4MBHA

Penam sulfone psr-3-226 bound to e166a variant of shv-1 beta-lactamase
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
265
structure length
265
Chain Sequence
b'SPQPLEQIKLSESQLSGRVGMIEMDLASGRTLTAWRADERFPMMSTFKVVLCGAVLARVDAGDEQLERKIHYRQQDLVDYSPVSEKHLADGMTVGELCAAAITMSDNSAANLLLATVGGPAGLTAFLRQIGDNVTRLDRWATELNEALPGDARDTTTPASMAATLRKLLTSQRLSARSQRQLLQWMVDDRVAGPLIRSVLPAGWFIADKTGAGERGARGIVALLGPNNKAERIVVIYLRDTPASMAERNQQIAGIGAALIEHWQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase SHV-1
publication title Penam sulfones and beta-lactamase inhibition: SA2-13 and the importance of the C2 side chain length and composition.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Hydrolase
total genus 98
structure length 265
sequence length 265
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2013-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13354 Beta-lactamase2 Beta-lactamase enzyme family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4mbhA00
3MBZA 4P87A 2RL3A 1FCMA 1YLJA 4EV4A 1LLBA 2HDUA 3VP4A 5DF7A 3DWKA 3ZG7B 3HLDA 4UA9A 3V5MA 2BLSA 5CTNA 3VSKA 2Y2LA 2ZMAA 3N8RA 2H0TA 3E2LA 5AQAA 1CEFA 3GV9A 3WS1A 3G34A 3BFDA 5EE8A 3UNWA 3BFGA 4KZ7A 3ZDJA 1GA0A 1GA9A 5A90A 4OH0A 3FYZA 4Q8IA 4GNUA 1KVLA 5CEBA 3BLMA 1DJAA 2Z2MB 2WGWA 4Z9QA 1EROA 4KZAA 4E3NA 4R3BA 1TEMA 3BFEA 4RX3A 4KZ5A 3TSGA 3ZG0A 4ZAMA 2FFFB 3DWZA 1OMEA 3SS5A 3VP0A 4WMCA 5E2EA 1KDWA 2ZC3B 3M2KA 2IWBA 3WS5A 3MKEA 3UPOA 2ZM0A 5FSRA 2WKHA 4MNRA 2J9PA 3LY4A 1BULA 2FFYA 4BQMA 3SS4A 1N9BA 2GDNA 5EOOA 3HLFA 3W4OA 4K0WA 3HUNA 1KE0A 1PI4A 3PBSA 3O3VA 5DTSA 4X55A 4PM8A 5GLBA 5BOHA 5FDHA 1IYOA 1K6RA 3VMAA 2IWCA 4ZTKA 4WYYA 3I7JA 1NY0A 4A5RA 5HW3A 5HX9A 3ITBA 3GMWA 4ZDXA 5HL1A 1HTZA 1MWTA 3ITAA 3IH8A 4E3IA 3OPPA 4RVAA 1WYCA 2Y2NA 5GLCA 2Y55A 1E3UD 4M3KA 4YFMA 5GLDA 4E3KA 3NBLA 4FH4A 2WZXA 4ID4A 1FSYA 2WYXA 1PI5A 4WELA 3VOZA 4F94A 1TDGA 4LV1A 5EECA 3OPLA 5FQIA 5M18A 2Z2LB 4X68A 1ZKJA 1Y54A 1MXOA 3IWIA 1KGEA 1KVMA 5HFOA 2BG1A 2Q9NA 4ZJ3A 4CJNA 2VGKA 5FA7A 1CK3A 2ZC5B 1C3BA 3CMZA 1IYQA 1W8YA 3G2YA 2DRWA 4R23A 3FZCA 3Q7VB 3CJMA 4DE2A 5F82A 5F83A 4PM7A 2Y2PA 4BL3A 4S2PA 5HAIA 5JYPA 4DE0A 5J8XA 1PIOA 4DE1A 1I2WA 4BENA 2V2FF 4OQHA 2WGVA 3UDIA 1VQQA 4IVIA 5FI6A 2Q9MA 3AGDA 4HBUA 1K54C 1FOFA 3RXWA 3A3EA 5E43A 2OV5A 4JXVA 1SCWA 4JPMA 4O7DA 1PYYA 2XDMA 4KZ6A 5I94A 1Q2QA 4KENB 1HZOA 1ESUA 3LO7A 1YLWA 3NY4A 1EI5A 2Y2MA 1MWRA 1ZG4A 3BFFA 3IXGA 3MXRA 4B4XA 2Y2OA 1HVBA 3BEBA 2WKEA 1PWDA 3BFCA 4S2JA 1FR6A 3M6HA 4FSFA 4R1GA 4XUXA 5GHXA 3DTMA 1CI8A 5AQ7A 5DF9A 4OONA 1E3UA 1TDLA 5GL9A 3A3DA 3C4OA 3WS4A 2HP5A 5FAOA 1MPLA 3EQVA 2V1ZA 5CTMA 5CRFA 4EBPA 5L2FA 5E2GA 2ZQAA 3Q7ZA 3C4PA 1EWZA 1GHPA 2OSUA 3HL9A 3OZHA 4P6BA 5E2HA 4KZBA 5CGXA 1ESIA 1SHVA 3ZNYA 4KQRA 2WK0A 2WKIA 1H5XA 3ZVWA 1O07A 5DTKA 1K55C 3QHYA 3NDGA 2XFSA 1ES4A 3G31A 3VFFA 4MBKA 3ZG9B 3ZFZA 3P09A 3CG5A 1KDSA 3C5AA 1RCJA 3S1YA 2UWXA 3B3XA 5GHYA 3BM6A 4BLMA 4Y0OA 1K38A 1MWSA 3MFDA 5DF8A 1KE4A 4GD6A 3V39A 3HREA 2XQZA 4FD8A 3P98A 3PBQA 1NXYA 3PBTA 4DXBA 1JTDA 1M6KA 4L0LA 4QHCA 4S2LA 2A3UA 4DDYA 4XXRA 1JWVA 1LL9A 4R4RA 3UE0A 3V50A 1VM1A 1K4FA 5EPHA 4ZJ2A 4X69A 3Q82A 1QMFA 3SH9A 3S22A 2V20A 3M2JA 4MEZA 5EOEA 5FQMA 3UPNA 4EBNA 1IKGA 1L0GA 1ES2A 3ZHHA 4BD0A 1MKIA 3PBNA 2B5RA 5KSCA 1K57C 3AGFA 3QNCA 3W8KA 3LEZA 1ALQA 1PW1A 4OOYA 4IEDA 3C7UA 3IWOA 3BECA 1LI9A 5FI2A 2RCXA 3IF6C 1L0EA 3HUOA 4OP5A 3BYDA 4PPRA 1N4OA 1L0FA 2C5WB 3JYIA 1K4EA 1W79A 4S2OA 4QY6A 1FQGA 1PW8A 2EX2A 2HP6A 5KMWA 1XKZA 3ZVTA 1ES5A 1W5DA 1Z6FA 4N9LA 2Y59A 3VSLA 4BD1A 4X56A 2A49A 2Y2KA 4KG2A 4RYEA 1FR1A 1RGYA 4MLLA 4KZ9A 3VFHA 1MBLA 3OC2A 1YLYA 1FCNA 4FCFA 4GDBA 5F1GA 4UA6A 1NYYA 5FI7A 4OOMA 5A91A 2WAEA 3OCLA 1FCOA 2OLUA 1CI9A 3ZGAB 4EQIA 2Y2QA 3IT9A 1KGGA 1YMSA 4E6XA 3N4IA 5CEDA 1JTGA 2JCHA 3UO9A 3WRZA 5GHZA 4N9KA 4E3MA 1MWUA 4BL2A 3NDEA 3O88A 5FAPA 2ZC7A 3PAGA 3ZG5A 5FQKA 1IYPA 2WGIA 1WE4A 4LV2A 1JWPA 1K6SA 5F1FA 3MZFA 1IKIA 2P9VA 1G6AA 3Q07A 4Y0TA 1XA7A 2ZQCA 1YLZA 5CGSA 3ZNTA 1NZOA 1K56D 1BSGA 1NZUA 1PZPA 4U0XA 3TOIA 1K57A 3D4FA 1YMXA 3N8LA 4LV3A 3ZG8B 5FQQA 1HD8A 3EQUA 1ZG6A 2DCFA 2WZZA 2ZD8A 3CZDA 5EVIB 1IYSA 3IF6A 4C75A 4QB8A 4DRTA 4S2NC 4EUZA 1IELA 1ES3A 4LCLA 3SOIA 2Y4AA 1M40A 1XPBA 5FQJA 3SH7A 4GD8A 5DVAA 1L0DA 3Q7VA 1I5QA 2ZJ9A 4MBHA 1NJ4A 2IWDA 1DJCA 1YQSA 1TVFA 2Y2JA 2ZQ7A 1ERQA 3RXXA 4OPZA 4C6YA 2HDQA 3C7VA 5HAPA 4HBTA 5TFQA 3MZDA 5EVLA 1AXBA 2EXAA 4WZ5C 2XLNA 1RP5A 3FKWA 1H8ZA 2QZ6A 2J9OA 2ZC6B 3V3SA 2HP9A 3VP3A 1ONHA 4PM6A 4PM9A 4QU3A 1GHIA 3GSGA 3MKFA 2XK1A 4WMCD 4UAAA 3PBOA 4OLDA 2WUQA 3Q81A 3IF5A 2Y2IA 5CGWA 3UPPA 2H10A 4P85A 1YM1A 2P74A 4EWFA 3FKVA 2XEPA 1YLPA 2X01A 1E25A 3S4XA 2WGWB 4R3JA 5TGFA 1IEMA 2G2WA 3GTCA 5GLAA 3UE3A 1CEGA 1PWCA 4KZ3A 2HDSA 3IH9A 5A93A 4GN2A 4KQQA 4Y0UA 2XGNA 3W4QA 4OQ0A 5FATA 1XGIA 4X53A 4U3TA 1ONGA 2H5SA 2HDRA 4R0QA 4S2IA 4E6WA 1BLPA 5CERA 1K54A 1XP4A 1E4DA 3LCEA 3G32A 3NIAA 3DW0A 2QMIA 3LY3A 2J7VA 4JF4A 3WRTA 4GOGA 5U47A 2ZM8A 1BT5A 5E2FA 2PU4A 2R9WA 3VP2A 5IHVA 3GVBA 1PZOA 4LCMA 4BJPA 3GR2A 4KQOA 2WADA 2XR0A 1BLSA 2C6WB 4C3QA 4D2OA 4GDNA 4N1XA 1GHMA 1RGZA 4MBFA 4S2NA 3N6IA 1BLHA 2XH9A 4XUZA 1GCEA 1FSWA 2R9XA 3PAEA 4E3LA 1WYBA 3AGEA 4RX2A 4DXCA 4DDSA 4S2MA 3IXHA 4IBXA 4WBGA 2XD1A 3IHAA 4JBFA 4KZ8A 3UN7A 4N1HA 1XX2A 3SS3A 4YINA 2Y2GA 3HLEA 4HESA 3IXDA 3UE1A 2J8YA 4JXGA 5A92A 4WZ5A 1S0WA 3BLSA 3G2ZA 1KE3A 3ISGA 3HLGA 5CXWA 5HAQA 4LV0A 2JE5A 3OCNA 2ZQ9A 4DE3A 5FQ9A 5CHJA 5D3OA 1K55A 3HBRA 2HPBA 1Q2PA 1YT4A 3HLBA 5AQBA 4RA7A 4IBRA 3TG9A 3FV7A 1KGFA 5DTTA 1QMEA 4JXWA 4KZ4A 3G4PA 5FASA 4EBLA 3A3JA 4KG5A 3O87A 5EVIC 4CPKA 4OQIA 4WM9A 4NK3A 4OP8A 4B88A 5CHMA 3N8SA 4N92A 4OQGA 3NCKA 2P9VB 3N7WA 3IHBA 1I2SA 1SDEA 1LHYA 4Y7PA 3VOYA 2EX8A 5FAQA 4DF6A 3SH8A 2DNSA 1L2SA 4UA7A 3V3RA 3HVFA 3GQZA 1BLCA 5EVID 5CECA 5KSHA 3OPRA 3PBRA 3VP1A 1XA1A 1NRFA 1S6RA 3NI9A 2XF3A 3PTEA 4PMAA 5AQ9A 1LL5A 4JXSA 3ZCZA 3IF6B 1BTLA 3MZEA 5EUAA 2ZC4B 5TR7A 4S2KA 2ZM2A 1H8YA 1LI0A 1PWGA 4LENA 1SDNA 4H8RA 4WEKA 4UHUA 2OLVA 1NYMA 3IXBA 2EFUA 3M6BA 4OPRA 1XXMA 4K91A 4QY5A 2I72A 4PM5A 2XD5A 3Q1FA 5CHUA 1ZC2A 2ZQDA 4R4SA 2EX9A 2X71A 3UDFA 3W4PA 2E8IA 2WAFA 2X02A 2Y2HA 4HEFA 3G30A 1JVJA 5HARA 4E3JA 3G35A 3UDXA 3RJUA 1JWZA 3OPHA 4JF5A 4OKPA 4U0TA 2EFXA 4ZJ1A 5KZHA 1U60A 4K0XA 1BZAA 3IWQA 2QPNA 1MY8A 4GB7A 4P0MA 3BRMA 4ZBEA 1YLTA 3WS0A 4OPYA 5M19A 2CC1A 4OLGA 1W8QA 4FH2A 3WS2A 4GKUA 4OPQA 4QJGA 2XFTA 4OOLA 2JC7A 4WZ4A 3HUMA 2EX6A 1W7FA 2PU2A 2H0YA 5G18A 4IVKA 4NETA 2JBFA 3O86A 3WWXA 2PBYA 4JF6A 4GZBA 4KG6A 1BUEA 3MXSA 1O7EA 1J9MA 4DKIA 2ZQ8A 5M1AA 3GRJA 1SKFA 3FWLA 2EXBA 2ZLYA 5EVIA 2Y91A 4X6TA 2G2UA 4E3OA 1G68A 1K25A 2VGJA 3A3IA 4JKTA 4JLFA 1XGJA 4OVDA 3E2KA 1ERMA 4B4ZA 1DY6A 4QD4A 5JYOA 1K56A 3UY6A 3IQAA 1DJBA 4WEJA 3A3FA 3HLWA 3HLCA 3QNBA 3NC8A
chains in the Genus database with same CATH superfamily
4P87A 1V9YA 4EV4A 1LLBA 3BY8A 1OTDA 2H0TA 2H28A 3WS1A 3A0SA 3KX0X 4HQAA 3ZDJA 4NXGA 2B95A 1KVLA 5CEBA 4NXFA 3D9YA 2W1TB 2Y79A 4E3NA 1D1JA 3BFEA 4KZ5A 2FFFB 3SW1A 1NLZA 4HP4A 3VP0A 3M2KA 3MKEA 3OBFA 5FSRA 3KO6A 2FFYA 2IA2A 4MN5A 3HLFA 4KUKA 3HUNA 3T1SA 5FDHA 1IYOA 4GJ4A 5HZHA 4ZTKA 3PHYA 1NY0A 4A5RA 2J3TC 3IH8A 2L1MA 4ME4A 2CMNA 5A8BA 3CAXA 4FH4A 3EGXC 1FSYA 2WYXA 4ID4A 2V0WA 3R7WA 5HFOA 3T4KA 4ZJ3A 1CK3A 3DAVA 3T4LA 2ZC5B 4R23A 4II7A 3CJMA 4DE2A 4PM7A 2Y2PA 4S2PA 5HAIA 5JYPA 4BENA 4OQHA 3AGDA 1K54C 3F1PB 2WKRA 2OV5A 1SKOB 2L4RA 1PYYA 5I94A 1D06A 4KENB 4YNRA 2GNXA 1EI5A 4GHIB 3IXGA 2V0UA 1HVBA 3LYXA 1FR6A 4HP9A 2GX5A 3A0VA 4OONA 1E3UA 3BY9A 3IX8A 2HP5A 5TJJA 4EBPA 5L2FA 5E2GA 3C4PA 3OZHA 3ZNYA 1SHVA 4KQRA 2WKIA 3ZVWA 1O07A 1K55C 1S67L 2XFSA 2ZL1B 4XT2B 3ZG9B 5DFYA 3P09A 3VE3A 3B3XA 2W3HA 3MQOA 4GD6A 2XQZA 4FD8A 4L0LA 4XXRA 1JWVA 3H7WB 3UE0A 3V50A 3S22A 1D7EA 5EOEA 1XFQA 2JHEA 1ES2A 3ZHHA 4YOFA 1MKIA 5EM1A 3W8KA 1ALQA 1PW1A 3UB5P 4OOYA 3C7UA 2VGLS 2FH5A 3BECA 1LI9A 2RCXA 3BYDA 4L9FA 1N4OA 1Y4OA 2PT7A 1W79A 4S2OA 4QY6A 4L9EA 5KMWA 1W5DA 3VOLA 2Y59A 4X56A 1RGYA 4MLLA 3VFHA 1G6OA 1YLYA 2HJEA 2KOIA 4FCFA 4GDBA 5HWVA 4UA6A 1NYYA 3FC7A 5FI7A 1VEUB 4OOMA 2I9VA 4GS9B 3VE4A 1FCOA 2OLUA 4EQIA 3ZGAB 1KGGA 3N4IA 4JGOA 4E3MA 1MWUA 3O88A 1GSVA 3ZG5A 5FQKA 1WE4A 4LV2A 1IKIA 2P9VA 1G6AA 3E98A 2ZQCA 5FDSA 3B47A 1BSGA 3JVUA 4FUWA 3TOIA 1K57A 1UWPX 5FQQA 3E0YA 3EQUA 4I5SA 3CZDA 1IYSA 4C75A 1OTEA 4EUZA 1IELA 2K2NA 3Q7VA 2JKFA 2Y2JA 4OPZA 4MMNA 2EXAA 4WZ5C 1T18A 2XLNA 2QZ6A 2J9OA 2KDKA 2ZC6B 1GSWA 1ONHA 4WMCD 3H82B 4OLDA 1VETA 3Q81A 4BBVA 1YM1A 4EWFA 1YLPA 1E25A 2M7VA 4CLCE 3IS2A 1X0OA 3JPUA 1IEMA 2G2WA 3GTCA 1PWCA 3T50A 5EM0A 3LR4A 1XJ4A 4OQ0A 1XGIA 4X53A 4U3TA 1ONGA 3E4OA 1BLPA 5CERA 1XP4A 1P9WA 3LY3A 2J7VA 4JF4A 2ZM8A 2R9WA 5IHVA 3GR2A 1EW0A 2XR0A 1BLSA 5L07A 4S2NA 3LGOA 3N6IA 1FSWA 3AGEA 4RX2A 4WBGA 4EQ1A 3IHAA 1XX2A 3IXDA 2J8YA 3C8CA 1XJ3A 4JXGA 4Q0IA 1S0WA 3ISGA 1TS7A 5HAQA 3OCNA 2ZQ9A 5FQ9A 3HLBA 4IBRA 5DTTA 2V8CA 3A3JA 3C38A 3O87A 4KG5A 4OQIA 5DJTA 2Q0OA 4OQGA 3NCKA 3N7WA 1SDEA 4Y7PA 3VOYA 3GQZA 5KSHA 3OPRA 3QP4A 1XA1A 2XF3A 5HWWA 3PTEA 5AQ9A 2J3TD 3CUEC 3IF6B 5EUAA 1H8YA 1LI0A 4WEKA 4H8RA 1DP6A 3IXBA 2EFUA 4QY5A 3NHQA 3W4PA 2X02A 4HEFA 3S7QA 4B93A 3F1OB 1JVJA 3RJUA 3DTKA 4OKPA 4U0TA 4ZJ1A 3IWQA 4P0MA 1MY8A 1YLTA 4OPYA 4OLGA 4HIAA 4OOLA 1T1CA 3K3DA 3HUMA 2QYBA 4NETA 2PBYA 3MSHA 4B9OA 1CJFA 4FTXA 3GRJA 2VX8A 1G68A 1FIKA 2BTFP 2JKRI 4JLFA 3HCYA 1XGJA 3LIDA 4OVDA 1CF0A 5JYOA 3UY6A 3LUQA 3A3FA 3HLWA 3QNBA 3NC8A 3DWKA 2ZBBA 3FPWA 3ZG7B 2VKSA 2Y2LA 3N8RA 3ZYTA 5AQAA 3QP8A 3BFDA 5EE8A 3UNWA 3MR0A 2ZOIA 1MZUA 1GA9A 5F69A 4OH0A 4Q8IA 1OJ5A 3BLMA 1DJAA 2WGWA 4Z9QA 1OTAA 2NUTC 1TEMA 4RX3A 3ZG0A 3RH8B 5FEFA 2D01A 3SS5A 3UPOA 4WMCA 1KDWA 1S4SA 2WKHA 2J9PA 3MMHA 4M4XA 4BQMA 3VV4A 2EA9A 5EOOA 4ETXA 4K0WA 1N9NA 4X55A 2IWCA 3S7OA 3D3OA 3O5YA 3GECA 1N9OA 5HL1A 1HTZA 2O0YA 4P6ZS 3OPPA 3R4KA 1E3UD 4M3KA 5GLDA 3NBLA 4F94A 3VOZA 4R70A 5TBMA 2Z2LB 3IWIA 2BG1A 2VGKA 5F68A 1S66L 4H6JA 1ODVA 3IBRA 1PIOA 1I2WA 1VQQA 1LT0A 4F3LA 1T19A 4HBUA 4ETZA 1FOFA 3EEHA 4G3KA 2GZAA 5E43A 1ACFA 2JKTM 4JPMA 4O7DA 3B42A 4KZ6A 1YPRA 3LO7A 5HDCA 3LIFA 2JN7A 2WKEA 1DRMA 4S2JA 5IU1A 4FSFA 4XUXA 3DTMA 5DF9A 3A3DA 3EEAA 3WS4A 5FAOA 1XJ2A 3EQVA 5CRFA 2ZQAA 1EWZA 1GHPA 4ARZA 2OSUA 3MFXA 3NDGA 1ES4A 3G31A 3VFFA 1F5MA 1KDSA 3S1YA 5GHYA 5EFWA 4UEYA 5CX7A 2OWHA 5DF8A 4PKYA 3V39A 1TD5A 3HREA 1F2KA 1JTDA 4QHCA 3OLOA 1LL9A 4R4RA 1VM1A 1K4FA 4ZJ2A 1QMFA 2K31A 3M2JA 4EBNA 1IKGA 3PBNA 1LSVA 2O99A 4X1LA 5KSCA 3AGFA 3LEZA 2INWA 3MQ0A 4IEDA 3LR0A 3IWOA 2BASA 4LRYC 3DTIA 3TE8A 1L0EA 1PFLA 3UMDA 4OP5A 2EWVA 2V8FA 4N9LA 1Z6FA 3R7WB 3LI9A 4RYEA 4ZRRA 2HJ9C 4ESPA 3OC2A 3P01A 5F1GA 1A0KA 3EGDC 2PR5A 5A91A 3OCLA 2Y2QA 4Y15A 1OJGA 4BWIA 1YMSA 4E6XA 5CEDA 4N9KA 5FAPA 3L7HA 1GSXA 1IYPA 3MZFA 4Y0TA 3ZNTA 4PHTA 1NZUA 1PZPA 2G7UA 3D4FA 3N8LA 3NECA 5EVIB 5F5YA 4QB8A 4LCLA 1KOUA 3SH7A 3T1XA 1L0DA 3IX4A 1NJ4A 4EESA 2ZQ7A 3MQQA 1F9IA 2HDQA 4C6YA 4HBTA 5TFQA 3MZDA 5EVLA 5DFXA 3FKWA 1SKOA 1H8MA 5J7EA 3UE6A 4PM9A 4QU3A 2XK1A 4UAAA 3PBOA 4HJ6A 5CGWA 3UPPA 4P85A 2P74A 3FKVA 3UB9A 3S4XA 4R3JA 5TGFA 1CEGA 2PD7A 3S7NA 4GN2A 4Y0UA 3H9WA 1TS6A 3T4QA 2HDRA 4R0QA 2PHYA 1E4DA 3G32A 4GOGA 5FL3A 5U47A 3G6OA 2XA7M 3VP2A 4XT2A 3LR5A 4BJPA 4KQOA 3CPTA 2C6WB 3NOUC 4LGWA 4N1XA 1RGZA 1YKDA 1BLHA 2PAVP 1GCEA 2R9XA 3PAEA 4E3LA 4DXCA 4CLCD 2D02A 4N1HA 2Y2GA 1OPXA 4HESA 3UE1A 2JKRM 4WZ5A 3G2ZA 3SZTA 1KE3A 4HH2A 2JE5A 4HY8A 4O0PA 5CHJA 5D3OA 2HPBA 1UGUA 1YT4A 4RA7A 2E8JA 4JXWA 4KZ4A 5EVIC 4B88A 2P9VB 1I2SA 5FAQA 1VHMA 2DNSA 1F98A 1ZTUA 4JGRA 1TS8A 1NRFA 1S6RA 4NXBA 3HJKA 1L3LA 4JXSA 1BTLA 3MZEA 4LENA 1PWGA 1SDNA 1VEUA 4UHUA 1NYMA 4OPRA 2I72A 5CHUA 3CI6A 4MN6A 1ZC2A 2ZQDA 2DMWA 2MJ6A 2WAFA 2XSSA 3UDXA 4JF5A 3KSIA 1U60A 2PYRA 3WS0A 5M19A 2CC1A 2W1RA 3WS2A 2XFTA 2JC7A 3EWKA 5HPIA 2EX6A 3T4TA 2H0YA 5IS1A 3EOIA 4HOIA 2JBFA 4NKPA 5DKLA 4IUKA 1YAXA 2V1AA 3IS2B 1T1AA 2EXBA 2NUPC 3BWLA 4RQ9A 4EW7A 5L09A 4B4ZA 4WF0A 4Y17A 1DY6A 5HWTA 5FATA 3DBAA 2RL3A 1FCMA 1YLJA 5DF7A 3LICA 3HLDA 4UA9A 2BLSA 3CUEA 2HGVA 2ZMAA 3T12B 3G34A 4KZ7A 1GA0A 1HLUP 3F1NA 4GNUA 2Z2MB 1EROA 3TSGA 4GCZA 4ZAMA 1OMEA 4QWOA 2HF6A 5E2EA 2ZM0A 4MNRA 1BULA 2UV0E 4HH3A 1N9BA 2GDNA 1KE0A 1PI4A 3PBSA 3GDIA 3I7JA 5HW3A 4ZDXA 3UB8A 4AFIA 3ITAA 4RVAA 1WYCA 2Z6CA 2Y2NA 3RTYA 1YSPA 2M1CA 1TDGA 2P04A 4LV1A 4EEUA 5FQIA 4HHDA 1MXOA 2HZ5A 1KGEA 1KVMA 4CJNA 2Q9NA 4LPZA 1IYQA 1W8YA 3G2YA 2DRWA 3CWFA 4BL3A 4CLCA 1S4RA 2WGVA 5FI6A 3ICYA 5G4YA 5I5LA 4JXVA 1SCWA 3UB6A 3LIBA 3U2AA 2W3EA 2A24B 3NY4A 1Z09A 1MWRA 2LB9A 1ZG4A 3BFFA 1STZA 1PWDA 3PYPA 3M6HA 4R1GA 5GHXA 5AQ7A 3BW6A 1MC0A 3C4OA 1P9RA 2V1ZA 5CTMA 4YWZA 4WN5A 3Q7ZA 4P6BA 1WA9A 2WK0A 3TW8A 1H5XA 3QHYA 2LB5A 4Z1WA 4MBKA 3ZFZA 4NEED 3C5AA 1RCJA 2HV1A 3BM6A 4Y0OA 1K38A 2KX6A 3P98A 4EEPA 4MN7A 2ZOHA 2QJ7A 3PBTA 4S2LA 5EPHA 3SH9A 1P97A 4PAUA 4MEZA 2WKQA 3NULA 1L0GA 2B5RA 5J4EA 3QNCA 4JGQA 4Q0JA 4HI4A 2Y8HA 1OT9A 3IF6C 3HUOA 3LR3A 2O9BA 4PPRA 3KYEA 1L0FA 2C5WB 5L10A 4LFUA 1PW8A 2EX2A 1XKZA 3ZVTA 1ES5A 3VSLA 4BD1A 5G4ZA 2Y2KA 4KG2A 4KZ9A 1FCNA 3FPVA 4H6JB 1AWIA 4X25A 2WAEA 4Q0HA 2W27A 4NXEA 4HJ3A 3ULFA 3IT9A 5AVFA 1IOUA 4F3LB 3P7NA 1JTGA 3UO9A 3WRZA 4BL2A 3NDEA 2VA0A 2W3FA 4HJ4A 2WGIA 5F1FA 1JWPA 4EU0A 3Q07A 3BQAA 1XA7A 1YLZA 5CGSA 4GLQA 1NZOA 3S7PA 4LV3A 2AVXA 3ZG8B 1ZG6A 2EWWA 2WZZA 3IBJA 4IUHA 1ES3A 2W0NA 3SOIA 2Y4AA 1XPBA 4GD8A 3RFBA 2ZJ9A 4MBHA 4MCWA 2IWDA 1DJCA 4I3IA 1ERQA 1NRJA 3C7VA 3CLOA 2W3GA 4R3AA 3UMEA 1RP5A 3KSFA 3V3SA 4PM6A 3MKFA 3GSGA 4LRZE 3NOPC 3T1QB 2WUQA 2H10A 4R6LA 4IHQA 2X01A 1ZHHB 1NLYA 3CITA 3KSHA 4BBUA 3UE3A 5AJGA 3MF0A 4KZ3A 3K3CA 4KQQA 3W4QA 4LLOB 4S2IA 4E6WA 1K54A 3NIAA 4Y2FA 2QMIA 3WRTA 1LSWA 5FEGA 1BT5A 2PU4A 1G28A 2WADA 1G5UA 4C3QA 4GDNA 1GHMA 3A0RA 2YKFA 2XH9A 4XUZA 2A2LA 2J80A 1H0MA 2O9AA 4S2MA 3IX3A 1CQAA 2XD1A 4JBFA 3UN7A 3LFVA 4YINA 2W1TA 2J3WA 4EUVA 3BLSA 3HLGA 4MDZA 4LV0A 4QPRA 1K55A 3HBRA 3TG9A 1KGFA 1QMEA 4WL9A 3C2WA 4CPKA 3K2NA 4NK3A 4CQHA 3JVVA 4OP8A 1P0ZA 3IHBA 1LHYA 4DF6A 2EX8A 2XRNA 4UA7A 3V3RA 2WKPA 5CECA 3NJAA 3PBRA 2PD8A 3NI9A 4PMAA 1LL5A 3LEQA 2M7UA 4DJ2A 2ZC4B 5TR7A 1BYWA 3M6BA 1XXMA 4K91A 4PM5A 3Q1FA 5HDSA 3OOVA 5HSQA 1T1BA 2EX9A 5L8MA 3G30A 4JGPA 3OPHA 5KZHA 3PXPA 2EFXA 4K0XA 2QPNA 4ZBEA 3BRMA 1W8QA 4FH2A 4QJGA 4GKUA 3F1PA 4X1MA 1W7FA 4IVKA 3WWXA 4JF6A 4GZBA 2PRFA 4Y5FA 2ZQ8A 3T4OA 2QKPA 5M1AA 3BJNA 4LRXC 3FWLA 5EVIA 2Y91A 3BQ8A 4GHIA 4X6TA 2G2UA 4E3OA 1VB6A 2XROA 3A3IA 1YSQA 3E2KA 1ERMA 3QP6A 4QD4A 4PKYG 2VGLM 1S1YA 2O9CA 3LY4A 3HLCA 3MBZA 3MXQA 2HDUA 3VP4A 3CPTB 2V9AA 4WUJA 3V5MA 5CTNA 3VSKA 3E2LA 2ZL1A 1CEFA 3GV9A 5HD3A 1W63M 3BFGA 5A90A 3FYZA 1MKMA 1K0KA 3T4SA 4KZAA 4R3BA 4KQDA 3H7WA 3DWZA 5KIZA 2ZC3B 2VJWA 2IWBA 3WS5A 2OAQ1 3B33A 3SS4A 3W4OA 1JNUA 3O3VA 5DTSA 4PM8A 5GLBA 2JKTI 5BOHA 2XA7S 1K6RA 3VMAA 4WYYA 4I3AA 5HX9A 3ITBA 3GMWA 1MWTA 1FILA 4E3IA 5GLCA 2Y55A 4YFMA 4E3KA 2WZXA 4WELA 1PI5A 1W63Q 5EECA 1TF1A 3OPLA 4O01A 5M18A 2VK3A 4X68A 1ZKJA 1Y54A 5FA7A 3FG8A 1C3BA 3CMZA 2OWJA 3FZCA 3Q7VB 4GS9A 4EETB 1LSXA 5F82A 5F83A 5MC7A 1OTIA 4R38A 4DE0A 5J8XA 4L9GA 4DE1A 2V2FF 3UDIA 4IVIA 2PDRA 2Q9MA 3RXWA 3A3EA 2VZWA 2B18A 2XDMA 2B02A 1NWZA 1Q2QA 1HZOA 1VETB 1ESUA 1YLWA 2Y2MA 2OOLA 3MXRA 4B4XA 2Y2OA 3BEBA 3BFCA 1CI8A 1TDLA 5GL9A 1MPLA 3W2ZA 4EXOA 3QP1A 4FOFA 3HL9A 5E2HA 5K5BA 4KZBA 5CGXA 1ESIA 5EVEA 3V67A 3MJQA 5DTKA 1H3QA 3PR6A 4DJ3A 3CG5A 2ACGA 2UWXA 3C30A 1MWSA 3F1NB 3MFDA 2P7JA 2VLGA 1KE4A 2JKGA 2PR6A 3PBQA 1NXYA 3H82A 4Y3IA 4DXBA 4BMWA 1M6KA 1UWNX 2A3UA 4DDYA 1DP8A 4X69A 3Q82A 2V20A 5FQMA 3UPNA 4BD0A 1K57C 3UB7A 4WLAA 2P08A 2GJ3A 5FI2A 3E4PA 1LL8A 5DKKA 5AVEA 5EV0A 3JYIA 1K4EA 1FQGA 2HP6A 2K7SA 5C5KA 2L0WA 4O8GA 2A49A 1FR1A 1XFNA 3TJZC 1MBLA 5HD5A 5J3WA 2KLIA 3LIEA 2VV6A 2R78A 2VV8A 1CI9A 3L9KA 4CLCB 3KYZA 2JCHA 5GHZA 5HPFA 3T1RA 1TS0A 2ZC7A 3E4QA 3PAGA 1K6SA 1XJ6A 1K56D 4U0XA 4IJGA 4D60A 1YMXA 5DJUA 3KYQA 1HD8A 2W3DA 2DCFA 3T4JA 4I38A 2ZD8A 2QHKA 3IF6A 4DRTA 4S2NC 2VEAA 3QP2A 1M40A 5FQJA 1V9ZA 1PRQA 5DVAA 1I5QA 2OAP1 1YQSA 1OT6A 1TVFA 3RXXA 4Y13A 1OTBA 5HAPA 1AXBA 2V1BA 3F1OA 1Y28A 1H8ZA 4E04A 2HP9A 3VP3A 4KUOA 1GHIA 4DN0A 2A24A 2YKHA 3IF5A 2Y2IA 5HL6A 2XEPA 2Z6DA 2WGWB 5GLAA 2HDSA 3IH9A 5A93A 2XGNA 5LBRA 2H5SA 1PNEA 3LCEA 3DW0A 3MS6A 2ZMVA 5E2FA 3GVBA 4EERA 1S1ZA 1PZOA 4LCMA 3TRCA 2PBDP 4I3JA 4DMZA 4CLCC 1SZVA 4D2OA 4P6ZM 4MBFA 1J3WA 3U4LP 1WYBA 4NG2A 4DDSA 3IXHA 4IBXA 3LI8A 4KZ8A 3CHWP 3D72A 3SS3A 5TBMB 3HLEA 4UQIM 2PYPA 2VV7A 5A92A 5CXWA 3HJIA 4DE3A 2QWSA 1Q2PA 5AQBA 4BBTA 4GW9A 5F6AA 3FV7A 5FASA 3G4PA 4EBLA 4G3VA 4WM9A 1IFQA 5CHMA 3N8SA 4N92A 4K08A 3NOTC 3SH8A 1L2SA 3HVFA 3ZQ5A 1BLCA 1N9LA 5EVID 3KSGA 3VP1A 5HDDA 4I39A 4HNBA 3ZCZA 4UQIS 4S2KA 2ZM2A 4BLMA 2OLVA 2XD5A 2QJ5A 4R4SA 2X71A 3UDFA 2E8IA 3DTEA 2Y2HA 4ARZB 5HARA 4E3JA 3G35A 1JWZA 1BZAA 4GB7A 2FZ0A 3QP5A 2ZMFA 4OPQA 5IT5A 4WZ4A 2PU2A 5G18A 3O86A 4KG6A 1BUEA 3MXSA 1O7EA 1J9MA 4G3WA 4DKIA 1SKFA 2ZLYA 3LIAA 1K25A 4JKTA 2VGJA 1DP9A 1K56A 1DJBA 4WEJA 3IQAA
chains in the Genus database with same CATH topology
3MBZA 4P87A 2RL3A 1FCMA 1YLJA 4EV4A 1LLBA 2HDUA 3VP4A 5DF7A 3DWKA 3ZG7B 3HLDA 4UA9A 3V5MA 2BLSA 5CTNA 3VSKA 2Y2LA 2ZMAA 3N8RA 2H0TA 3E2LA 5AQAA 1CEFA 3GV9A 3WS1A 3G34A 3BFDA 5EE8A 3UNWA 3BFGA 4KZ7A 3ZDJA 1GA0A 1GA9A 5A90A 4OH0A 3FYZA 4Q8IA 4GNUA 1KVLA 5CEBA 3BLMA 1DJAA 2Z2MB 2WGWA 4Z9QA 1EROA 4KZAA 4E3NA 4R3BA 1TEMA 3BFEA 4RX3A 4KZ5A 3TSGA 3ZG0A 4ZAMA 2FFFB 3DWZA 1OMEA 3SS5A 3VP0A 4WMCA 5E2EA 1KDWA 2ZC3B 3M2KA 2IWBA 3WS5A 3MKEA 3UPOA 2ZM0A 5FSRA 2WKHA 4MNRA 2J9PA 3LY4A 1BULA 2FFYA 4BQMA 3SS4A 1N9BA 2GDNA 5EOOA 3HLFA 3W4OA 4K0WA 3HUNA 1KE0A 1PI4A 3PBSA 3O3VA 5DTSA 4X55A 4PM8A 5GLBA 5BOHA 5FDHA 1IYOA 1K6RA 3VMAA 2IWCA 4ZTKA 4WYYA 3I7JA 1NY0A 4A5RA 5HW3A 5HX9A 3ITBA 3GMWA 4ZDXA 5HL1A 1HTZA 1MWTA 3ITAA 3IH8A 4E3IA 3OPPA 4RVAA 1WYCA 2Y2NA 5GLCA 2Y55A 1E3UD 4M3KA 4YFMA 5GLDA 4E3KA 3NBLA 4FH4A 2WZXA 4ID4A 1FSYA 2WYXA 1PI5A 4WELA 3VOZA 4F94A 1TDGA 4LV1A 5EECA 3OPLA 5FQIA 5M18A 2Z2LB 4X68A 1ZKJA 1Y54A 1MXOA 3IWIA 1KGEA 1KVMA 5HFOA 2BG1A 2Q9NA 4ZJ3A 4CJNA 2VGKA 5FA7A 1CK3A 2ZC5B 1C3BA 3CMZA 1IYQA 1W8YA 3G2YA 2DRWA 4R23A 3FZCA 3Q7VB 3CJMA 4DE2A 5F82A 5F83A 4PM7A 2Y2PA 4BL3A 4S2PA 5HAIA 5JYPA 4DE0A 5J8XA 1PIOA 4DE1A 1I2WA 4BENA 2V2FF 4OQHA 2WGVA 3UDIA 1VQQA 4IVIA 5FI6A 2Q9MA 3AGDA 4HBUA 1K54C 1FOFA 3RXWA 3A3EA 5E43A 2OV5A 4JXVA 1SCWA 4JPMA 4O7DA 1PYYA 2XDMA 4KZ6A 5I94A 1Q2QA 4KENB 1HZOA 1ESUA 3LO7A 1YLWA 3NY4A 1EI5A 2Y2MA 1MWRA 1ZG4A 3BFFA 3IXGA 3MXRA 4B4XA 2Y2OA 1HVBA 3BEBA 2WKEA 1PWDA 3BFCA 4S2JA 1FR6A 3M6HA 4FSFA 4R1GA 4XUXA 5GHXA 3DTMA 1CI8A 5AQ7A 5DF9A 4OONA 1E3UA 1TDLA 5GL9A 3A3DA 3C4OA 3WS4A 2HP5A 5FAOA 1MPLA 3EQVA 2V1ZA 5CTMA 5CRFA 4EBPA 5L2FA 5E2GA 2ZQAA 3Q7ZA 3C4PA 1EWZA 1GHPA 2OSUA 3HL9A 3OZHA 4P6BA 5E2HA 4KZBA 5CGXA 1ESIA 1SHVA 3ZNYA 4KQRA 2WK0A 2WKIA 1H5XA 3ZVWA 1O07A 5DTKA 1K55C 3QHYA 3NDGA 2XFSA 1ES4A 3G31A 3VFFA 4MBKA 3ZG9B 3ZFZA 3P09A 3CG5A 1KDSA 3C5AA 1RCJA 3S1YA 2UWXA 3B3XA 5GHYA 3BM6A 4BLMA 4Y0OA 1K38A 1MWSA 3MFDA 5DF8A 1KE4A 4GD6A 3V39A 3HREA 2XQZA 4FD8A 3P98A 3PBQA 1NXYA 3PBTA 4DXBA 1JTDA 1M6KA 4L0LA 4QHCA 4S2LA 2A3UA 4DDYA 4XXRA 1JWVA 1LL9A 4R4RA 3UE0A 3V50A 1VM1A 1K4FA 5EPHA 4ZJ2A 4X69A 3Q82A 1QMFA 3SH9A 3S22A 2V20A 3M2JA 4MEZA 5EOEA 5FQMA 3UPNA 4EBNA 1IKGA 1L0GA 1ES2A 3ZHHA 4BD0A 1MKIA 3PBNA 2B5RA 5KSCA 1K57C 3AGFA 3QNCA 3W8KA 3LEZA 1ALQA 1PW1A 4OOYA 4IEDA 3C7UA 3IWOA 3BECA 1LI9A 5FI2A 2RCXA 3IF6C 1L0EA 3HUOA 4OP5A 3BYDA 4PPRA 1N4OA 1L0FA 2C5WB 3JYIA 1K4EA 1W79A 4S2OA 4QY6A 1FQGA 1PW8A 2EX2A 2HP6A 5KMWA 1XKZA 3ZVTA 1ES5A 1W5DA 1Z6FA 4N9LA 2Y59A 3VSLA 4BD1A 4X56A 2A49A 2Y2KA 4KG2A 4RYEA 1FR1A 1RGYA 4MLLA 4KZ9A 3VFHA 1MBLA 3OC2A 1YLYA 1FCNA 4FCFA 4GDBA 5F1GA 4UA6A 1NYYA 5FI7A 4OOMA 5A91A 2WAEA 3OCLA 1FCOA 2OLUA 1CI9A 3ZGAB 4EQIA 2Y2QA 3IT9A 1KGGA 1YMSA 4E6XA 3N4IA 5CEDA 1JTGA 2JCHA 3UO9A 3WRZA 5GHZA 4N9KA 4E3MA 1MWUA 4BL2A 3NDEA 3O88A 5FAPA 2ZC7A 3PAGA 3ZG5A 5FQKA 1IYPA 2WGIA 1WE4A 4LV2A 1JWPA 1K6SA 5F1FA 3MZFA 1IKIA 2P9VA 1G6AA 3Q07A 4Y0TA 1XA7A 2ZQCA 1YLZA 5CGSA 3ZNTA 1NZOA 1K56D 1BSGA 1NZUA 1PZPA 4U0XA 3TOIA 1K57A 3D4FA 1YMXA 3N8LA 4LV3A 3ZG8B 5FQQA 1HD8A 3EQUA 1ZG6A 2DCFA 2WZZA 2ZD8A 3CZDA 5EVIB 1IYSA 3IF6A 4C75A 4QB8A 4DRTA 4S2NC 4EUZA 1IELA 1ES3A 4LCLA 3SOIA 2Y4AA 1M40A 1XPBA 5FQJA 3SH7A 4GD8A 5DVAA 1L0DA 3Q7VA 1I5QA 2ZJ9A 4MBHA 1NJ4A 2IWDA 1DJCA 1YQSA 1TVFA 2Y2JA 2ZQ7A 1ERQA 3RXXA 4OPZA 4C6YA 2HDQA 3C7VA 5HAPA 4HBTA 5TFQA 3MZDA 5EVLA 1AXBA 2EXAA 4WZ5C 2XLNA 1RP5A 3FKWA 1H8ZA 2QZ6A 2J9OA 2ZC6B 3V3SA 2HP9A 3VP3A 1ONHA 4PM6A 4PM9A 4QU3A 1GHIA 3GSGA 3MKFA 2XK1A 4WMCD 4UAAA 3PBOA 4OLDA 2WUQA 3Q81A 3IF5A 2Y2IA 5CGWA 3UPPA 2H10A 4P85A 1YM1A 2P74A 4EWFA 3FKVA 2XEPA 1YLPA 2X01A 1E25A 3S4XA 2WGWB 4R3JA 5TGFA 1IEMA 2G2WA 3GTCA 5GLAA 3UE3A 1CEGA 1PWCA 4KZ3A 2HDSA 3IH9A 5A93A 4GN2A 4KQQA 4Y0UA 2XGNA 3W4QA 4OQ0A 5FATA 1XGIA 4X53A 4U3TA 1ONGA 2H5SA 2HDRA 4R0QA 4S2IA 4E6WA 1BLPA 5CERA 1K54A 1XP4A 1E4DA 3LCEA 3G32A 3NIAA 3DW0A 2QMIA 3LY3A 2J7VA 4JF4A 3WRTA 4GOGA 5U47A 2ZM8A 1BT5A 5E2FA 2PU4A 2R9WA 3VP2A 5IHVA 3GVBA 1PZOA 4LCMA 4BJPA 3GR2A 4KQOA 2WADA 2XR0A 1BLSA 2C6WB 4C3QA 4D2OA 4GDNA 4N1XA 1GHMA 1RGZA 4MBFA 4S2NA 3N6IA 1BLHA 2XH9A 4XUZA 1GCEA 1FSWA 2R9XA 3PAEA 4E3LA 1WYBA 3AGEA 4RX2A 4DXCA 4DDSA 4S2MA 3IXHA 4IBXA 4WBGA 2XD1A 3IHAA 4JBFA 4KZ8A 3UN7A 4N1HA 1XX2A 3SS3A 4YINA 2Y2GA 3HLEA 4HESA 3IXDA 3UE1A 2J8YA 4JXGA 5A92A 4WZ5A 1S0WA 3BLSA 3G2ZA 1KE3A 3ISGA 3HLGA 5CXWA 5HAQA 4LV0A 2JE5A 3OCNA 2ZQ9A 4DE3A 5FQ9A 5CHJA 5D3OA 1K55A 3HBRA 2HPBA 1Q2PA 1YT4A 3HLBA 5AQBA 4RA7A 4IBRA 3TG9A 3FV7A 1KGFA 5DTTA 1QMEA 4JXWA 4KZ4A 3G4PA 5FASA 4EBLA 3A3JA 4KG5A 3O87A 5EVIC 4CPKA 4OQIA 4WM9A 4NK3A 4OP8A 4B88A 5CHMA 3N8SA 4N92A 4OQGA 3NCKA 2P9VB 3N7WA 3IHBA 1I2SA 1SDEA 1LHYA 4Y7PA 3VOYA 2EX8A 5FAQA 4DF6A 3SH8A 2DNSA 1L2SA 4UA7A 3V3RA 3HVFA 3GQZA 1BLCA 5EVID 5CECA 5KSHA 3OPRA 3PBRA 3VP1A 1XA1A 1NRFA 1S6RA 3NI9A 2XF3A 3PTEA 4PMAA 5AQ9A 1LL5A 4JXSA 3ZCZA 3IF6B 1BTLA 3MZEA 5EUAA 2ZC4B 5TR7A 4S2KA 2ZM2A 1H8YA 1LI0A 1PWGA 4LENA 1SDNA 4H8RA 4WEKA 4UHUA 2OLVA 1NYMA 3IXBA 2EFUA 3M6BA 4OPRA 1XXMA 4K91A 4QY5A 2I72A 4PM5A 2XD5A 3Q1FA 5CHUA 1ZC2A 2ZQDA 4R4SA 2EX9A 2X71A 3UDFA 3W4PA 2E8IA 2WAFA 2X02A 2Y2HA 4HEFA 3G30A 1JVJA 5HARA 4E3JA 3G35A 3UDXA 3RJUA 1JWZA 3OPHA 4JF5A 4OKPA 4U0TA 2EFXA 4ZJ1A 5KZHA 1U60A 4K0XA 1BZAA 3IWQA 2QPNA 1MY8A 4GB7A 4P0MA 3BRMA 4ZBEA 1YLTA 3WS0A 4OPYA 5M19A 2CC1A 4OLGA 1W8QA 4FH2A 3WS2A 4GKUA 4OPQA 4QJGA 2XFTA 4OOLA 2JC7A 4WZ4A 3HUMA 2EX6A 1W7FA 2PU2A 2H0YA 5G18A 4IVKA 4NETA 2JBFA 3O86A 3WWXA 2PBYA 4JF6A 4GZBA 4KG6A 1BUEA 3MXSA 1O7EA 1J9MA 4DKIA 2ZQ8A 5M1AA 3GRJA 1SKFA 3FWLA 2EXBA 2ZLYA 5EVIA 2Y91A 4X6TA 2G2UA 4E3OA 1G68A 1K25A 2VGJA 3A3IA 4JKTA 4JLFA 1XGJA 4OVDA 3E2KA 1ERMA 4B4ZA 1DY6A 4QD4A 5JYOA 1K56A 3UY6A 3IQAA 1DJBA 4WEJA 3A3FA 3HLWA 3HLCA 3QNBA 3NC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MBZ A;  4P87 A;  2RL3 A;  1FCM A;  1YLJ A;  4EV4 A;  1LLB A;  2HDU A;  3VP4 A;  5DF7 A;  3DWK A;  3ZG7 B;  3HLD A;  4UA9 A;  3V5M A;  2BLS A;  5CTN A;  3VSK A;  2Y2L A;  2ZMA A;  3N8R A;  2H0T A;  3E2L A;  5AQA A;  1CEF A;  3GV9 A;  3WS1 A;  3G34 A;  3BFD A;  5EE8 A;  3UNW A;  3BFG A;  4KZ7 A;  3ZDJ A;  1GA0 A;  1GA9 A;  5A90 A;  4OH0 A;  3FYZ A;  4Q8I A;  4GNU A;  1KVL A;  5CEB A;  3BLM A;  1DJA A;  2Z2M B;  2WGW A;  4Z9Q A;  1ERO A;  4KZA A;  4E3N A;  4R3B A;  1TEM A;  3BFE A;  4RX3 A;  4KZ5 A;  3TSG A;  3ZG0 A;  4ZAM A;  2FFF B;  3DWZ A;  1OME A;  3SS5 A;  3VP0 A;  4WMC A;  5E2E A;  1KDW A;  2ZC3 B;  3M2K A;  2IWB A;  3WS5 A;  3MKE A;  3UPO A;  2ZM0 A;  5FSR A;  2WKH A;  4MNR A;  2J9P A;  3LY4 A;  1BUL A;  2FFY A;  4BQM A;  3SS4 A;  1N9B A;  2GDN A;  5EOO A;  3HLF A;  3W4O A;  4K0W A;  3HUN A;  1KE0 A;  1PI4 A;  3PBS A;  3O3V A;  5DTS A;  4X55 A;  4PM8 A;  5GLB A;  5BOH A;  5FDH A;  1IYO A;  1K6R A;  3VMA A;  2IWC A;  4ZTK A;  4WYY A;  3I7J A;  1NY0 A;  4A5R A;  5HW3 A;  5HX9 A;  3ITB A;  3GMW A;  4ZDX A;  5HL1 A;  1HTZ A;  1MWT A;  3ITA A;  3IH8 A;  4E3I A;  3OPP A;  4RVA A;  1WYC A;  2Y2N A;  5GLC A;  2Y55 A;  1E3U D;  4M3K A;  4YFM A;  5GLD A;  4E3K A;  3NBL A;  4FH4 A;  2WZX A;  4ID4 A;  1FSY A;  2WYX A;  1PI5 A;  4WEL A;  3VOZ A;  4F94 A;  1TDG A;  4LV1 A;  5EEC A;  3OPL A;  5FQI A;  5M18 A;  2Z2L B;  4X68 A;  1ZKJ A;  1Y54 A;  1MXO A;  3IWI A;  1KGE A;  1KVM A;  5HFO A;  2BG1 A;  2Q9N A;  4ZJ3 A;  4CJN A;  2VGK A;  5FA7 A;  1CK3 A;  2ZC5 B;  1C3B A;  3CMZ A;  1IYQ A;  1W8Y A;  3G2Y A;  2DRW A;  4R23 A;  3FZC A;  3Q7V B;  3CJM A;  4DE2 A;  5F82 A;  5F83 A;  4PM7 A;  2Y2P A;  4BL3 A;  4S2P A;  5HAI A;  5JYP A;  4DE0 A;  5J8X A;  1PIO A;  4DE1 A;  1I2W A;  4BEN A;  2V2F F;  4OQH A;  2WGV A;  3UDI A;  1VQQ A;  4IVI A;  5FI6 A;  2Q9M A;  3AGD A;  4HBU A;  1K54 C;  1FOF A;  3RXW A;  3A3E A;  5E43 A;  2OV5 A;  4JXV A;  1SCW A;  4JPM A;  4O7D A;  1PYY A;  2XDM A;  4KZ6 A;  5I94 A;  1Q2Q A;  4KEN B;  1HZO A;  1ESU A;  3LO7 A;  1YLW A;  3NY4 A;  1EI5 A;  2Y2M A;  1MWR A;  1ZG4 A;  3BFF A;  3IXG A;  3MXR A;  4B4X A;  2Y2O A;  1HVB A;  3BEB A;  2WKE A;  1PWD A;  3BFC A;  4S2J A;  1FR6 A;  3M6H A;  4FSF A;  4R1G A;  4XUX A;  5GHX A;  3DTM A;  1CI8 A;  5AQ7 A;  5DF9 A;  4OON A;  1E3U A;  1TDL A;  5GL9 A;  3A3D A;  3C4O A;  3WS4 A;  2HP5 A;  5FAO A;  1MPL A;  3EQV A;  2V1Z A;  5CTM A;  5CRF A;  4EBP A;  5L2F A;  5E2G A;  2ZQA A;  3Q7Z A;  3C4P A;  1EWZ A;  1GHP A;  2OSU A;  3HL9 A;  3OZH A;  4P6B A;  5E2H A;  4KZB A;  5CGX A;  1ESI A;  1SHV A;  3ZNY A;  4KQR A;  2WK0 A;  2WKI A;  1H5X A;  3ZVW A;  1O07 A;  5DTK A;  1K55 C;  3QHY A;  3NDG A;  2XFS A;  1ES4 A;  3G31 A;  3VFF A;  4MBK A;  3ZG9 B;  3ZFZ A;  3P09 A;  3CG5 A;  1KDS A;  3C5A A;  1RCJ A;  3S1Y A;  2UWX A;  3B3X A;  5GHY A;  3BM6 A;  4BLM A;  4Y0O A;  1K38 A;  1MWS A;  3MFD A;  5DF8 A;  1KE4 A;  4GD6 A;  3V39 A;  3HRE A;  2XQZ A;  4FD8 A;  3P98 A;  3PBQ A;  1NXY A;  3PBT A;  4DXB A;  1JTD A;  1M6K A;  4L0L A;  4QHC A;  4S2L A;  2A3U A;  4DDY A;  4XXR A;  1JWV A;  1LL9 A;  4R4R A;  3UE0 A;  3V50 A;  1VM1 A;  1K4F A;  5EPH A;  4ZJ2 A;  4X69 A;  3Q82 A;  1QMF A;  3SH9 A;  3S22 A;  2V20 A;  3M2J A;  4MEZ A;  5EOE A;  5FQM A;  3UPN A;  4EBN A;  1IKG A;  1L0G A;  1ES2 A;  3ZHH A;  4BD0 A;  1MKI A;  3PBN A;  2B5R A;  5KSC A;  1K57 C;  3AGF A;  3QNC A;  3W8K A;  3LEZ A;  1ALQ A;  1PW1 A;  4OOY A;  4IED A;  3C7U A;  3IWO A;  3BEC A;  1LI9 A;  5FI2 A;  2RCX A;  3IF6 C;  1L0E A;  3HUO A;  4OP5 A;  3BYD A;  4PPR A;  1N4O A;  1L0F A;  2C5W B;  3JYI A;  1K4E A;  1W79 A;  4S2O A;  4QY6 A;  1FQG A;  1PW8 A;  2EX2 A;  2HP6 A;  5KMW A;  1XKZ A;  3ZVT A;  1ES5 A;  1W5D A;  1Z6F A;  4N9L A;  2Y59 A;  3VSL A;  4BD1 A;  4X56 A;  2A49 A;  2Y2K A;  4KG2 A;  4RYE A;  1FR1 A;  1RGY A;  4MLL A;  4KZ9 A;  3VFH A;  1MBL A;  3OC2 A;  1YLY A;  1FCN A;  4FCF A;  4GDB A;  5F1G A;  4UA6 A;  1NYY A;  5FI7 A;  4OOM A;  5A91 A;  2WAE A;  3OCL A;  1FCO A;  2OLU A;  1CI9 A;  3ZGA B;  4EQI A;  2Y2Q A;  3IT9 A;  1KGG A;  1YMS A;  4E6X A;  3N4I A;  5CED A;  1JTG A;  2JCH A;  3UO9 A;  3WRZ A;  5GHZ A;  4N9K A;  4E3M A;  1MWU A;  4BL2 A;  3NDE A;  3O88 A;  5FAP A;  2ZC7 A;  3PAG A;  3ZG5 A;  5FQK A;  1IYP A;  2WGI A;  1WE4 A;  4LV2 A;  1JWP A;  1K6S A;  5F1F A;  3MZF A;  1IKI A;  2P9V A;  1G6A A;  3Q07 A;  4Y0T A;  1XA7 A;  2ZQC A;  1YLZ A;  5CGS A;  3ZNT A;  1NZO A;  1K56 D;  1BSG A;  1NZU A;  1PZP A;  4U0X A;  3TOI A;  1K57 A;  3D4F A;  1YMX A;  3N8L A;  4LV3 A;  3ZG8 B;  5FQQ A;  1HD8 A;  3EQU A;  1ZG6 A;  2DCF A;  2WZZ A;  2ZD8 A;  3CZD A;  5EVI B;  1IYS A;  3IF6 A;  4C75 A;  4QB8 A;  4DRT A;  4S2N C;  4EUZ A;  1IEL A;  1ES3 A;  4LCL A;  3SOI A;  2Y4A A;  1M40 A;  1XPB A;  5FQJ A;  3SH7 A;  4GD8 A;  5DVA A;  1L0D A;  3Q7V A;  1I5Q A;  2ZJ9 A;  4MBH A;  1NJ4 A;  2IWD A;  1DJC A;  1YQS A;  1TVF A;  2Y2J A;  2ZQ7 A;  1ERQ A;  3RXX A;  4OPZ A;  4C6Y A;  2HDQ A;  3C7V A;  5HAP A;  4HBT A;  5TFQ A;  3MZD A;  5EVL A;  1AXB A;  2EXA A;  4WZ5 C;  2XLN A;  1RP5 A;  3FKW A;  1H8Z A;  2QZ6 A;  2J9O A;  2ZC6 B;  3V3S A;  2HP9 A;  3VP3 A;  1ONH A;  4PM6 A;  4PM9 A;  4QU3 A;  1GHI A;  3GSG A;  3MKF A;  2XK1 A;  4WMC D;  4UAA A;  3PBO A;  4OLD A;  2WUQ A;  3Q81 A;  3IF5 A;  2Y2I A;  5CGW A;  3UPP A;  2H10 A;  4P85 A;  1YM1 A;  2P74 A;  4EWF A;  3FKV A;  2XEP A;  1YLP A;  2X01 A;  1E25 A;  3S4X A;  2WGW B;  4R3J A;  5TGF A;  1IEM A;  2G2W A;  3GTC A;  5GLA A;  3UE3 A;  1CEG A;  1PWC A;  4KZ3 A;  2HDS A;  3IH9 A;  5A93 A;  4GN2 A;  4KQQ A;  4Y0U A;  2XGN A;  3W4Q A;  4OQ0 A;  5FAT A;  1XGI A;  4X53 A;  4U3T A;  1ONG A;  2H5S A;  2HDR A;  4R0Q A;  4S2I A;  4E6W A;  1BLP A;  5CER A;  1K54 A;  1XP4 A;  1E4D A;  3LCE A;  3G32 A;  3NIA A;  3DW0 A;  2QMI A;  3LY3 A;  2J7V A;  4JF4 A;  3WRT A;  4GOG A;  5U47 A;  2ZM8 A;  1BT5 A;  5E2F A;  2PU4 A;  2R9W A;  3VP2 A;  5IHV A;  3GVB A;  1PZO A;  4LCM A;  4BJP A;  3GR2 A;  4KQO A;  2WAD A;  2XR0 A;  1BLS A;  2C6W B;  4C3Q A;  4D2O A;  4GDN A;  4N1X A;  1GHM A;  1RGZ A;  4MBF A;  4S2N A;  3N6I A;  1BLH A;  2XH9 A;  4XUZ A;  1GCE A;  1FSW A;  2R9X A;  3PAE A;  4E3L A;  1WYB A;  3AGE A;  4RX2 A;  4DXC A;  4DDS A;  4S2M A;  3IXH A;  4IBX A;  4WBG A;  2XD1 A;  3IHA A;  4JBF A;  4KZ8 A;  3UN7 A;  4N1H A;  1XX2 A;  3SS3 A;  4YIN A;  2Y2G A;  3HLE A;  4HES A;  3IXD A;  3UE1 A;  2J8Y A;  4JXG A;  5A92 A;  4WZ5 A;  1S0W A;  3BLS A;  3G2Z A;  1KE3 A;  3ISG A;  3HLG A;  5CXW A;  5HAQ A;  4LV0 A;  2JE5 A;  3OCN A;  2ZQ9 A;  4DE3 A;  5FQ9 A;  5CHJ A;  5D3O A;  1K55 A;  3HBR A;  2HPB A;  1Q2P A;  1YT4 A;  3HLB A;  5AQB A;  4RA7 A;  4IBR A;  3TG9 A;  3FV7 A;  1KGF A;  5DTT A;  1QME A;  4JXW A;  4KZ4 A;  3G4P A;  5FAS A;  4EBL A;  3A3J A;  4KG5 A;  3O87 A;  5EVI C;  4CPK A;  4OQI A;  4WM9 A;  4NK3 A;  4OP8 A;  4B88 A;  5CHM A;  3N8S A;  4N92 A;  4OQG A;  3NCK A;  2P9V B;  3N7W A;  3IHB A;  1I2S A;  1SDE A;  1LHY A;  4Y7P A;  3VOY A;  2EX8 A;  5FAQ A;  4DF6 A;  3SH8 A;  2DNS A;  1L2S A;  4UA7 A;  3V3R A;  3HVF A;  3GQZ A;  1BLC A;  5EVI D;  5CEC A;  5KSH A;  3OPR A;  3PBR A;  3VP1 A;  1XA1 A;  1NRF A;  1S6R A;  3NI9 A;  2XF3 A;  3PTE A;  4PMA A;  5AQ9 A;  1LL5 A;  4JXS A;  3ZCZ A;  3IF6 B;  1BTL A;  3MZE A;  5EUA A;  2ZC4 B;  5TR7 A;  4S2K A;  2ZM2 A;  1H8Y A;  1LI0 A;  1PWG A;  4LEN A;  1SDN A;  4H8R A;  4WEK A;  4UHU A;  2OLV A;  1NYM A;  3IXB A;  2EFU A;  3M6B A;  4OPR A;  1XXM A;  4K91 A;  4QY5 A;  2I72 A;  4PM5 A;  2XD5 A;  3Q1F A;  5CHU A;  1ZC2 A;  2ZQD A;  4R4S A;  2EX9 A;  2X71 A;  3UDF A;  3W4P A;  2E8I A;  2WAF A;  2X02 A;  2Y2H A;  4HEF A;  3G30 A;  1JVJ A;  5HAR A;  4E3J A;  3G35 A;  3UDX A;  3RJU A;  1JWZ A;  3OPH A;  4JF5 A;  4OKP A;  4U0T A;  2EFX A;  4ZJ1 A;  5KZH A;  1U60 A;  4K0X A;  1BZA A;  3IWQ A;  2QPN A;  1MY8 A;  4GB7 A;  4P0M A;  3BRM A;  4ZBE A;  1YLT A;  3WS0 A;  4OPY A;  5M19 A;  2CC1 A;  4OLG A;  1W8Q A;  4FH2 A;  3WS2 A;  4GKU A;  4OPQ A;  4QJG A;  2XFT A;  4OOL A;  2JC7 A;  4WZ4 A;  3HUM A;  2EX6 A;  1W7F A;  2PU2 A;  2H0Y A;  5G18 A;  4IVK A;  4NET A;  2JBF A;  3O86 A;  3WWX A;  2PBY A;  4JF6 A;  4GZB A;  4KG6 A;  1BUE A;  3MXS A;  1O7E A;  1J9M A;  4DKI A;  2ZQ8 A;  5M1A A;  3GRJ A;  1SKF A;  3FWL A;  2EXB A;  2ZLY A;  5EVI A;  2Y91 A;  4X6T A;  2G2U A;  4E3O A;  1G68 A;  1K25 A;  2VGJ A;  3A3I A;  4JKT A;  4JLF A;  1XGJ A;  4OVD A;  3E2K A;  1ERM A;  4B4Z A;  1DY6 A;  4QD4 A;  5JYO A;  1K56 A;  3UY6 A;  3IQA A;  1DJB A;  4WEJ A;  3A3F A;  3HLW A;  3HLC A;  3QNB A;  3NC8 A; 
#chains in the Genus database with same CATH topology
 4P87 A;  1V9Y A;  4EV4 A;  1LLB A;  3BY8 A;  1OTD A;  2H0T A;  2H28 A;  3WS1 A;  3A0S A;  3KX0 X;  4HQA A;  3ZDJ A;  4NXG A;  2B95 A;  1KVL A;  5CEB A;  4NXF A;  3D9Y A;  2W1T B;  2Y79 A;  4E3N A;  1D1J A;  3BFE A;  4KZ5 A;  2FFF B;  3SW1 A;  1NLZ A;  4HP4 A;  3VP0 A;  3M2K A;  3MKE A;  3OBF A;  5FSR A;  3KO6 A;  2FFY A;  2IA2 A;  4MN5 A;  3HLF A;  4KUK A;  3HUN A;  3T1S A;  5FDH A;  1IYO A;  4GJ4 A;  5HZH A;  4ZTK A;  3PHY A;  1NY0 A;  4A5R A;  2J3T C;  3IH8 A;  2L1M A;  4ME4 A;  2CMN A;  5A8B A;  3CAX A;  4FH4 A;  3EGX C;  1FSY A;  2WYX A;  4ID4 A;  2V0W A;  3R7W A;  5HFO A;  3T4K A;  4ZJ3 A;  1CK3 A;  3DAV A;  3T4L A;  2ZC5 B;  4R23 A;  4II7 A;  3CJM A;  4DE2 A;  4PM7 A;  2Y2P A;  4S2P A;  5HAI A;  5JYP A;  4BEN A;  4OQH A;  3AGD A;  1K54 C;  3F1P B;  2WKR A;  2OV5 A;  1SKO B;  2L4R A;  1PYY A;  5I94 A;  1D06 A;  4KEN B;  4YNR A;  2GNX A;  1EI5 A;  4GHI B;  3IXG A;  2V0U A;  1HVB A;  3LYX A;  1FR6 A;  4HP9 A;  2GX5 A;  3A0V A;  4OON A;  1E3U A;  3BY9 A;  3IX8 A;  2HP5 A;  5TJJ A;  4EBP A;  5L2F A;  5E2G A;  3C4P A;  3OZH A;  3ZNY A;  1SHV A;  4KQR A;  2WKI A;  3ZVW A;  1O07 A;  1K55 C;  1S67 L;  2XFS A;  2ZL1 B;  4XT2 B;  3ZG9 B;  5DFY A;  3P09 A;  3VE3 A;  3B3X A;  2W3H A;  3MQO A;  4GD6 A;  2XQZ A;  4FD8 A;  4L0L A;  4XXR A;  1JWV A;  3H7W B;  3UE0 A;  3V50 A;  3S22 A;  1D7E A;  5EOE A;  1XFQ A;  2JHE A;  1ES2 A;  3ZHH A;  4YOF A;  1MKI A;  5EM1 A;  3W8K A;  1ALQ A;  1PW1 A;  3UB5 P;  4OOY A;  3C7U A;  2VGL S;  2FH5 A;  3BEC A;  1LI9 A;  2RCX A;  3BYD A;  4L9F A;  1N4O A;  1Y4O A;  2PT7 A;  1W79 A;  4S2O A;  4QY6 A;  4L9E A;  5KMW A;  1W5D A;  3VOL A;  2Y59 A;  4X56 A;  1RGY A;  4MLL A;  3VFH A;  1G6O A;  1YLY A;  2HJE A;  2KOI A;  4FCF A;  4GDB A;  5HWV A;  4UA6 A;  1NYY A;  3FC7 A;  5FI7 A;  1VEU B;  4OOM A;  2I9V A;  4GS9 B;  3VE4 A;  1FCO A;  2OLU A;  4EQI A;  3ZGA B;  1KGG A;  3N4I A;  4JGO A;  4E3M A;  1MWU A;  3O88 A;  1GSV A;  3ZG5 A;  5FQK A;  1WE4 A;  4LV2 A;  1IKI A;  2P9V A;  1G6A A;  3E98 A;  2ZQC A;  5FDS A;  3B47 A;  1BSG A;  3JVU A;  4FUW A;  3TOI A;  1K57 A;  1UWP X;  5FQQ A;  3E0Y A;  3EQU A;  4I5S A;  3CZD A;  1IYS A;  4C75 A;  1OTE A;  4EUZ A;  1IEL A;  2K2N A;  3Q7V A;  2JKF A;  2Y2J A;  4OPZ A;  4MMN A;  2EXA A;  4WZ5 C;  1T18 A;  2XLN A;  2QZ6 A;  2J9O A;  2KDK A;  2ZC6 B;  1GSW A;  1ONH A;  4WMC D;  3H82 B;  4OLD A;  1VET A;  3Q81 A;  4BBV A;  1YM1 A;  4EWF A;  1YLP A;  1E25 A;  2M7V A;  4CLC E;  3IS2 A;  1X0O A;  3JPU A;  1IEM A;  2G2W A;  3GTC A;  1PWC A;  3T50 A;  5EM0 A;  3LR4 A;  1XJ4 A;  4OQ0 A;  1XGI A;  4X53 A;  4U3T A;  1ONG A;  3E4O A;  1BLP A;  5CER A;  1XP4 A;  1P9W A;  3LY3 A;  2J7V A;  4JF4 A;  2ZM8 A;  2R9W A;  5IHV A;  3GR2 A;  1EW0 A;  2XR0 A;  1BLS A;  5L07 A;  4S2N A;  3LGO A;  3N6I A;  1FSW A;  3AGE A;  4RX2 A;  4WBG A;  4EQ1 A;  3IHA A;  1XX2 A;  3IXD A;  2J8Y A;  3C8C A;  1XJ3 A;  4JXG A;  4Q0I A;  1S0W A;  3ISG A;  1TS7 A;  5HAQ A;  3OCN A;  2ZQ9 A;  5FQ9 A;  3HLB A;  4IBR A;  5DTT A;  2V8C A;  3A3J A;  3C38 A;  3O87 A;  4KG5 A;  4OQI A;  5DJT A;  2Q0O A;  4OQG A;  3NCK A;  3N7W A;  1SDE A;  4Y7P A;  3VOY A;  3GQZ A;  5KSH A;  3OPR A;  3QP4 A;  1XA1 A;  2XF3 A;  5HWW A;  3PTE A;  5AQ9 A;  2J3T D;  3CUE C;  3IF6 B;  5EUA A;  1H8Y A;  1LI0 A;  4WEK A;  4H8R A;  1DP6 A;  3IXB A;  2EFU A;  4QY5 A;  3NHQ A;  3W4P A;  2X02 A;  4HEF A;  3S7Q A;  4B93 A;  3F1O B;  1JVJ A;  3RJU A;  3DTK A;  4OKP A;  4U0T A;  4ZJ1 A;  3IWQ A;  4P0M A;  1MY8 A;  1YLT A;  4OPY A;  4OLG A;  4HIA A;  4OOL A;  1T1C A;  3K3D A;  3HUM A;  2QYB A;  4NET A;  2PBY A;  3MSH A;  4B9O A;  1CJF A;  4FTX A;  3GRJ A;  2VX8 A;  1G68 A;  1FIK A;  2BTF P;  2JKR I;  4JLF A;  3HCY A;  1XGJ A;  3LID A;  4OVD A;  1CF0 A;  5JYO A;  3UY6 A;  3LUQ A;  3A3F A;  3HLW A;  3QNB A;  3NC8 A;  3DWK A;  2ZBB A;  3FPW A;  3ZG7 B;  2VKS A;  2Y2L A;  3N8R A;  3ZYT A;  5AQA A;  3QP8 A;  3BFD A;  5EE8 A;  3UNW A;  3MR0 A;  2ZOI A;  1MZU A;  1GA9 A;  5F69 A;  4OH0 A;  4Q8I A;  1OJ5 A;  3BLM A;  1DJA A;  2WGW A;  4Z9Q A;  1OTA A;  2NUT C;  1TEM A;  4RX3 A;  3ZG0 A;  3RH8 B;  5FEF A;  2D01 A;  3SS5 A;  3UPO A;  4WMC A;  1KDW A;  1S4S A;  2WKH A;  2J9P A;  3MMH A;  4M4X A;  4BQM A;  3VV4 A;  2EA9 A;  5EOO A;  4ETX A;  4K0W A;  1N9N A;  4X55 A;  2IWC A;  3S7O A;  3D3O A;  3O5Y A;  3GEC A;  1N9O A;  5HL1 A;  1HTZ A;  2O0Y A;  4P6Z S;  3OPP A;  3R4K A;  1E3U D;  4M3K A;  5GLD A;  3NBL A;  4F94 A;  3VOZ A;  4R70 A;  5TBM A;  2Z2L B;  3IWI A;  2BG1 A;  2VGK A;  5F68 A;  1S66 L;  4H6J A;  1ODV A;  3IBR A;  1PIO A;  1I2W A;  1VQQ A;  1LT0 A;  4F3L A;  1T19 A;  4HBU A;  4ETZ A;  1FOF A;  3EEH A;  4G3K A;  2GZA A;  5E43 A;  1ACF A;  2JKT M;  4JPM A;  4O7D A;  3B42 A;  4KZ6 A;  1YPR A;  3LO7 A;  5HDC A;  3LIF A;  2JN7 A;  2WKE A;  1DRM A;  4S2J A;  5IU1 A;  4FSF A;  4XUX A;  3DTM A;  5DF9 A;  3A3D A;  3EEA A;  3WS4 A;  5FAO A;  1XJ2 A;  3EQV A;  5CRF A;  2ZQA A;  1EWZ A;  1GHP A;  4ARZ A;  2OSU A;  3MFX A;  3NDG A;  1ES4 A;  3G31 A;  3VFF A;  1F5M A;  1KDS A;  3S1Y A;  5GHY A;  5EFW A;  4UEY A;  5CX7 A;  2OWH A;  5DF8 A;  4PKY A;  3V39 A;  1TD5 A;  3HRE A;  1F2K A;  1JTD A;  4QHC A;  3OLO A;  1LL9 A;  4R4R A;  1VM1 A;  1K4F A;  4ZJ2 A;  1QMF A;  2K31 A;  3M2J A;  4EBN A;  1IKG A;  3PBN A;  1LSV A;  2O99 A;  4X1L A;  5KSC A;  3AGF A;  3LEZ A;  2INW A;  3MQ0 A;  4IED A;  3LR0 A;  3IWO A;  2BAS A;  4LRY C;  3DTI A;  3TE8 A;  1L0E A;  1PFL A;  3UMD A;  4OP5 A;  2EWV A;  2V8F A;  4N9L A;  1Z6F A;  3R7W B;  3LI9 A;  4RYE A;  4ZRR A;  2HJ9 C;  4ESP A;  3OC2 A;  3P01 A;  5F1G A;  1A0K A;  3EGD C;  2PR5 A;  5A91 A;  3OCL A;  2Y2Q A;  4Y15 A;  1OJG A;  4BWI A;  1YMS A;  4E6X A;  5CED A;  4N9K A;  5FAP A;  3L7H A;  1GSX A;  1IYP A;  3MZF A;  4Y0T A;  3ZNT A;  4PHT A;  1NZU A;  1PZP A;  2G7U A;  3D4F A;  3N8L A;  3NEC A;  5EVI B;  5F5Y A;  4QB8 A;  4LCL A;  1KOU A;  3SH7 A;  3T1X A;  1L0D A;  3IX4 A;  1NJ4 A;  4EES A;  2ZQ7 A;  3MQQ A;  1F9I A;  2HDQ A;  4C6Y A;  4HBT A;  5TFQ A;  3MZD A;  5EVL A;  5DFX A;  3FKW A;  1SKO A;  1H8M A;  5J7E A;  3UE6 A;  4PM9 A;  4QU3 A;  2XK1 A;  4UAA A;  3PBO A;  4HJ6 A;  5CGW A;  3UPP A;  4P85 A;  2P74 A;  3FKV A;  3UB9 A;  3S4X A;  4R3J A;  5TGF A;  1CEG A;  2PD7 A;  3S7N A;  4GN2 A;  4Y0U A;  3H9W A;  1TS6 A;  3T4Q A;  2HDR A;  4R0Q A;  2PHY A;  1E4D A;  3G32 A;  4GOG A;  5FL3 A;  5U47 A;  3G6O A;  2XA7 M;  3VP2 A;  4XT2 A;  3LR5 A;  4BJP A;  4KQO A;  3CPT A;  2C6W B;  3NOU C;  4LGW A;  4N1X A;  1RGZ A;  1YKD A;  1BLH A;  2PAV P;  1GCE A;  2R9X A;  3PAE A;  4E3L A;  4DXC A;  4CLC D;  2D02 A;  4N1H A;  2Y2G A;  1OPX A;  4HES A;  3UE1 A;  2JKR M;  4WZ5 A;  3G2Z A;  3SZT A;  1KE3 A;  4HH2 A;  2JE5 A;  4HY8 A;  4O0P A;  5CHJ A;  5D3O A;  2HPB A;  1UGU A;  1YT4 A;  4RA7 A;  2E8J A;  4JXW A;  4KZ4 A;  5EVI C;  4B88 A;  2P9V B;  1I2S A;  5FAQ A;  1VHM A;  2DNS A;  1F98 A;  1ZTU A;  4JGR A;  1TS8 A;  1NRF A;  1S6R A;  4NXB A;  3HJK A;  1L3L A;  4JXS A;  1BTL A;  3MZE A;  4LEN A;  1PWG A;  1SDN A;  1VEU A;  4UHU A;  1NYM A;  4OPR A;  2I72 A;  5CHU A;  3CI6 A;  4MN6 A;  1ZC2 A;  2ZQD A;  2DMW A;  2MJ6 A;  2WAF A;  2XSS A;  3UDX A;  4JF5 A;  3KSI A;  1U60 A;  2PYR A;  3WS0 A;  5M19 A;  2CC1 A;  2W1R A;  3WS2 A;  2XFT A;  2JC7 A;  3EWK A;  5HPI A;  2EX6 A;  3T4T A;  2H0Y A;  5IS1 A;  3EOI A;  4HOI A;  2JBF A;  4NKP A;  5DKL A;  4IUK A;  1YAX A;  2V1A A;  3IS2 B;  1T1A A;  2EXB A;  2NUP C;  3BWL A;  4RQ9 A;  4EW7 A;  5L09 A;  4B4Z A;  4WF0 A;  4Y17 A;  1DY6 A;  5HWT A;  5FAT A;  3DBA A;  2RL3 A;  1FCM A;  1YLJ A;  5DF7 A;  3LIC A;  3HLD A;  4UA9 A;  2BLS A;  3CUE A;  2HGV A;  2ZMA A;  3T12 B;  3G34 A;  4KZ7 A;  1GA0 A;  1HLU P;  3F1N A;  4GNU A;  2Z2M B;  1ERO A;  3TSG A;  4GCZ A;  4ZAM A;  1OME A;  4QWO A;  2HF6 A;  5E2E A;  2ZM0 A;  4MNR A;  1BUL A;  2UV0 E;  4HH3 A;  1N9B A;  2GDN A;  1KE0 A;  1PI4 A;  3PBS A;  3GDI A;  3I7J A;  5HW3 A;  4ZDX A;  3UB8 A;  4AFI A;  3ITA A;  4RVA A;  1WYC A;  2Z6C A;  2Y2N A;  3RTY A;  1YSP A;  2M1C A;  1TDG A;  2P04 A;  4LV1 A;  4EEU A;  5FQI A;  4HHD A;  1MXO A;  2HZ5 A;  1KGE A;  1KVM A;  4CJN A;  2Q9N A;  4LPZ A;  1IYQ A;  1W8Y A;  3G2Y A;  2DRW A;  3CWF A;  4BL3 A;  4CLC A;  1S4R A;  2WGV A;  5FI6 A;  3ICY A;  5G4Y A;  5I5L A;  4JXV A;  1SCW A;  3UB6 A;  3LIB A;  3U2A A;  2W3E A;  2A24 B;  3NY4 A;  1Z09 A;  1MWR A;  2LB9 A;  1ZG4 A;  3BFF A;  1STZ A;  1PWD A;  3PYP A;  3M6H A;  4R1G A;  5GHX A;  5AQ7 A;  3BW6 A;  1MC0 A;  3C4O A;  1P9R A;  2V1Z A;  5CTM A;  4YWZ A;  4WN5 A;  3Q7Z A;  4P6B A;  1WA9 A;  2WK0 A;  3TW8 A;  1H5X A;  3QHY A;  2LB5 A;  4Z1W A;  4MBK A;  3ZFZ A;  4NEE D;  3C5A A;  1RCJ A;  2HV1 A;  3BM6 A;  4Y0O A;  1K38 A;  2KX6 A;  3P98 A;  4EEP A;  4MN7 A;  2ZOH A;  2QJ7 A;  3PBT A;  4S2L A;  5EPH A;  3SH9 A;  1P97 A;  4PAU A;  4MEZ A;  2WKQ A;  3NUL A;  1L0G A;  2B5R A;  5J4E A;  3QNC A;  4JGQ A;  4Q0J A;  4HI4 A;  2Y8H A;  1OT9 A;  3IF6 C;  3HUO A;  3LR3 A;  2O9B A;  4PPR A;  3KYE A;  1L0F A;  2C5W B;  5L10 A;  4LFU A;  1PW8 A;  2EX2 A;  1XKZ A;  3ZVT A;  1ES5 A;  3VSL A;  4BD1 A;  5G4Z A;  2Y2K A;  4KG2 A;  4KZ9 A;  1FCN A;  3FPV A;  4H6J B;  1AWI A;  4X25 A;  2WAE A;  4Q0H A;  2W27 A;  4NXE A;  4HJ3 A;  3ULF A;  3IT9 A;  5AVF A;  1IOU A;  4F3L B;  3P7N A;  1JTG A;  3UO9 A;  3WRZ A;  4BL2 A;  3NDE A;  2VA0 A;  2W3F A;  4HJ4 A;  2WGI A;  5F1F A;  1JWP A;  4EU0 A;  3Q07 A;  3BQA A;  1XA7 A;  1YLZ A;  5CGS A;  4GLQ A;  1NZO A;  3S7P A;  4LV3 A;  2AVX A;  3ZG8 B;  1ZG6 A;  2EWW A;  2WZZ A;  3IBJ A;  4IUH A;  1ES3 A;  2W0N A;  3SOI A;  2Y4A A;  1XPB A;  4GD8 A;  3RFB A;  2ZJ9 A;  4MBH A;  4MCW A;  2IWD A;  1DJC A;  4I3I A;  1ERQ A;  1NRJ A;  3C7V A;  3CLO A;  2W3G A;  4R3A A;  3UME A;  1RP5 A;  3KSF A;  3V3S A;  4PM6 A;  3MKF A;  3GSG A;  4LRZ E;  3NOP C;  3T1Q B;  2WUQ A;  2H10 A;  4R6L A;  4IHQ A;  2X01 A;  1ZHH B;  1NLY A;  3CIT A;  3KSH A;  4BBU A;  3UE3 A;  5AJG A;  3MF0 A;  4KZ3 A;  3K3C A;  4KQQ A;  3W4Q A;  4LLO B;  4S2I A;  4E6W A;  1K54 A;  3NIA A;  4Y2F A;  2QMI A;  3WRT A;  1LSW A;  5FEG A;  1BT5 A;  2PU4 A;  1G28 A;  2WAD A;  1G5U A;  4C3Q A;  4GDN A;  1GHM A;  3A0R A;  2YKF A;  2XH9 A;  4XUZ A;  2A2L A;  2J80 A;  1H0M A;  2O9A A;  4S2M A;  3IX3 A;  1CQA A;  2XD1 A;  4JBF A;  3UN7 A;  3LFV A;  4YIN A;  2W1T A;  2J3W A;  4EUV A;  3BLS A;  3HLG A;  4MDZ A;  4LV0 A;  4QPR A;  1K55 A;  3HBR A;  3TG9 A;  1KGF A;  1QME A;  4WL9 A;  3C2W A;  4CPK A;  3K2N A;  4NK3 A;  4CQH A;  3JVV A;  4OP8 A;  1P0Z A;  3IHB A;  1LHY A;  4DF6 A;  2EX8 A;  2XRN A;  4UA7 A;  3V3R A;  2WKP A;  5CEC A;  3NJA A;  3PBR A;  2PD8 A;  3NI9 A;  4PMA A;  1LL5 A;  3LEQ A;  2M7U A;  4DJ2 A;  2ZC4 B;  5TR7 A;  1BYW A;  3M6B A;  1XXM A;  4K91 A;  4PM5 A;  3Q1F A;  5HDS A;  3OOV A;  5HSQ A;  1T1B A;  2EX9 A;  5L8M A;  3G30 A;  4JGP A;  3OPH A;  5KZH A;  3PXP A;  2EFX A;  4K0X A;  2QPN A;  4ZBE A;  3BRM A;  1W8Q A;  4FH2 A;  4QJG A;  4GKU A;  3F1P A;  4X1M A;  1W7F A;  4IVK A;  3WWX A;  4JF6 A;  4GZB A;  2PRF A;  4Y5F A;  2ZQ8 A;  3T4O A;  2QKP A;  5M1A A;  3BJN A;  4LRX C;  3FWL A;  5EVI A;  2Y91 A;  3BQ8 A;  4GHI A;  4X6T A;  2G2U A;  4E3O A;  1VB6 A;  2XRO A;  3A3I A;  1YSQ A;  3E2K A;  1ERM A;  3QP6 A;  4QD4 A;  4PKY G;  2VGL M;  1S1Y A;  2O9C A;  3LY4 A;  3HLC A;  3MBZ A;  3MXQ A;  2HDU A;  3VP4 A;  3CPT B;  2V9A A;  4WUJ A;  3V5M A;  5CTN A;  3VSK A;  3E2L A;  2ZL1 A;  1CEF A;  3GV9 A;  5HD3 A;  1W63 M;  3BFG A;  5A90 A;  3FYZ A;  1MKM A;  1K0K A;  3T4S A;  4KZA A;  4R3B A;  4KQD A;  3H7W A;  3DWZ A;  5KIZ A;  2ZC3 B;  2VJW A;  2IWB A;  3WS5 A;  2OAQ 1;  3B33 A;  3SS4 A;  3W4O A;  1JNU A;  3O3V A;  5DTS A;  4PM8 A;  5GLB A;  2JKT I;  5BOH A;  2XA7 S;  1K6R A;  3VMA A;  4WYY A;  4I3A A;  5HX9 A;  3ITB A;  3GMW A;  1MWT A;  1FIL A;  4E3I A;  5GLC A;  2Y55 A;  4YFM A;  4E3K A;  2WZX A;  4WEL A;  1PI5 A;  1W63 Q;  5EEC A;  1TF1 A;  3OPL A;  4O01 A;  5M18 A;  2VK3 A;  4X68 A;  1ZKJ A;  1Y54 A;  5FA7 A;  3FG8 A;  1C3B A;  3CMZ A;  2OWJ A;  3FZC A;  3Q7V B;  4GS9 A;  4EET B;  1LSX A;  5F82 A;  5F83 A;  5MC7 A;  1OTI A;  4R38 A;  4DE0 A;  5J8X A;  4L9G A;  4DE1 A;  2V2F F;  3UDI A;  4IVI A;  2PDR A;  2Q9M A;  3RXW A;  3A3E A;  2VZW A;  2B18 A;  2XDM A;  2B02 A;  1NWZ A;  1Q2Q A;  1HZO A;  1VET B;  1ESU A;  1YLW A;  2Y2M A;  2OOL A;  3MXR A;  4B4X A;  2Y2O A;  3BEB A;  3BFC A;  1CI8 A;  1TDL A;  5GL9 A;  1MPL A;  3W2Z A;  4EXO A;  3QP1 A;  4FOF A;  3HL9 A;  5E2H A;  5K5B A;  4KZB A;  5CGX A;  1ESI A;  5EVE A;  3V67 A;  3MJQ A;  5DTK A;  1H3Q A;  3PR6 A;  4DJ3 A;  3CG5 A;  2ACG A;  2UWX A;  3C30 A;  1MWS A;  3F1N B;  3MFD A;  2P7J A;  2VLG A;  1KE4 A;  2JKG A;  2PR6 A;  3PBQ A;  1NXY A;  3H82 A;  4Y3I A;  4DXB A;  4BMW A;  1M6K A;  1UWN X;  2A3U A;  4DDY A;  1DP8 A;  4X69 A;  3Q82 A;  2V20 A;  5FQM A;  3UPN A;  4BD0 A;  1K57 C;  3UB7 A;  4WLA A;  2P08 A;  2GJ3 A;  5FI2 A;  3E4P A;  1LL8 A;  5DKK A;  5AVE A;  5EV0 A;  3JYI A;  1K4E A;  1FQG A;  2HP6 A;  2K7S A;  5C5K A;  2L0W A;  4O8G A;  2A49 A;  1FR1 A;  1XFN A;  3TJZ C;  1MBL A;  5HD5 A;  5J3W A;  2KLI A;  3LIE A;  2VV6 A;  2R78 A;  2VV8 A;  1CI9 A;  3L9K A;  4CLC B;  3KYZ A;  2JCH A;  5GHZ A;  5HPF A;  3T1R A;  1TS0 A;  2ZC7 A;  3E4Q A;  3PAG A;  1K6S A;  1XJ6 A;  1K56 D;  4U0X A;  4IJG A;  4D60 A;  1YMX A;  5DJU A;  3KYQ A;  1HD8 A;  2W3D A;  2DCF A;  3T4J A;  4I38 A;  2ZD8 A;  2QHK A;  3IF6 A;  4DRT A;  4S2N C;  2VEA A;  3QP2 A;  1M40 A;  5FQJ A;  1V9Z A;  1PRQ A;  5DVA A;  1I5Q A;  2OAP 1;  1YQS A;  1OT6 A;  1TVF A;  3RXX A;  4Y13 A;  1OTB A;  5HAP A;  1AXB A;  2V1B A;  3F1O A;  1Y28 A;  1H8Z A;  4E04 A;  2HP9 A;  3VP3 A;  4KUO A;  1GHI A;  4DN0 A;  2A24 A;  2YKH A;  3IF5 A;  2Y2I A;  5HL6 A;  2XEP A;  2Z6D A;  2WGW B;  5GLA A;  2HDS A;  3IH9 A;  5A93 A;  2XGN A;  5LBR A;  2H5S A;  1PNE A;  3LCE A;  3DW0 A;  3MS6 A;  2ZMV A;  5E2F A;  3GVB A;  4EER A;  1S1Z A;  1PZO A;  4LCM A;  3TRC A;  2PBD P;  4I3J A;  4DMZ A;  4CLC C;  1SZV A;  4D2O A;  4P6Z M;  4MBF A;  1J3W A;  3U4L P;  1WYB A;  4NG2 A;  4DDS A;  3IXH A;  4IBX A;  3LI8 A;  4KZ8 A;  3CHW P;  3D72 A;  3SS3 A;  5TBM B;  3HLE A;  4UQI M;  2PYP A;  2VV7 A;  5A92 A;  5CXW A;  3HJI A;  4DE3 A;  2QWS A;  1Q2P A;  5AQB A;  4BBT A;  4GW9 A;  5F6A A;  3FV7 A;  5FAS A;  3G4P A;  4EBL A;  4G3V A;  4WM9 A;  1IFQ A;  5CHM A;  3N8S A;  4N92 A;  4K08 A;  3NOT C;  3SH8 A;  1L2S A;  3HVF A;  3ZQ5 A;  1BLC A;  1N9L A;  5EVI D;  3KSG A;  3VP1 A;  5HDD A;  4I39 A;  4HNB A;  3ZCZ A;  4UQI S;  4S2K A;  2ZM2 A;  4BLM A;  2OLV A;  2XD5 A;  2QJ5 A;  4R4S A;  2X71 A;  3UDF A;  2E8I A;  3DTE A;  2Y2H A;  4ARZ B;  5HAR A;  4E3J A;  3G35 A;  1JWZ A;  1BZA A;  4GB7 A;  2FZ0 A;  3QP5 A;  2ZMF A;  4OPQ A;  5IT5 A;  4WZ4 A;  2PU2 A;  5G18 A;  3O86 A;  4KG6 A;  1BUE A;  3MXS A;  1O7E A;  1J9M A;  4G3W A;  4DKI A;  1SKF A;  2ZLY A;  3LIA A;  1K25 A;  4JKT A;  2VGJ A;  1DP9 A;  1K56 A;  1DJB A;  4WEJ A;  3IQA A; 
#chains in the Genus database with same CATH homology
 3MBZ A;  4P87 A;  2RL3 A;  1FCM A;  1YLJ A;  4EV4 A;  1LLB A;  2HDU A;  3VP4 A;  5DF7 A;  3DWK A;  3ZG7 B;  3HLD A;  4UA9 A;  3V5M A;  2BLS A;  5CTN A;  3VSK A;  2Y2L A;  2ZMA A;  3N8R A;  2H0T A;  3E2L A;  5AQA A;  1CEF A;  3GV9 A;  3WS1 A;  3G34 A;  3BFD A;  5EE8 A;  3UNW A;  3BFG A;  4KZ7 A;  3ZDJ A;  1GA0 A;  1GA9 A;  5A90 A;  4OH0 A;  3FYZ A;  4Q8I A;  4GNU A;  1KVL A;  5CEB A;  3BLM A;  1DJA A;  2Z2M B;  2WGW A;  4Z9Q A;  1ERO A;  4KZA A;  4E3N A;  4R3B A;  1TEM A;  3BFE A;  4RX3 A;  4KZ5 A;  3TSG A;  3ZG0 A;  4ZAM A;  2FFF B;  3DWZ A;  1OME A;  3SS5 A;  3VP0 A;  4WMC A;  5E2E A;  1KDW A;  2ZC3 B;  3M2K A;  2IWB A;  3WS5 A;  3MKE A;  3UPO A;  2ZM0 A;  5FSR A;  2WKH A;  4MNR A;  2J9P A;  3LY4 A;  1BUL A;  2FFY A;  4BQM A;  3SS4 A;  1N9B A;  2GDN A;  5EOO A;  3HLF A;  3W4O A;  4K0W A;  3HUN A;  1KE0 A;  1PI4 A;  3PBS A;  3O3V A;  5DTS A;  4X55 A;  4PM8 A;  5GLB A;  5BOH A;  5FDH A;  1IYO A;  1K6R A;  3VMA A;  2IWC A;  4ZTK A;  4WYY A;  3I7J A;  1NY0 A;  4A5R A;  5HW3 A;  5HX9 A;  3ITB A;  3GMW A;  4ZDX A;  5HL1 A;  1HTZ A;  1MWT A;  3ITA A;  3IH8 A;  4E3I A;  3OPP A;  4RVA A;  1WYC A;  2Y2N A;  5GLC A;  2Y55 A;  1E3U D;  4M3K A;  4YFM A;  5GLD A;  4E3K A;  3NBL A;  4FH4 A;  2WZX A;  4ID4 A;  1FSY A;  2WYX A;  1PI5 A;  4WEL A;  3VOZ A;  4F94 A;  1TDG A;  4LV1 A;  5EEC A;  3OPL A;  5FQI A;  5M18 A;  2Z2L B;  4X68 A;  1ZKJ A;  1Y54 A;  1MXO A;  3IWI A;  1KGE A;  1KVM A;  5HFO A;  2BG1 A;  2Q9N A;  4ZJ3 A;  4CJN A;  2VGK A;  5FA7 A;  1CK3 A;  2ZC5 B;  1C3B A;  3CMZ A;  1IYQ A;  1W8Y A;  3G2Y A;  2DRW A;  4R23 A;  3FZC A;  3Q7V B;  3CJM A;  4DE2 A;  5F82 A;  5F83 A;  4PM7 A;  2Y2P A;  4BL3 A;  4S2P A;  5HAI A;  5JYP A;  4DE0 A;  5J8X A;  1PIO A;  4DE1 A;  1I2W A;  4BEN A;  2V2F F;  4OQH A;  2WGV A;  3UDI A;  1VQQ A;  4IVI A;  5FI6 A;  2Q9M A;  3AGD A;  4HBU A;  1K54 C;  1FOF A;  3RXW A;  3A3E A;  5E43 A;  2OV5 A;  4JXV A;  1SCW A;  4JPM A;  4O7D A;  1PYY A;  2XDM A;  4KZ6 A;  5I94 A;  1Q2Q A;  4KEN B;  1HZO A;  1ESU A;  3LO7 A;  1YLW A;  3NY4 A;  1EI5 A;  2Y2M A;  1MWR A;  1ZG4 A;  3BFF A;  3IXG A;  3MXR A;  4B4X A;  2Y2O A;  1HVB A;  3BEB A;  2WKE A;  1PWD A;  3BFC A;  4S2J A;  1FR6 A;  3M6H A;  4FSF A;  4R1G A;  4XUX A;  5GHX A;  3DTM A;  1CI8 A;  5AQ7 A;  5DF9 A;  4OON A;  1E3U A;  1TDL A;  5GL9 A;  3A3D A;  3C4O A;  3WS4 A;  2HP5 A;  5FAO A;  1MPL A;  3EQV A;  2V1Z A;  5CTM A;  5CRF A;  4EBP A;  5L2F A;  5E2G A;  2ZQA A;  3Q7Z A;  3C4P A;  1EWZ A;  1GHP A;  2OSU A;  3HL9 A;  3OZH A;  4P6B A;  5E2H A;  4KZB A;  5CGX A;  1ESI A;  1SHV A;  3ZNY A;  4KQR A;  2WK0 A;  2WKI A;  1H5X A;  3ZVW A;  1O07 A;  5DTK A;  1K55 C;  3QHY A;  3NDG A;  2XFS A;  1ES4 A;  3G31 A;  3VFF A;  4MBK A;  3ZG9 B;  3ZFZ A;  3P09 A;  3CG5 A;  1KDS A;  3C5A A;  1RCJ A;  3S1Y A;  2UWX A;  3B3X A;  5GHY A;  3BM6 A;  4BLM A;  4Y0O A;  1K38 A;  1MWS A;  3MFD A;  5DF8 A;  1KE4 A;  4GD6 A;  3V39 A;  3HRE A;  2XQZ A;  4FD8 A;  3P98 A;  3PBQ A;  1NXY A;  3PBT A;  4DXB A;  1JTD A;  1M6K A;  4L0L A;  4QHC A;  4S2L A;  2A3U A;  4DDY A;  4XXR A;  1JWV A;  1LL9 A;  4R4R A;  3UE0 A;  3V50 A;  1VM1 A;  1K4F A;  5EPH A;  4ZJ2 A;  4X69 A;  3Q82 A;  1QMF A;  3SH9 A;  3S22 A;  2V20 A;  3M2J A;  4MEZ A;  5EOE A;  5FQM A;  3UPN A;  4EBN A;  1IKG A;  1L0G A;  1ES2 A;  3ZHH A;  4BD0 A;  1MKI A;  3PBN A;  2B5R A;  5KSC A;  1K57 C;  3AGF A;  3QNC A;  3W8K A;  3LEZ A;  1ALQ A;  1PW1 A;  4OOY A;  4IED A;  3C7U A;  3IWO A;  3BEC A;  1LI9 A;  5FI2 A;  2RCX A;  3IF6 C;  1L0E A;  3HUO A;  4OP5 A;  3BYD A;  4PPR A;  1N4O A;  1L0F A;  2C5W B;  3JYI A;  1K4E A;  1W79 A;  4S2O A;  4QY6 A;  1FQG A;  1PW8 A;  2EX2 A;  2HP6 A;  5KMW A;  1XKZ A;  3ZVT A;  1ES5 A;  1W5D A;  1Z6F A;  4N9L A;  2Y59 A;  3VSL A;  4BD1 A;  4X56 A;  2A49 A;  2Y2K A;  4KG2 A;  4RYE A;  1FR1 A;  1RGY A;  4MLL A;  4KZ9 A;  3VFH A;  1MBL A;  3OC2 A;  1YLY A;  1FCN A;  4FCF A;  4GDB A;  5F1G A;  4UA6 A;  1NYY A;  5FI7 A;  4OOM A;  5A91 A;  2WAE A;  3OCL A;  1FCO A;  2OLU A;  1CI9 A;  3ZGA B;  4EQI A;  2Y2Q A;  3IT9 A;  1KGG A;  1YMS A;  4E6X A;  3N4I A;  5CED A;  1JTG A;  2JCH A;  3UO9 A;  3WRZ A;  5GHZ A;  4N9K A;  4E3M A;  1MWU A;  4BL2 A;  3NDE A;  3O88 A;  5FAP A;  2ZC7 A;  3PAG A;  3ZG5 A;  5FQK A;  1IYP A;  2WGI A;  1WE4 A;  4LV2 A;  1JWP A;  1K6S A;  5F1F A;  3MZF A;  1IKI A;  2P9V A;  1G6A A;  3Q07 A;  4Y0T A;  1XA7 A;  2ZQC A;  1YLZ A;  5CGS A;  3ZNT A;  1NZO A;  1K56 D;  1BSG A;  1NZU A;  1PZP A;  4U0X A;  3TOI A;  1K57 A;  3D4F A;  1YMX A;  3N8L A;  4LV3 A;  3ZG8 B;  5FQQ A;  1HD8 A;  3EQU A;  1ZG6 A;  2DCF A;  2WZZ A;  2ZD8 A;  3CZD A;  5EVI B;  1IYS A;  3IF6 A;  4C75 A;  4QB8 A;  4DRT A;  4S2N C;  4EUZ A;  1IEL A;  1ES3 A;  4LCL A;  3SOI A;  2Y4A A;  1M40 A;  1XPB A;  5FQJ A;  3SH7 A;  4GD8 A;  5DVA A;  1L0D A;  3Q7V A;  1I5Q A;  2ZJ9 A;  4MBH A;  1NJ4 A;  2IWD A;  1DJC A;  1YQS A;  1TVF A;  2Y2J A;  2ZQ7 A;  1ERQ A;  3RXX A;  4OPZ A;  4C6Y A;  2HDQ A;  3C7V A;  5HAP A;  4HBT A;  5TFQ A;  3MZD A;  5EVL A;  1AXB A;  2EXA A;  4WZ5 C;  2XLN A;  1RP5 A;  3FKW A;  1H8Z A;  2QZ6 A;  2J9O A;  2ZC6 B;  3V3S A;  2HP9 A;  3VP3 A;  1ONH A;  4PM6 A;  4PM9 A;  4QU3 A;  1GHI A;  3GSG A;  3MKF A;  2XK1 A;  4WMC D;  4UAA A;  3PBO A;  4OLD A;  2WUQ A;  3Q81 A;  3IF5 A;  2Y2I A;  5CGW A;  3UPP A;  2H10 A;  4P85 A;  1YM1 A;  2P74 A;  4EWF A;  3FKV A;  2XEP A;  1YLP A;  2X01 A;  1E25 A;  3S4X A;  2WGW B;  4R3J A;  5TGF A;  1IEM A;  2G2W A;  3GTC A;  5GLA A;  3UE3 A;  1CEG A;  1PWC A;  4KZ3 A;  2HDS A;  3IH9 A;  5A93 A;  4GN2 A;  4KQQ A;  4Y0U A;  2XGN A;  3W4Q A;  4OQ0 A;  5FAT A;  1XGI A;  4X53 A;  4U3T A;  1ONG A;  2H5S A;  2HDR A;  4R0Q A;  4S2I A;  4E6W A;  1BLP A;  5CER A;  1K54 A;  1XP4 A;  1E4D A;  3LCE A;  3G32 A;  3NIA A;  3DW0 A;  2QMI A;  3LY3 A;  2J7V A;  4JF4 A;  3WRT A;  4GOG A;  5U47 A;  2ZM8 A;  1BT5 A;  5E2F A;  2PU4 A;  2R9W A;  3VP2 A;  5IHV A;  3GVB A;  1PZO A;  4LCM A;  4BJP A;  3GR2 A;  4KQO A;  2WAD A;  2XR0 A;  1BLS A;  2C6W B;  4C3Q A;  4D2O A;  4GDN A;  4N1X A;  1GHM A;  1RGZ A;  4MBF A;  4S2N A;  3N6I A;  1BLH A;  2XH9 A;  4XUZ A;  1GCE A;  1FSW A;  2R9X A;  3PAE A;  4E3L A;  1WYB A;  3AGE A;  4RX2 A;  4DXC A;  4DDS A;  4S2M A;  3IXH A;  4IBX A;  4WBG A;  2XD1 A;  3IHA A;  4JBF A;  4KZ8 A;  3UN7 A;  4N1H A;  1XX2 A;  3SS3 A;  4YIN A;  2Y2G A;  3HLE A;  4HES A;  3IXD A;  3UE1 A;  2J8Y A;  4JXG A;  5A92 A;  4WZ5 A;  1S0W A;  3BLS A;  3G2Z A;  1KE3 A;  3ISG A;  3HLG A;  5CXW A;  5HAQ A;  4LV0 A;  2JE5 A;  3OCN A;  2ZQ9 A;  4DE3 A;  5FQ9 A;  5CHJ A;  5D3O A;  1K55 A;  3HBR A;  2HPB A;  1Q2P A;  1YT4 A;  3HLB A;  5AQB A;  4RA7 A;  4IBR A;  3TG9 A;  3FV7 A;  1KGF A;  5DTT A;  1QME A;  4JXW A;  4KZ4 A;  3G4P A;  5FAS A;  4EBL A;  3A3J A;  4KG5 A;  3O87 A;  5EVI C;  4CPK A;  4OQI A;  4WM9 A;  4NK3 A;  4OP8 A;  4B88 A;  5CHM A;  3N8S A;  4N92 A;  4OQG A;  3NCK A;  2P9V B;  3N7W A;  3IHB A;  1I2S A;  1SDE A;  1LHY A;  4Y7P A;  3VOY A;  2EX8 A;  5FAQ A;  4DF6 A;  3SH8 A;  2DNS A;  1L2S A;  4UA7 A;  3V3R A;  3HVF A;  3GQZ A;  1BLC A;  5EVI D;  5CEC A;  5KSH A;  3OPR A;  3PBR A;  3VP1 A;  1XA1 A;  1NRF A;  1S6R A;  3NI9 A;  2XF3 A;  3PTE A;  4PMA A;  5AQ9 A;  1LL5 A;  4JXS A;  3ZCZ A;  3IF6 B;  1BTL A;  3MZE A;  5EUA A;  2ZC4 B;  5TR7 A;  4S2K A;  2ZM2 A;  1H8Y A;  1LI0 A;  1PWG A;  4LEN A;  1SDN A;  4H8R A;  4WEK A;  4UHU A;  2OLV A;  1NYM A;  3IXB A;  2EFU A;  3M6B A;  4OPR A;  1XXM A;  4K91 A;  4QY5 A;  2I72 A;  4PM5 A;  2XD5 A;  3Q1F A;  5CHU A;  1ZC2 A;  2ZQD A;  4R4S A;  2EX9 A;  2X71 A;  3UDF A;  3W4P A;  2E8I A;  2WAF A;  2X02 A;  2Y2H A;  4HEF A;  3G30 A;  1JVJ A;  5HAR A;  4E3J A;  3G35 A;  3UDX A;  3RJU A;  1JWZ A;  3OPH A;  4JF5 A;  4OKP A;  4U0T A;  2EFX A;  4ZJ1 A;  5KZH A;  1U60 A;  4K0X A;  1BZA A;  3IWQ A;  2QPN A;  1MY8 A;  4GB7 A;  4P0M A;  3BRM A;  4ZBE A;  1YLT A;  3WS0 A;  4OPY A;  5M19 A;  2CC1 A;  4OLG A;  1W8Q A;  4FH2 A;  3WS2 A;  4GKU A;  4OPQ A;  4QJG A;  2XFT A;  4OOL A;  2JC7 A;  4WZ4 A;  3HUM A;  2EX6 A;  1W7F A;  2PU2 A;  2H0Y A;  5G18 A;  4IVK A;  4NET A;  2JBF A;  3O86 A;  3WWX A;  2PBY A;  4JF6 A;  4GZB A;  4KG6 A;  1BUE A;  3MXS A;  1O7E A;  1J9M A;  4DKI A;  2ZQ8 A;  5M1A A;  3GRJ A;  1SKF A;  3FWL A;  2EXB A;  2ZLY A;  5EVI A;  2Y91 A;  4X6T A;  2G2U A;  4E3O A;  1G68 A;  1K25 A;  2VGJ A;  3A3I A;  4JKT A;  4JLF A;  1XGJ A;  4OVD A;  3E2K A;  1ERM A;  4B4Z A;  1DY6 A;  4QD4 A;  5JYO A;  1K56 A;  3UY6 A;  3IQA A;  1DJB A;  4WEJ A;  3A3F A;  3HLW A;  3HLC A;  3QNB A;  3NC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...