4MCSA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) his475tyr variant in complex with glutamic acid
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
691
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVYNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 266
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcsA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcsA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcsA02
2PJ1A 3RZAA 3WT4A 1HDQA 2PJ3A 2HB6A 3KR5A 4YWYA 4C9AA 2BO9A 1R3NA 3PB9X 3V7ZA 2AFOA 4MMOA 2PJ8A 1DTDA 4CPAA 5LRKA 4TJXA 4C8TA 3T8WA 3PRTA 3D7GA 1XFOA 2F8HA 2IQ6A 3KR4A 4P6YA 4W9YA 1ZG9A 3NH4A 4PXDA 4ZY2A 3N5FA 4MHPA 2JEWA 4EMEA 1UWYA 1XBUA 4ZY0A 1VIXA 2Q51A 1V6CA 1JQGA 3D67A 4MCPA 4YN3A 1GYTA 1IY7A 1BAVA 3FJUA 4OC0A 3WC6A 4OKOA 1R43A 5HVGA 2DEAA 5J1QA 2GU2A 2PCUA 3TX8A 1ARMA 3D7FA 3S9LA 5LYDA 2ZEHA 4P44A 2GREA 2PJ6A 3KGQA 3QNVA 1LCPA 3FVLA 1ARLA 2PJ5A 3NFZA 1BLLE 3ISZA 3DGVA 1LOKA 3PB7X 5CBMA 4C8FA 2PJAA 3KI9A 4DUKA 4OC5A 3CPAA 3SJEA 2XEFA 1Y9ZA 1Y7EA 1Z5RA 4YU9A 2PIYA 2ZEOA 1LANA 1H8LA 4C8PA 2ANPA 4UIBA 2AFXA 2CIJA 4X3RA 2IJZA 4X2TA 2V8HA 4H2KA 1YW4A 2XEIA 4F8ZA 4PPZA 4R7MA 2VL1A 2PE3A 2EWBA 3SI1A 4ZYQA 4NGNA 3WABA 2HC9A 3B3VA 1DE4C 2QVPA 3S9MA 1F2OA 3I74A 3FECA 2PRQA 3PFEA 3KHXA 3I6SA 3KZWA 4FAIA 3D7HA 4P4EA 4PQAA 4A37A 4P4FA 1BPMA 1CX8A 5IB9A 4A38A 1PCAA 1XRYA 2O53A 5JGFA 2WZNA 4B6ZA 3IIBA 1Y0RA 4MCRA 4BD9A 3PFOA 2ZEFA 1TKFA 3VH9A 4C8UA 2WYRA 1ELLP 3HUVA 2PJ2A 2C6CA 4OIWA 2ZOGA 3BHXA 4TNUA 3NA6A 5HVFA 3SJXA 1CP6A 1ZG7A 2IMOA 4FBEA 6CPAA 2C6PA 4CDKA 4OIDA 1LFWA 2ZELA 2C6GA 3B3WA 2FVGA 4NJRA 4OP4A 4OC2A 3I1UA 4X8IA 4NJQA 4OC4A 5CPAA 3BI0A 2CF4A 1RTQA 4C85A 4MHYA 2Q43A 4EFDA 1FNOA 4KSIA 5LYIA 4C86A 4UIAA 4P4DA 2RB7A 4IAVA 2ZEEA 4ZY1A 5K8PA 4WJBA 1AMPA 3KHZA 4C9EA 2POKA 4R8FA 5K8OA 5HVHA 3RBUA 4P10A 4R76A 3PB8X 3GB0A 5LRJA 3SJFA 2O4HA 3V38A 4FWUA 4EWTA 4C8AA 4K3NA 3GUXA 4C9UA 1EE3P 4AXVA 4JYWA 5I4MA 1XF1A 2I3CA 3B2YA 4P4BA 3ISXA 1CP7A 3D66A 3IWWA 1KWMA 2ZEMA 4OC3A 2RFHA 2J9AA 3SJGA 4NGSA 3IFEA 1IGBA 4LQGA 1M4LA 5HXDA 4WWVA 1TXRA 4MHNA 1Y0YA 2ZEPA 4G1PA 4PXBA 3D4UA 4FUUA 3FH4A 5F09A 4ZX9A 3PB6X 4C9VA 5DS0A 2QYVA 1LAMA 1HEEA 3NH8A 1ELMP 1TF8A 1Q7LA 3TC8A 7CPAA 1CPSA 3IO1A 5JM6A 2PJ7A 2PJ0A 3KQZA 2ZEDA 5LYFA 3SI0A 3LMSA 4PXEA 1YMEA 5JH9A 3PB4X 1CG2A 3IEHA 4P4IA 2PIZA 3D7DA 3WC7A 1CBXA 1OBRA 2GLFA 2JBKA 4PXCA 2CTCA 2NYQA 2V8VA 1TF9A 2QJ8A 3K9TA 4DJLA 4P4JA 2OOTA 4F9VA 1QMUA 4IK2A 3WC5A 2PJ9A 2JBJA 3JRUA 1XMBA 4MRIA 1Z8LA 3L2NA 3VTAA 4NFRA 3HLPA 2BOAA 2C1CA 4P45A 3D68A 3GLJA 4RUHA 4KNGE 2AFMA 2XEGA 2ZENA 4MHZA 4NGTA 1AYEA 1HDUA 1XJOA 4UEZA 5K8MA 2AFUA 3VATA 2BCOA 3S9NA 2GLJA 3PBBA 4TJVA 2ABZA 4ZX8A 4NGRA 3SI2A 3MRUA 4NGQA 3VARA 3BXMA 2G9DA 1YW6A 2PJCA 4C99A 4Z65A 3KASA 2AFWA 4MCQA 2V8GA 1LAPA 4ZI6A 1VHEA 5LRGA 5K8NA 1WVMA 2PJ4A 3H8EA 2PVWA 4UEEA 1YSJA 1Z2LA 3B7IA 4OMEA 1FT7A 4O23A 4NGPA 1ZG8A 1YLOA 2NSMA 3NH5A 4A39A 4F9UA 4DYOA 1VHOA 1F57A 2PVVA 2XEJA 1CPXA 1TKHA 5D29A 3CPXA 3DLJA 3H8FA 1VGYA 1TKJA 1NSAA 2V8DA 4C84A 4ONWA 3EIFA 3FMCA 3FX6A 2AFSA 3B3SA 3K2KA 4OC1A 1QQ9A 4C8CA 4IHMA 3RAMA 3PBEA 3FF3A 1F2PA 3B3CA 4UF4A 2OR4A 3B35A 3B3TA 4GM5A 3CT9A 1ZLIA 2EK9A 5LYLA 4MCSA 3CDXA 3LWUA 4JZ0A 2CTBA 1ZLHA 5D8NA 5ELYA 4UEFA 3IC1A 3IJ3A 3KL9A 2AFZA 2F7VA 3FEDA 4R6TA 4NGMA 3PEIA 3FEEA 2PJBA 3ICUA 2Q4ZA 8CPAA 4C9RA 4Q7AA 3KQXA 1PYTB 1BPNA 3H8GA 3BI1A 5THWA 4TWEA 3MN8A 2EK8A 4A94A 4MXUA 2V77A 2ZEGA 2ZOFA 4CDJA
chains in the Genus database with same CATH superfamily
4E5SA 1QSTA 2PJ1A 3RZAA 1Z9UA 1HDQA 2PJ3A 3WT4A 1BOBA 4HNYB 4NCZA 2HB6A 2PR1A 1P4NA 1P0HA 2B4BA 3D8PA 3TLCA 3KR5A 4YWYA 4C9AA 2BO9A 4A31A 1R3NA 3PB9X 4A30A 3V7ZA 4AG7A 2AFOA 4MMOA 4CRZB 4A32A 2PJ8A 2ZW6A 1DTDA 2Q7SA 1IU8A 5I0CA 1DIKA 4CPAA 3P2HA 5LRKA 1NE9A 4B5PB 1Z9EA 2FIAA 4TJXA 5C88A 4C8TA 3T8WA 2B4DA 3PRTA 3D7GA 3TYXA 2P6GA 1XFOA 2F8HA 2IQ6A 3JUWA 3KR4A 2Y1NA 4MY0A 5DWNA 2GE3A 2YGWA 4KS9A 4P6YA 2ZPAA 1ZL0A 3F9KC 4W9YA 1ZG9A 3NH4A 3G8WA 4PXDA 4ZY2A 1M44A 5F46A 3N5FA 4AVBA 4CAEA 2PR8A 1IIDA 1YR0A 4MHPA 2JEWA 4RN7A 4EMEA 1CE8B 1UWYA 1XBUA 1V0CA 4PK3A 4ZY0A 3T05A 5JYBA 3EO4A 1VIXA 4JWPA 4CYPA 2FCKA 2Q51A 1V6CA 1ZO0A 1JQGA 3D67A 1BXRB 2Y1MA 4MCPA 4YN3A 1GYTA 1IY7A 2NMTA 4CGLA 3EY5A 3H5ZA 1BAVA 3FJUA 4XPKA 5F48A 3TTHA 4OC0A 3WC6A 3W91A 3VWDA 4MBUA 1R43A 2I00A 2DEAA 4OKOA 5CNPA 4NEXA 5HVGA 2DLAA 3FXTA 1WK4A 2GU2A 2PCUA 2BEIA 3TX8A 4PK2A 1ARMA 3D7FA 3S9LA 5LYDA 2ZEHA 3TE4A 2EZAA 4P44A 4BMHA 1A2ZA 2GREA 2OB0A 2G3TA 2R8VA 2Z3PA 4HKFA 2PJ6A 2XPLA 2H5MA 3KGQA 3QNVA 1LCPA 1U6MA 3FVLA 1ARLA 1NXJA 3OB1B 3TLBA 4MHDA 3A9LA 2PJ5A 2WPWA 5IR2A 3NFZA 1ZRSA 1MJBA 1SQHA 5IB9A 2CY2A 1JDBC 3G23A 1BLLE 3ISZA 4M6GA 2X7BA 3DGVA 2X0SA 1LOKA 2ARHA 5HKYA 2PC1A 3PB7X 5CBMA 1TIQA 4C8FA 2ATRA 1WJTA 2PJAA 2P6EA 1S3ZA 3BLNA 3KI9A 4DUKA 4OC5A 3TLZA 2BSWA 3CPAA 3SJEA 2XEFA 3DR6A 2O28A 1Y9ZA 1Y7EA 5G1ZA 1Z5RA 4YU9A 1YGHA 3EZEA 3C8OA 2PIYA 5ISVA 1CM0A 2ZEOA 2Z3NA 4MFKA 1N71A 1LANA 2Z3OA 3DDDA 1H8LA 5KTAA 4C8PA 2ANPA 2IL4A 4ONUA 2YNEA 3FB3A 4UIBA 4MFLA 2AFXA 1NBWA 4B13A 2BL1A 5H84A 2CIJA 3JTKA 4X3RA 2IJZA 5GCNA 1KZFA 1S7NA 2V8HA 1IYLA 4H2KA 1YW4A 4X2TA 4CGNA 2XEIA 1GHEA 4F8ZA 2D0PA 4CYOA 1JWQA 4PPZA 4R7MA 3K9UA 2EZBA 1Q2YA 2VL1A 1YQEA 2PE3A 3GIUA 2PDOA 5F47A 4DNCA 2EWBA 3SI1A 4UFXA 3VGOA 1Z4EA 4ZYQA 4YGOA 4NGNA 3WABA 4KVME 2HC9A 3CXPA 2J8RA 3B3VA 1DE4C 1YVHA 4U5YA 3HPHE 3FYNA 3D2PA 1L0CA 2GANA 1F2OA 3S9MA 2QVPA 4Q38A 3I74A 4FD5A 4MI4A 4ZBGA 5KTCA 1YVOA 3FECA 2PRQA 3PGPA 3PFEA 3KHXA 1Z8TA 4UFWA 4OADA 3I6SA 2FL4A 4QBJA 4RS2A 5J8FA 5JVLA 4CDJA 3KZWA 4FAIA 4BPUB 5BY0A 2Q4YA 1B6BA 3OP0A 3VRRA 4GXHA 4KORA 3D7HA 4P4EA 4PQAA 2KCWA 3TLGA 5F13A 4H6ZA 3NFQA 3F8KA 4A37A 3T07A 4P4FA 1BPMA 1CX8A 2QMLA 4JJXA 4OAEA 1PCAA 1R57A 1XRYA 2I79A 3V8IA 4A38A 2O53A 2Z3MA 2WZNA 5JGFA 5AG4A 4B6ZA 3IIBA 2Z3KA 1Y0RA 2C27A 4MCRA 4UFVA 5F49A 4KUBA 2AJ6A 2YNCA 4BD9A 1KUVA 3FNCA 3PFOA 2ZEFA 1QSNA 2CNTA 4C2XA 1XIXA 4B11A 1TKFA 4CYNA 2JLMA 1MJAA 3VH9A 1IOFA 4L8AA 2D4OA 5JPHA 1KBLA 2R82A 4FD7A 3B8GA 4Y49C 4C8UA 4EYSA 2WYRA 2E28A 1ELLP 3HUVA 4C2YA 2PJ2A 2C6CA 2VQYA 2OLSA 2XPOA 3N7ZA 4OIWA 2ZOGA 3R9GA 2XPPA 3BHXA 3PLFB 4AG9A 4TNUA 4CZ1A 3I3GA 3TO9A 4KOSA 1MK4A 1VBGA 3NA6A 5HVFA 3SJXA 1CP6A 1ZG7A 2IMOA 3IWGA 4Q36A 4E2AA 4FBEA 2OU2A 4QVTA 2C6PA 6CPAA 2P6FA 1GGOA 1RO5A 2XPNA 3C26A 4CDKA 4OIDA 5K99A 4R87A 1LFWA 2ZELA 4UCNA 4II9A 3DNSA 3IGRA 1BO4A 4BBHA 2C6GA 3B3WA 2FVGA 4NJRA 4OP4A 1QSOA 4MFPA 3NE8A 4LQ6A 4R3KA 4OC2A 2PRBA 5AG6A 3I1UA 5E96A 2EBJA 4X8IA 4CAFA 2OH1A 4NJQA 4OC4A 1KUYA 3R1KA 2C5QA 2HI6A 2PCNA 4M3SA 5CPAA 4MFQA 1CJWA 3BI0A 3SXOA 3GJZA 2CF4A 3BJ7A 4H1HA 1RTQA 4C85A 1I21A 2YNCC 3D3SA 4CO9A 5IX3A 4MHYA 3IWEA 2Q43A 4C2ZA 4EFDA 3GKRA 2CNSA 1M1DA 4IIXA 5G20A 2EO8A 1FNOA 2WPXA 3OAKA 4KSIA 5LYIA 4UIAA 4C86A 4KOUA 3F0AA 5J1QA 3GY9A 3U1BA 4P4DA 2RB7A 4IAVA 3EZAA 2ZEEA 2Q04A 2ZW7A 3QB8A 4JXRA 4AVCA 4ZY1A 5K8PA 4WJBA 1AMPA 2DPTA 3KHZA 2Z10A 4C9EA 2POKA 4R8FA 5K8OA 1Q2DA 2R7HA 2DXQA 4AB7A 3RBUA 4P10A 2EVNA 3IU1A 5HVHA 3LD2A 3BUWB 2B4JC 4R76A 3PB8X 3GB0A 5LRJA 4KVOE 3SJFA 3TOBA 1X12A 3S6GA 1PU9A 4CGOA 2B5GA 5HH1A 3T0TA 2O4HA 3V38A 4FWUA 4AVAA 1Y7RA 4EWTA 2CBLA 2D4PA 2R98A 4K3NA 3SXNA 4C8AA 2VBQA 3GUXA 2VKZG 4C9UA 1KEEB 1EE3P 1ON0A 4AXVA 3PT1A 4JYWA 5I4MA 3R9FA 1XF1A 1M4GA 2I3CA 3JVNA 3B2YA 4P4BA 4UWJA 4MFZA 3ISXA 1CP7A 3D66A 1Z4RA 4XNHB 3IWWA 1S7FA 1KWMA 3UY5A 1EZAA 3MGDA 4OC3A 2RFHA 2ZEMA 2J9AA 3SJGA 1IICA 3E0KA 4CAXA 4U9ZA 4XPDC 1MJ9A 4KVXA 4NGSA 3IFEA 3TLGB 4LX9A 1IGBA 2BUEA 2Z3LA 4LQGA 3FBUA 1WWZA 1YREA 5A28A 1RXTA 2JDCA 1PUAA 4XPLA 1B47A 1M4LA 5FVJA 3CXQA 4B5PA 3HPGG 1YLEA 5H86A 4YFJA 5HXDA 1QSRA 4INJA 1XE4A 1NSLA 4LUAA 1AUGA 2ODFA 4IF5A 2REFA 4WWVA 3VWEA 1TXRA 4MHNA 1Y0YA 2UV8G 3G3SA 2ZEPA 4G1PA 4PXBA 4E0AA 4QUSA 3D4UA 1S7KA 2G0BA 4FUUA 4KOXA 1J3LA 3FH4A 5F09A 1LRZA 3GYAA 4ZX9A 3PB6X 4FD4A 3NOJA 4C9VA 5DS0A 2QYVA 1LAMA 2RC4A 1HEEA 3NH8A 5FD8A 1ELMP 4KZTA 1TF8A 4A33A 1Q2CA 1Q7LA 3SR3A 4KOYA 2PQ8A 3TC8A 4M6HA 4HPSA 4UWIA 7CPAA 3R9EA 1CPSA 3IO1A 3DR8A 4HNXB 2FS5A 5JM6A 4R9MA 2PJ7A 2PJ0A 1FBVA 3KQZA 2ZEDA 4C68A 3CZXA 4KOTA 5LYFA 2AUMA 3TLEA 3SI0A 3O8ZA 4BINA 2J8MA 2B4DB 3LMSA 4PXEA 4CAVA 1YMEA 3VRPA 2VXKA 4X5KA 5JH9A 1IB1E 1S5KA 1CG2A 3BUNB 2VEZA 2ZW4A 3IEHA 3PB4X 4QB9A 3BUOB 4ZGYB 1VKCA 4P4IA 2ZW5A 3H4QA 5EMIA 2F5IA 2ZXVA 2PIZA 2DF5A 5IV0A 4B14A 3I9SA 3D7DA 3WC7A 1CBXA 1OBRA 2OZUA 5C82A 2GLFA 2JBKA 1YK3A 1Z8WA 1S7LA 2CTCA 2GIVA 4H6UA 1Z8XA 4PXCA 1C3OB 4JVOA 3VRQA 2NYQA 2V8VA 4M8DA 2D0OA 1TF9A 4KOVA 2N3AB 2QJ8A 3ZJ0A 3EZBA 3K9TA 4DJLA 4P4JA 5A27A 2OOTA 4F9VA 4B10A 3QAHA 1QMUA 2HV2A 4IK2A 4KSAA 3WC5A 2B3UA 2AE6A 2FXFA 1XMTA 2PJ9A 4KLWA 2FSRA 4C7IA 2JBJA 2CNMA 1EZBA 5AG5A 3DSBA 3JRUA 3R96A 1XMBA 4MRIA 4MJXA 1Z8LA 3L2NA 1B87A 3W6XA 2VZZA 1Y9KA 5G21A 3NE7A 3VTAA 4NFRA 4RR2B 3SHPA 4K30A 3HLPA 4J0NA 2BOAA 5BWAB 5J8CA 2YNDA 2C1CA 4P45A 3BJ8A 3D68A 3GLJA 4H89A 2B5GB 3PP9A 5AG7A 3TT2A 2A4NA 4A95A 4RUHA 3D2MA 4KNGE 4MI1A 2Z11A 3VROA 2AFMA 2JDDA 2B58A 2WSAA 5HKZA 3P2FA 2XEGA 2ZENA 4MHZA 4YRHA 4NGTA 1M4IA 4A4BA 4COGA 1AYEA 1HDUA 1XJOA 4UEZA 3K4IA 5K8MA 2WUUA 2AFUA 3TO6A 3VATA 1XEBA 2BCOA 3S9NA 2GLJA 3PBBA 2GP4A 4TJVA 4KLVA 4U9YA 2ABZA 3F5BA 4ZX8A 3TO7A 1FY7A 4NGRA 4UA3A 3SI2A 3MRUA 5F1YA 4NGQA 3PZJA 4RI1A 3VARA 3IU2A 1IOIA 4R3LA 2HUZA 3QAYA 2QECA 2HWGA 3TLYA 1JDEA 4XNHC 1VBHA 3BXMA 4KOWA 2G9DA 4BPXB 4KUAA 1YW6A 2PJCA 2REEA 4C99A 4Z65A 3KASA 5EC4A 3RYOA 2YJVA 3KKWA 2AFWA 4HNWB 4MCQA 2V8GA 1LAPA 3LACA 4JD6A 4L89A 4ZI6A 1VHEA 5J3XA 5LRGA 2JEVA 5K8NA 2FT0A 1WVMA 4PSXA 1KC7A 3S6KA 2PJ4A 4F0XA 4E94A 3H8EA 1S60A 5HMNA 2PVWA 2P0WA 4UEEA 4Y49B 1YSJA 2HROA 1Z2LA 1QSMA 3B7IA 4OMEA 4FD6A 1FT7A 4MY3A 4O23A 4COBA 1Q5XA 1VHSA 4NGPA 1ZG8A 2Z0ZA 1YLOA 4B5OA 2NSMA 1M6VB 5IB0A 3NH5A 4OLLA 4UCPA 4A39A 4F9UA 1ZYMA 4DYOA 3TLAA 4I49A 2AUNA 3T5MA 1VHOA 4UBRA 5AXIA 5G22A 4CGPA 1F57A 1I12A 2VZYA 3LODA 4M85A 2PVVA 2K5TA 2XEJA 4JLYA 2FM4A 2GFQA 5DWMA 1NMTA 3T90A 4PV6A 3BUXB 1I1DA 1CPXA 1TKHA 3PFVA 5D29A 1IYKA 3CPXA 2FE7A 3DLJA 3H8FA 4MJ8A 3S6FA 3TOAA 1VGYA 2YJTA 1TKJA 1C30B 3OWCA 3HMJG 4ORFA 1J4JA 2Q44A 2OZGA 1NSAA 2V8DA 4BPWB 4R57A 2Q7BA 4C84A 4A4CA 4ONWA 3EIFA 5F5XA 3FMCA 2G3AA 1OZPA 2FIWA 3FX6A 2AFSA 4NSQA 4GS4A 3EXNA 3B3SA 5F9MA 4F0YA 4F6AA 4MFJA 3K2KA 3EC4A 4J3GA 4CAWA 5JQ4A 4OC1A 3ZZIA 4JXQA 3RNZA 1QQ9A 4IIYA 4C8CA 4IHMA 3RAMA 3PBEA 3FF3A 1F2PA 3B3CA 4PSWA 4CRYB 3FRMA 4CS0B 4UF4A 3S6HA 2OR4A 3B35A 3B3TA 2Q4VA 2PSWA 3TFYA 4UCMA 4GM5A 3CT9A 5HKWA 1ZLIA 2QIRA 2EK9A 3T9YA 4M6IA 5LYLA 4MCSA 3CDXA 3LWUA 4JZ0A 1VI4A 1KUXA 2CTBA 3W6SA 1ZLHA 4NF1A 5D8NA 1YX0A 5ELYA 4UEFA 2R1IA 3FIXA 3IC1A 3IJ3A 5EBVA 1X10A 3KL9A 1K4JA 2CXAA 2AFZA 4EVYA 2OZHA 2J8NA 2F7VA 2Q0YA 3FEDA 4R6TA 3CXSA 3RO0A 2DIKA 5AGEA 3KRVA 4NGMA 2HQYA 4NXYA 1YVKA 4XPDB 4C7HA 1CS0B 1T36B 3PEIA 3FEEA 3U88C 1R61A 2PJBA 1UFHA 2Q4ZA 2MP0A 3ICUA 3OB2B 8CPAA 2Y0MA 2DPSA 1EO0A 1XF8A 3WR7A 4C9RA 2VI7A 4Q7AA 4GPLB 3KQXA 4IUSA 3R95A 3TCVA 4CGMA 1PYTB 3EFAA 1BPNA 3H8GA 3BUMB 2B3VA 1M4DA 3BI1A 5THWA 4TWEA 4QC6A 5KTDA 4A2ZA 4B12A 4CYQA 1XOVA 4E8OA 2EZCA 3MN8A 2EK8A 4KSFA 4A94A 1A9XB 2EUIA 2V77A 3VRNA 4MXUA 2ZEGA 2ZOFA 2B0AA 1Y9WA 4BTFA 3ZNIA
chains in the Genus database with same CATH topology
2PJ1A 3RZAA 3WT4A 1HDQA 2PJ3A 2HB6A 3KR5A 4YWYA 4C9AA 2BO9A 1R3NA 3PB9X 3V7ZA 2AFOA 4MMOA 2PJ8A 1DTDA 4CPAA 5LRKA 4TJXA 4C8TA 3T8WA 3PRTA 3D7GA 1XFOA 2F8HA 2IQ6A 3KR4A 4P6YA 4W9YA 1ZG9A 3NH4A 4PXDA 4ZY2A 3N5FA 4MHPA 2JEWA 4EMEA 1UWYA 1XBUA 4ZY0A 1VIXA 2Q51A 1V6CA 1JQGA 3D67A 4MCPA 4YN3A 1GYTA 1IY7A 1BAVA 3FJUA 4OC0A 3WC6A 4OKOA 1R43A 5HVGA 2DEAA 5J1QA 2GU2A 2PCUA 3TX8A 1ARMA 3D7FA 3S9LA 5LYDA 2ZEHA 4P44A 2GREA 2PJ6A 3KGQA 3QNVA 1LCPA 3FVLA 1ARLA 2PJ5A 5IR2A 3NFZA 1BLLE 3ISZA 3DGVA 1LOKA 3PB7X 5CBMA 4C8FA 2PJAA 3KI9A 4DUKA 4OC5A 3CPAA 3SJEA 2XEFA 1Y9ZA 1Y7EA 1Z5RA 4YU9A 2PIYA 2ZEOA 1LANA 1H8LA 4C8PA 2ANPA 4UIBA 2AFXA 2CIJA 4X3RA 2IJZA 4X2TA 2V8HA 4H2KA 1YW4A 2XEIA 4F8ZA 4PPZA 4R7MA 2VL1A 2PE3A 2EWBA 3SI1A 4ZYQA 4NGNA 3WABA 2HC9A 3B3VA 1DE4C 2QVPA 3S9MA 1F2OA 3I74A 3FECA 2PRQA 3PFEA 3KHXA 3I6SA 3KZWA 4FAIA 3D7HA 4P4EA 4PQAA 4A37A 4P4FA 1BPMA 1CX8A 5IB9A 4A38A 1PCAA 1XRYA 2O53A 5JGFA 2WZNA 4B6ZA 3IIBA 1Y0RA 4MCRA 4BD9A 3PFOA 2ZEFA 1TKFA 3VH9A 4C8UA 2WYRA 1ELLP 3HUVA 2PJ2A 2C6CA 4OIWA 2ZOGA 3BHXA 4TNUA 3NA6A 5HVFA 3SJXA 1CP6A 1ZG7A 2IMOA 4FBEA 6CPAA 2C6PA 4CDKA 4OIDA 1LFWA 2ZELA 2C6GA 3B3WA 2FVGA 4NJRA 4OP4A 4OC2A 3I1UA 4X8IA 2C5QA 4NJQA 4OC4A 5CPAA 3BI0A 2CF4A 1RTQA 4C85A 4MHYA 2Q43A 4EFDA 1FNOA 4KSIA 5LYIA 4C86A 4UIAA 4P4DA 2RB7A 4IAVA 2ZEEA 4ZY1A 5K8PA 4WJBA 1AMPA 3KHZA 4C9EA 2POKA 4R8FA 5K8OA 5HVHA 3RBUA 4P10A 4R76A 3PB8X 3GB0A 5LRJA 3SJFA 2O4HA 3V38A 4FWUA 4EWTA 4C8AA 4K3NA 3GUXA 4C9UA 1EE3P 4AXVA 4JYWA 5I4MA 1XF1A 2I3CA 3B2YA 4P4BA 3ISXA 1CP7A 3D66A 3IWWA 1KWMA 2ZEMA 4OC3A 2RFHA 2J9AA 3SJGA 4NGSA 3IFEA 1IGBA 4LQGA 1M4LA 5HXDA 4WWVA 1TXRA 4MHNA 1Y0YA 2ZEPA 4G1PA 4PXBA 3D4UA 4FUUA 3FH4A 5F09A 4ZX9A 3PB6X 4C9VA 5DS0A 2QYVA 1LAMA 1HEEA 3NH8A 1ELMP 1TF8A 1Q7LA 3TC8A 7CPAA 1CPSA 3IO1A 5JM6A 2PJ7A 2PJ0A 3KQZA 2ZEDA 5LYFA 3SI0A 3LMSA 4PXEA 1YMEA 5JH9A 3PB4X 1CG2A 3IEHA 4P4IA 2PIZA 3D7DA 3WC7A 1CBXA 1OBRA 2GLFA 2JBKA 4PXCA 2CTCA 2NYQA 2V8VA 1TF9A 2QJ8A 3K9TA 4DJLA 4P4JA 2OOTA 4F9VA 1QMUA 4IK2A 3WC5A 2PJ9A 2JBJA 3JRUA 1XMBA 4MRIA 1Z8LA 3L2NA 3VTAA 4NFRA 3HLPA 2BOAA 2C1CA 4P45A 3D68A 3GLJA 4RUHA 4KNGE 2AFMA 2XEGA 2ZENA 4MHZA 4NGTA 1AYEA 1HDUA 1XJOA 4UEZA 5K8MA 2AFUA 3VATA 2BCOA 3S9NA 2GLJA 3PBBA 2GP4A 4TJVA 2ABZA 4ZX8A 4NGRA 3SI2A 3MRUA 4NGQA 3VARA 3BXMA 2G9DA 1YW6A 2PJCA 4C99A 4Z65A 3KASA 2AFWA 4MCQA 2V8GA 1LAPA 4ZI6A 1VHEA 5LRGA 5K8NA 1WVMA 2PJ4A 3H8EA 2PVWA 4UEEA 1YSJA 1Z2LA 3B7IA 4OMEA 1FT7A 4O23A 4NGPA 1ZG8A 1YLOA 2NSMA 3NH5A 4A39A 4F9UA 4DYOA 1VHOA 1F57A 2PVVA 2XEJA 1CPXA 1TKHA 5D29A 3CPXA 3DLJA 3H8FA 1VGYA 1TKJA 1NSAA 2V8DA 4C84A 4ONWA 3EIFA 3FMCA 3FX6A 2AFSA 3B3SA 3K2KA 4OC1A 1QQ9A 4C8CA 4IHMA 3RAMA 3PBEA 3FF3A 1F2PA 3B3CA 4UF4A 2OR4A 3B35A 3B3TA 4GM5A 3CT9A 1ZLIA 2EK9A 5LYLA 4MCSA 3CDXA 3LWUA 4JZ0A 2CTBA 1ZLHA 5D8NA 5ELYA 4UEFA 3IC1A 3IJ3A 3KL9A 2AFZA 2F7VA 3FEDA 4R6TA 4NGMA 3PEIA 3FEEA 2PJBA 3ICUA 2Q4ZA 8CPAA 4C9RA 4Q7AA 3KQXA 1PYTB 1BPNA 3H8GA 3BI1A 5THWA 4TWEA 3MN8A 2EK8A 4A94A 4MXUA 2V77A 2ZEGA 2ZOFA 4CDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJ1 A;  3RZA A;  3WT4 A;  1HDQ A;  2PJ3 A;  2HB6 A;  3KR5 A;  4YWY A;  4C9A A;  2BO9 A;  1R3N A;  3PB9 X;  3V7Z A;  2AFO A;  4MMO A;  2PJ8 A;  1DTD A;  4CPA A;  5LRK A;  4TJX A;  4C8T A;  3T8W A;  3PRT A;  3D7G A;  1XFO A;  2F8H A;  2IQ6 A;  3KR4 A;  4P6Y A;  4W9Y A;  1ZG9 A;  3NH4 A;  4PXD A;  4ZY2 A;  3N5F A;  4MHP A;  2JEW A;  4EME A;  1UWY A;  1XBU A;  4ZY0 A;  1VIX A;  2Q51 A;  1V6C A;  1JQG A;  3D67 A;  4MCP A;  4YN3 A;  1GYT A;  1IY7 A;  1BAV A;  3FJU A;  4OC0 A;  3WC6 A;  4OKO A;  1R43 A;  5HVG A;  2DEA A;  5J1Q A;  2GU2 A;  2PCU A;  3TX8 A;  1ARM A;  3D7F A;  3S9L A;  5LYD A;  2ZEH A;  4P44 A;  2GRE A;  2PJ6 A;  3KGQ A;  3QNV A;  1LCP A;  3FVL A;  1ARL A;  2PJ5 A;  3NFZ A;  1BLL E;  3ISZ A;  3DGV A;  1LOK A;  3PB7 X;  5CBM A;  4C8F A;  2PJA A;  3KI9 A;  4DUK A;  4OC5 A;  3CPA A;  3SJE A;  2XEF A;  1Y9Z A;  1Y7E A;  1Z5R A;  4YU9 A;  2PIY A;  2ZEO A;  1LAN A;  1H8L A;  4C8P A;  2ANP A;  4UIB A;  2AFX A;  2CIJ A;  4X3R A;  2IJZ A;  4X2T A;  2V8H A;  4H2K A;  1YW4 A;  2XEI A;  4F8Z A;  4PPZ A;  4R7M A;  2VL1 A;  2PE3 A;  2EWB A;  3SI1 A;  4ZYQ A;  4NGN A;  3WAB A;  2HC9 A;  3B3V A;  1DE4 C;  2QVP A;  3S9M A;  1F2O A;  3I74 A;  3FEC A;  2PRQ A;  3PFE A;  3KHX A;  3I6S A;  3KZW A;  4FAI A;  3D7H A;  4P4E A;  4PQA A;  4A37 A;  4P4F A;  1BPM A;  1CX8 A;  5IB9 A;  4A38 A;  1PCA A;  1XRY A;  2O53 A;  5JGF A;  2WZN A;  4B6Z A;  3IIB A;  1Y0R A;  4MCR A;  4BD9 A;  3PFO A;  2ZEF A;  1TKF A;  3VH9 A;  4C8U A;  2WYR A;  1ELL P;  3HUV A;  2PJ2 A;  2C6C A;  4OIW A;  2ZOG A;  3BHX A;  4TNU A;  3NA6 A;  5HVF A;  3SJX A;  1CP6 A;  1ZG7 A;  2IMO A;  4FBE A;  6CPA A;  2C6P A;  4CDK A;  4OID A;  1LFW A;  2ZEL A;  2C6G A;  3B3W A;  2FVG A;  4NJR A;  4OP4 A;  4OC2 A;  3I1U A;  4X8I A;  4NJQ A;  4OC4 A;  5CPA A;  3BI0 A;  2CF4 A;  1RTQ A;  4C85 A;  4MHY A;  2Q43 A;  4EFD A;  1FNO A;  4KSI A;  5LYI A;  4C86 A;  4UIA A;  4P4D A;  2RB7 A;  4IAV A;  2ZEE A;  4ZY1 A;  5K8P A;  4WJB A;  1AMP A;  3KHZ A;  4C9E A;  2POK A;  4R8F A;  5K8O A;  5HVH A;  3RBU A;  4P10 A;  4R76 A;  3PB8 X;  3GB0 A;  5LRJ A;  3SJF A;  2O4H A;  3V38 A;  4FWU A;  4EWT A;  4C8A A;  4K3N A;  3GUX A;  4C9U A;  1EE3 P;  4AXV A;  4JYW A;  5I4M A;  1XF1 A;  2I3C A;  3B2Y A;  4P4B A;  3ISX A;  1CP7 A;  3D66 A;  3IWW A;  1KWM A;  2ZEM A;  4OC3 A;  2RFH A;  2J9A A;  3SJG A;  4NGS A;  3IFE A;  1IGB A;  4LQG A;  1M4L A;  5HXD A;  4WWV A;  1TXR A;  4MHN A;  1Y0Y A;  2ZEP A;  4G1P A;  4PXB A;  3D4U A;  4FUU A;  3FH4 A;  5F09 A;  4ZX9 A;  3PB6 X;  4C9V A;  5DS0 A;  2QYV A;  1LAM A;  1HEE A;  3NH8 A;  1ELM P;  1TF8 A;  1Q7L A;  3TC8 A;  7CPA A;  1CPS A;  3IO1 A;  5JM6 A;  2PJ7 A;  2PJ0 A;  3KQZ A;  2ZED A;  5LYF A;  3SI0 A;  3LMS A;  4PXE A;  1YME A;  5JH9 A;  3PB4 X;  1CG2 A;  3IEH A;  4P4I A;  2PIZ A;  3D7D A;  3WC7 A;  1CBX A;  1OBR A;  2GLF A;  2JBK A;  4PXC A;  2CTC A;  2NYQ A;  2V8V A;  1TF9 A;  2QJ8 A;  3K9T A;  4DJL A;  4P4J A;  2OOT A;  4F9V A;  1QMU A;  4IK2 A;  3WC5 A;  2PJ9 A;  2JBJ A;  3JRU A;  1XMB A;  4MRI A;  1Z8L A;  3L2N A;  3VTA A;  4NFR A;  3HLP A;  2BOA A;  2C1C A;  4P45 A;  3D68 A;  3GLJ A;  4RUH A;  4KNG E;  2AFM A;  2XEG A;  2ZEN A;  4MHZ A;  4NGT A;  1AYE A;  1HDU A;  1XJO A;  4UEZ A;  5K8M A;  2AFU A;  3VAT A;  2BCO A;  3S9N A;  2GLJ A;  3PBB A;  4TJV A;  2ABZ A;  4ZX8 A;  4NGR A;  3SI2 A;  3MRU A;  4NGQ A;  3VAR A;  3BXM A;  2G9D A;  1YW6 A;  2PJC A;  4C99 A;  4Z65 A;  3KAS A;  2AFW A;  4MCQ A;  2V8G A;  1LAP A;  4ZI6 A;  1VHE A;  5LRG A;  5K8N A;  1WVM A;  2PJ4 A;  3H8E A;  2PVW A;  4UEE A;  1YSJ A;  1Z2L A;  3B7I A;  4OME A;  1FT7 A;  4O23 A;  4NGP A;  1ZG8 A;  1YLO A;  2NSM A;  3NH5 A;  4A39 A;  4F9U A;  4DYO A;  1VHO A;  1F57 A;  2PVV A;  2XEJ A;  1CPX A;  1TKH A;  5D29 A;  3CPX A;  3DLJ A;  3H8F A;  1VGY A;  1TKJ A;  1NSA A;  2V8D A;  4C84 A;  4ONW A;  3EIF A;  3FMC A;  3FX6 A;  2AFS A;  3B3S A;  3K2K A;  4OC1 A;  1QQ9 A;  4C8C A;  4IHM A;  3RAM A;  3PBE A;  3FF3 A;  1F2P A;  3B3C A;  4UF4 A;  2OR4 A;  3B35 A;  3B3T A;  4GM5 A;  3CT9 A;  1ZLI A;  2EK9 A;  5LYL A;  4MCS A;  3CDX A;  3LWU A;  4JZ0 A;  2CTB A;  1ZLH A;  5D8N A;  5ELY A;  4UEF A;  3IC1 A;  3IJ3 A;  3KL9 A;  2AFZ A;  2F7V A;  3FED A;  4R6T A;  4NGM A;  3PEI A;  3FEE A;  2PJB A;  3ICU A;  2Q4Z A;  8CPA A;  4C9R A;  4Q7A A;  3KQX A;  1PYT B;  1BPN A;  3H8G A;  3BI1 A;  5THW A;  4TWE A;  3MN8 A;  2EK8 A;  4A94 A;  4MXU A;  2V77 A;  2ZEG A;  2ZOF A;  4CDJ A; 
#chains in the Genus database with same CATH topology
 4E5S A;  1QST A;  2PJ1 A;  3RZA A;  1Z9U A;  1HDQ A;  2PJ3 A;  3WT4 A;  1BOB A;  4HNY B;  4NCZ A;  2HB6 A;  2PR1 A;  1P4N A;  1P0H A;  2B4B A;  3D8P A;  3TLC A;  3KR5 A;  4YWY A;  4C9A A;  2BO9 A;  4A31 A;  1R3N A;  3PB9 X;  4A30 A;  3V7Z A;  4AG7 A;  2AFO A;  4MMO A;  4CRZ B;  4A32 A;  2PJ8 A;  2ZW6 A;  1DTD A;  2Q7S A;  1IU8 A;  5I0C A;  1DIK A;  4CPA A;  3P2H A;  5LRK A;  1NE9 A;  4B5P B;  1Z9E A;  2FIA A;  4TJX A;  5C88 A;  4C8T A;  3T8W A;  2B4D A;  3PRT A;  3D7G A;  3TYX A;  2P6G A;  1XFO A;  2F8H A;  2IQ6 A;  3JUW A;  3KR4 A;  2Y1N A;  4MY0 A;  5DWN A;  2GE3 A;  2YGW A;  4KS9 A;  4P6Y A;  2ZPA A;  1ZL0 A;  3F9K C;  4W9Y A;  1ZG9 A;  3NH4 A;  3G8W A;  4PXD A;  4ZY2 A;  1M44 A;  5F46 A;  3N5F A;  4AVB A;  4CAE A;  2PR8 A;  1IID A;  1YR0 A;  4MHP A;  2JEW A;  4RN7 A;  4EME A;  1CE8 B;  1UWY A;  1XBU A;  1V0C A;  4PK3 A;  4ZY0 A;  3T05 A;  5JYB A;  3EO4 A;  1VIX A;  4JWP A;  4CYP A;  2FCK A;  2Q51 A;  1V6C A;  1ZO0 A;  1JQG A;  3D67 A;  1BXR B;  2Y1M A;  4MCP A;  4YN3 A;  1GYT A;  1IY7 A;  2NMT A;  4CGL A;  3EY5 A;  3H5Z A;  1BAV A;  3FJU A;  4XPK A;  5F48 A;  3TTH A;  4OC0 A;  3WC6 A;  3W91 A;  3VWD A;  4MBU A;  1R43 A;  2I00 A;  2DEA A;  4OKO A;  5CNP A;  4NEX A;  5HVG A;  2DLA A;  3FXT A;  1WK4 A;  2GU2 A;  2PCU A;  2BEI A;  3TX8 A;  4PK2 A;  1ARM A;  3D7F A;  3S9L A;  5LYD A;  2ZEH A;  3TE4 A;  2EZA A;  4P44 A;  4BMH A;  1A2Z A;  2GRE A;  2OB0 A;  2G3T A;  2R8V A;  2Z3P A;  4HKF A;  2PJ6 A;  2XPL A;  2H5M A;  3KGQ A;  3QNV A;  1LCP A;  1U6M A;  3FVL A;  1ARL A;  1NXJ A;  3OB1 B;  3TLB A;  4MHD A;  3A9L A;  2PJ5 A;  2WPW A;  5IR2 A;  3NFZ A;  1ZRS A;  1MJB A;  1SQH A;  5IB9 A;  2CY2 A;  1JDB C;  3G23 A;  1BLL E;  3ISZ A;  4M6G A;  2X7B A;  3DGV A;  2X0S A;  1LOK A;  2ARH A;  5HKY A;  2PC1 A;  3PB7 X;  5CBM A;  1TIQ A;  4C8F A;  2ATR A;  1WJT A;  2PJA A;  2P6E A;  1S3Z A;  3BLN A;  3KI9 A;  4DUK A;  4OC5 A;  3TLZ A;  2BSW A;  3CPA A;  3SJE A;  2XEF A;  3DR6 A;  2O28 A;  1Y9Z A;  1Y7E A;  5G1Z A;  1Z5R A;  4YU9 A;  1YGH A;  3EZE A;  3C8O A;  2PIY A;  5ISV A;  1CM0 A;  2ZEO A;  2Z3N A;  4MFK A;  1N71 A;  1LAN A;  2Z3O A;  3DDD A;  1H8L A;  5KTA A;  4C8P A;  2ANP A;  2IL4 A;  4ONU A;  2YNE A;  3FB3 A;  4UIB A;  4MFL A;  2AFX A;  1NBW A;  4B13 A;  2BL1 A;  5H84 A;  2CIJ A;  3JTK A;  4X3R A;  2IJZ A;  5GCN A;  1KZF A;  1S7N A;  2V8H A;  1IYL A;  4H2K A;  1YW4 A;  4X2T A;  4CGN A;  2XEI A;  1GHE A;  4F8Z A;  2D0P A;  4CYO A;  1JWQ A;  4PPZ A;  4R7M A;  3K9U A;  2EZB A;  1Q2Y A;  2VL1 A;  1YQE A;  2PE3 A;  3GIU A;  2PDO A;  5F47 A;  4DNC A;  2EWB A;  3SI1 A;  4UFX A;  3VGO A;  1Z4E A;  4ZYQ A;  4YGO A;  4NGN A;  3WAB A;  4KVM E;  2HC9 A;  3CXP A;  2J8R A;  3B3V A;  1DE4 C;  1YVH A;  4U5Y A;  3HPH E;  3FYN A;  3D2P A;  1L0C A;  2GAN A;  1F2O A;  3S9M A;  2QVP A;  4Q38 A;  3I74 A;  4FD5 A;  4MI4 A;  4ZBG A;  5KTC A;  1YVO A;  3FEC A;  2PRQ A;  3PGP A;  3PFE A;  3KHX A;  1Z8T A;  4UFW A;  4OAD A;  3I6S A;  2FL4 A;  4QBJ A;  4RS2 A;  5J8F A;  5JVL A;  4CDJ A;  3KZW A;  4FAI A;  4BPU B;  5BY0 A;  2Q4Y A;  1B6B A;  3OP0 A;  3VRR A;  4GXH A;  4KOR A;  3D7H A;  4P4E A;  4PQA A;  2KCW A;  3TLG A;  5F13 A;  4H6Z A;  3NFQ A;  3F8K A;  4A37 A;  3T07 A;  4P4F A;  1BPM A;  1CX8 A;  2QML A;  4JJX A;  4OAE A;  1PCA A;  1R57 A;  1XRY A;  2I79 A;  3V8I A;  4A38 A;  2O53 A;  2Z3M A;  2WZN A;  5JGF A;  5AG4 A;  4B6Z A;  3IIB A;  2Z3K A;  1Y0R A;  2C27 A;  4MCR A;  4UFV A;  5F49 A;  4KUB A;  2AJ6 A;  2YNC A;  4BD9 A;  1KUV A;  3FNC A;  3PFO A;  2ZEF A;  1QSN A;  2CNT A;  4C2X A;  1XIX A;  4B11 A;  1TKF A;  4CYN A;  2JLM A;  1MJA A;  3VH9 A;  1IOF A;  4L8A A;  2D4O A;  5JPH A;  1KBL A;  2R82 A;  4FD7 A;  3B8G A;  4Y49 C;  4C8U A;  4EYS A;  2WYR A;  2E28 A;  1ELL P;  3HUV A;  4C2Y A;  2PJ2 A;  2C6C A;  2VQY A;  2OLS A;  2XPO A;  3N7Z A;  4OIW A;  2ZOG A;  3R9G A;  2XPP A;  3BHX A;  3PLF B;  4AG9 A;  4TNU A;  4CZ1 A;  3I3G A;  3TO9 A;  4KOS A;  1MK4 A;  1VBG A;  3NA6 A;  5HVF A;  3SJX A;  1CP6 A;  1ZG7 A;  2IMO A;  3IWG A;  4Q36 A;  4E2A A;  4FBE A;  2OU2 A;  4QVT A;  2C6P A;  6CPA A;  2P6F A;  1GGO A;  1RO5 A;  2XPN A;  3C26 A;  4CDK A;  4OID A;  5K99 A;  4R87 A;  1LFW A;  2ZEL A;  4UCN A;  4II9 A;  3DNS A;  3IGR A;  1BO4 A;  4BBH A;  2C6G A;  3B3W A;  2FVG A;  4NJR A;  4OP4 A;  1QSO A;  4MFP A;  3NE8 A;  4LQ6 A;  4R3K A;  4OC2 A;  2PRB A;  5AG6 A;  3I1U A;  5E96 A;  2EBJ A;  4X8I A;  4CAF A;  2OH1 A;  4NJQ A;  4OC4 A;  1KUY A;  3R1K A;  2C5Q A;  2HI6 A;  2PCN A;  4M3S A;  5CPA A;  4MFQ A;  1CJW A;  3BI0 A;  3SXO A;  3GJZ A;  2CF4 A;  3BJ7 A;  4H1H A;  1RTQ A;  4C85 A;  1I21 A;  2YNC C;  3D3S A;  4CO9 A;  5IX3 A;  4MHY A;  3IWE A;  2Q43 A;  4C2Z A;  4EFD A;  3GKR A;  2CNS A;  1M1D A;  4IIX A;  5G20 A;  2EO8 A;  1FNO A;  2WPX A;  3OAK A;  4KSI A;  5LYI A;  4UIA A;  4C86 A;  4KOU A;  3F0A A;  5J1Q A;  3GY9 A;  3U1B A;  4P4D A;  2RB7 A;  4IAV A;  3EZA A;  2ZEE A;  2Q04 A;  2ZW7 A;  3QB8 A;  4JXR A;  4AVC A;  4ZY1 A;  5K8P A;  4WJB A;  1AMP A;  2DPT A;  3KHZ A;  2Z10 A;  4C9E A;  2POK A;  4R8F A;  5K8O A;  1Q2D A;  2R7H A;  2DXQ A;  4AB7 A;  3RBU A;  4P10 A;  2EVN A;  3IU1 A;  5HVH A;  3LD2 A;  3BUW B;  2B4J C;  4R76 A;  3PB8 X;  3GB0 A;  5LRJ A;  4KVO E;  3SJF A;  3TOB A;  1X12 A;  3S6G A;  1PU9 A;  4CGO A;  2B5G A;  5HH1 A;  3T0T A;  2O4H A;  3V38 A;  4FWU A;  4AVA A;  1Y7R A;  4EWT A;  2CBL A;  2D4P A;  2R98 A;  4K3N A;  3SXN A;  4C8A A;  2VBQ A;  3GUX A;  2VKZ G;  4C9U A;  1KEE B;  1EE3 P;  1ON0 A;  4AXV A;  3PT1 A;  4JYW A;  5I4M A;  3R9F A;  1XF1 A;  1M4G A;  2I3C A;  3JVN A;  3B2Y A;  4P4B A;  4UWJ A;  4MFZ A;  3ISX A;  1CP7 A;  3D66 A;  1Z4R A;  4XNH B;  3IWW A;  1S7F A;  1KWM A;  3UY5 A;  1EZA A;  3MGD A;  4OC3 A;  2RFH A;  2ZEM A;  2J9A A;  3SJG A;  1IIC A;  3E0K A;  4CAX A;  4U9Z A;  4XPD C;  1MJ9 A;  4KVX A;  4NGS A;  3IFE A;  3TLG B;  4LX9 A;  1IGB A;  2BUE A;  2Z3L A;  4LQG A;  3FBU A;  1WWZ A;  1YRE A;  5A28 A;  1RXT A;  2JDC A;  1PUA A;  4XPL A;  1B47 A;  1M4L A;  5FVJ A;  3CXQ A;  4B5P A;  3HPG G;  1YLE A;  5H86 A;  4YFJ A;  5HXD A;  1QSR A;  4INJ A;  1XE4 A;  1NSL A;  4LUA A;  1AUG A;  2ODF A;  4IF5 A;  2REF A;  4WWV A;  3VWE A;  1TXR A;  4MHN A;  1Y0Y A;  2UV8 G;  3G3S A;  2ZEP A;  4G1P A;  4PXB A;  4E0A A;  4QUS A;  3D4U A;  1S7K A;  2G0B A;  4FUU A;  4KOX A;  1J3L A;  3FH4 A;  5F09 A;  1LRZ A;  3GYA A;  4ZX9 A;  3PB6 X;  4FD4 A;  3NOJ A;  4C9V A;  5DS0 A;  2QYV A;  1LAM A;  2RC4 A;  1HEE A;  3NH8 A;  5FD8 A;  1ELM P;  4KZT A;  1TF8 A;  4A33 A;  1Q2C A;  1Q7L A;  3SR3 A;  4KOY A;  2PQ8 A;  3TC8 A;  4M6H A;  4HPS A;  4UWI A;  7CPA A;  3R9E A;  1CPS A;  3IO1 A;  3DR8 A;  4HNX B;  2FS5 A;  5JM6 A;  4R9M A;  2PJ7 A;  2PJ0 A;  1FBV A;  3KQZ A;  2ZED A;  4C68 A;  3CZX A;  4KOT A;  5LYF A;  2AUM A;  3TLE A;  3SI0 A;  3O8Z A;  4BIN A;  2J8M A;  2B4D B;  3LMS A;  4PXE A;  4CAV A;  1YME A;  3VRP A;  2VXK A;  4X5K A;  5JH9 A;  1IB1 E;  1S5K A;  1CG2 A;  3BUN B;  2VEZ A;  2ZW4 A;  3IEH A;  3PB4 X;  4QB9 A;  3BUO B;  4ZGY B;  1VKC A;  4P4I A;  2ZW5 A;  3H4Q A;  5EMI A;  2F5I A;  2ZXV A;  2PIZ A;  2DF5 A;  5IV0 A;  4B14 A;  3I9S A;  3D7D A;  3WC7 A;  1CBX A;  1OBR A;  2OZU A;  5C82 A;  2GLF A;  2JBK A;  1YK3 A;  1Z8W A;  1S7L A;  2CTC A;  2GIV A;  4H6U A;  1Z8X A;  4PXC A;  1C3O B;  4JVO A;  3VRQ A;  2NYQ A;  2V8V A;  4M8D A;  2D0O A;  1TF9 A;  4KOV A;  2N3A B;  2QJ8 A;  3ZJ0 A;  3EZB A;  3K9T A;  4DJL A;  4P4J A;  5A27 A;  2OOT A;  4F9V A;  4B10 A;  3QAH A;  1QMU A;  2HV2 A;  4IK2 A;  4KSA A;  3WC5 A;  2B3U A;  2AE6 A;  2FXF A;  1XMT A;  2PJ9 A;  4KLW A;  2FSR A;  4C7I A;  2JBJ A;  2CNM A;  1EZB A;  5AG5 A;  3DSB A;  3JRU A;  3R96 A;  1XMB A;  4MRI A;  4MJX A;  1Z8L A;  3L2N A;  1B87 A;  3W6X A;  2VZZ A;  1Y9K A;  5G21 A;  3NE7 A;  3VTA A;  4NFR A;  4RR2 B;  3SHP A;  4K30 A;  3HLP A;  4J0N A;  2BOA A;  5BWA B;  5J8C A;  2YND A;  2C1C A;  4P45 A;  3BJ8 A;  3D68 A;  3GLJ A;  4H89 A;  2B5G B;  3PP9 A;  5AG7 A;  3TT2 A;  2A4N A;  4A95 A;  4RUH A;  3D2M A;  4KNG E;  4MI1 A;  2Z11 A;  3VRO A;  2AFM A;  2JDD A;  2B58 A;  2WSA A;  5HKZ A;  3P2F A;  2XEG A;  2ZEN A;  4MHZ A;  4YRH A;  4NGT A;  1M4I A;  4A4B A;  4COG A;  1AYE A;  1HDU A;  1XJO A;  4UEZ A;  3K4I A;  5K8M A;  2WUU A;  2AFU A;  3TO6 A;  3VAT A;  1XEB A;  2BCO A;  3S9N A;  2GLJ A;  3PBB A;  2GP4 A;  4TJV A;  4KLV A;  4U9Y A;  2ABZ A;  3F5B A;  4ZX8 A;  3TO7 A;  1FY7 A;  4NGR A;  4UA3 A;  3SI2 A;  3MRU A;  5F1Y A;  4NGQ A;  3PZJ A;  4RI1 A;  3VAR A;  3IU2 A;  1IOI A;  4R3L A;  2HUZ A;  3QAY A;  2QEC A;  2HWG A;  3TLY A;  1JDE A;  4XNH C;  1VBH A;  3BXM A;  4KOW A;  2G9D A;  4BPX B;  4KUA A;  1YW6 A;  2PJC A;  2REE A;  4C99 A;  4Z65 A;  3KAS A;  5EC4 A;  3RYO A;  2YJV A;  3KKW A;  2AFW A;  4HNW B;  4MCQ A;  2V8G A;  1LAP A;  3LAC A;  4JD6 A;  4L89 A;  4ZI6 A;  1VHE A;  5J3X A;  5LRG A;  2JEV A;  5K8N A;  2FT0 A;  1WVM A;  4PSX A;  1KC7 A;  3S6K A;  2PJ4 A;  4F0X A;  4E94 A;  3H8E A;  1S60 A;  5HMN A;  2PVW A;  2P0W A;  4UEE A;  4Y49 B;  1YSJ A;  2HRO A;  1Z2L A;  1QSM A;  3B7I A;  4OME A;  4FD6 A;  1FT7 A;  4MY3 A;  4O23 A;  4COB A;  1Q5X A;  1VHS A;  4NGP A;  1ZG8 A;  2Z0Z A;  1YLO A;  4B5O A;  2NSM A;  1M6V B;  5IB0 A;  3NH5 A;  4OLL A;  4UCP A;  4A39 A;  4F9U A;  1ZYM A;  4DYO A;  3TLA A;  4I49 A;  2AUN A;  3T5M A;  1VHO A;  4UBR A;  5AXI A;  5G22 A;  4CGP A;  1F57 A;  1I12 A;  2VZY A;  3LOD A;  4M85 A;  2PVV A;  2K5T A;  2XEJ A;  4JLY A;  2FM4 A;  2GFQ A;  5DWM A;  1NMT A;  3T90 A;  4PV6 A;  3BUX B;  1I1D A;  1CPX A;  1TKH A;  3PFV A;  5D29 A;  1IYK A;  3CPX A;  2FE7 A;  3DLJ A;  3H8F A;  4MJ8 A;  3S6F A;  3TOA A;  1VGY A;  2YJT A;  1TKJ A;  1C30 B;  3OWC A;  3HMJ G;  4ORF A;  1J4J A;  2Q44 A;  2OZG A;  1NSA A;  2V8D A;  4BPW B;  4R57 A;  2Q7B A;  4C84 A;  4A4C A;  4ONW A;  3EIF A;  5F5X A;  3FMC A;  2G3A A;  1OZP A;  2FIW A;  3FX6 A;  2AFS A;  4NSQ A;  4GS4 A;  3EXN A;  3B3S A;  5F9M A;  4F0Y A;  4F6A A;  4MFJ A;  3K2K A;  3EC4 A;  4J3G A;  4CAW A;  5JQ4 A;  4OC1 A;  3ZZI A;  4JXQ A;  3RNZ A;  1QQ9 A;  4IIY A;  4C8C A;  4IHM A;  3RAM A;  3PBE A;  3FF3 A;  1F2P A;  3B3C A;  4PSW A;  4CRY B;  3FRM A;  4CS0 B;  4UF4 A;  3S6H A;  2OR4 A;  3B35 A;  3B3T A;  2Q4V A;  2PSW A;  3TFY A;  4UCM A;  4GM5 A;  3CT9 A;  5HKW A;  1ZLI A;  2QIR A;  2EK9 A;  3T9Y A;  4M6I A;  5LYL A;  4MCS A;  3CDX A;  3LWU A;  4JZ0 A;  1VI4 A;  1KUX A;  2CTB A;  3W6S A;  1ZLH A;  4NF1 A;  5D8N A;  1YX0 A;  5ELY A;  4UEF A;  2R1I A;  3FIX A;  3IC1 A;  3IJ3 A;  5EBV A;  1X10 A;  3KL9 A;  1K4J A;  2CXA A;  2AFZ A;  4EVY A;  2OZH A;  2J8N A;  2F7V A;  2Q0Y A;  3FED A;  4R6T A;  3CXS A;  3RO0 A;  2DIK A;  5AGE A;  3KRV A;  4NGM A;  2HQY A;  4NXY A;  1YVK A;  4XPD B;  4C7H A;  1CS0 B;  1T36 B;  3PEI A;  3FEE A;  3U88 C;  1R61 A;  2PJB A;  1UFH A;  2Q4Z A;  2MP0 A;  3ICU A;  3OB2 B;  8CPA A;  2Y0M A;  2DPS A;  1EO0 A;  1XF8 A;  3WR7 A;  4C9R A;  2VI7 A;  4Q7A A;  4GPL B;  3KQX A;  4IUS A;  3R95 A;  3TCV A;  4CGM A;  1PYT B;  3EFA A;  1BPN A;  3H8G A;  3BUM B;  2B3V A;  1M4D A;  3BI1 A;  5THW A;  4TWE A;  4QC6 A;  5KTD A;  4A2Z A;  4B12 A;  4CYQ A;  1XOV A;  4E8O A;  2EZC A;  3MN8 A;  2EK8 A;  4KSF A;  4A94 A;  1A9X B;  2EUI A;  2V77 A;  3VRN A;  4MXU A;  2ZEG A;  2ZOF A;  2B0A A;  1Y9W A;  4BTF A;  3ZNI A; 
#chains in the Genus database with same CATH homology
 2PJ1 A;  3RZA A;  3WT4 A;  1HDQ A;  2PJ3 A;  2HB6 A;  3KR5 A;  4YWY A;  4C9A A;  2BO9 A;  1R3N A;  3PB9 X;  3V7Z A;  2AFO A;  4MMO A;  2PJ8 A;  1DTD A;  4CPA A;  5LRK A;  4TJX A;  4C8T A;  3T8W A;  3PRT A;  3D7G A;  1XFO A;  2F8H A;  2IQ6 A;  3KR4 A;  4P6Y A;  4W9Y A;  1ZG9 A;  3NH4 A;  4PXD A;  4ZY2 A;  3N5F A;  4MHP A;  2JEW A;  4EME A;  1UWY A;  1XBU A;  4ZY0 A;  1VIX A;  2Q51 A;  1V6C A;  1JQG A;  3D67 A;  4MCP A;  4YN3 A;  1GYT A;  1IY7 A;  1BAV A;  3FJU A;  4OC0 A;  3WC6 A;  4OKO A;  1R43 A;  5HVG A;  2DEA A;  5J1Q A;  2GU2 A;  2PCU A;  3TX8 A;  1ARM A;  3D7F A;  3S9L A;  5LYD A;  2ZEH A;  4P44 A;  2GRE A;  2PJ6 A;  3KGQ A;  3QNV A;  1LCP A;  3FVL A;  1ARL A;  2PJ5 A;  5IR2 A;  3NFZ A;  1BLL E;  3ISZ A;  3DGV A;  1LOK A;  3PB7 X;  5CBM A;  4C8F A;  2PJA A;  3KI9 A;  4DUK A;  4OC5 A;  3CPA A;  3SJE A;  2XEF A;  1Y9Z A;  1Y7E A;  1Z5R A;  4YU9 A;  2PIY A;  2ZEO A;  1LAN A;  1H8L A;  4C8P A;  2ANP A;  4UIB A;  2AFX A;  2CIJ A;  4X3R A;  2IJZ A;  4X2T A;  2V8H A;  4H2K A;  1YW4 A;  2XEI A;  4F8Z A;  4PPZ A;  4R7M A;  2VL1 A;  2PE3 A;  2EWB A;  3SI1 A;  4ZYQ A;  4NGN A;  3WAB A;  2HC9 A;  3B3V A;  1DE4 C;  2QVP A;  3S9M A;  1F2O A;  3I74 A;  3FEC A;  2PRQ A;  3PFE A;  3KHX A;  3I6S A;  3KZW A;  4FAI A;  3D7H A;  4P4E A;  4PQA A;  4A37 A;  4P4F A;  1BPM A;  1CX8 A;  5IB9 A;  4A38 A;  1PCA A;  1XRY A;  2O53 A;  5JGF A;  2WZN A;  4B6Z A;  3IIB A;  1Y0R A;  4MCR A;  4BD9 A;  3PFO A;  2ZEF A;  1TKF A;  3VH9 A;  4C8U A;  2WYR A;  1ELL P;  3HUV A;  2PJ2 A;  2C6C A;  4OIW A;  2ZOG A;  3BHX A;  4TNU A;  3NA6 A;  5HVF A;  3SJX A;  1CP6 A;  1ZG7 A;  2IMO A;  4FBE A;  6CPA A;  2C6P A;  4CDK A;  4OID A;  1LFW A;  2ZEL A;  2C6G A;  3B3W A;  2FVG A;  4NJR A;  4OP4 A;  4OC2 A;  3I1U A;  4X8I A;  2C5Q A;  4NJQ A;  4OC4 A;  5CPA A;  3BI0 A;  2CF4 A;  1RTQ A;  4C85 A;  4MHY A;  2Q43 A;  4EFD A;  1FNO A;  4KSI A;  5LYI A;  4C86 A;  4UIA A;  4P4D A;  2RB7 A;  4IAV A;  2ZEE A;  4ZY1 A;  5K8P A;  4WJB A;  1AMP A;  3KHZ A;  4C9E A;  2POK A;  4R8F A;  5K8O A;  5HVH A;  3RBU A;  4P10 A;  4R76 A;  3PB8 X;  3GB0 A;  5LRJ A;  3SJF A;  2O4H A;  3V38 A;  4FWU A;  4EWT A;  4C8A A;  4K3N A;  3GUX A;  4C9U A;  1EE3 P;  4AXV A;  4JYW A;  5I4M A;  1XF1 A;  2I3C A;  3B2Y A;  4P4B A;  3ISX A;  1CP7 A;  3D66 A;  3IWW A;  1KWM A;  2ZEM A;  4OC3 A;  2RFH A;  2J9A A;  3SJG A;  4NGS A;  3IFE A;  1IGB A;  4LQG A;  1M4L A;  5HXD A;  4WWV A;  1TXR A;  4MHN A;  1Y0Y A;  2ZEP A;  4G1P A;  4PXB A;  3D4U A;  4FUU A;  3FH4 A;  5F09 A;  4ZX9 A;  3PB6 X;  4C9V A;  5DS0 A;  2QYV A;  1LAM A;  1HEE A;  3NH8 A;  1ELM P;  1TF8 A;  1Q7L A;  3TC8 A;  7CPA A;  1CPS A;  3IO1 A;  5JM6 A;  2PJ7 A;  2PJ0 A;  3KQZ A;  2ZED A;  5LYF A;  3SI0 A;  3LMS A;  4PXE A;  1YME A;  5JH9 A;  3PB4 X;  1CG2 A;  3IEH A;  4P4I A;  2PIZ A;  3D7D A;  3WC7 A;  1CBX A;  1OBR A;  2GLF A;  2JBK A;  4PXC A;  2CTC A;  2NYQ A;  2V8V A;  1TF9 A;  2QJ8 A;  3K9T A;  4DJL A;  4P4J A;  2OOT A;  4F9V A;  1QMU A;  4IK2 A;  3WC5 A;  2PJ9 A;  2JBJ A;  3JRU A;  1XMB A;  4MRI A;  1Z8L A;  3L2N A;  3VTA A;  4NFR A;  3HLP A;  2BOA A;  2C1C A;  4P45 A;  3D68 A;  3GLJ A;  4RUH A;  4KNG E;  2AFM A;  2XEG A;  2ZEN A;  4MHZ A;  4NGT A;  1AYE A;  1HDU A;  1XJO A;  4UEZ A;  5K8M A;  2AFU A;  3VAT A;  2BCO A;  3S9N A;  2GLJ A;  3PBB A;  2GP4 A;  4TJV A;  2ABZ A;  4ZX8 A;  4NGR A;  3SI2 A;  3MRU A;  4NGQ A;  3VAR A;  3BXM A;  2G9D A;  1YW6 A;  2PJC A;  4C99 A;  4Z65 A;  3KAS A;  2AFW A;  4MCQ A;  2V8G A;  1LAP A;  4ZI6 A;  1VHE A;  5LRG A;  5K8N A;  1WVM A;  2PJ4 A;  3H8E A;  2PVW A;  4UEE A;  1YSJ A;  1Z2L A;  3B7I A;  4OME A;  1FT7 A;  4O23 A;  4NGP A;  1ZG8 A;  1YLO A;  2NSM A;  3NH5 A;  4A39 A;  4F9U A;  4DYO A;  1VHO A;  1F57 A;  2PVV A;  2XEJ A;  1CPX A;  1TKH A;  5D29 A;  3CPX A;  3DLJ A;  3H8F A;  1VGY A;  1TKJ A;  1NSA A;  2V8D A;  4C84 A;  4ONW A;  3EIF A;  3FMC A;  3FX6 A;  2AFS A;  3B3S A;  3K2K A;  4OC1 A;  1QQ9 A;  4C8C A;  4IHM A;  3RAM A;  3PBE A;  3FF3 A;  1F2P A;  3B3C A;  4UF4 A;  2OR4 A;  3B35 A;  3B3T A;  4GM5 A;  3CT9 A;  1ZLI A;  2EK9 A;  5LYL A;  4MCS A;  3CDX A;  3LWU A;  4JZ0 A;  2CTB A;  1ZLH A;  5D8N A;  5ELY A;  4UEF A;  3IC1 A;  3IJ3 A;  3KL9 A;  2AFZ A;  2F7V A;  3FED A;  4R6T A;  4NGM A;  3PEI A;  3FEE A;  2PJB A;  3ICU A;  2Q4Z A;  8CPA A;  4C9R A;  4Q7A A;  3KQX A;  1PYT B;  1BPN A;  3H8G A;  3BI1 A;  5THW A;  4TWE A;  3MN8 A;  2EK8 A;  4A94 A;  4MXU A;  2V77 A;  2ZEG A;  2ZOF A;  4CDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...