4MCBA

H.influenzae trmd in complex with n-(4-{[(1h-imidazol-2-ylmethyl)amino]methyl}benzyl)-4-oxo-3,4-dihydrothieno[2,3-d]pyrimidine-5-carboxamide
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
Knots found
sequence length
219
structure length
205
Chain Sequence
MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLGLLDCPHYTRPEVLEGLTVPPVLMSHHEEIRKWRLKQSLQRTWLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Selective Inhibitors of Bacterial t-RNA-(N(1)G37) Methyltransferase (TrmD) That Demonstrate Novel Ordering of the Lid Domain.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Transferase/transferase inhibitor
total genus 50
structure length 205
sequence length 219
chains with identical sequence B
other databases KnotProt 2.0: K +31
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4mcbA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4mcbA01
4H3ZA 2V3KA 1TO0A 1P9PA 5D9FA 1X7OA 4YVKA 5CO4A 4YQOA 4YQNA 4YVJA 3OINA 2EGVA 2CX8A 4J3CA 3IEFA 4L69A 3NK7A 1UAJA 4KDZA 3ILKA 3N4KA 4CNDA 1VHKA 4MCDA 4YQ2A 1GZ0A 4CNEA 1V6ZA 4X3LA 4YQ7A 3BBHA 4FAKA 2Z0YA 3ONPA 5GM8A 4X3MA 2I6DA 4YVGA 4YQ6A 4YQSA 3BBDA 2QMMA 4YQGA 4PZKA 4MCBA 4YQDA 3GYQA 4CNGA 4RG1A 1IPAA 4MCCA 3DCMX 4YQ8A 1UAKA 3NK6A 1V2XA 4YQTA 3AXZA 1UALA 1Z85A 4YPYA 4XBOA 4YQRA 4IG6A 1O6DA 3AI9X 4JALA 4YQ0A 4YQPA 3OIJA 4YQBA 4YPWA 1ZJRA 4E8BA 4YPZA 4YQQA 3L8UA 1UAMA 4YQJA 4YQCA 3KW2A 3KNUA 5FAIA 4CNFA 3O7BA 3E5YA 4JAKA 1VH0A 2QWVA 4YVHA 1K3RA 4YQIA 3KTYA 1NXZA 5GMCA 4YQ9A 3AIAA 1X7PA 1J85A 4YPXA 4YQAA 3N4JA 4KGNA 4YQKA 4YQ1A 3KY7A 2HA8A 2YY8A 3BBEA 5GMBA 2EGWA 4YQ5A 3QUVA 1NS5A 3IC6A 4YQLA 4H3YA 2V3JA 3OIIA 1OY5A 4YVIA 1VHYA 1MXIA 2O3AA 4YQ4A 4YQ3A
chains in the Genus database with same CATH superfamily
3FRWA 4H3ZA 1TO0A 2V3KA 1P9PA 5D9FA 1X7OA 4YVKA 3WRPA 5CO4A 4YQOA 4YQNA 4YVJA 4JWHA 4JWGA 3OINA 2EGVA 2CX8A 4J3CA 3IEFA 4L69A 3NK7A 1UAJA 4KDZA 3ILKA 3N4KA 4CNDA 1VHKA 4MCDA 4YQ2A 1GZ0A 4CNEA 1V6ZA 4X3LA 4JWJA 4YQ7A 3BBHA 4FAKA 2Z0YA 4JWFA 3SSXN 3ONPA 5GM8A 4X3MA 2I6DA 4YVGA 4YQ6A 4YQSA 3BBDA 2QMMA 2OZ9R 2XDIA 4YQGA 4PZKA 1TRRA 3SSWN 4MCBA 4YQDA 3GYQA 4CNGA 4RG1A 1IPAA 4MCCA 3DCMX 4YQ8A 1UAKA 3NK6A 1V2XA 4YQTA 3AXZA 1MI7R 1UALA 1Z85A 4YPYA 4XBOA 4YQRA 4IG6A 1O6DA 3AI9X 4JALA 4YQ0A 4YQPA 3OIJA 4YQBA 4YPWA 1ZJRA 4E8BA 4YPZA 4YQQA 3L8UA 1WRSR 1UAMA 4YQJA 4YQCA 3KW2A 3KNUA 5FAIA 4CNFA 3O7BA 3E5YA 4JAKA 1VH0A 2QWVA 4YVHA 1K3RA 4YQIA 1JHGA 3KTYA 1NXZA 5GMCA 4YQ9A 3AIAA 1X7PA 1J85A 1ZT9A 3KORA 4YPXA 1CO0A 4YQAA 3N4JA 1WRPR 4KGNA 1RCSA 4YQKA 4YQ1A 1WRTR 3KY7A 3G1CA 2HA8A 2YY8A 3BBEA 5GMBA 2EGWA 4YQ5A 3QUVA 1TROA 1NS5A 3IC6A 4YQLA 4H3YA 2V3JA 3OIIA 1OY5A 4YVIA 1VHYA 1MXIA 4FMWA 2O3AA 4YQ4A 4YQ3A
chains in the Genus database with same CATH topology
4H3ZA 2V3KA 1TO0A 1P9PA 5D9FA 1X7OA 4YVKA 5CO4A 4YQOA 4YQNA 4YVJA 4JWHA 4JWGA 3OINA 2EGVA 2CX8A 4J3CA 3IEFA 4L69A 3NK7A 1UAJA 4KDZA 3ILKA 3N4KA 4CNDA 1VHKA 4MCDA 4YQ2A 1GZ0A 4CNEA 1V6ZA 4X3LA 4JWJA 4YQ7A 3BBHA 4FAKA 2Z0YA 4JWFA 3ONPA 5GM8A 4X3MA 2I6DA 4YVGA 4YQ6A 4YQSA 3BBDA 2QMMA 4YQGA 4PZKA 4MCBA 4YQDA 3GYQA 4CNGA 4RG1A 1IPAA 4MCCA 3DCMX 4YQ8A 1UAKA 3NK6A 1V2XA 4YQTA 3AXZA 1UALA 1Z85A 4YPYA 4XBOA 4YQRA 4IG6A 1O6DA 3AI9X 4JALA 4YQ0A 4YQPA 3OIJA 4YQBA 4YPWA 1ZJRA 4E8BA 4YPZA 4YQQA 3L8UA 1UAMA 4YQJA 4YQCA 3KW2A 3KNUA 5FAIA 4CNFA 3O7BA 3E5YA 4JAKA 1VH0A 2QWVA 4YVHA 1K3RA 4YQIA 3KTYA 1NXZA 5GMCA 4YQ9A 3AIAA 1X7PA 1J85A 4YPXA 4YQAA 3N4JA 4KGNA 4YQKA 4YQ1A 3KY7A 2HA8A 2YY8A 3BBEA 5GMBA 2EGWA 4YQ5A 3QUVA 1NS5A 3IC6A 4YQLA 4H3YA 2V3JA 3OIIA 1OY5A 4YVIA 1VHYA 1MXIA 4FMWA 2O3AA 4YQ4A 4YQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H3Z A;  2V3K A;  1TO0 A;  1P9P A;  5D9F A;  1X7O A;  4YVK A;  5CO4 A;  4YQO A;  4YQN A;  4YVJ A;  3OIN A;  2EGV A;  2CX8 A;  4J3C A;  3IEF A;  4L69 A;  3NK7 A;  1UAJ A;  4KDZ A;  3ILK A;  3N4K A;  4CND A;  1VHK A;  4MCD A;  4YQ2 A;  1GZ0 A;  4CNE A;  1V6Z A;  4X3L A;  4YQ7 A;  3BBH A;  4FAK A;  2Z0Y A;  3ONP A;  5GM8 A;  4X3M A;  2I6D A;  4YVG A;  4YQ6 A;  4YQS A;  3BBD A;  2QMM A;  4YQG A;  4PZK A;  4MCB A;  4YQD A;  3GYQ A;  4CNG A;  4RG1 A;  1IPA A;  4MCC A;  3DCM X;  4YQ8 A;  1UAK A;  3NK6 A;  1V2X A;  4YQT A;  3AXZ A;  1UAL A;  1Z85 A;  4YPY A;  4XBO A;  4YQR A;  4IG6 A;  1O6D A;  3AI9 X;  4JAL A;  4YQ0 A;  4YQP A;  3OIJ A;  4YQB A;  4YPW A;  1ZJR A;  4E8B A;  4YPZ A;  4YQQ A;  3L8U A;  1UAM A;  4YQJ A;  4YQC A;  3KW2 A;  3KNU A;  5FAI A;  4CNF A;  3O7B A;  3E5Y A;  4JAK A;  1VH0 A;  2QWV A;  4YVH A;  1K3R A;  4YQI A;  3KTY A;  1NXZ A;  5GMC A;  4YQ9 A;  3AIA A;  1X7P A;  1J85 A;  4YPX A;  4YQA A;  3N4J A;  4KGN A;  4YQK A;  4YQ1 A;  3KY7 A;  2HA8 A;  2YY8 A;  3BBE A;  5GMB A;  2EGW A;  4YQ5 A;  3QUV A;  1NS5 A;  3IC6 A;  4YQL A;  4H3Y A;  2V3J A;  3OII A;  1OY5 A;  4YVI A;  1VHY A;  1MXI A;  2O3A A;  4YQ4 A;  4YQ3 A; 
#chains in the Genus database with same CATH topology
 3FRW A;  4H3Z A;  1TO0 A;  2V3K A;  1P9P A;  5D9F A;  1X7O A;  4YVK A;  3WRP A;  5CO4 A;  4YQO A;  4YQN A;  4YVJ A;  4JWH A;  4JWG A;  3OIN A;  2EGV A;  2CX8 A;  4J3C A;  3IEF A;  4L69 A;  3NK7 A;  1UAJ A;  4KDZ A;  3ILK A;  3N4K A;  4CND A;  1VHK A;  4MCD A;  4YQ2 A;  1GZ0 A;  4CNE A;  1V6Z A;  4X3L A;  4JWJ A;  4YQ7 A;  3BBH A;  4FAK A;  2Z0Y A;  4JWF A;  3SSX N;  3ONP A;  5GM8 A;  4X3M A;  2I6D A;  4YVG A;  4YQ6 A;  4YQS A;  3BBD A;  2QMM A;  2OZ9 R;  2XDI A;  4YQG A;  4PZK A;  1TRR A;  3SSW N;  4MCB A;  4YQD A;  3GYQ A;  4CNG A;  4RG1 A;  1IPA A;  4MCC A;  3DCM X;  4YQ8 A;  1UAK A;  3NK6 A;  1V2X A;  4YQT A;  3AXZ A;  1MI7 R;  1UAL A;  1Z85 A;  4YPY A;  4XBO A;  4YQR A;  4IG6 A;  1O6D A;  3AI9 X;  4JAL A;  4YQ0 A;  4YQP A;  3OIJ A;  4YQB A;  4YPW A;  1ZJR A;  4E8B A;  4YPZ A;  4YQQ A;  3L8U A;  1WRS R;  1UAM A;  4YQJ A;  4YQC A;  3KW2 A;  3KNU A;  5FAI A;  4CNF A;  3O7B A;  3E5Y A;  4JAK A;  1VH0 A;  2QWV A;  4YVH A;  1K3R A;  4YQI A;  1JHG A;  3KTY A;  1NXZ A;  5GMC A;  4YQ9 A;  3AIA A;  1X7P A;  1J85 A;  1ZT9 A;  3KOR A;  4YPX A;  1CO0 A;  4YQA A;  3N4J A;  1WRP R;  4KGN A;  1RCS A;  4YQK A;  4YQ1 A;  1WRT R;  3KY7 A;  3G1C A;  2HA8 A;  2YY8 A;  3BBE A;  5GMB A;  2EGW A;  4YQ5 A;  3QUV A;  1TRO A;  1NS5 A;  3IC6 A;  4YQL A;  4H3Y A;  2V3J A;  3OII A;  1OY5 A;  4YVI A;  1VHY A;  1MXI A;  4FMW A;  2O3A A;  4YQ4 A;  4YQ3 A; 
#chains in the Genus database with same CATH homology
 4H3Z A;  2V3K A;  1TO0 A;  1P9P A;  5D9F A;  1X7O A;  4YVK A;  5CO4 A;  4YQO A;  4YQN A;  4YVJ A;  4JWH A;  4JWG A;  3OIN A;  2EGV A;  2CX8 A;  4J3C A;  3IEF A;  4L69 A;  3NK7 A;  1UAJ A;  4KDZ A;  3ILK A;  3N4K A;  4CND A;  1VHK A;  4MCD A;  4YQ2 A;  1GZ0 A;  4CNE A;  1V6Z A;  4X3L A;  4JWJ A;  4YQ7 A;  3BBH A;  4FAK A;  2Z0Y A;  4JWF A;  3ONP A;  5GM8 A;  4X3M A;  2I6D A;  4YVG A;  4YQ6 A;  4YQS A;  3BBD A;  2QMM A;  4YQG A;  4PZK A;  4MCB A;  4YQD A;  3GYQ A;  4CNG A;  4RG1 A;  1IPA A;  4MCC A;  3DCM X;  4YQ8 A;  1UAK A;  3NK6 A;  1V2X A;  4YQT A;  3AXZ A;  1UAL A;  1Z85 A;  4YPY A;  4XBO A;  4YQR A;  4IG6 A;  1O6D A;  3AI9 X;  4JAL A;  4YQ0 A;  4YQP A;  3OIJ A;  4YQB A;  4YPW A;  1ZJR A;  4E8B A;  4YPZ A;  4YQQ A;  3L8U A;  1UAM A;  4YQJ A;  4YQC A;  3KW2 A;  3KNU A;  5FAI A;  4CNF A;  3O7B A;  3E5Y A;  4JAK A;  1VH0 A;  2QWV A;  4YVH A;  1K3R A;  4YQI A;  3KTY A;  1NXZ A;  5GMC A;  4YQ9 A;  3AIA A;  1X7P A;  1J85 A;  4YPX A;  4YQA A;  3N4J A;  4KGN A;  4YQK A;  4YQ1 A;  3KY7 A;  2HA8 A;  2YY8 A;  3BBE A;  5GMB A;  2EGW A;  4YQ5 A;  3QUV A;  1NS5 A;  3IC6 A;  4YQL A;  4H3Y A;  2V3J A;  3OII A;  1OY5 A;  4YVI A;  1VHY A;  1MXI A;  4FMW A;  2O3A A;  4YQ4 A;  4YQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...