4MCBA

H.influenzae trmd in complex with n-(4-{[(1h-imidazol-2-ylmethyl)amino]methyl}benzyl)-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidine-5-carboxamide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
Knots found
sequence length
219
structure length
205
Chain Sequence
b'MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGLLDCPHYTRPEVLEGLTVPPVLMSHHEEIRKWRLKQSLQRTWLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Selective Inhibitors of Bacterial t-RNA-(N(1)G37) Methyltransferase (TrmD) That Demonstrate Novel Ordering of the Lid Domain.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase/transferase inhibitor
total genus 50
structure length 205
sequence length 219
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4mcbA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4mcbA01
1OY5A 4YQ1A 4YPYA 3GYQA 4XBOA 1Z85A 1IPAA 3N4JA 4X3LA 4JALA 4YQPA 4YQIA 3L8UA 1P9PA 3AI9X 1V2XA 1UALA 2V3JA 5CO4A 4YQBA 1UAMA 3N4KA 4JAKA 3BBHA 4PZKA 4YQ6A 4MCCA 3OINA 4YQSA 3OIIA 2QWVA 3KW2A 3O7BA 1X7OA 5GMCA 4CNEA 1NXZA 2YY8A 3E5YA 3BBEA 4YQ5A 4YQ9A 4YVKA 4YQDA 1VH0A 4YQQA 4YPZA 4CNFA 4YQ0A 3ONPA 3DCMX 4YQRA 2V3KA 4YVHA 4RG1A 2I6DA 1X7PA 2EGVA 4YVIA 5D9FA 1ZJRA 4YQNA 4YQJA 4X3MA 4FAKA 2HA8A 1MXIA 4H3ZA 1UAKA 4J3CA 4YVJA 1O6DA 3BBDA 4YQ8A 1VHYA 4KDZA 1VHKA 1K3RA 3IEFA 4YVGA 4L69A 3NK6A 4IG6A 4H3YA 5FAIA 4YQOA 4YQ4A 3KY7A 2O3AA 4YQCA 2QMMA 4E8BA 5GMBA 4KGNA 4YQ2A 3KNUA 4CNDA 5GM8A 4YQKA 3OIJA 4YQ7A 4YQGA 4CNGA 3IC6A 1TO0A 3ILKA 1NS5A 2Z0YA 3KTYA 3AXZA 2CX8A 1V6ZA 4YQLA 3NK7A 4YPXA 1UAJA 4YQTA 4YPWA 4YQ3A 4YQAA 4MCDA 1J85A 4MCBA 1GZ0A 3QUVA 3AIAA 2EGWA
chains in the Genus database with same CATH superfamily
1CO0A 1OY5A 4YQ1A 4YPYA 3GYQA 4XBOA 1Z85A 1IPAA 3N4JA 4X3LA 3WRPA 1TROA 4JALA 4YQPA 1WRPR 4YQIA 3L8UA 1P9PA 3AI9X 1V2XA 1UALA 2OZ9R 1RCSA 2V3JA 5CO4A 4YQBA 1UAMA 3N4KA 4JAKA 3BBHA 4PZKA 4YQ6A 4MCCA 3OINA 4YQSA 2XDIA 3OIIA 2QWVA 3KW2A 4JWGA 3O7BA 1JHGA 1X7OA 5GMCA 4CNEA 1NXZA 2YY8A 3E5YA 3BBEA 4YQ5A 4YQ9A 4FMWA 4YVKA 4YQDA 1VH0A 4YQQA 4YPZA 4JWFA 4CNFA 4YQ0A 3G1CA 1ZT9A 3ONPA 3DCMX 4YQRA 1WRSR 2V3KA 4YVHA 4RG1A 2I6DA 1MI7R 1X7PA 2EGVA 4YVIA 5D9FA 1ZJRA 4YQNA 4YQJA 4X3MA 4FAKA 2HA8A 1MXIA 1WRTR 4H3ZA 1UAKA 4J3CA 4YVJA 1O6DA 3BBDA 4YQ8A 1VHYA 4KDZA 1VHKA 1K3RA 3IEFA 4YVGA 4L69A 1TRRA 3NK6A 4IG6A 4H3YA 5FAIA 4YQOA 4YQ4A 3KY7A 2O3AA 4YQCA 2QMMA 4E8BA 5GMBA 4KGNA 4YQ2A 3KNUA 4CNDA 4JWJA 5GM8A 4YQKA 3OIJA 4YQ7A 4YQGA 3SSXN 4CNGA 3IC6A 3KORA 1TO0A 3ILKA 1NS5A 2Z0YA 3KTYA 3SSWN 3AXZA 2CX8A 4YQLA 1V6ZA 3NK7A 4YPXA 1UAJA 4YQTA 4YPWA 4YQ3A 4YQAA 4JWHA 4MCDA 1J85A 3FRWA 4MCBA 1GZ0A 3QUVA 3AIAA 2EGWA
chains in the Genus database with same CATH topology
1OY5A 4YQ1A 4YPYA 3GYQA 4XBOA 1Z85A 1IPAA 3N4JA 4X3LA 4JALA 4YQPA 4YQIA 3L8UA 1P9PA 3AI9X 1V2XA 1UALA 2V3JA 5CO4A 4YQBA 1UAMA 3N4KA 4JAKA 3BBHA 4PZKA 4YQ6A 4MCCA 3OINA 4YQSA 3OIIA 2QWVA 3KW2A 4JWGA 3O7BA 1X7OA 5GMCA 4CNEA 1NXZA 2YY8A 3E5YA 3BBEA 4YQ5A 4YQ9A 4FMWA 4YVKA 4YQDA 1VH0A 4YQQA 4YPZA 4JWFA 4CNFA 4YQ0A 3ONPA 3DCMX 4YQRA 2V3KA 4YVHA 4RG1A 2I6DA 1X7PA 2EGVA 4YVIA 5D9FA 1ZJRA 4YQNA 4YQJA 4X3MA 4FAKA 2HA8A 1MXIA 4H3ZA 1UAKA 4J3CA 4YVJA 1O6DA 3BBDA 4YQ8A 1VHYA 4KDZA 1VHKA 1K3RA 3IEFA 4YVGA 4L69A 3NK6A 4IG6A 4H3YA 5FAIA 4YQOA 4YQ4A 3KY7A 2O3AA 4YQCA 2QMMA 4E8BA 5GMBA 4KGNA 4YQ2A 3KNUA 4CNDA 4JWJA 5GM8A 4YQKA 3OIJA 4YQ7A 4YQGA 4CNGA 3IC6A 1TO0A 3ILKA 1NS5A 2Z0YA 3KTYA 3AXZA 2CX8A 1V6ZA 4YQLA 3NK7A 4YPXA 1UAJA 4YQTA 4YPWA 4YQ3A 4YQAA 4JWHA 4MCDA 1J85A 4MCBA 1GZ0A 3QUVA 3AIAA 2EGWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OY5 A;  4YQ1 A;  4YPY A;  3GYQ A;  4XBO A;  1Z85 A;  1IPA A;  3N4J A;  4X3L A;  4JAL A;  4YQP A;  4YQI A;  3L8U A;  1P9P A;  3AI9 X;  1V2X A;  1UAL A;  2V3J A;  5CO4 A;  4YQB A;  1UAM A;  3N4K A;  4JAK A;  3BBH A;  4PZK A;  4YQ6 A;  4MCC A;  3OIN A;  4YQS A;  3OII A;  2QWV A;  3KW2 A;  3O7B A;  1X7O A;  5GMC A;  4CNE A;  1NXZ A;  2YY8 A;  3E5Y A;  3BBE A;  4YQ5 A;  4YQ9 A;  4YVK A;  4YQD A;  1VH0 A;  4YQQ A;  4YPZ A;  4CNF A;  4YQ0 A;  3ONP A;  3DCM X;  4YQR A;  2V3K A;  4YVH A;  4RG1 A;  2I6D A;  1X7P A;  2EGV A;  4YVI A;  5D9F A;  1ZJR A;  4YQN A;  4YQJ A;  4X3M A;  4FAK A;  2HA8 A;  1MXI A;  4H3Z A;  1UAK A;  4J3C A;  4YVJ A;  1O6D A;  3BBD A;  4YQ8 A;  1VHY A;  4KDZ A;  1VHK A;  1K3R A;  3IEF A;  4YVG A;  4L69 A;  3NK6 A;  4IG6 A;  4H3Y A;  5FAI A;  4YQO A;  4YQ4 A;  3KY7 A;  2O3A A;  4YQC A;  2QMM A;  4E8B A;  5GMB A;  4KGN A;  4YQ2 A;  3KNU A;  4CND A;  5GM8 A;  4YQK A;  3OIJ A;  4YQ7 A;  4YQG A;  4CNG A;  3IC6 A;  1TO0 A;  3ILK A;  1NS5 A;  2Z0Y A;  3KTY A;  3AXZ A;  2CX8 A;  1V6Z A;  4YQL A;  3NK7 A;  4YPX A;  1UAJ A;  4YQT A;  4YPW A;  4YQ3 A;  4YQA A;  4MCD A;  1J85 A;  4MCB A;  1GZ0 A;  3QUV A;  3AIA A;  2EGW A; 
#chains in the Genus database with same CATH topology
 1CO0 A;  1OY5 A;  4YQ1 A;  4YPY A;  3GYQ A;  4XBO A;  1Z85 A;  1IPA A;  3N4J A;  4X3L A;  3WRP A;  1TRO A;  4JAL A;  4YQP A;  1WRP R;  4YQI A;  3L8U A;  1P9P A;  3AI9 X;  1V2X A;  1UAL A;  2OZ9 R;  1RCS A;  2V3J A;  5CO4 A;  4YQB A;  1UAM A;  3N4K A;  4JAK A;  3BBH A;  4PZK A;  4YQ6 A;  4MCC A;  3OIN A;  4YQS A;  2XDI A;  3OII A;  2QWV A;  3KW2 A;  4JWG A;  3O7B A;  1JHG A;  1X7O A;  5GMC A;  4CNE A;  1NXZ A;  2YY8 A;  3E5Y A;  3BBE A;  4YQ5 A;  4YQ9 A;  4FMW A;  4YVK A;  4YQD A;  1VH0 A;  4YQQ A;  4YPZ A;  4JWF A;  4CNF A;  4YQ0 A;  3G1C A;  1ZT9 A;  3ONP A;  3DCM X;  4YQR A;  1WRS R;  2V3K A;  4YVH A;  4RG1 A;  2I6D A;  1MI7 R;  1X7P A;  2EGV A;  4YVI A;  5D9F A;  1ZJR A;  4YQN A;  4YQJ A;  4X3M A;  4FAK A;  2HA8 A;  1MXI A;  1WRT R;  4H3Z A;  1UAK A;  4J3C A;  4YVJ A;  1O6D A;  3BBD A;  4YQ8 A;  1VHY A;  4KDZ A;  1VHK A;  1K3R A;  3IEF A;  4YVG A;  4L69 A;  1TRR A;  3NK6 A;  4IG6 A;  4H3Y A;  5FAI A;  4YQO A;  4YQ4 A;  3KY7 A;  2O3A A;  4YQC A;  2QMM A;  4E8B A;  5GMB A;  4KGN A;  4YQ2 A;  3KNU A;  4CND A;  4JWJ A;  5GM8 A;  4YQK A;  3OIJ A;  4YQ7 A;  4YQG A;  3SSX N;  4CNG A;  3IC6 A;  3KOR A;  1TO0 A;  3ILK A;  1NS5 A;  2Z0Y A;  3KTY A;  3SSW N;  3AXZ A;  2CX8 A;  4YQL A;  1V6Z A;  3NK7 A;  4YPX A;  1UAJ A;  4YQT A;  4YPW A;  4YQ3 A;  4YQA A;  4JWH A;  4MCD A;  1J85 A;  3FRW A;  4MCB A;  1GZ0 A;  3QUV A;  3AIA A;  2EGW A; 
#chains in the Genus database with same CATH homology
 1OY5 A;  4YQ1 A;  4YPY A;  3GYQ A;  4XBO A;  1Z85 A;  1IPA A;  3N4J A;  4X3L A;  4JAL A;  4YQP A;  4YQI A;  3L8U A;  1P9P A;  3AI9 X;  1V2X A;  1UAL A;  2V3J A;  5CO4 A;  4YQB A;  1UAM A;  3N4K A;  4JAK A;  3BBH A;  4PZK A;  4YQ6 A;  4MCC A;  3OIN A;  4YQS A;  3OII A;  2QWV A;  3KW2 A;  4JWG A;  3O7B A;  1X7O A;  5GMC A;  4CNE A;  1NXZ A;  2YY8 A;  3E5Y A;  3BBE A;  4YQ5 A;  4YQ9 A;  4FMW A;  4YVK A;  4YQD A;  1VH0 A;  4YQQ A;  4YPZ A;  4JWF A;  4CNF A;  4YQ0 A;  3ONP A;  3DCM X;  4YQR A;  2V3K A;  4YVH A;  4RG1 A;  2I6D A;  1X7P A;  2EGV A;  4YVI A;  5D9F A;  1ZJR A;  4YQN A;  4YQJ A;  4X3M A;  4FAK A;  2HA8 A;  1MXI A;  4H3Z A;  1UAK A;  4J3C A;  4YVJ A;  1O6D A;  3BBD A;  4YQ8 A;  1VHY A;  4KDZ A;  1VHK A;  1K3R A;  3IEF A;  4YVG A;  4L69 A;  3NK6 A;  4IG6 A;  4H3Y A;  5FAI A;  4YQO A;  4YQ4 A;  3KY7 A;  2O3A A;  4YQC A;  2QMM A;  4E8B A;  5GMB A;  4KGN A;  4YQ2 A;  3KNU A;  4CND A;  4JWJ A;  5GM8 A;  4YQK A;  3OIJ A;  4YQ7 A;  4YQG A;  4CNG A;  3IC6 A;  1TO0 A;  3ILK A;  1NS5 A;  2Z0Y A;  3KTY A;  3AXZ A;  2CX8 A;  1V6Z A;  4YQL A;  3NK7 A;  4YPX A;  1UAJ A;  4YQT A;  4YPW A;  4YQ3 A;  4YQA A;  4JWH A;  4MCD A;  1J85 A;  4MCB A;  1GZ0 A;  3QUV A;  3AIA A;  2EGW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...