4MCSA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) his475tyr variant in complex with glutamic acid
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVYNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 266
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcsA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcsA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcsA02
3LWUA 3B3WA 1XRYA 1RTQA 4FBEA 3K2KA 3HUVA 3ISZA 2PVWA 4OP4A 4KSIA 2PJ2A 1YLOA 5I4MA 3PRTA 4EFDA 3NA6A 5CPAA 1ARLA 1F57A 2PJ7A 3CDXA 1FNOA 3TC8A 2BO9A 4P4FA 4P10A 4P4DA 4OKOA 1ZG8A 4ZYQA 4C9VA 3RZAA 3WC5A 4C84A 1PYTB 3VARA 2QJ8A 2PJBA 4A38A 3H8EA 2GLJA 3VATA 2ZEGA 2JBKA 5HXDA 4R8FA 2XEJA 3D7FA 4R6TA 4O23A 2ZEOA 2GLFA 4FWUA 4WJBA 4PXBA 3KHXA 2WZNA 4TJXA 3NFZA 3KQXA 3WC6A 1PCAA 5CBMA 8CPAA 1FT7A 3BI0A 4IK2A 3S9MA 4NGRA 2BCOA 1WVMA 4G1PA 4PXCA 1HDQA 4ZX8A 3NH4A 3B3TA 2AFMA 2PJ0A 4MCSA 1TKFA 2NSMA 2Q51A 2EK8A 3FJUA 1CPSA 4OIDA 4MCRA 4OC3A 4OC4A 3FH4A 1JQGA 3LMSA 4DYOA 3D7GA 3H8GA 4X3RA 4FAIA 2PJ3A 4C8CA 4PPZA 1Y0YA 4MMOA 3D7DA 1F2OA 2ZEMA 3FMCA 1Y9ZA 1CP7A 1BPNA 3NH8A 2PRQA 3WT4A 3KHZA 3S9NA 2PJCA 1F2PA 2PE3A 1CX8A 3IC1A 4ONWA 4H2KA 3RBUA 5THWA 1VIXA 2BOAA 2V8GA 4F8ZA 4B6ZA 3MRUA 4ZY1A 1XMBA 2F7VA 2CF4A 4BD9A 4GM5A 2IJZA 1TKHA 2JBJA 2ZEFA 3D4UA 4OC0A 3QNVA 1BAVA 3PB7X 3PBBA 4C9RA 1Z5RA 4A37A 3D66A 2HC9A 3DGVA 3KASA 1ELMP 5J1QA 4C85A 3PBEA 2AFOA 3PFOA 4NGSA 4OIWA 5JM6A 1BPMA 4IAVA 4UEEA 3PB8X 1Q7LA 3JRUA 3CPAA 3NH5A 2QYVA 2C6PA 2IMOA 2AFSA 4EMEA 4C9EA 4R7MA 4P6YA 4MHNA 1HEEA 2POKA 4A39A 2Q43A 2PJ9A 4UIBA 4TWEA 4ZY2A 1ZLHA 3GUXA 4TJVA 1ELLP 2VL1A 3D67A 1UWYA 4F9UA 3FX6A 3I74A 1ZG7A 4MCQA 2ZEDA 4YWYA 3FVLA 3WC7A 1AMPA 4CDJA 5DS0A 2PCUA 2ZOFA 4RUHA 2ZELA 4ZX9A 4C99A 1XJOA 2XEGA 4C8AA 1CG2A 2PJ1A 3PB9X 1Z2LA 4P44A 2EWBA 4NGMA 2DEAA 4NJRA 4P4EA 3PB6X 2AFZA 4P4JA 2CTBA 3KL9A 3TX8A 5LYIA 1M4LA 1ZLIA 1YW6A 4CPAA 4ZI6A 2PJ6A 3IFEA 4K3NA 3KI9A 1CP6A 3SI1A 1QQ9A 4P4BA 4MCPA 2F8HA 5LRKA 2XEIA 2AFXA 5IB9A 3HLPA 3EIFA 3PFEA 3V7ZA 1OBRA 4NFRA 4W9YA 5K8NA 4Q7AA 4C8PA 4OC5A 3IO1A 4YN3A 3SI0A 2O4HA 3KR5A 1R3NA 1LAMA 2Q4ZA 4MHPA 3N5FA 2C1CA 3V38A 1BLLE 1Z8LA 3I6SA 4P45A 3RAMA 4MRIA 2GREA 3CPXA 3IEHA 4C8TA 2HB6A 2V8HA 3FECA 3ICUA 3SI2A 5K8MA 4KNGE 2V77A 2AFWA 3D7HA 2ZEEA 5D8NA 4CDKA 2G9DA 4Z65A 3FF3A 2ABZA 3FEEA 4A94A 4UEFA 4UEZA 5JH9A 3H8FA 1H8LA 5LRJA 3D68A 3GLJA 2C6GA 1TF8A 4MXUA 1QMUA 5LYDA 3B3SA 4FUUA 1CPXA 1VHEA 1YMEA 5LYLA 2ZOGA 4MHZA 3T8WA 1NSAA 1XFOA 3K9TA 3B35A 1V6CA 1TKJA 2PJ4A 1XBUA 1ARMA 3PB4X 1TXRA 4R76A 2PIZA 3WABA 3KR4A 4C8UA 3S9LA 3BI1A 4JYWA 1TF9A 2PIYA 1EE3P 4NGQA 3L2NA 2O53A 2V8VA 4IHMA 1Y0RA 1IGBA 1GYTA 1YW4A 2OOTA 2XEFA 1CBXA 4X2TA 3BXMA 3B7IA 3IWWA 2ZENA 1VHOA 2GU2A 4F9VA 1R43A 3DLJA 4JZ0A 2WYRA 4NGNA 4PXEA 7CPAA 4MHYA 5JGFA 4NGPA 2J9AA 2NYQA 4YU9A 2PVVA 2V8DA 4P4IA 3SJEA 3SJGA 2CTCA 1LANA 1LOKA 2PJAA 3IIBA 3KQZA 5D29A 4LQGA 2ZEHA 3VH9A 5HVGA 1HDUA 5K8OA 4UIAA 4OC2A 3BHXA 3MN8A 2OR4A 1Y7EA 4TNUA 3B2YA 2FVGA 5HVFA 2I3CA 3FEDA 3VTAA 2AFUA 3B3VA 5F09A 3SJXA 5HVHA 4AXVA 2CIJA 4X8IA 4NJQA 4PQAA 3KGQA 3IJ3A 4DJLA 2EK9A 4C9UA 1XF1A 5LYFA 5ELYA 2IQ6A 3PEIA 2PJ5A 3GB0A 1YSJA 5LRGA 1LCPA 4NGTA 3B3CA 2RB7A 1LAPA 6CPAA 1LFWA 4C8FA 4UF4A 3SJFA 2QVPA 4C9AA 1IY7A 2PJ8A 1AYEA 1ZG9A 4EWTA 1KWMA 1DE4C 1VGYA 3I1UA 4OMEA 4OC1A 2ZEPA 3CT9A 4PXDA 2RFHA 2JEWA 3KZWA 2ANPA 4ZY0A 1DTDA 4C86A 3ISXA 5K8PA 4DUKA 2C6CA 4WWVA
chains in the Genus database with same CATH superfamily
1IIDA 5F5XA 3FRMA 3LWUA 2Q0YA 3B3WA 2VQYA 1XRYA 4MI4A 1RTQA 2B4DB 1WWZA 1NXJA 4FBEA 1FY7A 2FL4A 3TLEA 5KTDA 3K2KA 3HUVA 5G1ZA 3ISZA 2PVWA 4IIXA 4E0AA 4OP4A 4M3SA 4KSIA 2OH1A 1YLOA 2PJ2A 4ONUA 1M4DA 4CGMA 5I4MA 3PRTA 4EFDA 4E8OA 3NA6A 5CPAA 1ARLA 1ON0A 4KSFA 1F57A 2FE7A 2PJ7A 2RC4A 1Q2DA 3CDXA 2EUIA 1FNOA 3TC8A 2I79A 3FXTA 4CAWA 2BO9A 3GYAA 4P4FA 4P10A 4P4DA 4OKOA 4UA3A 1ZG8A 4C7IA 4ZYQA 4C9VA 3RZAA 3WC5A 4C84A 4A4CA 1PYTB 1YVOA 2QJ8A 4H6UA 2PJBA 3VARA 4XPLA 4A38A 3P2FA 3H8EA 2GLJA 2XPOA 2R7HA 3D2PA 4PSXA 4KVOE 4U9ZA 3R9EA 3VATA 4CGOA 3VWEA 3CXQA 4CYOA 2ZEGA 2JBKA 5HXDA 1Z8TA 4R8FA 2B58A 2XEJA 3PLFB 5BY0A 4A32A 4BINA 1EZAA 3D7FA 4MFJA 2YNCC 4R6TA 4O23A 1XMTA 5IX3A 1S60A 3EO4A 4NXYA 2ZEOA 2GLFA 3GY9A 4MY0A 4FWUA 4MFLA 4WJBA 4PXBA 2HV2A 3EC4A 3KHXA 1KBLA 2WZNA 4TJXA 1Q2CA 2PDOA 3EFAA 2EVNA 3NFZA 4IIYA 5DWMA 3KQXA 5K99A 3JTKA 3WC6A 1PCAA 4BPXB 5CBMA 8CPAA 2XPNA 1FT7A 3BI0A 2R1IA 3PGPA 4MHDA 2Y1NA 1V0CA 3K9UA 4K30A 3R1KA 2GP4A 2FS5A 4NGRA 3S9MA 3JVNA 4IK2A 3R9FA 2BCOA 2CNSA 3I3GA 1WVMA 2D0PA 4G1PA 4PXCA 4MI1A 1MJBA 3HPGG 2B5GA 1HDQA 4ZX8A 3NH4A 3B3TA 2J8NA 5G20A 4ZBGA 3T05A 2AFMA 2PJ0A 4MCSA 1TKFA 2NSMA 1QSOA 2Q51A 2EK8A 2R8VA 3FJUA 1CPSA 4OIDA 4KVME 2EZAA 1KEEB 1I21A 4OADA 3OB1B 4MCRA 3IU2A 5KTCA 4HPSA 1MJ9A 2REFA 4KOSA 4OC3A 4OC4A 3TFYA 1M1DA 3FH4A 2BEIA 1JQGA 1S7KA 3LMSA 4DYOA 3D7GA 3H8GA 2F5IA 4YFJA 2N3AB 2G3AA 3N7ZA 3I9SA 2R98A 4X3RA 1IOIA 4UBRA 1Z4RA 2BUEA 5H86A 3W6SA 1EO0A 5GCNA 4FAIA 3A9LA 2PJ3A 4C8CA 4PPZA 4CYPA 1Y0YA 3D7DA 1IB1E 1F2OA 2DF5A 2ZEMA 3FMCA 4MMOA 4II9A 4JXQA 1CP7A 1BPNA 3QAHA 2CNMA 4L89A 2AUNA 5IV0A 3VRNA 3NH8A 4FD6A 4JLYA 5J3XA 1VBGA 2PRQA 3WT4A 4B10A 3KHZA 1NSLA 1KUXA 2XPLA 1S5KA 4UFVA 3S9NA 4F0YA 2D0OA 3W6XA 4B14A 3BLNA 2PJCA 2Z3MA 4QC6A 1F2PA 4CGNA 1VBHA 2JEVA 2PE3A 3FYNA 1CX8A 3IC1A 4ONWA 4H2KA 3RBUA 4H89A 5THWA 1VIXA 3PT1A 2BOAA 2V8GA 4F8ZA 1CE8B 4B6ZA 5EC4A 2YJTA 3MRUA 4ZY1A 1XMBA 2F7VA 1Y7RA 3LODA 2CF4A 4BD9A 4XPKA 4GM5A 1YK3A 1RXTA 4UCMA 4Y49C 1FBVA 2OZHA 4NSQA 1XF8A 2IJZA 3FNCA 4R3KA 2E28A 1TKHA 4GPLB 1Q2YA 2JBJA 2ZEFA 3RYOA 1IYLA 2B4BA 4OC0A 3D4UA 3QNVA 2X0SA 3VRRA 1BAVA 3PB7X 3PBBA 4HNYB 4C9RA 1Z5RA 4Q36A 4A37A 3D66A 1J3LA 2C5QA 2VKZG 2HC9A 5FD8A 4C68A 2PCNA 1X12A 2Z3LA 2Z3KA 3DGVA 3KASA 4M8DA 1KUYA 2ATRA 3HPHE 4AVAA 1DIKA 4QBJA 1ELMP 5J1QA 4C85A 1R57A 3PBEA 5JQ4A 2AFOA 3PFOA 4NGSA 4OIWA 2B5GB 3MGDA 5JM6A 3O8ZA 1BPMA 3HMJG 2K5TA 1MK4A 1M4GA 2Z3PA 3CZXA 4IAVA 4UEEA 3PB8X 1Q7LA 3JRUA 3CPAA 3NH5A 2QYVA 2C6PA 2IMOA 4B11A 2AFSA 2Z0ZA 5F49A 4EMEA 4C9EA 4MFZA 3T0TA 3BUMB 4GS4A 5AXIA 1YVKA 2YNCA 4R7MA 3VGOA 4MHNA 1HEEA 4P6YA 4B12A 3EZEA 1P0HA 4JXRA 2POKA 4A39A 4L8AA 2KCWA 3VRQA 1IOFA 2Q43A 4J3GA 5HKWA 1N71A 1X10A 2PJ9A 2ZW6A 4R9MA 4UIBA 4TWEA 4ZY2A 1ZLHA 1RO5A 2Z11A 2ZW5A 3GUXA 3S6GA 2EZBA 4TJVA 1ELLP 2VL1A 3D67A 5HKYA 3G3SA 3GJZA 3DR8A 3NE7A 1UWYA 2YGWA 2HI6A 4F9UA 3VROA 3FX6A 1PU9A 1XEBA 3I74A 1ZG7A 2OZGA 3S6FA 3EXNA 4C2XA 4MCQA 4XPDB 1IU8A 1T36B 3TOBA 3WR7A 4C2ZA 1IICA 1I1DA 5IR2A 2Y0MA 1Y9WA 2ZEDA 3EZAA 4YWYA 3SR3A 4KOXA 3FVLA 3IU1A 4LUAA 4CDKA 1PUAA 2JLMA 4CGPA 1YR0A 3WC7A 1AMPA 1WJTA 3E0KA 3P2HA 4KUBA 4R3LA 5DS0A 5J8FA 2PCUA 4J0NA 1Z9UA 1Z9EA 2ZOFA 5C82A 4RUHA 2ZELA 1IYKA 4ZX9A 4IF5A 4C99A 2HUZA 2WSAA 3T90A 5JPHA 1XJOA 4GXHA 2CBLA 4C7HA 2XEGA 3R9GA 2P0WA 4C8AA 2DPSA 3C26A 1GGOA 4JJXA 1CG2A 2PJ1A 1KUVA 3TLCA 1S3ZA 4UFXA 3PB9X 1YLEA 1S7LA 4A2ZA 1Z2LA 4E5SA 3TTHA 2B3UA 4P44A 2EWBA 4NGMA 3S6HA 3VWDA 4CYQA 2DEAA 2JDDA 4NJRA 2R82A 1NE9A 4P4EA 3PB6X 2AFZA 4P4JA 1QSRA 2WPWA 3ZNIA 5EMIA 2YNDA 2CTBA 3KL9A 3TX8A 5LYIA 2P6FA 4B5PB 3B8GA 2FM4A 4MFPA 1M4LA 1ZLIA 1YW6A 3G8WA 2B4JC 4CPAA 2PJ6A 3IFEA 4AVCA 2PQ8A 4ZI6A 3EZBA 2WPXA 4HNWB 4K3NA 3KI9A 2VEZA 4BPWB 1CP6A 1P4NA 2QECA 3SI1A 1QQ9A 2DPTA 4P4BA 2FIAA 1L0CA 4MCPA 2F8HA 3EY5A 4KSAA 2CY2A 4UWIA 3TCVA 4KOYA 3IWGA 2Q7BA 4A31A 5LRKA 2XEIA 2AFXA 1YX0A 4UCPA 1I12A 3HLPA 5IB9A 3EIFA 3PFEA 1Z4EA 3V7ZA 3BJ8A 1OBRA 4NFRA 5AGEA 5F1YA 3TO9A 4W9YA 2PRBA 2D4PA 3IWEA 5K8NA 4Q7AA 1GHEA 1MJAA 1Y9ZA 4U9YA 4AG7A 4MY3A 5I0CA 4KOUA 4C8PA 4OC5A 5FVJA 4DNCA 1C3OB 4A95A 3IO1A 1CM0A 4YN3A 4HNXB 3OWCA 3SI0A 2O4HA 4CZ1A 3KR5A 4H1HA 1R3NA 2B4DA 1LAMA 2GIVA 2J8RA 4CGLA 3H5ZA 1R61A 2Q4ZA 4MHPA 2ARHA 3N5FA 4I49A 4M6HA 4FD7A 2C1CA 1ZL0A 3NFQA 2DXQA 1Z8WA 3V38A 1BLLE 5DWNA 4PK3A 1Z8LA 1ZO0A 2BSWA 3GIUA 3I6SA 4P45A 3RAMA 4B5OA 4MRIA 1KZFA 2GREA 4FD5A 3CPXA 3IEHA 3F9KC 2VZYA 2X7BA 4C8TA 3C8OA 3TLYA 2GFQA 1S7FA 5CNPA 2HB6A 2V8HA 3W91A 3FECA 1SQHA 1BXRB 3ICUA 5F9MA 3SI2A 3SXOA 2Q44A 5K8MA 2V77A 1U6MA 2AFWA 3D7HA 2BL1A 2ZEEA 4NCZA 2UV8G 4BTFA 2G9DA 4RR2B 3FF3A 5D8NA 4Z65A 2ABZA 4M6GA 3FEEA 4A94A 1NBWA 1Q5XA 1TIQA 2AE6A 2ZPAA 5ISVA 4UEFA 3DSBA 2G3TA 4QUSA 4RI1A 3G23A 3ZJ0A 4UEZA 2H5MA 3KKWA 4KNGE 2P6EA 2Q4VA 2DIKA 5EBVA 5JH9A 3H8FA 4NF1A 3TO7A 4C9UA 1H8LA 2EZCA 3NE8A 5LRJA 2A4NA 3D68A 4MJ8A 4COBA 3GLJA 2C6GA 1TF8A 4QB9A 3S6KA 4MXUA 4CAFA 2G0BA 1QMUA 5LYDA 1Y9KA 4CS0B 3B3SA 4XNHB 4FUUA 2IL4A 4MBUA 4E94A 1CPXA 1VHEA 1OZPA 1YMEA 4AB7A 3D2MA 3UY5A 5LYLA 3DNSA 3TO6A 2ZOGA 2B0AA 4MHZA 2CXAA 3DDDA 1WK4A 3T8WA 1YGHA 1NSAA 1XFOA 3K9TA 3B35A 3JUWA 1XOVA 3TOAA 1QSTA 4CAVA 3NOJA 4AVBA 1TKJA 2PJ4A 5AG6A 3RNZA 2VZZA 1V6CA 4CDJA 5BWAB 1XBUA 3PZJA 4BPUB 1ARMA 3GKRA 3PB4X 5JYBA 1TXRA 4R76A 2PIZA 4EVYA 5C88A 1B47A 3F0AA 4OLLA 3BJ7A 3KR4A 3OAKA 3D3SA 3S9LA 4KORA 3BI1A 3WABA 1VKCA 2CNTA 4C8UA 4JYWA 2OZUA 3F5BA 3LACA 3OP0A 1TF9A 3LD2A 2PIYA 1EE3P 2VBQA 4NGQA 2XPPA 2PC1A 2B3VA 3L2NA 2O53A 3TYXA 3TE4A 2EO8A 2YNEA 2V8VA 4IHMA 1Y0RA 1IGBA 3H4QA 1GYTA 1YW4A 2OOTA 4CRYB 2XEFA 1CBXA 4X2TA 2FIWA 2O28A 1JDEA 1CS0B 3BXMA 3B7IA 3K4IA 5F46A 3SXNA 3IWWA 2ZENA 2FSRA 4RS2A 4UFWA 4AG9A 1VHOA 1JDBC 2GU2A 1J4JA 1Z8XA 3TT2A 3PFVA 3ZZIA 1A2ZA 4F9VA 5IB0A 1R43A 3DLJA 4JZ0A 2WYRA 4NGNA 4KVXA 4PXEA 7CPAA 4MHYA 5JGFA 4NGPA 4INJA 1A9XB 3U1BA 2Z10A 1B6BA 5F13A 3F8KA 4UWJA 2J9AA 2NYQA 4Q38A 4H6ZA 4YU9A 2PVVA 2V8DA 1M6VB 2HWGA 4P4IA 3SJEA 4PSWA 3BUWB 4LQ6A 3SJGA 4BMHA 2CTCA 4R87A 1LANA 1BOBA 1LOKA 5H84A 3T9YA 2MP0A 2PJAA 4NEXA 3IIBA 2QIRA 3KQZA 4C2YA 5D29A 4A33A 4LQGA 5A28A 2JDCA 1M4IA 1YQEA 4JWPA 4XPDC 4JVOA 2ZEHA 3VH9A 5HVGA 1HDUA 3T5MA 5K8OA 5JVLA 4MJXA 4UIAA 2GE3A 2GANA 4OC2A 3BHXA 4MFKA 4KZTA 1AUGA 1LRZA 1NMTA 3MN8A 4KLVA 3R96A 1ZRSA 2OR4A 3CXPA 4CO9A 1Y7EA 2PR1A 4JD6A 1CJWA 4PV6A 4TNUA 5A27A 1EZBA 3B2YA 3U88C 2Q4YA 3TLAA 4M85A 3D8PA 2Q7SA 4FD4A 5HH1A 2FVGA 2ODFA 1K4JA 3OB2B 2OB0A 4CAEA 4EYSA 1XE4A 5HVFA 4KUAA 2I3CA 3FEDA 2YJVA 1VHSA 3V8IA 3BUNB 2AFUA 4CRZB 3VTAA 2NMTA 3B3VA 4A30A 2Q04A 2VXKA 3FBUA 2HROA 3TLBA 2PR8A 3FB3A 5F09A 4RN7A 2ZW4A 3SJXA 3DR6A 1M44A 3PP9A 2CIJA 4AXVA 5HVHA 4YGOA 2D4OA 4X8IA 3TLGA 5E96A 2PSWA 2AUMA 2Z3OA 1C30B 4NJQA 1JWQA 3KRVA 3QAYA 4PQAA 4KS9A 3KGQA 3BUOB 1BO4A 4A4BA 3IJ3A 4IUSA 4PK2A 4YRHA 4BBHA 4DJLA 4ZGYB 2EK9A 4E2AA 4MFQA 1XF1A 3T07A 4CAXA 5LYFA 5ELYA 5HKZA 2ZW7A 2C27A 4QVTA 5F47A 4ORFA 2IQ6A 3PEIA 3QB8A 2PJ5A 3GB0A 1YSJA 4KOWA 3TLZA 4XNHC 5LRGA 1KC7A 1LCPA 1S7NA 4COGA 4NGTA 3VRPA 4KOVA 3B3CA 2FT0A 2RB7A 1YREA 4F0XA 1LAPA 2P6GA 1QSNA 2REEA 5AG5A 6CPAA 1LFWA 1XIXA 2Z3NA 5KTAA 4R57A 5G22A 4C8FA 4LX9A 4UF4A 3SJFA 3R95A 2QVPA 2HQYA 2AJ6A 5AG4A 5HMNA 4C9AA 1IY7A 2PJ8A 1AYEA 1ZG9A 3BUXB 2Y1MA 4UCNA 4EWTA 1VI4A 4M6IA 1YVHA 1KWMA 1DE4C 5J8CA 2I00A 1VGYA 1B87A 3I1UA 5G21A 4OMEA 4HKFA 4OC1A 2ZEPA 2ZXVA 3CT9A 4KLWA 3SHPA 3FIXA 2J8MA 5AG7A 4F6AA 2FCKA 4PXDA 1QSMA 2RFHA 4X5KA 3TLGB 2JEWA 2OLSA 3KZWA 4KOTA 2ANPA 4B13A 1ZYMA 3RO0A 4B5PA 2OU2A 4ZY0A 1DTDA 4Y49B 3ISXA 2QMLA 4C86A 3IGRA 1UFHA 5F48A 2FXFA 2DLAA 2WUUA 3CXSA 5K8PA 4OAEA 4CYNA 4DUKA 4U5YA 2VI7A 2C6CA 2EBJA 4WWVA
chains in the Genus database with same CATH topology
3LWUA 3B3WA 1XRYA 1RTQA 4FBEA 3K2KA 3HUVA 3ISZA 2PVWA 4OP4A 4KSIA 2PJ2A 1YLOA 5I4MA 3PRTA 4EFDA 3NA6A 5CPAA 1ARLA 1F57A 2PJ7A 3CDXA 1FNOA 3TC8A 2BO9A 4P4FA 4P10A 4P4DA 4OKOA 1ZG8A 4ZYQA 4C9VA 3RZAA 3WC5A 4C84A 1PYTB 3VARA 2QJ8A 2PJBA 4A38A 3H8EA 2GLJA 3VATA 2ZEGA 2JBKA 5HXDA 4R8FA 2XEJA 3D7FA 4R6TA 4O23A 2ZEOA 2GLFA 4FWUA 4WJBA 4PXBA 3KHXA 2WZNA 4TJXA 3NFZA 3KQXA 3WC6A 1PCAA 5CBMA 8CPAA 1FT7A 3BI0A 2GP4A 4IK2A 3S9MA 4NGRA 2BCOA 1WVMA 4G1PA 4PXCA 1HDQA 4ZX8A 3NH4A 3B3TA 2AFMA 2PJ0A 4MCSA 1TKFA 2NSMA 2Q51A 2EK8A 3FJUA 1CPSA 4OIDA 4MCRA 4OC3A 4OC4A 3FH4A 1JQGA 3LMSA 4DYOA 3D7GA 3H8GA 4X3RA 4FAIA 2PJ3A 4C8CA 4PPZA 1Y0YA 4MMOA 3D7DA 1F2OA 2ZEMA 3FMCA 1Y9ZA 1CP7A 1BPNA 3NH8A 2PRQA 3WT4A 3KHZA 3S9NA 2PJCA 1F2PA 2PE3A 1CX8A 3IC1A 4ONWA 4H2KA 3RBUA 5THWA 1VIXA 2BOAA 2V8GA 4F8ZA 4B6ZA 3MRUA 4ZY1A 1XMBA 2F7VA 2CF4A 4BD9A 4GM5A 2IJZA 1TKHA 2JBJA 2ZEFA 3D4UA 4OC0A 3QNVA 1BAVA 3PB7X 3PBBA 4C9RA 1Z5RA 4A37A 3D66A 2C5QA 2HC9A 3DGVA 3KASA 1ELMP 5J1QA 4C85A 3PBEA 2AFOA 3PFOA 4NGSA 4OIWA 5JM6A 1BPMA 4IAVA 4UEEA 3PB8X 1Q7LA 3JRUA 3CPAA 3NH5A 2QYVA 2C6PA 2IMOA 2AFSA 4EMEA 4C9EA 4R7MA 4P6YA 4MHNA 1HEEA 2POKA 4A39A 2Q43A 2PJ9A 4UIBA 4TWEA 4ZY2A 1ZLHA 3GUXA 4TJVA 1ELLP 2VL1A 3D67A 1UWYA 4F9UA 3FX6A 3I74A 1ZG7A 4MCQA 5IR2A 2ZEDA 4YWYA 3FVLA 3WC7A 1AMPA 4CDJA 5DS0A 2PCUA 2ZOFA 4RUHA 2ZELA 4ZX9A 4C99A 1XJOA 2XEGA 4C8AA 1CG2A 2PJ1A 3PB9X 1Z2LA 4P44A 2EWBA 4NGMA 2DEAA 4NJRA 4P4EA 3PB6X 2AFZA 4P4JA 2CTBA 3KL9A 3TX8A 5LYIA 1M4LA 1ZLIA 1YW6A 4CPAA 4ZI6A 2PJ6A 3IFEA 4K3NA 3KI9A 1CP6A 3SI1A 1QQ9A 4P4BA 4MCPA 2F8HA 5LRKA 2XEIA 2AFXA 5IB9A 3HLPA 3EIFA 3PFEA 3V7ZA 1OBRA 4NFRA 4W9YA 5K8NA 4Q7AA 4C8PA 4OC5A 3IO1A 4YN3A 3SI0A 2O4HA 3KR5A 1R3NA 1LAMA 2Q4ZA 4MHPA 3N5FA 2C1CA 3V38A 1BLLE 1Z8LA 3I6SA 4P45A 3RAMA 4MRIA 2GREA 3CPXA 3IEHA 4C8TA 2HB6A 2V8HA 3FECA 3ICUA 3SI2A 5K8MA 4KNGE 2V77A 2AFWA 3D7HA 2ZEEA 5D8NA 4CDKA 2G9DA 4Z65A 3FF3A 2ABZA 3FEEA 4A94A 4UEFA 4UEZA 5JH9A 3H8FA 1H8LA 5LRJA 3D68A 3GLJA 2C6GA 1TF8A 4MXUA 1QMUA 5LYDA 3B3SA 4FUUA 1CPXA 1VHEA 1YMEA 5LYLA 2ZOGA 4MHZA 3T8WA 1NSAA 1XFOA 3K9TA 3B35A 1V6CA 1TKJA 2PJ4A 1XBUA 1ARMA 3PB4X 1TXRA 4R76A 2PIZA 3WABA 3KR4A 4C8UA 3S9LA 3BI1A 4JYWA 1TF9A 2PIYA 1EE3P 4NGQA 3L2NA 2O53A 2V8VA 4IHMA 1Y0RA 1IGBA 1GYTA 1YW4A 2OOTA 2XEFA 1CBXA 4X2TA 3BXMA 3B7IA 3IWWA 2ZENA 1VHOA 2GU2A 4F9VA 1R43A 3DLJA 4JZ0A 2WYRA 4NGNA 4PXEA 7CPAA 4MHYA 5JGFA 4NGPA 2J9AA 2NYQA 4YU9A 2PVVA 2V8DA 4P4IA 3SJEA 3SJGA 2CTCA 1LANA 1LOKA 2PJAA 3IIBA 3KQZA 5D29A 4LQGA 2ZEHA 3VH9A 5HVGA 1HDUA 5K8OA 4UIAA 4OC2A 3BHXA 3MN8A 2OR4A 1Y7EA 4TNUA 3B2YA 2FVGA 5HVFA 2I3CA 3FEDA 3VTAA 2AFUA 3B3VA 5F09A 3SJXA 5HVHA 4AXVA 2CIJA 4X8IA 4NJQA 4PQAA 3KGQA 3IJ3A 4DJLA 2EK9A 4C9UA 1XF1A 5LYFA 5ELYA 2IQ6A 3PEIA 2PJ5A 3GB0A 1YSJA 5LRGA 1LCPA 4NGTA 3B3CA 2RB7A 1LAPA 6CPAA 1LFWA 4C8FA 4UF4A 3SJFA 2QVPA 4C9AA 1IY7A 2PJ8A 1AYEA 1ZG9A 4EWTA 1KWMA 1DE4C 1VGYA 3I1UA 4OMEA 4OC1A 2ZEPA 3CT9A 4PXDA 2RFHA 2JEWA 3KZWA 2ANPA 4ZY0A 1DTDA 4C86A 3ISXA 5K8PA 4DUKA 2C6CA 4WWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LWU A;  3B3W A;  1XRY A;  1RTQ A;  4FBE A;  3K2K A;  3HUV A;  3ISZ A;  2PVW A;  4OP4 A;  4KSI A;  2PJ2 A;  1YLO A;  5I4M A;  3PRT A;  4EFD A;  3NA6 A;  5CPA A;  1ARL A;  1F57 A;  2PJ7 A;  3CDX A;  1FNO A;  3TC8 A;  2BO9 A;  4P4F A;  4P10 A;  4P4D A;  4OKO A;  1ZG8 A;  4ZYQ A;  4C9V A;  3RZA A;  3WC5 A;  4C84 A;  1PYT B;  3VAR A;  2QJ8 A;  2PJB A;  4A38 A;  3H8E A;  2GLJ A;  3VAT A;  2ZEG A;  2JBK A;  5HXD A;  4R8F A;  2XEJ A;  3D7F A;  4R6T A;  4O23 A;  2ZEO A;  2GLF A;  4FWU A;  4WJB A;  4PXB A;  3KHX A;  2WZN A;  4TJX A;  3NFZ A;  3KQX A;  3WC6 A;  1PCA A;  5CBM A;  8CPA A;  1FT7 A;  3BI0 A;  4IK2 A;  3S9M A;  4NGR A;  2BCO A;  1WVM A;  4G1P A;  4PXC A;  1HDQ A;  4ZX8 A;  3NH4 A;  3B3T A;  2AFM A;  2PJ0 A;  4MCS A;  1TKF A;  2NSM A;  2Q51 A;  2EK8 A;  3FJU A;  1CPS A;  4OID A;  4MCR A;  4OC3 A;  4OC4 A;  3FH4 A;  1JQG A;  3LMS A;  4DYO A;  3D7G A;  3H8G A;  4X3R A;  4FAI A;  2PJ3 A;  4C8C A;  4PPZ A;  1Y0Y A;  4MMO A;  3D7D A;  1F2O A;  2ZEM A;  3FMC A;  1Y9Z A;  1CP7 A;  1BPN A;  3NH8 A;  2PRQ A;  3WT4 A;  3KHZ A;  3S9N A;  2PJC A;  1F2P A;  2PE3 A;  1CX8 A;  3IC1 A;  4ONW A;  4H2K A;  3RBU A;  5THW A;  1VIX A;  2BOA A;  2V8G A;  4F8Z A;  4B6Z A;  3MRU A;  4ZY1 A;  1XMB A;  2F7V A;  2CF4 A;  4BD9 A;  4GM5 A;  2IJZ A;  1TKH A;  2JBJ A;  2ZEF A;  3D4U A;  4OC0 A;  3QNV A;  1BAV A;  3PB7 X;  3PBB A;  4C9R A;  1Z5R A;  4A37 A;  3D66 A;  2HC9 A;  3DGV A;  3KAS A;  1ELM P;  5J1Q A;  4C85 A;  3PBE A;  2AFO A;  3PFO A;  4NGS A;  4OIW A;  5JM6 A;  1BPM A;  4IAV A;  4UEE A;  3PB8 X;  1Q7L A;  3JRU A;  3CPA A;  3NH5 A;  2QYV A;  2C6P A;  2IMO A;  2AFS A;  4EME A;  4C9E A;  4R7M A;  4P6Y A;  4MHN A;  1HEE A;  2POK A;  4A39 A;  2Q43 A;  2PJ9 A;  4UIB A;  4TWE A;  4ZY2 A;  1ZLH A;  3GUX A;  4TJV A;  1ELL P;  2VL1 A;  3D67 A;  1UWY A;  4F9U A;  3FX6 A;  3I74 A;  1ZG7 A;  4MCQ A;  2ZED A;  4YWY A;  3FVL A;  3WC7 A;  1AMP A;  4CDJ A;  5DS0 A;  2PCU A;  2ZOF A;  4RUH A;  2ZEL A;  4ZX9 A;  4C99 A;  1XJO A;  2XEG A;  4C8A A;  1CG2 A;  2PJ1 A;  3PB9 X;  1Z2L A;  4P44 A;  2EWB A;  4NGM A;  2DEA A;  4NJR A;  4P4E A;  3PB6 X;  2AFZ A;  4P4J A;  2CTB A;  3KL9 A;  3TX8 A;  5LYI A;  1M4L A;  1ZLI A;  1YW6 A;  4CPA A;  4ZI6 A;  2PJ6 A;  3IFE A;  4K3N A;  3KI9 A;  1CP6 A;  3SI1 A;  1QQ9 A;  4P4B A;  4MCP A;  2F8H A;  5LRK A;  2XEI A;  2AFX A;  5IB9 A;  3HLP A;  3EIF A;  3PFE A;  3V7Z A;  1OBR A;  4NFR A;  4W9Y A;  5K8N A;  4Q7A A;  4C8P A;  4OC5 A;  3IO1 A;  4YN3 A;  3SI0 A;  2O4H A;  3KR5 A;  1R3N A;  1LAM A;  2Q4Z A;  4MHP A;  3N5F A;  2C1C A;  3V38 A;  1BLL E;  1Z8L A;  3I6S A;  4P45 A;  3RAM A;  4MRI A;  2GRE A;  3CPX A;  3IEH A;  4C8T A;  2HB6 A;  2V8H A;  3FEC A;  3ICU A;  3SI2 A;  5K8M A;  4KNG E;  2V77 A;  2AFW A;  3D7H A;  2ZEE A;  5D8N A;  4CDK A;  2G9D A;  4Z65 A;  3FF3 A;  2ABZ A;  3FEE A;  4A94 A;  4UEF A;  4UEZ A;  5JH9 A;  3H8F A;  1H8L A;  5LRJ A;  3D68 A;  3GLJ A;  2C6G A;  1TF8 A;  4MXU A;  1QMU A;  5LYD A;  3B3S A;  4FUU A;  1CPX A;  1VHE A;  1YME A;  5LYL A;  2ZOG A;  4MHZ A;  3T8W A;  1NSA A;  1XFO A;  3K9T A;  3B35 A;  1V6C A;  1TKJ A;  2PJ4 A;  1XBU A;  1ARM A;  3PB4 X;  1TXR A;  4R76 A;  2PIZ A;  3WAB A;  3KR4 A;  4C8U A;  3S9L A;  3BI1 A;  4JYW A;  1TF9 A;  2PIY A;  1EE3 P;  4NGQ A;  3L2N A;  2O53 A;  2V8V A;  4IHM A;  1Y0R A;  1IGB A;  1GYT A;  1YW4 A;  2OOT A;  2XEF A;  1CBX A;  4X2T A;  3BXM A;  3B7I A;  3IWW A;  2ZEN A;  1VHO A;  2GU2 A;  4F9V A;  1R43 A;  3DLJ A;  4JZ0 A;  2WYR A;  4NGN A;  4PXE A;  7CPA A;  4MHY A;  5JGF A;  4NGP A;  2J9A A;  2NYQ A;  4YU9 A;  2PVV A;  2V8D A;  4P4I A;  3SJE A;  3SJG A;  2CTC A;  1LAN A;  1LOK A;  2PJA A;  3IIB A;  3KQZ A;  5D29 A;  4LQG A;  2ZEH A;  3VH9 A;  5HVG A;  1HDU A;  5K8O A;  4UIA A;  4OC2 A;  3BHX A;  3MN8 A;  2OR4 A;  1Y7E A;  4TNU A;  3B2Y A;  2FVG A;  5HVF A;  2I3C A;  3FED A;  3VTA A;  2AFU A;  3B3V A;  5F09 A;  3SJX A;  5HVH A;  4AXV A;  2CIJ A;  4X8I A;  4NJQ A;  4PQA A;  3KGQ A;  3IJ3 A;  4DJL A;  2EK9 A;  4C9U A;  1XF1 A;  5LYF A;  5ELY A;  2IQ6 A;  3PEI A;  2PJ5 A;  3GB0 A;  1YSJ A;  5LRG A;  1LCP A;  4NGT A;  3B3C A;  2RB7 A;  1LAP A;  6CPA A;  1LFW A;  4C8F A;  4UF4 A;  3SJF A;  2QVP A;  4C9A A;  1IY7 A;  2PJ8 A;  1AYE A;  1ZG9 A;  4EWT A;  1KWM A;  1DE4 C;  1VGY A;  3I1U A;  4OME A;  4OC1 A;  2ZEP A;  3CT9 A;  4PXD A;  2RFH A;  2JEW A;  3KZW A;  2ANP A;  4ZY0 A;  1DTD A;  4C86 A;  3ISX A;  5K8P A;  4DUK A;  2C6C A;  4WWV A; 
#chains in the Genus database with same CATH topology
 1IID A;  5F5X A;  3FRM A;  3LWU A;  2Q0Y A;  3B3W A;  2VQY A;  1XRY A;  4MI4 A;  1RTQ A;  2B4D B;  1WWZ A;  1NXJ A;  4FBE A;  1FY7 A;  2FL4 A;  3TLE A;  5KTD A;  3K2K A;  3HUV A;  5G1Z A;  3ISZ A;  2PVW A;  4IIX A;  4E0A A;  4OP4 A;  4M3S A;  4KSI A;  2OH1 A;  1YLO A;  2PJ2 A;  4ONU A;  1M4D A;  4CGM A;  5I4M A;  3PRT A;  4EFD A;  4E8O A;  3NA6 A;  5CPA A;  1ARL A;  1ON0 A;  4KSF A;  1F57 A;  2FE7 A;  2PJ7 A;  2RC4 A;  1Q2D A;  3CDX A;  2EUI A;  1FNO A;  3TC8 A;  2I79 A;  3FXT A;  4CAW A;  2BO9 A;  3GYA A;  4P4F A;  4P10 A;  4P4D A;  4OKO A;  4UA3 A;  1ZG8 A;  4C7I A;  4ZYQ A;  4C9V A;  3RZA A;  3WC5 A;  4C84 A;  4A4C A;  1PYT B;  1YVO A;  2QJ8 A;  4H6U A;  2PJB A;  3VAR A;  4XPL A;  4A38 A;  3P2F A;  3H8E A;  2GLJ A;  2XPO A;  2R7H A;  3D2P A;  4PSX A;  4KVO E;  4U9Z A;  3R9E A;  3VAT A;  4CGO A;  3VWE A;  3CXQ A;  4CYO A;  2ZEG A;  2JBK A;  5HXD A;  1Z8T A;  4R8F A;  2B58 A;  2XEJ A;  3PLF B;  5BY0 A;  4A32 A;  4BIN A;  1EZA A;  3D7F A;  4MFJ A;  2YNC C;  4R6T A;  4O23 A;  1XMT A;  5IX3 A;  1S60 A;  3EO4 A;  4NXY A;  2ZEO A;  2GLF A;  3GY9 A;  4MY0 A;  4FWU A;  4MFL A;  4WJB A;  4PXB A;  2HV2 A;  3EC4 A;  3KHX A;  1KBL A;  2WZN A;  4TJX A;  1Q2C A;  2PDO A;  3EFA A;  2EVN A;  3NFZ A;  4IIY A;  5DWM A;  3KQX A;  5K99 A;  3JTK A;  3WC6 A;  1PCA A;  4BPX B;  5CBM A;  8CPA A;  2XPN A;  1FT7 A;  3BI0 A;  2R1I A;  3PGP A;  4MHD A;  2Y1N A;  1V0C A;  3K9U A;  4K30 A;  3R1K A;  2GP4 A;  2FS5 A;  4NGR A;  3S9M A;  3JVN A;  4IK2 A;  3R9F A;  2BCO A;  2CNS A;  3I3G A;  1WVM A;  2D0P A;  4G1P A;  4PXC A;  4MI1 A;  1MJB A;  3HPG G;  2B5G A;  1HDQ A;  4ZX8 A;  3NH4 A;  3B3T A;  2J8N A;  5G20 A;  4ZBG A;  3T05 A;  2AFM A;  2PJ0 A;  4MCS A;  1TKF A;  2NSM A;  1QSO A;  2Q51 A;  2EK8 A;  2R8V A;  3FJU A;  1CPS A;  4OID A;  4KVM E;  2EZA A;  1KEE B;  1I21 A;  4OAD A;  3OB1 B;  4MCR A;  3IU2 A;  5KTC A;  4HPS A;  1MJ9 A;  2REF A;  4KOS A;  4OC3 A;  4OC4 A;  3TFY A;  1M1D A;  3FH4 A;  2BEI A;  1JQG A;  1S7K A;  3LMS A;  4DYO A;  3D7G A;  3H8G A;  2F5I A;  4YFJ A;  2N3A B;  2G3A A;  3N7Z A;  3I9S A;  2R98 A;  4X3R A;  1IOI A;  4UBR A;  1Z4R A;  2BUE A;  5H86 A;  3W6S A;  1EO0 A;  5GCN A;  4FAI A;  3A9L A;  2PJ3 A;  4C8C A;  4PPZ A;  4CYP A;  1Y0Y A;  3D7D A;  1IB1 E;  1F2O A;  2DF5 A;  2ZEM A;  3FMC A;  4MMO A;  4II9 A;  4JXQ A;  1CP7 A;  1BPN A;  3QAH A;  2CNM A;  4L89 A;  2AUN A;  5IV0 A;  3VRN A;  3NH8 A;  4FD6 A;  4JLY A;  5J3X A;  1VBG A;  2PRQ A;  3WT4 A;  4B10 A;  3KHZ A;  1NSL A;  1KUX A;  2XPL A;  1S5K A;  4UFV A;  3S9N A;  4F0Y A;  2D0O A;  3W6X A;  4B14 A;  3BLN A;  2PJC A;  2Z3M A;  4QC6 A;  1F2P A;  4CGN A;  1VBH A;  2JEV A;  2PE3 A;  3FYN A;  1CX8 A;  3IC1 A;  4ONW A;  4H2K A;  3RBU A;  4H89 A;  5THW A;  1VIX A;  3PT1 A;  2BOA A;  2V8G A;  4F8Z A;  1CE8 B;  4B6Z A;  5EC4 A;  2YJT A;  3MRU A;  4ZY1 A;  1XMB A;  2F7V A;  1Y7R A;  3LOD A;  2CF4 A;  4BD9 A;  4XPK A;  4GM5 A;  1YK3 A;  1RXT A;  4UCM A;  4Y49 C;  1FBV A;  2OZH A;  4NSQ A;  1XF8 A;  2IJZ A;  3FNC A;  4R3K A;  2E28 A;  1TKH A;  4GPL B;  1Q2Y A;  2JBJ A;  2ZEF A;  3RYO A;  1IYL A;  2B4B A;  4OC0 A;  3D4U A;  3QNV A;  2X0S A;  3VRR A;  1BAV A;  3PB7 X;  3PBB A;  4HNY B;  4C9R A;  1Z5R A;  4Q36 A;  4A37 A;  3D66 A;  1J3L A;  2C5Q A;  2VKZ G;  2HC9 A;  5FD8 A;  4C68 A;  2PCN A;  1X12 A;  2Z3L A;  2Z3K A;  3DGV A;  3KAS A;  4M8D A;  1KUY A;  2ATR A;  3HPH E;  4AVA A;  1DIK A;  4QBJ A;  1ELM P;  5J1Q A;  4C85 A;  1R57 A;  3PBE A;  5JQ4 A;  2AFO A;  3PFO A;  4NGS A;  4OIW A;  2B5G B;  3MGD A;  5JM6 A;  3O8Z A;  1BPM A;  3HMJ G;  2K5T A;  1MK4 A;  1M4G A;  2Z3P A;  3CZX A;  4IAV A;  4UEE A;  3PB8 X;  1Q7L A;  3JRU A;  3CPA A;  3NH5 A;  2QYV A;  2C6P A;  2IMO A;  4B11 A;  2AFS A;  2Z0Z A;  5F49 A;  4EME A;  4C9E A;  4MFZ A;  3T0T A;  3BUM B;  4GS4 A;  5AXI A;  1YVK A;  2YNC A;  4R7M A;  3VGO A;  4MHN A;  1HEE A;  4P6Y A;  4B12 A;  3EZE A;  1P0H A;  4JXR A;  2POK A;  4A39 A;  4L8A A;  2KCW A;  3VRQ A;  1IOF A;  2Q43 A;  4J3G A;  5HKW A;  1N71 A;  1X10 A;  2PJ9 A;  2ZW6 A;  4R9M A;  4UIB A;  4TWE A;  4ZY2 A;  1ZLH A;  1RO5 A;  2Z11 A;  2ZW5 A;  3GUX A;  3S6G A;  2EZB A;  4TJV A;  1ELL P;  2VL1 A;  3D67 A;  5HKY A;  3G3S A;  3GJZ A;  3DR8 A;  3NE7 A;  1UWY A;  2YGW A;  2HI6 A;  4F9U A;  3VRO A;  3FX6 A;  1PU9 A;  1XEB A;  3I74 A;  1ZG7 A;  2OZG A;  3S6F A;  3EXN A;  4C2X A;  4MCQ A;  4XPD B;  1IU8 A;  1T36 B;  3TOB A;  3WR7 A;  4C2Z A;  1IIC A;  1I1D A;  5IR2 A;  2Y0M A;  1Y9W A;  2ZED A;  3EZA A;  4YWY A;  3SR3 A;  4KOX A;  3FVL A;  3IU1 A;  4LUA A;  4CDK A;  1PUA A;  2JLM A;  4CGP A;  1YR0 A;  3WC7 A;  1AMP A;  1WJT A;  3E0K A;  3P2H A;  4KUB A;  4R3L A;  5DS0 A;  5J8F A;  2PCU A;  4J0N A;  1Z9U A;  1Z9E A;  2ZOF A;  5C82 A;  4RUH A;  2ZEL A;  1IYK A;  4ZX9 A;  4IF5 A;  4C99 A;  2HUZ A;  2WSA A;  3T90 A;  5JPH A;  1XJO A;  4GXH A;  2CBL A;  4C7H A;  2XEG A;  3R9G A;  2P0W A;  4C8A A;  2DPS A;  3C26 A;  1GGO A;  4JJX A;  1CG2 A;  2PJ1 A;  1KUV A;  3TLC A;  1S3Z A;  4UFX A;  3PB9 X;  1YLE A;  1S7L A;  4A2Z A;  1Z2L A;  4E5S A;  3TTH A;  2B3U A;  4P44 A;  2EWB A;  4NGM A;  3S6H A;  3VWD A;  4CYQ A;  2DEA A;  2JDD A;  4NJR A;  2R82 A;  1NE9 A;  4P4E A;  3PB6 X;  2AFZ A;  4P4J A;  1QSR A;  2WPW A;  3ZNI A;  5EMI A;  2YND A;  2CTB A;  3KL9 A;  3TX8 A;  5LYI A;  2P6F A;  4B5P B;  3B8G A;  2FM4 A;  4MFP A;  1M4L A;  1ZLI A;  1YW6 A;  3G8W A;  2B4J C;  4CPA A;  2PJ6 A;  3IFE A;  4AVC A;  2PQ8 A;  4ZI6 A;  3EZB A;  2WPX A;  4HNW B;  4K3N A;  3KI9 A;  2VEZ A;  4BPW B;  1CP6 A;  1P4N A;  2QEC A;  3SI1 A;  1QQ9 A;  2DPT A;  4P4B A;  2FIA A;  1L0C A;  4MCP A;  2F8H A;  3EY5 A;  4KSA A;  2CY2 A;  4UWI A;  3TCV A;  4KOY A;  3IWG A;  2Q7B A;  4A31 A;  5LRK A;  2XEI A;  2AFX A;  1YX0 A;  4UCP A;  1I12 A;  3HLP A;  5IB9 A;  3EIF A;  3PFE A;  1Z4E A;  3V7Z A;  3BJ8 A;  1OBR A;  4NFR A;  5AGE A;  5F1Y A;  3TO9 A;  4W9Y A;  2PRB A;  2D4P A;  3IWE A;  5K8N A;  4Q7A A;  1GHE A;  1MJA A;  1Y9Z A;  4U9Y A;  4AG7 A;  4MY3 A;  5I0C A;  4KOU A;  4C8P A;  4OC5 A;  5FVJ A;  4DNC A;  1C3O B;  4A95 A;  3IO1 A;  1CM0 A;  4YN3 A;  4HNX B;  3OWC A;  3SI0 A;  2O4H A;  4CZ1 A;  3KR5 A;  4H1H A;  1R3N A;  2B4D A;  1LAM A;  2GIV A;  2J8R A;  4CGL A;  3H5Z A;  1R61 A;  2Q4Z A;  4MHP A;  2ARH A;  3N5F A;  4I49 A;  4M6H A;  4FD7 A;  2C1C A;  1ZL0 A;  3NFQ A;  2DXQ A;  1Z8W A;  3V38 A;  1BLL E;  5DWN A;  4PK3 A;  1Z8L A;  1ZO0 A;  2BSW A;  3GIU A;  3I6S A;  4P45 A;  3RAM A;  4B5O A;  4MRI A;  1KZF A;  2GRE A;  4FD5 A;  3CPX A;  3IEH A;  3F9K C;  2VZY A;  2X7B A;  4C8T A;  3C8O A;  3TLY A;  2GFQ A;  1S7F A;  5CNP A;  2HB6 A;  2V8H A;  3W91 A;  3FEC A;  1SQH A;  1BXR B;  3ICU A;  5F9M A;  3SI2 A;  3SXO A;  2Q44 A;  5K8M A;  2V77 A;  1U6M A;  2AFW A;  3D7H A;  2BL1 A;  2ZEE A;  4NCZ A;  2UV8 G;  4BTF A;  2G9D A;  4RR2 B;  3FF3 A;  5D8N A;  4Z65 A;  2ABZ A;  4M6G A;  3FEE A;  4A94 A;  1NBW A;  1Q5X A;  1TIQ A;  2AE6 A;  2ZPA A;  5ISV A;  4UEF A;  3DSB A;  2G3T A;  4QUS A;  4RI1 A;  3G23 A;  3ZJ0 A;  4UEZ A;  2H5M A;  3KKW A;  4KNG E;  2P6E A;  2Q4V A;  2DIK A;  5EBV A;  5JH9 A;  3H8F A;  4NF1 A;  3TO7 A;  4C9U A;  1H8L A;  2EZC A;  3NE8 A;  5LRJ A;  2A4N A;  3D68 A;  4MJ8 A;  4COB A;  3GLJ A;  2C6G A;  1TF8 A;  4QB9 A;  3S6K A;  4MXU A;  4CAF A;  2G0B A;  1QMU A;  5LYD A;  1Y9K A;  4CS0 B;  3B3S A;  4XNH B;  4FUU A;  2IL4 A;  4MBU A;  4E94 A;  1CPX A;  1VHE A;  1OZP A;  1YME A;  4AB7 A;  3D2M A;  3UY5 A;  5LYL A;  3DNS A;  3TO6 A;  2ZOG A;  2B0A A;  4MHZ A;  2CXA A;  3DDD A;  1WK4 A;  3T8W A;  1YGH A;  1NSA A;  1XFO A;  3K9T A;  3B35 A;  3JUW A;  1XOV A;  3TOA A;  1QST A;  4CAV A;  3NOJ A;  4AVB A;  1TKJ A;  2PJ4 A;  5AG6 A;  3RNZ A;  2VZZ A;  1V6C A;  4CDJ A;  5BWA B;  1XBU A;  3PZJ A;  4BPU B;  1ARM A;  3GKR A;  3PB4 X;  5JYB A;  1TXR A;  4R76 A;  2PIZ A;  4EVY A;  5C88 A;  1B47 A;  3F0A A;  4OLL A;  3BJ7 A;  3KR4 A;  3OAK A;  3D3S A;  3S9L A;  4KOR A;  3BI1 A;  3WAB A;  1VKC A;  2CNT A;  4C8U A;  4JYW A;  2OZU A;  3F5B A;  3LAC A;  3OP0 A;  1TF9 A;  3LD2 A;  2PIY A;  1EE3 P;  2VBQ A;  4NGQ A;  2XPP A;  2PC1 A;  2B3V A;  3L2N A;  2O53 A;  3TYX A;  3TE4 A;  2EO8 A;  2YNE A;  2V8V A;  4IHM A;  1Y0R A;  1IGB A;  3H4Q A;  1GYT A;  1YW4 A;  2OOT A;  4CRY B;  2XEF A;  1CBX A;  4X2T A;  2FIW A;  2O28 A;  1JDE A;  1CS0 B;  3BXM A;  3B7I A;  3K4I A;  5F46 A;  3SXN A;  3IWW A;  2ZEN A;  2FSR A;  4RS2 A;  4UFW A;  4AG9 A;  1VHO A;  1JDB C;  2GU2 A;  1J4J A;  1Z8X A;  3TT2 A;  3PFV A;  3ZZI A;  1A2Z A;  4F9V A;  5IB0 A;  1R43 A;  3DLJ A;  4JZ0 A;  2WYR A;  4NGN A;  4KVX A;  4PXE A;  7CPA A;  4MHY A;  5JGF A;  4NGP A;  4INJ A;  1A9X B;  3U1B A;  2Z10 A;  1B6B A;  5F13 A;  3F8K A;  4UWJ A;  2J9A A;  2NYQ A;  4Q38 A;  4H6Z A;  4YU9 A;  2PVV A;  2V8D A;  1M6V B;  2HWG A;  4P4I A;  3SJE A;  4PSW A;  3BUW B;  4LQ6 A;  3SJG A;  4BMH A;  2CTC A;  4R87 A;  1LAN A;  1BOB A;  1LOK A;  5H84 A;  3T9Y A;  2MP0 A;  2PJA A;  4NEX A;  3IIB A;  2QIR A;  3KQZ A;  4C2Y A;  5D29 A;  4A33 A;  4LQG A;  5A28 A;  2JDC A;  1M4I A;  1YQE A;  4JWP A;  4XPD C;  4JVO A;  2ZEH A;  3VH9 A;  5HVG A;  1HDU A;  3T5M A;  5K8O A;  5JVL A;  4MJX A;  4UIA A;  2GE3 A;  2GAN A;  4OC2 A;  3BHX A;  4MFK A;  4KZT A;  1AUG A;  1LRZ A;  1NMT A;  3MN8 A;  4KLV A;  3R96 A;  1ZRS A;  2OR4 A;  3CXP A;  4CO9 A;  1Y7E A;  2PR1 A;  4JD6 A;  1CJW A;  4PV6 A;  4TNU A;  5A27 A;  1EZB A;  3B2Y A;  3U88 C;  2Q4Y A;  3TLA A;  4M85 A;  3D8P A;  2Q7S A;  4FD4 A;  5HH1 A;  2FVG A;  2ODF A;  1K4J A;  3OB2 B;  2OB0 A;  4CAE A;  4EYS A;  1XE4 A;  5HVF A;  4KUA A;  2I3C A;  3FED A;  2YJV A;  1VHS A;  3V8I A;  3BUN B;  2AFU A;  4CRZ B;  3VTA A;  2NMT A;  3B3V A;  4A30 A;  2Q04 A;  2VXK A;  3FBU A;  2HRO A;  3TLB A;  2PR8 A;  3FB3 A;  5F09 A;  4RN7 A;  2ZW4 A;  3SJX A;  3DR6 A;  1M44 A;  3PP9 A;  2CIJ A;  4AXV A;  5HVH A;  4YGO A;  2D4O A;  4X8I A;  3TLG A;  5E96 A;  2PSW A;  2AUM A;  2Z3O A;  1C30 B;  4NJQ A;  1JWQ A;  3KRV A;  3QAY A;  4PQA A;  4KS9 A;  3KGQ A;  3BUO B;  1BO4 A;  4A4B A;  3IJ3 A;  4IUS A;  4PK2 A;  4YRH A;  4BBH A;  4DJL A;  4ZGY B;  2EK9 A;  4E2A A;  4MFQ A;  1XF1 A;  3T07 A;  4CAX A;  5LYF A;  5ELY A;  5HKZ A;  2ZW7 A;  2C27 A;  4QVT A;  5F47 A;  4ORF A;  2IQ6 A;  3PEI A;  3QB8 A;  2PJ5 A;  3GB0 A;  1YSJ A;  4KOW A;  3TLZ A;  4XNH C;  5LRG A;  1KC7 A;  1LCP A;  1S7N A;  4COG A;  4NGT A;  3VRP A;  4KOV A;  3B3C A;  2FT0 A;  2RB7 A;  1YRE A;  4F0X A;  1LAP A;  2P6G A;  1QSN A;  2REE A;  5AG5 A;  6CPA A;  1LFW A;  1XIX A;  2Z3N A;  5KTA A;  4R57 A;  5G22 A;  4C8F A;  4LX9 A;  4UF4 A;  3SJF A;  3R95 A;  2QVP A;  2HQY A;  2AJ6 A;  5AG4 A;  5HMN A;  4C9A A;  1IY7 A;  2PJ8 A;  1AYE A;  1ZG9 A;  3BUX B;  2Y1M A;  4UCN A;  4EWT A;  1VI4 A;  4M6I A;  1YVH A;  1KWM A;  1DE4 C;  5J8C A;  2I00 A;  1VGY A;  1B87 A;  3I1U A;  5G21 A;  4OME A;  4HKF A;  4OC1 A;  2ZEP A;  2ZXV A;  3CT9 A;  4KLW A;  3SHP A;  3FIX A;  2J8M A;  5AG7 A;  4F6A A;  2FCK A;  4PXD A;  1QSM A;  2RFH A;  4X5K A;  3TLG B;  2JEW A;  2OLS A;  3KZW A;  4KOT A;  2ANP A;  4B13 A;  1ZYM A;  3RO0 A;  4B5P A;  2OU2 A;  4ZY0 A;  1DTD A;  4Y49 B;  3ISX A;  2QML A;  4C86 A;  3IGR A;  1UFH A;  5F48 A;  2FXF A;  2DLA A;  2WUU A;  3CXS A;  5K8P A;  4OAE A;  4CYN A;  4DUK A;  4U5Y A;  2VI7 A;  2C6C A;  2EBJ A;  4WWV A; 
#chains in the Genus database with same CATH homology
 3LWU A;  3B3W A;  1XRY A;  1RTQ A;  4FBE A;  3K2K A;  3HUV A;  3ISZ A;  2PVW A;  4OP4 A;  4KSI A;  2PJ2 A;  1YLO A;  5I4M A;  3PRT A;  4EFD A;  3NA6 A;  5CPA A;  1ARL A;  1F57 A;  2PJ7 A;  3CDX A;  1FNO A;  3TC8 A;  2BO9 A;  4P4F A;  4P10 A;  4P4D A;  4OKO A;  1ZG8 A;  4ZYQ A;  4C9V A;  3RZA A;  3WC5 A;  4C84 A;  1PYT B;  3VAR A;  2QJ8 A;  2PJB A;  4A38 A;  3H8E A;  2GLJ A;  3VAT A;  2ZEG A;  2JBK A;  5HXD A;  4R8F A;  2XEJ A;  3D7F A;  4R6T A;  4O23 A;  2ZEO A;  2GLF A;  4FWU A;  4WJB A;  4PXB A;  3KHX A;  2WZN A;  4TJX A;  3NFZ A;  3KQX A;  3WC6 A;  1PCA A;  5CBM A;  8CPA A;  1FT7 A;  3BI0 A;  2GP4 A;  4IK2 A;  3S9M A;  4NGR A;  2BCO A;  1WVM A;  4G1P A;  4PXC A;  1HDQ A;  4ZX8 A;  3NH4 A;  3B3T A;  2AFM A;  2PJ0 A;  4MCS A;  1TKF A;  2NSM A;  2Q51 A;  2EK8 A;  3FJU A;  1CPS A;  4OID A;  4MCR A;  4OC3 A;  4OC4 A;  3FH4 A;  1JQG A;  3LMS A;  4DYO A;  3D7G A;  3H8G A;  4X3R A;  4FAI A;  2PJ3 A;  4C8C A;  4PPZ A;  1Y0Y A;  4MMO A;  3D7D A;  1F2O A;  2ZEM A;  3FMC A;  1Y9Z A;  1CP7 A;  1BPN A;  3NH8 A;  2PRQ A;  3WT4 A;  3KHZ A;  3S9N A;  2PJC A;  1F2P A;  2PE3 A;  1CX8 A;  3IC1 A;  4ONW A;  4H2K A;  3RBU A;  5THW A;  1VIX A;  2BOA A;  2V8G A;  4F8Z A;  4B6Z A;  3MRU A;  4ZY1 A;  1XMB A;  2F7V A;  2CF4 A;  4BD9 A;  4GM5 A;  2IJZ A;  1TKH A;  2JBJ A;  2ZEF A;  3D4U A;  4OC0 A;  3QNV A;  1BAV A;  3PB7 X;  3PBB A;  4C9R A;  1Z5R A;  4A37 A;  3D66 A;  2C5Q A;  2HC9 A;  3DGV A;  3KAS A;  1ELM P;  5J1Q A;  4C85 A;  3PBE A;  2AFO A;  3PFO A;  4NGS A;  4OIW A;  5JM6 A;  1BPM A;  4IAV A;  4UEE A;  3PB8 X;  1Q7L A;  3JRU A;  3CPA A;  3NH5 A;  2QYV A;  2C6P A;  2IMO A;  2AFS A;  4EME A;  4C9E A;  4R7M A;  4P6Y A;  4MHN A;  1HEE A;  2POK A;  4A39 A;  2Q43 A;  2PJ9 A;  4UIB A;  4TWE A;  4ZY2 A;  1ZLH A;  3GUX A;  4TJV A;  1ELL P;  2VL1 A;  3D67 A;  1UWY A;  4F9U A;  3FX6 A;  3I74 A;  1ZG7 A;  4MCQ A;  5IR2 A;  2ZED A;  4YWY A;  3FVL A;  3WC7 A;  1AMP A;  4CDJ A;  5DS0 A;  2PCU A;  2ZOF A;  4RUH A;  2ZEL A;  4ZX9 A;  4C99 A;  1XJO A;  2XEG A;  4C8A A;  1CG2 A;  2PJ1 A;  3PB9 X;  1Z2L A;  4P44 A;  2EWB A;  4NGM A;  2DEA A;  4NJR A;  4P4E A;  3PB6 X;  2AFZ A;  4P4J A;  2CTB A;  3KL9 A;  3TX8 A;  5LYI A;  1M4L A;  1ZLI A;  1YW6 A;  4CPA A;  4ZI6 A;  2PJ6 A;  3IFE A;  4K3N A;  3KI9 A;  1CP6 A;  3SI1 A;  1QQ9 A;  4P4B A;  4MCP A;  2F8H A;  5LRK A;  2XEI A;  2AFX A;  5IB9 A;  3HLP A;  3EIF A;  3PFE A;  3V7Z A;  1OBR A;  4NFR A;  4W9Y A;  5K8N A;  4Q7A A;  4C8P A;  4OC5 A;  3IO1 A;  4YN3 A;  3SI0 A;  2O4H A;  3KR5 A;  1R3N A;  1LAM A;  2Q4Z A;  4MHP A;  3N5F A;  2C1C A;  3V38 A;  1BLL E;  1Z8L A;  3I6S A;  4P45 A;  3RAM A;  4MRI A;  2GRE A;  3CPX A;  3IEH A;  4C8T A;  2HB6 A;  2V8H A;  3FEC A;  3ICU A;  3SI2 A;  5K8M A;  4KNG E;  2V77 A;  2AFW A;  3D7H A;  2ZEE A;  5D8N A;  4CDK A;  2G9D A;  4Z65 A;  3FF3 A;  2ABZ A;  3FEE A;  4A94 A;  4UEF A;  4UEZ A;  5JH9 A;  3H8F A;  1H8L A;  5LRJ A;  3D68 A;  3GLJ A;  2C6G A;  1TF8 A;  4MXU A;  1QMU A;  5LYD A;  3B3S A;  4FUU A;  1CPX A;  1VHE A;  1YME A;  5LYL A;  2ZOG A;  4MHZ A;  3T8W A;  1NSA A;  1XFO A;  3K9T A;  3B35 A;  1V6C A;  1TKJ A;  2PJ4 A;  1XBU A;  1ARM A;  3PB4 X;  1TXR A;  4R76 A;  2PIZ A;  3WAB A;  3KR4 A;  4C8U A;  3S9L A;  3BI1 A;  4JYW A;  1TF9 A;  2PIY A;  1EE3 P;  4NGQ A;  3L2N A;  2O53 A;  2V8V A;  4IHM A;  1Y0R A;  1IGB A;  1GYT A;  1YW4 A;  2OOT A;  2XEF A;  1CBX A;  4X2T A;  3BXM A;  3B7I A;  3IWW A;  2ZEN A;  1VHO A;  2GU2 A;  4F9V A;  1R43 A;  3DLJ A;  4JZ0 A;  2WYR A;  4NGN A;  4PXE A;  7CPA A;  4MHY A;  5JGF A;  4NGP A;  2J9A A;  2NYQ A;  4YU9 A;  2PVV A;  2V8D A;  4P4I A;  3SJE A;  3SJG A;  2CTC A;  1LAN A;  1LOK A;  2PJA A;  3IIB A;  3KQZ A;  5D29 A;  4LQG A;  2ZEH A;  3VH9 A;  5HVG A;  1HDU A;  5K8O A;  4UIA A;  4OC2 A;  3BHX A;  3MN8 A;  2OR4 A;  1Y7E A;  4TNU A;  3B2Y A;  2FVG A;  5HVF A;  2I3C A;  3FED A;  3VTA A;  2AFU A;  3B3V A;  5F09 A;  3SJX A;  5HVH A;  4AXV A;  2CIJ A;  4X8I A;  4NJQ A;  4PQA A;  3KGQ A;  3IJ3 A;  4DJL A;  2EK9 A;  4C9U A;  1XF1 A;  5LYF A;  5ELY A;  2IQ6 A;  3PEI A;  2PJ5 A;  3GB0 A;  1YSJ A;  5LRG A;  1LCP A;  4NGT A;  3B3C A;  2RB7 A;  1LAP A;  6CPA A;  1LFW A;  4C8F A;  4UF4 A;  3SJF A;  2QVP A;  4C9A A;  1IY7 A;  2PJ8 A;  1AYE A;  1ZG9 A;  4EWT A;  1KWM A;  1DE4 C;  1VGY A;  3I1U A;  4OME A;  4OC1 A;  2ZEP A;  3CT9 A;  4PXD A;  2RFH A;  2JEW A;  3KZW A;  2ANP A;  4ZY0 A;  1DTD A;  4C86 A;  3ISX A;  5K8P A;  4DUK A;  2C6C A;  4WWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...