GHIA 1MY8A 3OZHA 1SDEA 4B4XA 5FAOA 4YFMA 4QY5A 2HP5A 3NBLA 3MKFA 3N8RA 4Y0OA 3E2KA 5E43A 4Y0UA 1NY0A 4X68A 3AGDA 3ITBA 5BOHA 3UE0A 1E25A 5KSCA 1KGGA 4K0XA 4IVKA 5KMWA 2ZM0A 3MZDA 4S2NA 5AQ9A 4QD4A 2Y2GA 4K91A 5EVIB 5FQIA 3UDIA 1ZKJA 3NDGA 1EROA 3WS5A 1YMXA 4JLFA 4R23A 1W8YA 2IWCA 1MWUA 3IXBA 4RYEA 1DJCA 1KGEA 4S2NC 3FV7A 5CXWA 1QMFA 4JXVA 3SH8A 3ZDJA 2Y55A 1PWDA 3IH8A 4FD8A 3SS5A 3C7VA 3UPNA 5D3OA 4BD1A 3UN7A 1J9MA 1RP5A 3OPLA 3MZFA 4KQOA 5CGWA 2PU2A 3Q7ZA 4D2OA 2EX8A 2EFUA 4IBXA 2HDSA 2Y2KA 3IHBA 5HFOA 2Y2NA 4E6WA 4HEFA 2Q9NA 1N4OA 2ZJ9A 3OCLA 4JBFA 4R4SA 3ZNTA 4KG5A 1K38A 4GOGA 2HP6A 4OLDA 2QZ6A 2Y2IA 1IELA 1LI0A 5FI7A 3BLMA 4ID4A 4ZAMA 2C5WB 1GHMA 1K54A 1K57A 3LCEA 3M6HA 3ZGAB 4E3JA 5DVAA 5HAIA 3HL9A 3OPPA 1Z6FA 1KVLA 3MFDA 2V1ZA 5GL9A 1CEGA 3VFFA 4GDNA 2Q9MA 2R9XA 4MBHA 3UPOA 1JWPA 4KZ9A 4OQIA 2WADA 1S6RA 2ZC6B 4E6XA 2EX9A 3RJUA 4F94A 2JC7A 5FASA 1H5XA 5F1GA 4QJGA 5FATA 1SDNA 4KZ6A 4HBTA 3PBTA 1TVFA 3W4PA 3OPRA 4CJNA 3VP4A 5CEDA 3IXHA 1S0WA 5HARA 2V20A 5EPHA 3O87A 1CI9A 3PAGA 4HESA 1IEMA 3VFHA 5E2FA 3AGFA 2G2WA 5AQAA 5FQJA 2XLNA 3IF6C 1YLJA 4N92A 4IVIA 4E3LA 4R1GA 4DF6A 1L0FA 4QHCA 2X02A 1ZG4A 3ZG7B 1XPBA 3MZEA 4OPYA 1W5DA 4P0MA 3HLFA 3UDXA 2WYXA 2XR0A 1DJAA 5DF8A 1MWRA 1I2WA 5HAPA 3V3SA 3GMWA 4P85A 5FQQA 1KDWA 4H8RA 5CHJA 4E3IA 4GD8A 1BLCA 1K56D 3A3JA 4UHUA 4O7DA 3QNCA 4P6BA 2QMIA 3IHAA 4S2PA 4ZBEA 4FH2A 1CI8A 4WBGA 4E3MA 5JYOA 1GA0A 2J7VA 2XH9A 4RA7A 1JTDA 3ZVWA 5HL1A 4PMAA 1KGFA 1W7FA 4NETA 4EBPA 3DTMA 4LCMA 3FKWA 5EUAA 3M2JA 5G18A 3ZVTA 3ZG9B 4JF5A 1FQGA 4WMCA 3Q7VB 3IH9A 1KE4A 2BLSA 4GN2A 5FAPA 3QNBA 2WK0A 4R0QA 2EXAA 5F83A 1K56A 4GD6A 4DRTA 1VQQA 1O7EA 4XUZA 1ONHA 3AGEA 3MXRA 5M18A 3GRJA 3BFDA 5CGXA 4JKTA 2ZM2A 4MBFA 5A93A 4EQIA 1H8YA 3UE3A 3MBZA 4JXWA 2C6WB 1PWCA 4KQRA 5J8XA 4DDSA 2ZC3B 3C4PA 3DWZA 1YM1A 3RXWA 3O88A 1XGIA 3LY3A 3UE1A 1L0GA 1PIOA 3UDFA 2WZZA 4X6TA 1KE0A 1HZOA 4XUXA 5TGFA 3VSLA 4ZDXA 5FQ9A 3O3VA 4PM6A 1BTLA 3Q1FA 1M40A 5GHYA 4OPZA 3N8LA 4ZJ1A 1G6AA 3VP2A 4EBLA 2H10A 3HLWA 3LEZA 2XGNA 3IWOA 5EVLA 3A3DA 1PW1A 1PI4A 1ESIA 1ERQA 4B4ZA 4BL3A 1XA1A 4PM8A 5GLAA 1GHPA 3B3XA 3A3EA 4PM9A 1PWGA 3D4FA 4CPKA 3FWLA 5EVIC 4EBNA 3WS2A 1Q2QA 2ZC4B 3IWQA 2WKEA 3P09A 2ZLYA 3MXSA 4ZJ2A 3UPPA 3ZCZA 3C5AA 4OP8A 1IYPA 5M1AA 5EOEA 2A49A 4WEKA 2XDMA 3OPHA 2JCHA 3NCKA 3CG5A 3M2KA 4C6YA 4S2MA 5FSRA 2FFFB 4BQMA 1SKFA 4GNUA 2Z2MB 1ES2A 2G2UA 4MNRA 1QMEA 2X71A 3BYDA 3SS3A 3G34A 1IKIA 2Y2MA 3PBQA 5FDHA 3SOIA 3W4OA 1XX2A 1YLYA 4HBUA 1GA9A 5GLDA 1BT5A 3PBOA 1RGZA 4KG2A 4GKUA 5GLBA 4R4RA 3EQUA 5GHXA 1I5QA 2J8YA 4OONA 2B5RA 3E2LA 1Q2PA 2DNSA 1LL5A 3HBRA 4KZ3A 5AQ7A 1SCWA 5FQMA 3W8KA 2H0TA 4R3BA 2GDNA 3IF6A 3UY6A 1NZUA 1XXMA 3Q82A 4KZ7A 1N9BA 1RCJA 2XFSA 2E8IA 4FCFA 2WKHA 4WELA 4MBKA 5F1FA 1FR6A 1ALQA 1K55C 4YINA 4BJPA 3GQZA 3S1YA 1FCNA 2WAFA 1NYMA 2P74A 3HLDA 1MBLA 1OMEA 4KZAA 5EECA 1K6RA 1LHYA 4KG6A 5FA7A 4EWFA 1W79A 3IF6B 2WGIA 4PM5A 1NYYA 1KE3A 2EX6A 1CK3A 3ISGA 4KQQA 1KDSA 4WZ5C 2Y2JA 3BRMA 3ZFZA 3S4XA 4EUZA 1LLBA 2Y2QA 4MEZA 4U3TA 1ES5A 2J9PA 3SS4A 2ZQCA 2X01A 2XF3A 3OC2A 4LV3A 4P87A 3ZG8B 4JXSA 4Y7PA 3GV9A 4IEDA 3PBRA 1YLWA 2Y2HA 3GTCA 1W8QA 2WAEA 3HLBA 1BSGA 4QY6A 4E3KA 1M6KA 5CEBA 1IYQA 5GLCA 1EI5A 1PYYA 2CC1A 5L2FA 3Q07A 3TSGA 2EX2A 2XQZA 3Q81A 4LV2A
chains in the Genus database with same CATH superfamily
1ONGA 4LLOB 5KIZA 2Y91A 1W63M 3LIFA 5KSHA 3NC8A 5E2EA 1D1JA 3IXDA 3N7WA 3V50A 1BUEA 3TG9A 4LRZE 4C75A 4GJ4A 5EVID 4EV4A 3A3FA 1WYCA 4ZRRA 3UB6A 2L0WA 4BBVA 4A5RA 4I3IA 2R9WA 1XA7A 3NOTC 2ZC7A 1LI9A 1ES3A 1UWNX 3MKEA 5EVIA 4GZBA 5E2GA 3VE4A 4E3NA 1XJ6A 4XT2B 4OKPA 3T1QB 3FPVA 2OAP1 4UAAA 3BECA 1XKZA 3IXGA 4DXBA 2Y2OA 1XJ2A 5AQBA 3VSKA 4OPRA 4JF6A 4KZ8A 4ZTKA 1DJBA 3SH9A 5AJGA 4KZ5A 1OT6A 1NRFA 3N8SA 4N1HA 5A92A 5DJUA 4PM7A 2A2LA 3PTEA 3TOIA 1BLPA 2OLUA 4DJ3A 4OVDA 2O9BA 3S7PA 4EETB 3BFCA 2O9AA 1K55A 3UMEA 4LV0A 1L2SA 1HD8A 5F69A 4OLGA 3A0SA 1DP8A 5CECA 2XK1A 3H9WA 5IHVA 2H0YA 1J3WA 1DY6A 1IOUA 4QB8A 4WZ5A 5F6AA 4LRYC 1S4SA 4JGPA 2HDUA 2V2FF 1S67L 1OTAA 3PR6A 1G5UA 1BZAA 3HLGA 4R3JA 4E3OA 2M1CA 3MS6A 3BM6A 4PHTA 3E4QA 1DP9A 1WYBA 4BMWA 3DW0A 2FH5A 4EESA 2CMNA 2M7VA 1NXYA 2VGKA 2HPBA 3MJQA 1JWVA 3U2AA 3HUOA 4OPQA 3LO7A 3W4QA 4HP9A 3FZCA 4GDBA 1YLTA 5HW3A 3G2ZA 4D60A 4LENA 3P98A 4HP4A 4PPRA 1YT4A 2PBYA 2J3WA 3V67A 4M3KA 1YMSA 3S7QA 1SHVA 5CHMA 5I94A 3WWXA 1HTZA 3D72A 1ESUA 5C5KA 5TFQA 1Y54A 3PBNA 5CTNA 3TRCA 3TJZC 3G4PA 5DFXA 1TS8A 4OQ0A 5DTKA 4BLMA 3JYIA 2HP9A 3BEBA 1S66L 2H5SA 3QP4A 1JWZA 2XD1A 4DKIA 3IT9A 1BYWA 2E8JA 1VHMA 2PAVP 3CI6A 3NBLA 4Y0UA 4X68A 2XROA 3AGDA 5BOHA 2J80A 4II7A 4K0XA 2QJ7A 4IVKA 5KMWA 2ZM0A 3MZDA 5AQ9A 1ZKJA 3WS5A 4JLFA 3BQ8A 1TS6A 3IXBA 1DJCA 5CXWA 5IS1A 3F1PB 2JKRM 2KOIA 3SS5A 1ACFA 4BD1A 2W3GA 3RTYA 1RP5A 2G7UA 4O01A 2PR6A 3MZFA 2PU2A 3Q7ZA 1T1CA 3IHBA 2Y2NA 4HEFA 3OCLA 2ZJ9A 4JBFA 3ZNTA 3IX8A 4GOGA 1LI0A 2ZL1A 4ID4A 4E3JA 1S1ZA 3HL9A 1Z6FA 5GL9A 3UPOA 4MBHA 1D06A 1JWPA 5HL6A 4OQIA 2EX9A 3S7OA 3ZYTA 1H5XA 5F1GA 5FASA 4QJGA 5TBMA 1EW0A 4CJNA 3C8CA 5EPHA 4DJ2A 3O87A 3TE8A 1CI9A 3PAGA 4GHIA 1IEMA 5AQAA 1YLJA 4IVIA 3KSFA 5TBMB 1L0FA 1OJGA 4RQ9A 1XPBA 3MZEA 3HLFA 4GHIB 1MWRA 1I2WA 5HDSA 4QWOA 5HZHA 2HZ5A 4E3IA 4FH2A 1CI8A 3MSHA 4Q0JA 5JYOA 3MF0A 5IT5A 3F1NA 4RA7A 2GX5A 4PMAA 3DTMA 4WN5A 5EUAA 1XJ4A 3ZG9B 4JF5A 2WK0A 4R0QA 2EXAA 5F83A 5J7EA 2K31A 1VQQA 4BBTA 2IA2A 1ONHA 3AGEA 3BFDA 5A93A 4JXWA 3UB8A 2C6WB 1PWCA 4DDSA 2ZOHA 3O88A 1XGIA 3UE1A 3DAVA 1ZHHB 3VSLA 5FQ9A 1LSWA 2QKPA 1BTLA 2PR5A 2XGNA 2P7JA 4B4ZA 3B3XA 1CJFA 3A3EA 3MR0A 4P6ZS 4EBNA 1Q2QA 2WKEA 3LR3A 3ZCZA 3C5AA 3P01A 4OP8A 4X1LA 5MC7A 2Z6CA 3E98A 3NCKA 5L07A 2FFFB 2O0YA 2G2UA 1YPRA 3BQAA 5EM0A 2EWVA 2Y2MA 3PBQA 3LR4A 1GA9A 3TW8A 2W1RA 1I5QA 4OONA 1Q2PA 3KYEA 1LL5A 5FQMA 1XXMA 3Q82A 3OBFA 2XFSA 2YKHA 5F1FA 4MBKA 1FR6A 4YINA 3DTKA 2WAFA 3HLDA 2I9VA 4MN7A 4KG6A 5FA7A 4EWFA 3EEAA 4ARZB 5EVEA 1NYYA 2EX6A 1KDSA 1STZA 3R7WB 3OC2A 3K3DA 4HH3A 3ZG8B 3JVUA 4JGQA 3K2NA 5FEFA 4HOIA 1PYYA 2EX2A 2XQZA 1NLYA 4LV2A 2PRFA 4X1MA 3IX4A 3HUNA 2B02A 4EEUA 4DE3A 1E4DA 4JXGA 4JPMA 3ZG5A 4CLCC 1ZC2A 4HJ3A 2EXBA 2ZQ8A 1S4RA 3A3IA 4OOMA 1U60A 3GVBA 1MZUA 3DWKA 2DRWA 3PBSA 1GSVA 1CQAA 3CMZA 1MWSA 1BULA 2KLIA 3VOLA 4S2KA 1ZG6A 3T12B 3MXQA 5A8BA 5HAQA 3HLEA 4K08A 2JE5A 3DTIA 4X25A 1SKOA 4Y5FA 1FR1A 2WKPA 4N9KA 4QU3A 1CEFA 3EOIA 4OQGA 3K3CA 4UA9A 3VMAA 5HWWA 1SKOB 2QWSA 5L09A 5GHZA 2OOLA 1UGUA 3B47A 3G2YA 2XD5A 3WS0A 2ZQ7A 1IYOA 4L0LA 2XEPA 1UWPX 3LIDA 3KX0X 4BL2A 1FSYA 3HUMA 4ESPA 4XXRA 4L9FA 4OOLA 2ZMAA 1BLHA 4CLCE 4BD0A 1YLPA 3UMDA 2HGVA 4JGOA 1K4FA 1NZOA 4EERA 1Z09A 1T19A 2V8CA 2WKQA 2XSSA 4BENA 1L0EA 3KSIA 1HVBA 2Q0OA 4RX2A 4CLCD 1LSVA 3CUEC 5HDCA 1O07A 4HHDA 3A0VA 1JVJA 3BLSA 3G35A 3ZNYA 2W0NA 4DN0A 5EFWA 4WM9A 1TDGA 1MXOA 1LT0A 3CAXA 1K0KA 5JYPA 3H82B 3V39A 4FSFA 4DE1A 4PKYA 4CLCA 2A3UA 4Y2FA 4G3VA 4C3QA 3IF5A 3OCNA 2Y2PA 3G30A 2VJWA 2V0UA 3Q7VA 2OV5A 3FKVA 3M6BA 4CLCB 4Y0TA 3C38A 5FDSA 4S2JA 2EFXA 3SH7A 2OSUA 1IKGA 1L0DA 1OTIA 1YQSA 2Y4AA 1YAXA 2XFTA 2VGJA 3C7UA 2WZXA 1YLZA 2RL3A 4NKPA 1GHIA 2K7SA 3OZHA 4B4XA 2W3DA 4QY5A 2HP5A 3MKFA 3N8RA 3E2KA 1NY0A 1YSPA 5KSCA 1KGGA 4PKYG 1SZVA 4QD4A 1P97A 5EVIB 5FQIA 3NDGA 2IWCA 3E4PA 3L7HA 1KGEA 1XJ3A 1A0KA 3SH8A 3IH8A 3UN7A 3OPLA 2Y2KA 5HFOA 3LGOA 4R4SA 4WL9A 3B42A 4OLDA 2Y2IA 1IELA 3E0YA 4P6ZM 2ZMVA 5FI7A 1OPXA 4ZAMA 3LCEA 1GHMA 4NXEA 2V1ZA 3CUEA 3KSHA 4GDNA 2Q9MA 3CLOA 1S6RA 2JC7A 3GECA 4KZ6A 3PBTA 3OPRA 3VP4A 5G4YA 1S1YA 5J3WA 2PYPA 1F5MA 2WKRA 3AGFA 4N92A 2VK3A 4E3LA 3LIBA 4R1GA 4Y3IA 3ZG7B 4I3AA 4WF0A 3A0RA 4OPYA 4P0MA 3UDXA 4LFUA 5DF8A 2GJ3A 3V3SA 4P85A 5FQQA 1KDWA 4H8RA 1K56D 4EW7A 4O7DA 4ZBEA 4P6BA 2QMIA 4S2PA 4IUHA 3KO6A 2J7VA 2VGLS 3EGXC 4EBPA 3U4LP 1TS0A 5G18A 3ZVTA 5HDDA 1GSXA 1KE4A 4GN2A 3T4SA 1K56A 4DRTA 4NXBA 4AFIA 1ODVA 3MXRA 4UQIM 4MBFA 4EQIA 2XRNA 3UE3A 4LPZA 4HQAA 3LY3A 2PD7A 2VV8A 1KE0A 4BBUA 3O3VA 5J4EA 3Q1FA 4YNRA 3VP2A 3ULFA 2H10A 3HLWA 2ZOIA 5EVLA 2JKRI 4L9GA 3A3DA 2V1BA 1XA1A 5GLAA 5DJTA 3FWLA 2ZC4B 4ZJ2A 2NUTC 2ZLYA 2ACGA 3IS2A 3FC7A 4WEKA 2XA7S 3CG5A 3M2KA 4F3LA 4S2MA 4BQMA 2OWJA 1SKFA 4GNUA 1QMEA 2X71A 2V0WA 5L8MA 4ETZA 3P7NA 5FDHA 3SOIA 4F3LB 4R6LA 5HWTA 5GLBA 4HH2A 3LYXA 1XFQA 3EQUA 2ZL1B 3E2LA 3HBRA 3W8KA 5EV0A 3UY6A 4KZ7A 3HJIA 3EWKA 4I5SA 2E8IA 1OT9A 2WKHA 1P9WA 3S1YA 2W27A 1PRQA 4PM5A 1KE3A 5F68A 1CK3A 5HPFA 2AVXA 3BRMA 3S4XA 3ZFZA 4U3TA 1ES5A 2YKFA 2XF3A 3ZQ5A 2VLGA 4LV3A 2M7UA 1W63Q 3PBRA 2WAEA 2P04A 2PDRA 4QY6A 4E3KA 4Y15A 5GLCA 3JPUA 1EI5A 4LGWA 5L2FA 3Q07A 4NETA 4JF4A 4OOYA 5DF9A 1TDLA 3NY4A 5FAQA 3IQAA 2WKIA 4WZ4A 3F1NB 3ITAA 5CHUA 3G31A 1RGYA 5G4ZA 3LEQA 3HLCA 3FYZA 4X69A 2INWA 3C4OA 2VX8A 3VP1A 2HV1A 1H0MA 1PZPA 1FCMA 2PHYA 2Y59A 2OAQ1 2P08A 3PAEA 2JKTI 3HVFA 2Y79A 4HY8A 3KYQA 2JKTM 1NRJA 2QHKA 5DKKA 1N9NA 3V5MA 2P9VA 4N9LA 5U47A 4KZBA 2Y2LA 4S2OA 2ZQDA 1VM1A 4NK3A 3RH8B 4BWIA 5FI2A 1G6OA 3QP1A 2P9VB 1E3UD 2ZQAA 4MMNA 4DE0A 3T4OA 3VOYA 2ZD8A 3NIAA 5TR7A 1X0OA 1IYSA 1H8ZA 5F82A 1VB6A 2JBFA 4RX3A 5AVFA 3UB9A 4MLLA 1E3UA 1LL9A 3ICYA 5HSQA 2KDKA 4DMZA 3BFGA 2GNXA 1XFNA 5LBRA 3UO9A 1JTGA 3EQVA 3PHYA 4FOFA 2Z6DA 2RCXA 2WGVA 4ETXA 2J3TD 1K25A 4FTXA 2J9OA 1ERMA 4RVAA 4K0WA 4EEPA 3WS1A 5HX9A 3W2ZA 4UQIS 2IWDA 2QYBA 4O8GA 3MQQA 4H6JA 1TEMA 4WMCD 1G68A 3LFVA 1T18A 4JGRA 2HDRA 3CPTA 3WRTA 3KSGA 2VV6A 4HIAA 3NOUC 3I7JA 1HLUP 1NJ4A 1ES4A 1WE4A 4KZ4A 5E2HA 4H6JB 5DTSA 1P9RA 4FH4A 3LY4A 4U0TA 3DBAA 4B93A 2DMWA 4DE2A 3V3RA 5DF7A 2Z2LB 4MCWA 4WEJA 2I72A 5FL3A 2Y8HA 2ZQ9A 4U0XA 2VGLM 2PU4A 2VV7A 1VEUA 1MY8A 4L9EA 2JKFA 5E43A 4IHQA 3ITBA 1E25A 4S2NA 5HD3A 1Y4OA 2Y2GA 1VEUB 4K91A 3UE6A 3UDIA 1YMXA 4QPRA 1DRMA 4R23A 2V8FA 2LB9A 2LB5A 3FV7A 3T4QA 2JN7A 3H7WA 2Y55A 4IUKA 3UPNA 5D3OA 5CGWA 4EUVA 2B18A 4D2OA 2EX8A 2EFUA 2HDSA 2Q9NA 3H7WB 4KG5A 2HP6A 2QZ6A 2C5WB 4KQDA 3LI8A 3OPPA 3MFDA 2K2NA 3NOPC 5IU1A 2H28A 1CEGA 3VFFA 2XA7M 3BY9A 2BASA 2ZC6B 4E6XA 4MN6A 4HBTA 1TVFA 3O5YA 3W4PA 2PBDP 3IXHA 2V20A 3LIEA 1VETA 4HESA 2BTFP 2HJEA 4G3WA 3VFHA 2XLNA 4NXGA 4NEED 3MFXA 2X02A 2PT7A 4PAUA 1VETB 5K5BA 5HAPA 3GMWA 5CHJA 1BLCA 3OOVA 3QNCA 4EU0A 3IHAA 3LI9A 4WBGA 4E3MA 2XH9A 3ZVWA 2FZ0A 1W7FA 4LCMA 3FKWA 5EM1A 3M2JA 4R38A 1FQGA 3Q7VB 3QNBA 1MC0A 4WUJA 4GD6A 1TD5A 4YWZA 3PXPA 5HD5A 3C2WA 3LUQA 4JKTA 1H8YA 4KQRA 5J8XA 3T4TA 1IFQA 1OJ5A 2ZC3B 3DWZA 3RXWA 1L0GA 4R70A 4XT2A 3T4LA 1PIOA 4X6TA 3B33A 5TGFA 4ZDXA 3T1SA 1M40A 1T1BA 4OPZA 3N8LA 4ZJ1A 4M4XA 4EBLA 3LEZA 4GS9A 2ZBBA 1ESIA 1ERQA 4O0PA 4PM8A 2W3HA 1GHPA 3IBJA 3D4FA 4WLAA 3UPPA 5M1AA 4GS9B 3OPHA 2Z2MB 1ES2A 3HJKA 4MNRA 3SS3A 3G34A 3W4OA 1XX2A 1YLYA 4HBUA 1BT5A 1Y28A 5TJJA 5GHXA 1LSXA 4KZ3A 1SCWA 2H0TA 4R3BA 3OLOA 1NZUA 1N9BA 2UV0E 1RCJA 4WELA 4FCFA 3QP5A 3GDIA 1ALQA 4BJPA 3GQZA 1FCNA 2D02A 2NUPC 1OMEA 4KZAA 5EECA 1K6RA 1W79A 4G3KA 3ISGA 4EUZA 2B95A 1LLBA 2Y2QA 5HPIA 4MEZA 2J9PA 3CITA 3SS4A 1H3QA 1YKDA 4Y7PA 4IEDA 1YLWA 3GTCA 1W8QA 1IYQA 3E4OA 3Q81A 5FSRA 3BY8A 3CHWP 2QPNA 3BW6A 5A91A 2EWWA 2WUQA 2V9AA 3N6IA 1F2KA 3G32A 3VP0A 4MDZA 2FFYA 3R4KA 4LV1A 4B88A 4OP5A 3MMHA 3LIAA 1V9YA 2L4RA 1XGJA 4Q0IA 1KVMA 5CGSA 4LCLA 3ZHHA 1OTBA 3D3OA 3IWIA 2VEAA 4GLQA 5EE8A 1V9ZA 5CTMA 2W3FA 1FSWA 2JHEA 4DXCA 2DCFA 3GSGA 2VZWA 4N1XA 4OH0A 1PNEA 4GB7A 3FG8A 3NI9A 4R3AA 3HCYA 5EOOA 3LR0A 3BFEA 1K6SA 2OWHA 3SZTA 3L9KA 1MPLA 3F1PA 3N4IA 5A90A 4EQ1A 3T4KA 1BLSA 1YSQA 5FQKA 1PZOA 3UNWA 3G6OA 5DTTA 1DP6A 2HJ9C 1K4EA 1MWTA 5I5LA 2UWXA 5CERA 3WRZA 3IS2B 4KENB 5CRFA 3NECA 3WS4A 4IBRA 4X56A 2ZM8A 2IWBA 5FI6A 4WYYA 3GR2A 3HREA 4ZJ3A 2ZC5B 4Z9QA 3RXXA 3C30A 5DKLA 3S22A 3ZG0A 1PI5A 1K54C 1EWZA 1K57C 1N9LA 3O86A 4UEYA 4I39A 3T50A 4X53A 4I38A 1I2SA 4UA6A 1PFLA 3VOZA 1FCOA 2OLVA 1C3BA 2L1MA 2BG1A 1XP4A 2GZAA 5CX7A 4Q0HA 5FEGA 3CJMA 1MKIA 1PW8A 4NXFA 1GSWA 1OTEA 2VKSA 2QJ5A 2WGWA 3NDEA 4Y13A 5KZHA 2O9CA 1GCEA 3QHYA 4UA7A 2HDQA 1WA9A 2J3TC 3BWLA 1OTDA 2WGWB 4S2LA 3T1RA 4DDYA 4X55A 4S2IA 1FOFA 1AXBA 1FILA 2PD8A 5L10A 3VE3A 1NLZA 4OQHA 1TS7A 4FUWA 4HJ6A 3BJNA 4KUKA 4Q8IA 3CZDA 2VA0A 3BFFA 5M19A 3IX3A 3VP3A 3QP2A 1SDEA 5FAOA 4YFMA 1MKMA 3QP6A 4Y0OA 3T4JA 2W3EA 3UE0A 4HNBA 3CWFA 1EROA 1W8YA 2R78A 1MWUA 4RYEA 4S2NC 1QMFA 4JXVA 5AVEA 1D7EA 3ZDJA 1PWDA 4HJ4A 4FD8A 4E04A 3C7VA 1N9OA 5DFYA 1J9MA 4KQOA 4EXOA 4IBXA 1T1AA 4E6WA 1N4OA 3RFBA 1K38A 2ZMFA 1H8MA 2O99A 3BLMA 4GW9A 1K54A 3M6HA 1K57A 3ZGAB 5DVAA 1P0ZA 5HAIA 4LRXC 1KVLA 2HF6A 2R9XA 2PYRA 4KZ9A 2WADA 3RJUA 4F94A 5FATA 1SDNA 2MJ6A 3T1XA 4ARZA 4ME4A 5CEDA 5F5YA 1S0WA 5HARA 1F98A 5E2FA 3R7WA 2G2WA 5FQJA 3IF6C 4MN5A 4Z1WA 4DF6A 4QHCA 1ZG4A 3NULA 4KUOA 1W5DA 3PYPA 2WYXA 2XR0A 1DJAA 1L3LA 2EA9A 4GD8A 3A3JA 4UHUA 3NJAA 5HWVA 1GA0A 1JTDA 5HL1A 3EGDC 1KGFA 1TF1A 2W1TA 1FIKA 3CPTB 4WMCA 3IH9A 2BLSA 5FAPA 3LR5A 1O7EA 4XUZA 5M18A 2W1TB 3GRJA 5CGXA 2ZM2A 4NG2A 1LL8A 3MBZA 3MQ0A 3QP8A 3C4PA 1NWZA 1YM1A 3DTEA 3UDFA 2WZZA 1HZOA 4XUXA 1G28A 4PM6A 1F9IA 5GHYA 1G6AA 3IWOA 3LICA 3S7NA 4CQHA 1PW1A 3D9YA 1PI4A 4BL3A 1JNUA 3SW1A 4YOFA 4PM9A 1PWGA 4CPKA 5EVIC 3WS2A 3IWQA 3JVVA 3P09A 3MXSA 1IYPA 5EOEA 2A49A 2XDMA 2JCHA 4C6YA 2JKGA 3MQOA 4GCZA 3BYDA 1IKIA 4B9OA 5GLDA 4HI4A 3PBOA 1RGZA 4KG2A 4GKUA 4R4RA 4Y17A 1CF0A 2J8YA 2B5RA 1ZTUA 2DNSA 5AQ7A 2GDNA 3IF6A 1KOUA 3IBRA 1K55C 3EEHA 1NYMA 2P74A 1MBLA 1LHYA 4I3JA 3UB7A 3NHQA 3IF6B 3F1OA 2A24A 2WGIA 4KQQA 4IJGA 4WZ5C 2Y2JA 3H82A 2D01A 2ZQCA 3FPWA 3KYZA 2X01A 4P87A 4JXSA 3F1OB 3VV4A 2A24B 1AWIA 3GV9A 2KX6A 2Y2HA 3UB5P 3HLBA 2V1AA 1BSGA 5CEBA 1M6KA 2CC1A 3TSGA
chains in the Genus database with same CATH topology
4JF4A 4OOYA 5DF9A 1TDLA 2QPNA 1ONGA 3HUNA 2Y91A 5A91A 3NY4A 4DE3A 1E4DA 2WUQA 5KSHA 4JXGA 3NC8A 3IQAA 3N6IA 2WKIA 4JPMA 5FAQA 5E2EA 4WZ4A 3G32A 3IXDA 3ZG5A 1ZC2A 3ITAA 3VP0A 2FFYA 5CHUA 2EXBA 3G31A 4LV1A 2ZQ8A 3N7WA 4B88A 3V50A 3A3IA 1BUEA 4OP5A 3TG9A 1RGYA 4C75A 4OOMA 1U60A 3GVBA 3DWKA 2DRWA 5EVID 3HLCA 3PBSA 1XGJA 4EV4A 3A3FA 3FYZA 4X69A 1KVMA 1WYCA 5CGSA 4LCLA 3ZHHA 3C4OA 3CMZA 1MWSA 3IWIA 3VP1A 1BULA 4S2KA 1PZPA 5EE8A 5CTMA 4A5RA 1FCMA 1FSWA 2Y59A 1ZG6A 2R9WA 1XA7A 4DXCA 2DCFA 2ZC7A 3GSGA 3PAEA 1LI9A 1ES3A 3MKEA 3HVFA 5HAQA 4N1XA 5EVIA 3HLEA 4GZBA 5E2GA 4OH0A 2JE5A 4E3NA 4GB7A 3NI9A 5EOOA 1FR1A 4OKPA 3BFEA 4N9KA 1K6SA 4UAAA 2P9VA 3V5MA 4N9LA 4QU3A 5U47A 4KZBA 2Y2LA 3BECA 1MPLA 3N4IA 1XKZA 4S2OA 1CEFA 2ZQDA 3IXGA 4DXBA 2Y2OA 5A90A 1VM1A 5AQBA 4OQGA 3VSKA 4UA9A 4NK3A 4OPRA 3VMAA 1BLSA 4JF6A 5FQKA 1PZOA 4KZ8A 4ZTKA 3UNWA 5FI2A 1DJBA 5GHZA 3SH9A 5DTTA 4KZ5A 1K4EA 2P9VB 1E3UD 2ZQAA 1MWTA 4DE0A 3G2YA 2XD5A 3WS0A 1NRFA 2UWXA 2ZQ7A 3N8SA 1IYOA 5CERA 4N1HA 3WRZA 4L0LA 5A92A 3VOYA 2ZD8A 3NIAA 5TR7A 4PM7A 2XEPA 3PTEA 3TOIA 1BLPA 2OLUA 1IYSA 4BL2A 4OVDA 1H8ZA 4KENB 5F82A 1FSYA 5CRFA 3HUMA 2JBFA 4XXRA 4RX3A 3WS4A 4IBRA 3BFCA 4MLLA 1K55A 2ZMAA 1E3UA 1BLHA 1LL9A 2ZM8A 1L2SA 4LV0A 4OOLA 4X56A 1HD8A 4OLGA 2IWBA 4BD0A 3BFGA 5FI6A 5CECA 1YLPA 4WYYA 2XK1A 3GR2A 3HREA 5IHVA 1K4FA 2H0YA 1NZOA 4ZJ3A 2ZC5B 4Z9QA 3RXXA 3UO9A 1DY6A 1JTGA 4QB8A 4BENA 4WZ5A 3S22A 3ZG0A 1PI5A 1L0EA 1K54C 1EWZA 1K57C 2HDUA 3O86A 3EQVA 2V2FF 1HVBA 4X53A 1I2SA 4RX2A 2RCXA 1BZAA 3HLGA 4R3JA 4E3OA 1O07A 2WGVA 4UA6A 3BM6A 1JVJA 1K25A 3BLSA 3VOZA 1FCOA 3G35A 2OLVA 3ZNYA 1C3BA 1WYBA 2J9OA 3DW0A 2BG1A 1XP4A 4WM9A 1ERMA 1TDGA 4RVAA 1MXOA 4K0WA 3CJMA 1MKIA 3WS1A 1PW8A 5HX9A 1NXYA 2VGKA 2HPBA 2IWDA 5JYPA 3V39A 4FSFA 4DE1A 1JWVA 2A3UA 3HUOA 4OPQA 2WGWA 3NDEA 3LO7A 5KZHA 3W4QA 3FZCA 4C3QA 1TEMA 4GDBA 1YLTA 3IF5A 3OCNA 4WMCD 5HW3A 3G2ZA 1GCEA 3QHYA 2Y2PA 3G30A 1G68A 4UA7A 2HDRA 2HDQA 4LENA 3P98A 3WRTA 3Q7VA 2OV5A 4PPRA 1YT4A 2PBYA 3FKVA 3I7JA 3M6BA 4M3KA 1YMSA 1NJ4A 1SHVA 2WGWB 5CHMA 5I94A 1ES4A 1WE4A 4KZ4A 5E2HA 3WWXA 5DTSA 1HTZA 1ESUA 4S2LA 4DDYA 4Y0TA 4FH4A 4X55A 3LY4A 4S2IA 1FOFA 5TFQA 1Y54A 3PBNA 5CTNA 4U0TA 4S2JA 1AXBA 3G4PA 2EFXA 3SH7A 4OQ0A 5DTKA 2OSUA 4BLMA 1IKGA 3JYIA 2HP9A 4OQHA 1L0DA 3BEBA 3V3RA 4DE2A 5DF7A 1YQSA 2Y4AA 2H5SA 2XFTA 2Z2LB 2VGJA 3C7UA 4Q8IA 3CZDA 4WEJA 2I72A 2ZQ9A 3BFFA 5M19A 4U0XA 2XD1A 1JWZA 3VP3A 3IT9A 4DKIA 2PU4A 2WZXA 1YLZA 2RL3A 1GHIA 1MY8A 3OZHA 1SDEA 4B4XA 5FAOA 4YFMA 4QY5A 2HP5A 3NBLA 3MKFA 3N8RA 4Y0OA 3E2KA 5E43A 4Y0UA 1NY0A 4X68A 3AGDA 3ITBA 5BOHA 3UE0A 1E25A 5KSCA 1KGGA 4K0XA 4IVKA 5KMWA 2ZM0A 3MZDA 4S2NA 5AQ9A 4QD4A 2Y2GA 4K91A 5EVIB 5FQIA 3UDIA 1ZKJA 3NDGA 1EROA 3WS5A 1YMXA 4JLFA 4R23A 1W8YA 2IWCA 1MWUA 3IXBA 4RYEA 1DJCA 1KGEA 4S2NC 3FV7A 5CXWA 1QMFA 4JXVA 3SH8A 3ZDJA 2Y55A 1PWDA 3IH8A 4FD8A 3SS5A 3C7VA 3UPNA 5D3OA 4BD1A 3UN7A 1J9MA 1RP5A 3OPLA 3MZFA 4KQOA 5CGWA 2PU2A 3Q7ZA 4D2OA 2EX8A 2EFUA 4IBXA 2HDSA 2Y2KA 3IHBA 5HFOA 2Y2NA 4E6WA 4HEFA 2Q9NA 1N4OA 2ZJ9A 3OCLA 4JBFA 4R4SA 3ZNTA 4KG5A 1K38A 4GOGA 2HP6A 4OLDA 2QZ6A 2Y2IA 1IELA 1LI0A 5FI7A 3BLMA 4ID4A 4ZAMA 2C5WB 1GHMA 1K54A 1K57A 3LCEA 3M6HA 3ZGAB 4E3JA 5DVAA 5HAIA 3HL9A 3OPPA 1Z6FA 1KVLA 3MFDA 2V1ZA 5GL9A 1CEGA 3VFFA 4GDNA 2Q9MA 2R9XA 4MBHA 3UPOA 1JWPA 4KZ9A 4OQIA 2WADA 1S6RA 2ZC6B 4E6XA 2EX9A 3RJUA 4F94A 2JC7A 5FASA 1H5XA 5F1GA 4QJGA 5FATA 1SDNA 4KZ6A 4HBTA 3PBTA 1TVFA 3W4PA 3OPRA 4CJNA 3VP4A 5CEDA 3IXHA 1S0WA 5HARA 2V20A 5EPHA 3O87A 1CI9A 3PAGA 4HESA 1IEMA 3VFHA 5E2FA 3AGFA 2G2WA 5AQAA 5FQJA 2XLNA 3IF6C 1YLJA 4N92A 4IVIA 4E3LA 4R1GA 4DF6A 1L0FA 4QHCA 2X02A 1ZG4A 3ZG7B 1XPBA 3MZEA 4OPYA 1W5DA 4P0MA 3HLFA 3UDXA 2WYXA 2XR0A 1DJAA 5DF8A 1MWRA 1I2WA 5HAPA 3V3SA 3GMWA 4P85A 5FQQA 1KDWA 4H8RA 5CHJA 4E3IA 4GD8A 1BLCA 1K56D 3A3JA 4UHUA 4O7DA 3QNCA 4P6BA 2QMIA 3IHAA 4S2PA 4ZBEA 4FH2A 1CI8A 4WBGA 4E3MA 5JYOA 1GA0A 2J7VA 2XH9A 4RA7A 1JTDA 3ZVWA 5HL1A 4PMAA 1KGFA 1W7FA 4NETA 4EBPA 3DTMA 4LCMA 3FKWA 5EUAA 3M2JA 5G18A 3ZVTA 3ZG9B 4JF5A 1FQGA 4WMCA 3Q7VB 3IH9A 1KE4A 2BLSA 4GN2A 5FAPA 3QNBA 2WK0A 4R0QA 2EXAA 5F83A 1K56A 4GD6A 4DRTA 1VQQA 1O7EA 4XUZA 1ONHA 3AGEA 3MXRA 5M18A 3GRJA 3BFDA 5CGXA 4JKTA 2ZM2A 4MBFA 5A93A 4EQIA 1H8YA 3UE3A 3MBZA 4JXWA 2C6WB 1PWCA 4KQRA 5J8XA 4DDSA 2ZC3B 3C4PA 3DWZA 1YM1A 3RXWA 3O88A 1XGIA 3LY3A 3UE1A 1L0GA 1PIOA 3UDFA 2WZZA 4X6TA 1KE0A 1HZOA 4XUXA 5TGFA 3VSLA 4ZDXA 5FQ9A 3O3VA 4PM6A 1BTLA 3Q1FA 1M40A 5GHYA 4OPZA 3N8LA 4ZJ1A 1G6AA 3VP2A 4EBLA 2H10A 3HLWA 3LEZA 2XGNA 3IWOA 5EVLA 3A3DA 1PW1A 1PI4A 1ESIA 1ERQA 4B4ZA 4BL3A 1XA1A 4PM8A 5GLAA 1GHPA 3B3XA 3A3EA 4PM9A 1PWGA 3D4FA 4CPKA 3FWLA 5EVIC 4EBNA 3WS2A 1Q2QA 2ZC4B 3IWQA 2WKEA 3P09A 2ZLYA 3MXSA 4ZJ2A 3UPPA 3ZCZA 3C5AA 4OP8A 1IYPA 5M1AA 5EOEA 2A49A 4WEKA 2XDMA 3OPHA 2JCHA 3NCKA 3CG5A 3M2KA 4C6YA 4S2MA 5FSRA 2FFFB 4BQMA 1SKFA 4GNUA 2Z2MB 1ES2A 2G2UA 4MNRA 1QMEA 2X71A 3BYDA 3SS3A 3G34A 1IKIA 2Y2MA 3PBQA 5FDHA 3SOIA 3W4OA 1XX2A 1YLYA 4HBUA 1GA9A 5GLDA 1BT5A 3PBOA 1RGZA 4KG2A 4GKUA 5GLBA 4R4RA 3EQUA 5GHXA 1I5QA 2J8YA 4OONA 2B5RA 3E2LA 1Q2PA 2DNSA 1LL5A 3HBRA 4KZ3A 5AQ7A 1SCWA 5FQMA 3W8KA 2H0TA 4R3BA 2GDNA 3IF6A 3UY6A 1NZUA 1XXMA 3Q82A 4KZ7A 1N9BA 1RCJA 2XFSA 2E8IA 4FCFA 2WKHA 4WELA 4MBKA 5F1FA 1FR6A 1ALQA 1K55C 4YINA 4BJPA 3GQZA 3S1YA 1FCNA 2WAFA 1NYMA 2P74A 3HLDA 1MBLA 1OMEA 4KZAA 5EECA 1K6RA 1LHYA 4KG6A 5FA7A 4EWFA 1W79A 3IF6B 2WGIA 4PM5A 1NYYA 1KE3A 2EX6A 1CK3A 3ISGA 4KQQA 1KDSA 4WZ5C 2Y2JA 3BRMA 3ZFZA 3S4XA 4EUZA 1LLBA 2Y2QA 4MEZA 4U3TA 1ES5A 2J9PA 3SS4A 2ZQCA 2X01A 2XF3A 3OC2A 4LV3A 4P87A 3ZG8B 4JXSA 4Y7PA 3GV9A 4IEDA 3PBRA 1YLWA 2Y2HA 3GTCA 1W8QA 2WAEA 3HLBA 1BSGA 4QY6A 4E3KA 1M6KA 5CEBA 1IYQA 5GLCA 1EI5A 1PYYA 2CC1A 5L2FA 3Q07A 3TSGA 2EX2A 2XQZA 3Q81A 4LV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JF4 A;  4OOY A;  5DF9 A;  1TDL A;  2QPN A;  1ONG A;  3HUN A;  2Y91 A;  5A91 A;  3NY4 A;  4DE3 A;  1E4D A;  2WUQ A;  5KSH A;  4JXG A;  3NC8 A;  3IQA A;  3N6I A;  2WKI A;  4JPM A;  5FAQ A;  5E2E A;  4WZ4 A;  3G32 A;  3IXD A;  3ZG5 A;  1ZC2 A;  3ITA A;  3VP0 A;  2FFY A;  5CHU A;  2EXB A;  3G31 A;  4LV1 A;  2ZQ8 A;  3N7W A;  4B88 A;  3V50 A;  3A3I A;  1BUE A;  4OP5 A;  3TG9 A;  1RGY A;  4C75 A;  4OOM A;  1U60 A;  3GVB A;  3DWK A;  2DRW A;  5EVI D;  3HLC A;  3PBS A;  1XGJ A;  4EV4 A;  3A3F A;  3FYZ A;  4X69 A;  1KVM A;  1WYC A;  5CGS A;  4LCL A;  3ZHH A;  3C4O A;  3CMZ A;  1MWS A;  3IWI A;  3VP1 A;  1BUL A;  4S2K A;  1PZP A;  5EE8 A;  5CTM A;  4A5R A;  1FCM A;  1FSW A;  2Y59 A;  1ZG6 A;  2R9W A;  1XA7 A;  4DXC A;  2DCF A;  2ZC7 A;  3GSG A;  3PAE A;  1LI9 A;  1ES3 A;  3MKE A;  3HVF A;  5HAQ A;  4N1X A;  5EVI A;  3HLE A;  4GZB A;  5E2G A;  4OH0 A;  2JE5 A;  4E3N A;  4GB7 A;  3NI9 A;  5EOO A;  1FR1 A;  4OKP A;  3BFE A;  4N9K A;  1K6S A;  4UAA A;  2P9V A;  3V5M A;  4N9L A;  4QU3 A;  5U47 A;  4KZB A;  2Y2L A;  3BEC A;  1MPL A;  3N4I A;  1XKZ A;  4S2O A;  1CEF A;  2ZQD A;  3IXG A;  4DXB A;  2Y2O A;  5A90 A;  1VM1 A;  5AQB A;  4OQG A;  3VSK A;  4UA9 A;  4NK3 A;  4OPR A;  3VMA A;  1BLS A;  4JF6 A;  5FQK A;  1PZO A;  4KZ8 A;  4ZTK A;  3UNW A;  5FI2 A;  1DJB A;  5GHZ A;  3SH9 A;  5DTT A;  4KZ5 A;  1K4E A;  2P9V B;  1E3U D;  2ZQA A;  1MWT A;  4DE0 A;  3G2Y A;  2XD5 A;  3WS0 A;  1NRF A;  2UWX A;  2ZQ7 A;  3N8S A;  1IYO A;  5CER A;  4N1H A;  3WRZ A;  4L0L A;  5A92 A;  3VOY A;  2ZD8 A;  3NIA A;  5TR7 A;  4PM7 A;  2XEP A;  3PTE A;  3TOI A;  1BLP A;  2OLU A;  1IYS A;  4BL2 A;  4OVD A;  1H8Z A;  4KEN B;  5F82 A;  1FSY A;  5CRF A;  3HUM A;  2JBF A;  4XXR A;  4RX3 A;  3WS4 A;  4IBR A;  3BFC A;  4MLL A;  1K55 A;  2ZMA A;  1E3U A;  1BLH A;  1LL9 A;  2ZM8 A;  1L2S A;  4LV0 A;  4OOL A;  4X56 A;  1HD8 A;  4OLG A;  2IWB A;  4BD0 A;  3BFG A;  5FI6 A;  5CEC A;  1YLP A;  4WYY A;  2XK1 A;  3GR2 A;  3HRE A;  5IHV A;  1K4F A;  2H0Y A;  1NZO A;  4ZJ3 A;  2ZC5 B;  4Z9Q A;  3RXX A;  3UO9 A;  1DY6 A;  1JTG A;  4QB8 A;  4BEN A;  4WZ5 A;  3S22 A;  3ZG0 A;  1PI5 A;  1L0E A;  1K54 C;  1EWZ A;  1K57 C;  2HDU A;  3O86 A;  3EQV A;  2V2F F;  1HVB A;  4X53 A;  1I2S A;  4RX2 A;  2RCX A;  1BZA A;  3HLG A;  4R3J A;  4E3O A;  1O07 A;  2WGV A;  4UA6 A;  3BM6 A;  1JVJ A;  1K25 A;  3BLS A;  3VOZ A;  1FCO A;  3G35 A;  2OLV A;  3ZNY A;  1C3B A;  1WYB A;  2J9O A;  3DW0 A;  2BG1 A;  1XP4 A;  4WM9 A;  1ERM A;  1TDG A;  4RVA A;  1MXO A;  4K0W A;  3CJM A;  1MKI A;  3WS1 A;  1PW8 A;  5HX9 A;  1NXY A;  2VGK A;  2HPB A;  2IWD A;  5JYP A;  3V39 A;  4FSF A;  4DE1 A;  1JWV A;  2A3U A;  3HUO A;  4OPQ A;  2WGW A;  3NDE A;  3LO7 A;  5KZH A;  3W4Q A;  3FZC A;  4C3Q A;  1TEM A;  4GDB A;  1YLT A;  3IF5 A;  3OCN A;  4WMC D;  5HW3 A;  3G2Z A;  1GCE A;  3QHY A;  2Y2P A;  3G30 A;  1G68 A;  4UA7 A;  2HDR A;  2HDQ A;  4LEN A;  3P98 A;  3WRT A;  3Q7V A;  2OV5 A;  4PPR A;  1YT4 A;  2PBY A;  3FKV A;  3I7J A;  3M6B A;  4M3K A;  1YMS A;  1NJ4 A;  1SHV A;  2WGW B;  5CHM A;  5I94 A;  1ES4 A;  1WE4 A;  4KZ4 A;  5E2H A;  3WWX A;  5DTS A;  1HTZ A;  1ESU A;  4S2L A;  4DDY A;  4Y0T A;  4FH4 A;  4X55 A;  3LY4 A;  4S2I A;  1FOF A;  5TFQ A;  1Y54 A;  3PBN A;  5CTN A;  4U0T A;  4S2J A;  1AXB A;  3G4P A;  2EFX A;  3SH7 A;  4OQ0 A;  5DTK A;  2OSU A;  4BLM A;  1IKG A;  3JYI A;  2HP9 A;  4OQH A;  1L0D A;  3BEB A;  3V3R A;  4DE2 A;  5DF7 A;  1YQS A;  2Y4A A;  2H5S A;  2XFT A;  2Z2L B;  2VGJ A;  3C7U A;  4Q8I A;  3CZD A;  4WEJ A;  2I72 A;  2ZQ9 A;  3BFF A;  5M19 A;  4U0X A;  2XD1 A;  1JWZ A;  3VP3 A;  3IT9 A;  4DKI A;  2PU4 A;  2WZX A;  1YLZ A;  2RL3 A;  1GHI A;  1MY8 A;  3OZH A;  1SDE A;  4B4X A;  5FAO A;  4YFM A;  4QY5 A;  2HP5 A;  3NBL A;  3MKF A;  3N8R A;  4Y0O A;  3E2K A;  5E43 A;  4Y0U A;  1NY0 A;  4X68 A;  3AGD A;  3ITB A;  5BOH A;  3UE0 A;  1E25 A;  5KSC A;  1KGG A;  4K0X A;  4IVK A;  5KMW A;  2ZM0 A;  3MZD A;  4S2N A;  5AQ9 A;  4QD4 A;  2Y2G A;  4K91 A;  5EVI B;  5FQI A;  3UDI A;  1ZKJ A;  3NDG A;  1ERO A;  3WS5 A;  1YMX A;  4JLF A;  4R23 A;  1W8Y A;  2IWC A;  1MWU A;  3IXB A;  4RYE A;  1DJC A;  1KGE A;  4S2N C;  3FV7 A;  5CXW A;  1QMF A;  4JXV A;  3SH8 A;  3ZDJ A;  2Y55 A;  1PWD A;  3IH8 A;  4FD8 A;  3SS5 A;  3C7V A;  3UPN A;  5D3O A;  4BD1 A;  3UN7 A;  1J9M A;  1RP5 A;  3OPL A;  3MZF A;  4KQO A;  5CGW A;  2PU2 A;  3Q7Z A;  4D2O A;  2EX8 A;  2EFU A;  4IBX A;  2HDS A;  2Y2K A;  3IHB A;  5HFO A;  2Y2N A;  4E6W A;  4HEF A;  2Q9N A;  1N4O A;  2ZJ9 A;  3OCL A;  4JBF A;  4R4S A;  3ZNT A;  4KG5 A;  1K38 A;  4GOG A;  2HP6 A;  4OLD A;  2QZ6 A;  2Y2I A;  1IEL A;  1LI0 A;  5FI7 A;  3BLM A;  4ID4 A;  4ZAM A;  2C5W B;  1GHM A;  1K54 A;  1K57 A;  3LCE A;  3M6H A;  3ZGA B;  4E3J A;  5DVA A;  5HAI A;  3HL9 A;  3OPP A;  1Z6F A;  1KVL A;  3MFD A;  2V1Z A;  5GL9 A;  1CEG A;  3VFF A;  4GDN A;  2Q9M A;  2R9X A;  4MBH A;  3UPO A;  1JWP A;  4KZ9 A;  4OQI A;  2WAD A;  1S6R A;  2ZC6 B;  4E6X A;  2EX9 A;  3RJU A;  4F94 A;  2JC7 A;  5FAS A;  1H5X A;  5F1G A;  4QJG A;  5FAT A;  1SDN A;  4KZ6 A;  4HBT A;  3PBT A;  1TVF A;  3W4P A;  3OPR A;  4CJN A;  3VP4 A;  5CED A;  3IXH A;  1S0W A;  5HAR A;  2V20 A;  5EPH A;  3O87 A;  1CI9 A;  3PAG A;  4HES A;  1IEM A;  3VFH A;  5E2F A;  3AGF A;  2G2W A;  5AQA A;  5FQJ A;  2XLN A;  3IF6 C;  1YLJ A;  4N92 A;  4IVI A;  4E3L A;  4R1G A;  4DF6 A;  1L0F A;  4QHC A;  2X02 A;  1ZG4 A;  3ZG7 B;  1XPB A;  3MZE A;  4OPY A;  1W5D A;  4P0M A;  3HLF A;  3UDX A;  2WYX A;  2XR0 A;  1DJA A;  5DF8 A;  1MWR A;  1I2W A;  5HAP A;  3V3S A;  3GMW A;  4P85 A;  5FQQ A;  1KDW A;  4H8R A;  5CHJ A;  4E3I A;  4GD8 A;  1BLC A;  1K56 D;  3A3J A;  4UHU A;  4O7D A;  3QNC A;  4P6B A;  2QMI A;  3IHA A;  4S2P A;  4ZBE A;  4FH2 A;  1CI8 A;  4WBG A;  4E3M A;  5JYO A;  1GA0 A;  2J7V A;  2XH9 A;  4RA7 A;  1JTD A;  3ZVW A;  5HL1 A;  4PMA A;  1KGF A;  1W7F A;  4NET A;  4EBP A;  3DTM A;  4LCM A;  3FKW A;  5EUA A;  3M2J A;  5G18 A;  3ZVT A;  3ZG9 B;  4JF5 A;  1FQG A;  4WMC A;  3Q7V B;  3IH9 A;  1KE4 A;  2BLS A;  4GN2 A;  5FAP A;  3QNB A;  2WK0 A;  4R0Q A;  2EXA A;  5F83 A;  1K56 A;  4GD6 A;  4DRT A;  1VQQ A;  1O7E A;  4XUZ A;  1ONH A;  3AGE A;  3MXR A;  5M18 A;  3GRJ A;  3BFD A;  5CGX A;  4JKT A;  2ZM2 A;  4MBF A;  5A93 A;  4EQI A;  1H8Y A;  3UE3 A;  3MBZ A;  4JXW A;  2C6W B;  1PWC A;  4KQR A;  5J8X A;  4DDS A;  2ZC3 B;  3C4P A;  3DWZ A;  1YM1 A;  3RXW A;  3O88 A;  1XGI A;  3LY3 A;  3UE1 A;  1L0G A;  1PIO A;  3UDF A;  2WZZ A;  4X6T A;  1KE0 A;  1HZO A;  4XUX A;  5TGF A;  3VSL A;  4ZDX A;  5FQ9 A;  3O3V A;  4PM6 A;  1BTL A;  3Q1F A;  1M40 A;  5GHY A;  4OPZ A;  3N8L A;  4ZJ1 A;  1G6A A;  3VP2 A;  4EBL A;  2H10 A;  3HLW A;  3LEZ A;  2XGN A;  3IWO A;  5EVL A;  3A3D A;  1PW1 A;  1PI4 A;  1ESI A;  1ERQ A;  4B4Z A;  4BL3 A;  1XA1 A;  4PM8 A;  5GLA A;  1GHP A;  3B3X A;  3A3E A;  4PM9 A;  1PWG A;  3D4F A;  4CPK A;  3FWL A;  5EVI C;  4EBN A;  3WS2 A;  1Q2Q A;  2ZC4 B;  3IWQ A;  2WKE A;  3P09 A;  2ZLY A;  3MXS A;  4ZJ2 A;  3UPP A;  3ZCZ A;  3C5A A;  4OP8 A;  1IYP A;  5M1A A;  5EOE A;  2A49 A;  4WEK A;  2XDM A;  3OPH A;  2JCH A;  3NCK A;  3CG5 A;  3M2K A;  4C6Y A;  4S2M A;  5FSR A;  2FFF B;  4BQM A;  1SKF A;  4GNU A;  2Z2M B;  1ES2 A;  2G2U A;  4MNR A;  1QME A;  2X71 A;  3BYD A;  3SS3 A;  3G34 A;  1IKI A;  2Y2M A;  3PBQ A;  5FDH A;  3SOI A;  3W4O A;  1XX2 A;  1YLY A;  4HBU A;  1GA9 A;  5GLD A;  1BT5 A;  3PBO A;  1RGZ A;  4KG2 A;  4GKU A;  5GLB A;  4R4R A;  3EQU A;  5GHX A;  1I5Q A;  2J8Y A;  4OON A;  2B5R A;  3E2L A;  1Q2P A;  2DNS A;  1LL5 A;  3HBR A;  4KZ3 A;  5AQ7 A;  1SCW A;  5FQM A;  3W8K A;  2H0T A;  4R3B A;  2GDN A;  3IF6 A;  3UY6 A;  1NZU A;  1XXM A;  3Q82 A;  4KZ7 A;  1N9B A;  1RCJ A;  2XFS A;  2E8I A;  4FCF A;  2WKH A;  4WEL A;  4MBK A;  5F1F A;  1FR6 A;  1ALQ A;  1K55 C;  4YIN A;  4BJP A;  3GQZ A;  3S1Y A;  1FCN A;  2WAF A;  1NYM A;  2P74 A;  3HLD A;  1MBL A;  1OME A;  4KZA A;  5EEC A;  1K6R A;  1LHY A;  4KG6 A;  5FA7 A;  4EWF A;  1W79 A;  3IF6 B;  2WGI A;  4PM5 A;  1NYY A;  1KE3 A;  2EX6 A;  1CK3 A;  3ISG A;  4KQQ A;  1KDS A;  4WZ5 C;  2Y2J A;  3BRM A;  3ZFZ A;  3S4X A;  4EUZ A;  1LLB A;  2Y2Q A;  4MEZ A;  4U3T A;  1ES5 A;  2J9P A;  3SS4 A;  2ZQC A;  2X01 A;  2XF3 A;  3OC2 A;  4LV3 A;  4P87 A;  3ZG8 B;  4JXS A;  4Y7P A;  3GV9 A;  4IED A;  3PBR A;  1YLW A;  2Y2H A;  3GTC A;  1W8Q A;  2WAE A;  3HLB A;  1BSG A;  4QY6 A;  4E3K A;  1M6K A;  5CEB A;  1IYQ A;  5GLC A;  1EI5 A;  1PYY A;  2CC1 A;  5L2F A;  3Q07 A;  3TSG A;  2EX2 A;  2XQZ A;  3Q81 A;  4LV2 A; 
#chains in the Genus database with same CATH topology
 1ONG A;  4LLO B;  5KIZ A;  2Y91 A;  1W63 M;  3LIF A;  5KSH A;  3NC8 A;  5E2E A;  1D1J A;  3IXD A;  3N7W A;  3V50 A;  1BUE A;  3TG9 A;  4LRZ E;  4C75 A;  4GJ4 A;  5EVI D;  4EV4 A;  3A3F A;  1WYC A;  4ZRR A;  3UB6 A;  2L0W A;  4BBV A;  4A5R A;  4I3I A;  2R9W A;  1XA7 A;  3NOT C;  2ZC7 A;  1LI9 A;  1ES3 A;  1UWN X;  3MKE A;  5EVI A;  4GZB A;  5E2G A;  3VE4 A;  4E3N A;  1XJ6 A;  4XT2 B;  4OKP A;  3T1Q B;  3FPV A;  2OAP 1;  4UAA A;  3BEC A;  1XKZ A;  3IXG A;  4DXB A;  2Y2O A;  1XJ2 A;  5AQB A;  3VSK A;  4OPR A;  4JF6 A;  4KZ8 A;  4ZTK A;  1DJB A;  3SH9 A;  5AJG A;  4KZ5 A;  1OT6 A;  1NRF A;  3N8S A;  4N1H A;  5A92 A;  5DJU A;  4PM7 A;  2A2L A;  3PTE A;  3TOI A;  1BLP A;  2OLU A;  4DJ3 A;  4OVD A;  2O9B A;  3S7P A;  4EET B;  3BFC A;  2O9A A;  1K55 A;  3UME A;  4LV0 A;  1L2S A;  1HD8 A;  5F69 A;  4OLG A;  3A0S A;  1DP8 A;  5CEC A;  2XK1 A;  3H9W A;  5IHV A;  2H0Y A;  1J3W A;  1DY6 A;  1IOU A;  4QB8 A;  4WZ5 A;  5F6A A;  4LRY C;  1S4S A;  4JGP A;  2HDU A;  2V2F F;  1S67 L;  1OTA A;  3PR6 A;  1G5U A;  1BZA A;  3HLG A;  4R3J A;  4E3O A;  2M1C A;  3MS6 A;  3BM6 A;  4PHT A;  3E4Q A;  1DP9 A;  1WYB A;  4BMW A;  3DW0 A;  2FH5 A;  4EES A;  2CMN A;  2M7V A;  1NXY A;  2VGK A;  2HPB A;  3MJQ A;  1JWV A;  3U2A A;  3HUO A;  4OPQ A;  3LO7 A;  3W4Q A;  4HP9 A;  3FZC A;  4GDB A;  1YLT A;  5HW3 A;  3G2Z A;  4D60 A;  4LEN A;  3P98 A;  4HP4 A;  4PPR A;  1YT4 A;  2PBY A;  2J3W A;  3V67 A;  4M3K A;  1YMS A;  3S7Q A;  1SHV A;  5CHM A;  5I94 A;  3WWX A;  1HTZ A;  3D72 A;  1ESU A;  5C5K A;  5TFQ A;  1Y54 A;  3PBN A;  5CTN A;  3TRC A;  3TJZ C;  3G4P A;  5DFX A;  1TS8 A;  4OQ0 A;  5DTK A;  4BLM A;  3JYI A;  2HP9 A;  3BEB A;  1S66 L;  2H5S A;  3QP4 A;  1JWZ A;  2XD1 A;  4DKI A;  3IT9 A;  1BYW A;  2E8J A;  1VHM A;  2PAV P;  3CI6 A;  3NBL A;  4Y0U A;  4X68 A;  2XRO A;  3AGD A;  5BOH A;  2J80 A;  4II7 A;  4K0X A;  2QJ7 A;  4IVK A;  5KMW A;  2ZM0 A;  3MZD A;  5AQ9 A;  1ZKJ A;  3WS5 A;  4JLF A;  3BQ8 A;  1TS6 A;  3IXB A;  1DJC A;  5CXW A;  5IS1 A;  3F1P B;  2JKR M;  2KOI A;  3SS5 A;  1ACF A;  4BD1 A;  2W3G A;  3RTY A;  1RP5 A;  2G7U A;  4O01 A;  2PR6 A;  3MZF A;  2PU2 A;  3Q7Z A;  1T1C A;  3IHB A;  2Y2N A;  4HEF A;  3OCL A;  2ZJ9 A;  4JBF A;  3ZNT A;  3IX8 A;  4GOG A;  1LI0 A;  2ZL1 A;  4ID4 A;  4E3J A;  1S1Z A;  3HL9 A;  1Z6F A;  5GL9 A;  3UPO A;  4MBH A;  1D06 A;  1JWP A;  5HL6 A;  4OQI A;  2EX9 A;  3S7O A;  3ZYT A;  1H5X A;  5F1G A;  5FAS A;  4QJG A;  5TBM A;  1EW0 A;  4CJN A;  3C8C A;  5EPH A;  4DJ2 A;  3O87 A;  3TE8 A;  1CI9 A;  3PAG A;  4GHI A;  1IEM A;  5AQA A;  1YLJ A;  4IVI A;  3KSF A;  5TBM B;  1L0F A;  1OJG A;  4RQ9 A;  1XPB A;  3MZE A;  3HLF A;  4GHI B;  1MWR A;  1I2W A;  5HDS A;  4QWO A;  5HZH A;  2HZ5 A;  4E3I A;  4FH2 A;  1CI8 A;  3MSH A;  4Q0J A;  5JYO A;  3MF0 A;  5IT5 A;  3F1N A;  4RA7 A;  2GX5 A;  4PMA A;  3DTM A;  4WN5 A;  5EUA A;  1XJ4 A;  3ZG9 B;  4JF5 A;  2WK0 A;  4R0Q A;  2EXA A;  5F83 A;  5J7E A;  2K31 A;  1VQQ A;  4BBT A;  2IA2 A;  1ONH A;  3AGE A;  3BFD A;  5A93 A;  4JXW A;  3UB8 A;  2C6W B;  1PWC A;  4DDS A;  2ZOH A;  3O88 A;  1XGI A;  3UE1 A;  3DAV A;  1ZHH B;  3VSL A;  5FQ9 A;  1LSW A;  2QKP A;  1BTL A;  2PR5 A;  2XGN A;  2P7J A;  4B4Z A;  3B3X A;  1CJF A;  3A3E A;  3MR0 A;  4P6Z S;  4EBN A;  1Q2Q A;  2WKE A;  3LR3 A;  3ZCZ A;  3C5A A;  3P01 A;  4OP8 A;  4X1L A;  5MC7 A;  2Z6C A;  3E98 A;  3NCK A;  5L07 A;  2FFF B;  2O0Y A;  2G2U A;  1YPR A;  3BQA A;  5EM0 A;  2EWV A;  2Y2M A;  3PBQ A;  3LR4 A;  1GA9 A;  3TW8 A;  2W1R A;  1I5Q A;  4OON A;  1Q2P A;  3KYE A;  1LL5 A;  5FQM A;  1XXM A;  3Q82 A;  3OBF A;  2XFS A;  2YKH A;  5F1F A;  4MBK A;  1FR6 A;  4YIN A;  3DTK A;  2WAF A;  3HLD A;  2I9V A;  4MN7 A;  4KG6 A;  5FA7 A;  4EWF A;  3EEA A;  4ARZ B;  5EVE A;  1NYY A;  2EX6 A;  1KDS A;  1STZ A;  3R7W B;  3OC2 A;  3K3D A;  4HH3 A;  3ZG8 B;  3JVU A;  4JGQ A;  3K2N A;  5FEF A;  4HOI A;  1PYY A;  2EX2 A;  2XQZ A;  1NLY A;  4LV2 A;  2PRF A;  4X1M A;  3IX4 A;  3HUN A;  2B02 A;  4EEU A;  4DE3 A;  1E4D A;  4JXG A;  4JPM A;  3ZG5 A;  4CLC C;  1ZC2 A;  4HJ3 A;  2EXB A;  2ZQ8 A;  1S4R A;  3A3I A;  4OOM A;  1U60 A;  3GVB A;  1MZU A;  3DWK A;  2DRW A;  3PBS A;  1GSV A;  1CQA A;  3CMZ A;  1MWS A;  1BUL A;  2KLI A;  3VOL A;  4S2K A;  1ZG6 A;  3T12 B;  3MXQ A;  5A8B A;  5HAQ A;  3HLE A;  4K08 A;  2JE5 A;  3DTI A;  4X25 A;  1SKO A;  4Y5F A;  1FR1 A;  2WKP A;  4N9K A;  4QU3 A;  1CEF A;  3EOI A;  4OQG A;  3K3C A;  4UA9 A;  3VMA A;  5HWW A;  1SKO B;  2QWS A;  5L09 A;  5GHZ A;  2OOL A;  1UGU A;  3B47 A;  3G2Y A;  2XD5 A;  3WS0 A;  2ZQ7 A;  1IYO A;  4L0L A;  2XEP A;  1UWP X;  3LID A;  3KX0 X;  4BL2 A;  1FSY A;  3HUM A;  4ESP A;  4XXR A;  4L9F A;  4OOL A;  2ZMA A;  1BLH A;  4CLC E;  4BD0 A;  1YLP A;  3UMD A;  2HGV A;  4JGO A;  1K4F A;  1NZO A;  4EER A;  1Z09 A;  1T19 A;  2V8C A;  2WKQ A;  2XSS A;  4BEN A;  1L0E A;  3KSI A;  1HVB A;  2Q0O A;  4RX2 A;  4CLC D;  1LSV A;  3CUE C;  5HDC A;  1O07 A;  4HHD A;  3A0V A;  1JVJ A;  3BLS A;  3G35 A;  3ZNY A;  2W0N A;  4DN0 A;  5EFW A;  4WM9 A;  1TDG A;  1MXO A;  1LT0 A;  3CAX A;  1K0K A;  5JYP A;  3H82 B;  3V39 A;  4FSF A;  4DE1 A;  4PKY A;  4CLC A;  2A3U A;  4Y2F A;  4G3V A;  4C3Q A;  3IF5 A;  3OCN A;  2Y2P A;  3G30 A;  2VJW A;  2V0U A;  3Q7V A;  2OV5 A;  3FKV A;  3M6B A;  4CLC B;  4Y0T A;  3C38 A;  5FDS A;  4S2J A;  2EFX A;  3SH7 A;  2OSU A;  1IKG A;  1L0D A;  1OTI A;  1YQS A;  2Y4A A;  1YAX A;  2XFT A;  2VGJ A;  3C7U A;  2WZX A;  1YLZ A;  2RL3 A;  4NKP A;  1GHI A;  2K7S A;  3OZH A;  4B4X A;  2W3D A;  4QY5 A;  2HP5 A;  3MKF A;  3N8R A;  3E2K A;  1NY0 A;  1YSP A;  5KSC A;  1KGG A;  4PKY G;  1SZV A;  4QD4 A;  1P97 A;  5EVI B;  5FQI A;  3NDG A;  2IWC A;  3E4P A;  3L7H A;  1KGE A;  1XJ3 A;  1A0K A;  3SH8 A;  3IH8 A;  3UN7 A;  3OPL A;  2Y2K A;  5HFO A;  3LGO A;  4R4S A;  4WL9 A;  3B42 A;  4OLD A;  2Y2I A;  1IEL A;  3E0Y A;  4P6Z M;  2ZMV A;  5FI7 A;  1OPX A;  4ZAM A;  3LCE A;  1GHM A;  4NXE A;  2V1Z A;  3CUE A;  3KSH A;  4GDN A;  2Q9M A;  3CLO A;  1S6R A;  2JC7 A;  3GEC A;  4KZ6 A;  3PBT A;  3OPR A;  3VP4 A;  5G4Y A;  1S1Y A;  5J3W A;  2PYP A;  1F5M A;  2WKR A;  3AGF A;  4N92 A;  2VK3 A;  4E3L A;  3LIB A;  4R1G A;  4Y3I A;  3ZG7 B;  4I3A A;  4WF0 A;  3A0R A;  4OPY A;  4P0M A;  3UDX A;  4LFU A;  5DF8 A;  2GJ3 A;  3V3S A;  4P85 A;  5FQQ A;  1KDW A;  4H8R A;  1K56 D;  4EW7 A;  4O7D A;  4ZBE A;  4P6B A;  2QMI A;  4S2P A;  4IUH A;  3KO6 A;  2J7V A;  2VGL S;  3EGX C;  4EBP A;  3U4L P;  1TS0 A;  5G18 A;  3ZVT A;  5HDD A;  1GSX A;  1KE4 A;  4GN2 A;  3T4S A;  1K56 A;  4DRT A;  4NXB A;  4AFI A;  1ODV A;  3MXR A;  4UQI M;  4MBF A;  4EQI A;  2XRN A;  3UE3 A;  4LPZ A;  4HQA A;  3LY3 A;  2PD7 A;  2VV8 A;  1KE0 A;  4BBU A;  3O3V A;  5J4E A;  3Q1F A;  4YNR A;  3VP2 A;  3ULF A;  2H10 A;  3HLW A;  2ZOI A;  5EVL A;  2JKR I;  4L9G A;  3A3D A;  2V1B A;  1XA1 A;  5GLA A;  5DJT A;  3FWL A;  2ZC4 B;  4ZJ2 A;  2NUT C;  2ZLY A;  2ACG A;  3IS2 A;  3FC7 A;  4WEK A;  2XA7 S;  3CG5 A;  3M2K A;  4F3L A;  4S2M A;  4BQM A;  2OWJ A;  1SKF A;  4GNU A;  1QME A;  2X71 A;  2V0W A;  5L8M A;  4ETZ A;  3P7N A;  5FDH A;  3SOI A;  4F3L B;  4R6L A;  5HWT A;  5GLB A;  4HH2 A;  3LYX A;  1XFQ A;  3EQU A;  2ZL1 B;  3E2L A;  3HBR A;  3W8K A;  5EV0 A;  3UY6 A;  4KZ7 A;  3HJI A;  3EWK A;  4I5S A;  2E8I A;  1OT9 A;  2WKH A;  1P9W A;  3S1Y A;  2W27 A;  1PRQ A;  4PM5 A;  1KE3 A;  5F68 A;  1CK3 A;  5HPF A;  2AVX A;  3BRM A;  3S4X A;  3ZFZ A;  4U3T A;  1ES5 A;  2YKF A;  2XF3 A;  3ZQ5 A;  2VLG A;  4LV3 A;  2M7U A;  1W63 Q;  3PBR A;  2WAE A;  2P04 A;  2PDR A;  4QY6 A;  4E3K A;  4Y15 A;  5GLC A;  3JPU A;  1EI5 A;  4LGW A;  5L2F A;  3Q07 A;  4NET A;  4JF4 A;  4OOY A;  5DF9 A;  1TDL A;  3NY4 A;  5FAQ A;  3IQA A;  2WKI A;  4WZ4 A;  3F1N B;  3ITA A;  5CHU A;  3G31 A;  1RGY A;  5G4Z A;  3LEQ A;  3HLC A;  3FYZ A;  4X69 A;  2INW A;  3C4O A;  2VX8 A;  3VP1 A;  2HV1 A;  1H0M A;  1PZP A;  1FCM A;  2PHY A;  2Y59 A;  2OAQ 1;  2P08 A;  3PAE A;  2JKT I;  3HVF A;  2Y79 A;  4HY8 A;  3KYQ A;  2JKT M;  1NRJ A;  2QHK A;  5DKK A;  1N9N A;  3V5M A;  2P9V A;  4N9L A;  5U47 A;  4KZB A;  2Y2L A;  4S2O A;  2ZQD A;  1VM1 A;  4NK3 A;  3RH8 B;  4BWI A;  5FI2 A;  1G6O A;  3QP1 A;  2P9V B;  1E3U D;  2ZQA A;  4MMN A;  4DE0 A;  3T4O A;  3VOY A;  2ZD8 A;  3NIA A;  5TR7 A;  1X0O A;  1IYS A;  1H8Z A;  5F82 A;  1VB6 A;  2JBF A;  4RX3 A;  5AVF A;  3UB9 A;  4MLL A;  1E3U A;  1LL9 A;  3ICY A;  5HSQ A;  2KDK A;  4DMZ A;  3BFG A;  2GNX A;  1XFN A;  5LBR A;  3UO9 A;  1JTG A;  3EQV A;  3PHY A;  4FOF A;  2Z6D A;  2RCX A;  2WGV A;  4ETX A;  2J3T D;  1K25 A;  4FTX A;  2J9O A;  1ERM A;  4RVA A;  4K0W A;  4EEP A;  3WS1 A;  5HX9 A;  3W2Z A;  4UQI S;  2IWD A;  2QYB A;  4O8G A;  3MQQ A;  4H6J A;  1TEM A;  4WMC D;  1G68 A;  3LFV A;  1T18 A;  4JGR A;  2HDR A;  3CPT A;  3WRT A;  3KSG A;  2VV6 A;  4HIA A;  3NOU C;  3I7J A;  1HLU P;  1NJ4 A;  1ES4 A;  1WE4 A;  4KZ4 A;  5E2H A;  4H6J B;  5DTS A;  1P9R A;  4FH4 A;  3LY4 A;  4U0T A;  3DBA A;  4B93 A;  2DMW A;  4DE2 A;  3V3R A;  5DF7 A;  2Z2L B;  4MCW A;  4WEJ A;  2I72 A;  5FL3 A;  2Y8H A;  2ZQ9 A;  4U0X A;  2VGL M;  2PU4 A;  2VV7 A;  1VEU A;  1MY8 A;  4L9E A;  2JKF A;  5E43 A;  4IHQ A;  3ITB A;  1E25 A;  4S2N A;  5HD3 A;  1Y4O A;  2Y2G A;  1VEU B;  4K91 A;  3UE6 A;  3UDI A;  1YMX A;  4QPR A;  1DRM A;  4R23 A;  2V8F A;  2LB9 A;  2LB5 A;  3FV7 A;  3T4Q A;  2JN7 A;  3H7W A;  2Y55 A;  4IUK A;  3UPN A;  5D3O A;  5CGW A;  4EUV A;  2B18 A;  4D2O A;  2EX8 A;  2EFU A;  2HDS A;  2Q9N A;  3H7W B;  4KG5 A;  2HP6 A;  2QZ6 A;  2C5W B;  4KQD A;  3LI8 A;  3OPP A;  3MFD A;  2K2N A;  3NOP C;  5IU1 A;  2H28 A;  1CEG A;  3VFF A;  2XA7 M;  3BY9 A;  2BAS A;  2ZC6 B;  4E6X A;  4MN6 A;  4HBT A;  1TVF A;  3O5Y A;  3W4P A;  2PBD P;  3IXH A;  2V20 A;  3LIE A;  1VET A;  4HES A;  2BTF P;  2HJE A;  4G3W A;  3VFH A;  2XLN A;  4NXG A;  4NEE D;  3MFX A;  2X02 A;  2PT7 A;  4PAU A;  1VET B;  5K5B A;  5HAP A;  3GMW A;  5CHJ A;  1BLC A;  3OOV A;  3QNC A;  4EU0 A;  3IHA A;  3LI9 A;  4WBG A;  4E3M A;  2XH9 A;  3ZVW A;  2FZ0 A;  1W7F A;  4LCM A;  3FKW A;  5EM1 A;  3M2J A;  4R38 A;  1FQG A;  3Q7V B;  3QNB A;  1MC0 A;  4WUJ A;  4GD6 A;  1TD5 A;  4YWZ A;  3PXP A;  5HD5 A;  3C2W A;  3LUQ A;  4JKT A;  1H8Y A;  4KQR A;  5J8X A;  3T4T A;  1IFQ A;  1OJ5 A;  2ZC3 B;  3DWZ A;  3RXW A;  1L0G A;  4R70 A;  4XT2 A;  3T4L A;  1PIO A;  4X6T A;  3B33 A;  5TGF A;  4ZDX A;  3T1S A;  1M40 A;  1T1B A;  4OPZ A;  3N8L A;  4ZJ1 A;  4M4X A;  4EBL A;  3LEZ A;  4GS9 A;  2ZBB A;  1ESI A;  1ERQ A;  4O0P A;  4PM8 A;  2W3H A;  1GHP A;  3IBJ A;  3D4F A;  4WLA A;  3UPP A;  5M1A A;  4GS9 B;  3OPH A;  2Z2M B;  1ES2 A;  3HJK A;  4MNR A;  3SS3 A;  3G34 A;  3W4O A;  1XX2 A;  1YLY A;  4HBU A;  1BT5 A;  1Y28 A;  5TJJ A;  5GHX A;  1LSX A;  4KZ3 A;  1SCW A;  2H0T A;  4R3B A;  3OLO A;  1NZU A;  1N9B A;  2UV0 E;  1RCJ A;  4WEL A;  4FCF A;  3QP5 A;  3GDI A;  1ALQ A;  4BJP A;  3GQZ A;  1FCN A;  2D02 A;  2NUP C;  1OME A;  4KZA A;  5EEC A;  1K6R A;  1W79 A;  4G3K A;  3ISG A;  4EUZ A;  2B95 A;  1LLB A;  2Y2Q A;  5HPI A;  4MEZ A;  2J9P A;  3CIT A;  3SS4 A;  1H3Q A;  1YKD A;  4Y7P A;  4IED A;  1YLW A;  3GTC A;  1W8Q A;  1IYQ A;  3E4O A;  3Q81 A;  5FSR A;  3BY8 A;  3CHW P;  2QPN A;  3BW6 A;  5A91 A;  2EWW A;  2WUQ A;  2V9A A;  3N6I A;  1F2K A;  3G32 A;  3VP0 A;  4MDZ A;  2FFY A;  3R4K A;  4LV1 A;  4B88 A;  4OP5 A;  3MMH A;  3LIA A;  1V9Y A;  2L4R A;  1XGJ A;  4Q0I A;  1KVM A;  5CGS A;  4LCL A;  3ZHH A;  1OTB A;  3D3O A;  3IWI A;  2VEA A;  4GLQ A;  5EE8 A;  1V9Z A;  5CTM A;  2W3F A;  1FSW A;  2JHE A;  4DXC A;  2DCF A;  3GSG A;  2VZW A;  4N1X A;  4OH0 A;  1PNE A;  4GB7 A;  3FG8 A;  3NI9 A;  4R3A A;  3HCY A;  5EOO A;  3LR0 A;  3BFE A;  1K6S A;  2OWH A;  3SZT A;  3L9K A;  1MPL A;  3F1P A;  3N4I A;  5A90 A;  4EQ1 A;  3T4K A;  1BLS A;  1YSQ A;  5FQK A;  1PZO A;  3UNW A;  3G6O A;  5DTT A;  1DP6 A;  2HJ9 C;  1K4E A;  1MWT A;  5I5L A;  2UWX A;  5CER A;  3WRZ A;  3IS2 B;  4KEN B;  5CRF A;  3NEC A;  3WS4 A;  4IBR A;  4X56 A;  2ZM8 A;  2IWB A;  5FI6 A;  4WYY A;  3GR2 A;  3HRE A;  4ZJ3 A;  2ZC5 B;  4Z9Q A;  3RXX A;  3C30 A;  5DKL A;  3S22 A;  3ZG0 A;  1PI5 A;  1K54 C;  1EWZ A;  1K57 C;  1N9L A;  3O86 A;  4UEY A;  4I39 A;  3T50 A;  4X53 A;  4I38 A;  1I2S A;  4UA6 A;  1PFL A;  3VOZ A;  1FCO A;  2OLV A;  1C3B A;  2L1M A;  2BG1 A;  1XP4 A;  2GZA A;  5CX7 A;  4Q0H A;  5FEG A;  3CJM A;  1MKI A;  1PW8 A;  4NXF A;  1GSW A;  1OTE A;  2VKS A;  2QJ5 A;  2WGW A;  3NDE A;  4Y13 A;  5KZH A;  2O9C A;  1GCE A;  3QHY A;  4UA7 A;  2HDQ A;  1WA9 A;  2J3T C;  3BWL A;  1OTD A;  2WGW B;  4S2L A;  3T1R A;  4DDY A;  4X55 A;  4S2I A;  1FOF A;  1AXB A;  1FIL A;  2PD8 A;  5L10 A;  3VE3 A;  1NLZ A;  4OQH A;  1TS7 A;  4FUW A;  4HJ6 A;  3BJN A;  4KUK A;  4Q8I A;  3CZD A;  2VA0 A;  3BFF A;  5M19 A;  3IX3 A;  3VP3 A;  3QP2 A;  1SDE A;  5FAO A;  4YFM A;  1MKM A;  3QP6 A;  4Y0O A;  3T4J A;  2W3E A;  3UE0 A;  4HNB A;  3CWF A;  1ERO A;  1W8Y A;  2R78 A;  1MWU A;  4RYE A;  4S2N C;  1QMF A;  4JXV A;  5AVE A;  1D7E A;  3ZDJ A;  1PWD A;  4HJ4 A;  4FD8 A;  4E04 A;  3C7V A;  1N9O A;  5DFY A;  1J9M A;  4KQO A;  4EXO A;  4IBX A;  1T1A A;  4E6W A;  1N4O A;  3RFB A;  1K38 A;  2ZMF A;  1H8M A;  2O99 A;  3BLM A;  4GW9 A;  1K54 A;  3M6H A;  1K57 A;  3ZGA B;  5DVA A;  1P0Z A;  5HAI A;  4LRX C;  1KVL A;  2HF6 A;  2R9X A;  2PYR A;  4KZ9 A;  2WAD A;  3RJU A;  4F94 A;  5FAT A;  1SDN A;  2MJ6 A;  3T1X A;  4ARZ A;  4ME4 A;  5CED A;  5F5Y A;  1S0W A;  5HAR A;  1F98 A;  5E2F A;  3R7W A;  2G2W A;  5FQJ A;  3IF6 C;  4MN5 A;  4Z1W A;  4DF6 A;  4QHC A;  1ZG4 A;  3NUL A;  4KUO A;  1W5D A;  3PYP A;  2WYX A;  2XR0 A;  1DJA A;  1L3L A;  2EA9 A;  4GD8 A;  3A3J A;  4UHU A;  3NJA A;  5HWV A;  1GA0 A;  1JTD A;  5HL1 A;  3EGD C;  1KGF A;  1TF1 A;  2W1T A;  1FIK A;  3CPT B;  4WMC A;  3IH9 A;  2BLS A;  5FAP A;  3LR5 A;  1O7E A;  4XUZ A;  5M18 A;  2W1T B;  3GRJ A;  5CGX A;  2ZM2 A;  4NG2 A;  1LL8 A;  3MBZ A;  3MQ0 A;  3QP8 A;  3C4P A;  1NWZ A;  1YM1 A;  3DTE A;  3UDF A;  2WZZ A;  1HZO A;  4XUX A;  1G28 A;  4PM6 A;  1F9I A;  5GHY A;  1G6A A;  3IWO A;  3LIC A;  3S7N A;  4CQH A;  1PW1 A;  3D9Y A;  1PI4 A;  4BL3 A;  1JNU A;  3SW1 A;  4YOF A;  4PM9 A;  1PWG A;  4CPK A;  5EVI C;  3WS2 A;  3IWQ A;  3JVV A;  3P09 A;  3MXS A;  1IYP A;  5EOE A;  2A49 A;  2XDM A;  2JCH A;  4C6Y A;  2JKG A;  3MQO A;  4GCZ A;  3BYD A;  1IKI A;  4B9O A;  5GLD A;  4HI4 A;  3PBO A;  1RGZ A;  4KG2 A;  4GKU A;  4R4R A;  4Y17 A;  1CF0 A;  2J8Y A;  2B5R A;  1ZTU A;  2DNS A;  5AQ7 A;  2GDN A;  3IF6 A;  1KOU A;  3IBR A;  1K55 C;  3EEH A;  1NYM A;  2P74 A;  1MBL A;  1LHY A;  4I3J A;  3UB7 A;  3NHQ A;  3IF6 B;  3F1O A;  2A24 A;  2WGI A;  4KQQ A;  4IJG A;  4WZ5 C;  2Y2J A;  3H82 A;  2D01 A;  2ZQC A;  3FPW A;  3KYZ A;  2X01 A;  4P87 A;  4JXS A;  3F1O B;  3VV4 A;  2A24 B;  1AWI A;  3GV9 A;  2KX6 A;  2Y2H A;  3UB5 P;  3HLB A;  2V1A A;  1BSG A;  5CEB A;  1M6K A;  2CC1 A;  3TSG A; 
#chains in the Genus database with same CATH homology
 4JF4 A;  4OOY A;  5DF9 A;  1TDL A;  2QPN A;  1ONG A;  3HUN A;  2Y91 A;  5A91 A;  3NY4 A;  4DE3 A;  1E4D A;  2WUQ A;  5KSH A;  4JXG A;  3NC8 A;  3IQA A;  3N6I A;  2WKI A;  4JPM A;  5FAQ A;  5E2E A;  4WZ4 A;  3G32 A;  3IXD A;  3ZG5 A;  1ZC2 A;  3ITA A;  3VP0 A;  2FFY A;  5CHU A;  2EXB A;  3G31 A;  4LV1 A;  2ZQ8 A;  3N7W A;  4B88 A;  3V50 A;  3A3I A;  1BUE A;  4OP5 A;  3TG9 A;  1RGY A;  4C75 A;  4OOM A;  1U60 A;  3GVB A;  3DWK A;  2DRW A;  5EVI D;  3HLC A;  3PBS A;  1XGJ A;  4EV4 A;  3A3F A;  3FYZ A;  4X69 A;  1KVM A;  1WYC A;  5CGS A;  4LCL A;  3ZHH A;  3C4O A;  3CMZ A;  1MWS A;  3IWI A;  3VP1 A;  1BUL A;  4S2K A;  1PZP A;  5EE8 A;  5CTM A;  4A5R A;  1FCM A;  1FSW A;  2Y59 A;  1ZG6 A;  2R9W A;  1XA7 A;  4DXC A;  2DCF A;  2ZC7 A;  3GSG A;  3PAE A;  1LI9 A;  1ES3 A;  3MKE A;  3HVF A;  5HAQ A;  4N1X A;  5EVI A;  3HLE A;  4GZB A;  5E2G A;  4OH0 A;  2JE5 A;  4E3N A;  4GB7 A;  3NI9 A;  5EOO A;  1FR1 A;  4OKP A;  3BFE A;  4N9K A;  1K6S A;  4UAA A;  2P9V A;  3V5M A;  4N9L A;  4QU3 A;  5U47 A;  4KZB A;  2Y2L A;  3BEC A;  1MPL A;  3N4I A;  1XKZ A;  4S2O A;  1CEF A;  2ZQD A;  3IXG A;  4DXB A;  2Y2O A;  5A90 A;  1VM1 A;  5AQB A;  4OQG A;  3VSK A;  4UA9 A;  4NK3 A;  4OPR A;  3VMA A;  1BLS A;  4JF6 A;  5FQK A;  1PZO A;  4KZ8 A;  4ZTK A;  3UNW A;  5FI2 A;  1DJB A;  5GHZ A;  3SH9 A;  5DTT A;  4KZ5 A;  1K4E A;  2P9V B;  1E3U D;  2ZQA A;  1MWT A;  4DE0 A;  3G2Y A;  2XD5 A;  3WS0 A;  1NRF A;  2UWX A;  2ZQ7 A;  3N8S A;  1IYO A;  5CER A;  4N1H A;  3WRZ A;  4L0L A;  5A92 A;  3VOY A;  2ZD8 A;  3NIA A;  5TR7 A;  4PM7 A;  2XEP A;  3PTE A;  3TOI A;  1BLP A;  2OLU A;  1IYS A;  4BL2 A;  4OVD A;  1H8Z A;  4KEN B;  5F82 A;  1FSY A;  5CRF A;  3HUM A;  2JBF A;  4XXR A;  4RX3 A;  3WS4 A;  4IBR A;  3BFC A;  4MLL A;  1K55 A;  2ZMA A;  1E3U A;  1BLH A;  1LL9 A;  2ZM8 A;  1L2S A;  4LV0 A;  4OOL A;  4X56 A;  1HD8 A;  4OLG A;  2IWB A;  4BD0 A;  3BFG A;  5FI6 A;  5CEC A;  1YLP A;  4WYY A;  2XK1 A;  3GR2 A;  3HRE A;  5IHV A;  1K4F A;  2H0Y A;  1NZO A;  4ZJ3 A;  2ZC5 B;  4Z9Q A;  3RXX A;  3UO9 A;  1DY6 A;  1JTG A;  4QB8 A;  4BEN A;  4WZ5 A;  3S22 A;  3ZG0 A;  1PI5 A;  1L0E A;  1K54 C;  1EWZ A;  1K57 C;  2HDU A;  3O86 A;  3EQV A;  2V2F F;  1HVB A;  4X53 A;  1I2S A;  4RX2 A;  2RCX A;  1BZA A;  3HLG A;  4R3J A;  4E3O A;  1O07 A;  2WGV A;  4UA6 A;  3BM6 A;  1JVJ A;  1K25 A;  3BLS A;  3VOZ A;  1FCO A;  3G35 A;  2OLV A;  3ZNY A;  1C3B A;  1WYB A;  2J9O A;  3DW0 A;  2BG1 A;  1XP4 A;  4WM9 A;  1ERM A;  1TDG A;  4RVA A;  1MXO A;  4K0W A;  3CJM A;  1MKI A;  3WS1 A;  1PW8 A;  5HX9 A;  1NXY A;  2VGK A;  2HPB A;  2IWD A;  5JYP A;  3V39 A;  4FSF A;  4DE1 A;  1JWV A;  2A3U A;  3HUO A;  4OPQ A;  2WGW A;  3NDE A;  3LO7 A;  5KZH A;  3W4Q A;  3FZC A;  4C3Q A;  1TEM A;  4GDB A;  1YLT A;  3IF5 A;  3OCN A;  4WMC D;  5HW3 A;  3G2Z A;  1GCE A;  3QHY A;  2Y2P A;  3G30 A;  1G68 A;  4UA7 A;  2HDR A;  2HDQ A;  4LEN A;  3P98 A;  3WRT A;  3Q7V A;  2OV5 A;  4PPR A;  1YT4 A;  2PBY A;  3FKV A;  3I7J A;  3M6B A;  4M3K A;  1YMS A;  1NJ4 A;  1SHV A;  2WGW B;  5CHM A;  5I94 A;  1ES4 A;  1WE4 A;  4KZ4 A;  5E2H A;  3WWX A;  5DTS A;  1HTZ A;  1ESU A;  4S2L A;  4DDY A;  4Y0T A;  4FH4 A;  4X55 A;  3LY4 A;  4S2I A;  1FOF A;  5TFQ A;  1Y54 A;  3PBN A;  5CTN A;  4U0T A;  4S2J A;  1AXB A;  3G4P A;  2EFX A;  3SH7 A;  4OQ0 A;  5DTK A;  2OSU A;  4BLM A;  1IKG A;  3JYI A;  2HP9 A;  4OQH A;  1L0D A;  3BEB A;  3V3R A;  4DE2 A;  5DF7 A;  1YQS A;  2Y4A A;  2H5S A;  2XFT A;  2Z2L B;  2VGJ A;  3C7U A;  4Q8I A;  3CZD A;  4WEJ A;  2I72 A;  2ZQ9 A;  3BFF A;  5M19 A;  4U0X A;  2XD1 A;  1JWZ A;  3VP3 A;  3IT9 A;  4DKI A;  2PU4 A;  2WZX A;  1YLZ A;  2RL3 A;  1GHI A;  1MY8 A;  3OZH A;  1SDE A;  4B4X A;  5FAO A;  4YFM A;  4QY5 A;  2HP5 A;  3NBL A;  3MKF A;  3N8R A;  4Y0O A;  3E2K A;  5E43 A;  4Y0U A;  1NY0 A;  4X68 A;  3AGD A;  3ITB A;  5BOH A;  3UE0 A;  1E25 A;  5KSC A;  1KGG A;  4K0X A;  4IVK A;  5KMW A;  2ZM0 A;  3MZD A;  4S2N A;  5AQ9 A;  4QD4 A;  2Y2G A;  4K91 A;  5EVI B;  5FQI A;  3UDI A;  1ZKJ A;  3NDG A;  1ERO A;  3WS5 A;  1YMX A;  4JLF A;  4R23 A;  1W8Y A;  2IWC A;  1MWU A;  3IXB A;  4RYE A;  1DJC A;  1KGE A;  4S2N C;  3FV7 A;  5CXW A;  1QMF A;  4JXV A;  3SH8 A;  3ZDJ A;  2Y55 A;  1PWD A;  3IH8 A;  4FD8 A;  3SS5 A;  3C7V A;  3UPN A;  5D3O A;  4BD1 A;  3UN7 A;  1J9M A;  1RP5 A;  3OPL A;  3MZF A;  4KQO A;  5CGW A;  2PU2 A;  3Q7Z A;  4D2O A;  2EX8 A;  2EFU A;  4IBX A;  2HDS A;  2Y2K A;  3IHB A;  5HFO A;  2Y2N A;  4E6W A;  4HEF A;  2Q9N A;  1N4O A;  2ZJ9 A;  3OCL A;  4JBF A;  4R4S A;  3ZNT A;  4KG5 A;  1K38 A;  4GOG A;  2HP6 A;  4OLD A;  2QZ6 A;  2Y2I A;  1IEL A;  1LI0 A;  5FI7 A;  3BLM A;  4ID4 A;  4ZAM A;  2C5W B;  1GHM A;  1K54 A;  1K57 A;  3LCE A;  3M6H A;  3ZGA B;  4E3J A;  5DVA A;  5HAI A;  3HL9 A;  3OPP A;  1Z6F A;  1KVL A;  3MFD A;  2V1Z A;  5GL9 A;  1CEG A;  3VFF A;  4GDN A;  2Q9M A;  2R9X A;  4MBH A;  3UPO A;  1JWP A;  4KZ9 A;  4OQI A;  2WAD A;  1S6R A;  2ZC6 B;  4E6X A;  2EX9 A;  3RJU A;  4F94 A;  2JC7 A;  5FAS A;  1H5X A;  5F1G A;  4QJG A;  5FAT A;  1SDN A;  4KZ6 A;  4HBT A;  3PBT A;  1TVF A;  3W4P A;  3OPR A;  4CJN A;  3VP4 A;  5CED A;  3IXH A;  1S0W A;  5HAR A;  2V20 A;  5EPH A;  3O87 A;  1CI9 A;  3PAG A;  4HES A;  1IEM A;  3VFH A;  5E2F A;  3AGF A;  2G2W A;  5AQA A;  5FQJ A;  2XLN A;  3IF6 C;  1YLJ A;  4N92 A;  4IVI A;  4E3L A;  4R1G A;  4DF6 A;  1L0F A;  4QHC A;  2X02 A;  1ZG4 A;  3ZG7 B;  1XPB A;  3MZE A;  4OPY A;  1W5D A;  4P0M A;  3HLF A;  3UDX A;  2WYX A;  2XR0 A;  1DJA A;  5DF8 A;  1MWR A;  1I2W A;  5HAP A;  3V3S A;  3GMW A;  4P85 A;  5FQQ A;  1KDW A;  4H8R A;  5CHJ A;  4E3I A;  4GD8 A;  1BLC A;  1K56 D;  3A3J A;  4UHU A;  4O7D A;  3QNC A;  4P6B A;  2QMI A;  3IHA A;  4S2P A;  4ZBE A;  4FH2 A;  1CI8 A;  4WBG A;  4E3M A;  5JYO A;  1GA0 A;  2J7V A;  2XH9 A;  4RA7 A;  1JTD A;  3ZVW A;  5HL1 A;  4PMA A;  1KGF A;  1W7F A;  4NET A;  4EBP A;  3DTM A;  4LCM A;  3FKW A;  5EUA A;  3M2J A;  5G18 A;  3ZVT A;  3ZG9 B;  4JF5 A;  1FQG A;  4WMC A;  3Q7V B;  3IH9 A;  1KE4 A;  2BLS A;  4GN2 A;  5FAP A;  3QNB A;  2WK0 A;  4R0Q A;  2EXA A;  5F83 A;  1K56 A;  4GD6 A;  4DRT A;  1VQQ A;  1O7E A;  4XUZ A;  1ONH A;  3AGE A;  3MXR A;  5M18 A;  3GRJ A;  3BFD A;  5CGX A;  4JKT A;  2ZM2 A;  4MBF A;  5A93 A;  4EQI A;  1H8Y A;  3UE3 A;  3MBZ A;  4JXW A;  2C6W B;  1PWC A;  4KQR A;  5J8X A;  4DDS A;  2ZC3 B;  3C4P A;  3DWZ A;  1YM1 A;  3RXW A;  3O88 A;  1XGI A;  3LY3 A;  3UE1 A;  1L0G A;  1PIO A;  3UDF A;  2WZZ A;  4X6T A;  1KE0 A;  1HZO A;  4XUX A;  5TGF A;  3VSL A;  4ZDX A;  5FQ9 A;  3O3V A;  4PM6 A;  1BTL A;  3Q1F A;  1M40 A;  5GHY A;  4OPZ A;  3N8L A;  4ZJ1 A;  1G6A A;  3VP2 A;  4EBL A;  2H10 A;  3HLW A;  3LEZ A;  2XGN A;  3IWO A;  5EVL A;  3A3D A;  1PW1 A;  1PI4 A;  1ESI A;  1ERQ A;  4B4Z A;  4BL3 A;  1XA1 A;  4PM8 A;  5GLA A;  1GHP A;  3B3X A;  3A3E A;  4PM9 A;  1PWG A;  3D4F A;  4CPK A;  3FWL A;  5EVI C;  4EBN A;  3WS2 A;  1Q2Q A;  2ZC4 B;  3IWQ A;  2WKE A;  3P09 A;  2ZLY A;  3MXS A;  4ZJ2 A;  3UPP A;  3ZCZ A;  3C5A A;  4OP8 A;  1IYP A;  5M1A A;  5EOE A;  2A49 A;  4WEK A;  2XDM A;  3OPH A;  2JCH A;  3NCK A;  3CG5 A;  3M2K A;  4C6Y A;  4S2M A;  5FSR A;  2FFF B;  4BQM A;  1SKF A;  4GNU A;  2Z2M B;  1ES2 A;  2G2U A;  4MNR A;  1QME A;  2X71 A;  3BYD A;  3SS3 A;  3G34 A;  1IKI A;  2Y2M A;  3PBQ A;  5FDH A;  3SOI A;  3W4O A;  1XX2 A;  1YLY A;  4HBU A;  1GA9 A;  5GLD A;  1BT5 A;  3PBO A;  1RGZ A;  4KG2 A;  4GKU A;  5GLB A;  4R4R A;  3EQU A;  5GHX A;  1I5Q A;  2J8Y A;  4OON A;  2B5R A;  3E2L A;  1Q2P A;  2DNS A;  1LL5 A;  3HBR A;  4KZ3 A;  5AQ7 A;  1SCW A;  5FQM A;  3W8K A;  2H0T A;  4R3B A;  2GDN A;  3IF6 A;  3UY6 A;  1NZU A;  1XXM A;  3Q82 A;  4KZ7 A;  1N9B A;  1RCJ A;  2XFS A;  2E8I A;  4FCF A;  2WKH A;  4WEL A;  4MBK A;  5F1F A;  1FR6 A;  1ALQ A;  1K55 C;  4YIN A;  4BJP A;  3GQZ A;  3S1Y A;  1FCN A;  2WAF A;  1NYM A;  2P74 A;  3HLD A;  1MBL A;  1OME A;  4KZA A;  5EEC A;  1K6R A;  1LHY A;  4KG6 A;  5FA7 A;  4EWF A;  1W79 A;  3IF6 B;  2WGI A;  4PM5 A;  1NYY A;  1KE3 A;  2EX6 A;  1CK3 A;  3ISG A;  4KQQ A;  1KDS A;  4WZ5 C;  2Y2J A;  3BRM A;  3ZFZ A;  3S4X A;  4EUZ A;  1LLB A;  2Y2Q A;  4MEZ A;  4U3T A;  1ES5 A;  2J9P A;  3SS4 A;  2ZQC A;  2X01 A;  2XF3 A;  3OC2 A;  4LV3 A;  4P87 A;  3ZG8 B;  4JXS A;  4Y7P A;  3GV9 A;  4IED A;  3PBR A;  1YLW A;  2Y2H A;  3GTC A;  1W8Q A;  2WAE A;  3HLB A;  1BSG A;  4QY6 A;  4E3K A;  1M6K A;  5CEB A;  1IYQ A;  5GLC A;  1EI5 A;  1PYY A;  2CC1 A;  5L2F A;  3Q07 A;  3TSG A;  2EX2 A;  2XQZ A;  3Q81 A;  4LV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...