4MCSA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) his475tyr variant in complex with glutamic acid
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVYNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 266
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcsA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcsA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcsA02
4C9EA 4MCPA 1Y9ZA 3FF3A 3WC7A 4C86A 1XFOA 1FT7A 4G1PA 3I6SA 4Z65A 3FH4A 1QQ9A 1VHEA 4C85A 4ZY2A 1LFWA 5LRGA 4R8FA 1HDQA 5K8MA 4LQGA 3B3CA 3IEHA 2EWBA 4KSIA 4X8IA 1IGBA 2RB7A 3BXMA 2AFOA 2QYVA 2RFHA 2V8VA 3FECA 4C8TA 1ZLIA 1YLOA 3DLJA 2ANPA 3NA6A 1F57A 1JQGA 1ARLA 3BI1A 2ZEEA 3B35A 5ELYA 4KNGE 3B3WA 4B6ZA 4P4IA 3KR5A 2IQ6A 1BPMA 5J1QA 4PXEA 5D8NA 2F8HA 4YWYA 1OBRA 1YSJA 2PJBA 3IJ3A 4MHYA 2V8DA 4PXCA 3GUXA 1V6CA 3LMSA 1LAPA 1BLLE 1R3NA 1ZLHA 3KZWA 4WJBA 4UIAA 2BOAA 5HVHA 4NGSA 1LCPA 1Y0RA 3GB0A 1EE3P 1XRYA 3KR4A 1CX8A 4P4FA 1TKJA 3KQXA 1GYTA 3CPXA 1CBXA 3SJFA 3WABA 3WC6A 4OC5A 2J9AA 4UF4A 4UEEA 3SI0A 2PJ3A 2Q51A 3IIBA 2PE3A 2ZEFA 2PJCA 4MMOA 1Y7EA 3B3TA 2C6CA 2QJ8A 3SI2A 5IB9A 3ISZA 4Q7AA 4MCSA 3FX6A 1XJOA 3PB8X 4P6YA 2PJ7A 4OC1A 1ARMA 1ZG8A 1Z8LA 2PJ5A 4OP4A 2PIYA 4PXBA 3H8EA 4F9VA 5CBMA 4OC4A 1XF1A 4EWTA 4FAIA 2DEAA 3K2KA 4F8ZA 5F09A 4OIDA 2PJ1A 4WWVA 1AMPA 2PJ0A 2JEWA 1WVMA 1Z5RA 4NGMA 4ZY1A 2ZEPA 5HXDA 3SJXA 2POKA 3B7IA 2VL1A 3NH4A 5LYFA 2C1CA 1Q7LA 3ICUA 3WT4A 3NH5A 2CTCA 3T8WA 1F2PA 4OKOA 3RBUA 2EK9A 3NH8A 2HB6A 2HC9A 2F7VA 3KGQA 5HVGA 1VGYA 2AFXA 3RAMA 4ZX8A 3KL9A 3QNVA 1CPSA 7CPAA 4C8UA 3ISXA 2IMOA 2PJAA 3B2YA 3EIFA 4ZX9A 3FEEA 2ZEHA 3L2NA 4IHMA 4C8PA 2ZEGA 4CDKA 2PJ4A 1CG2A 1TKHA 3S9LA 1H8LA 4AXVA 3VH9A 3GLJA 4P10A 3FJUA 3PB9X 2ZEMA 3S9NA 1LANA 4ZYQA 2ABZA 3PFOA 5K8OA 5DS0A 5JH9A 3IO1A 1Z2LA 1HDUA 3PEIA 4UIBA 3I1UA 5I4MA 4A38A 1DE4C 3CT9A 4H2KA 4MCRA 3PB7X 3TC8A 6CPAA 4IAVA 2PVVA 1LOKA 1CPXA 2GU2A 2G9DA 4A37A 4P4EA 2IJZA 3FMCA 4C9RA 4MCQA 3HLPA 1YW4A 2CIJA 4DJLA 1BAVA 4BD9A 2OR4A 1RTQA 2ZOFA 4X3RA 3D67A 4NGPA 3FEDA 3PBEA 3RZAA 1R43A 2PJ8A 4UEZA 4CPAA 2AFMA 4NGRA 3DGVA 4UEFA 3V38A 4JYWA 2NSMA 1BPNA 4P44A 2ZOGA 3KI9A 4NGQA 2BO9A 5LYDA 3KASA 1TF9A 4GM5A 1TKFA 4TNUA 3IFEA 4MHPA 4C9AA 2ZENA 3D7HA 2GLFA 4DUKA 1CP6A 5LYIA 4P4BA 1XBUA 4NJRA 3H8GA 4NFRA 1ELMP 4MXUA 4K3NA 4C8AA 3WC5A 2JBJA 4NJQA 2V77A 4C8CA 3KHXA 1VHOA 5LYLA 4R6TA 1NSAA 4FUUA 3PRTA 4PPZA 5THWA 4OC0A 2O4HA 2PRQA 4C8FA 3D4UA 8CPAA 3NFZA 2ZEDA 3VARA 4C84A 4FWUA 3CDXA 4YU9A 3B3SA 5LRJA 1QMUA 3SJGA 1PYTB 2XEGA 4X2TA 2O53A 1Y0YA 2Q4ZA 5D29A 1DTDA 2XEFA 2WZNA 3PFEA 3VTAA 1KWMA 4NGNA 5K8NA 3MRUA 4EMEA 1FNOA 2CF4A 4P4DA 2AFUA 4A94A 3VATA 2QVPA 1F2OA 3D7DA 2PJ2A 3KHZA 4EFDA 3BI0A 5JGFA 4C9VA 3IC1A 3FVLA 1ZG7A 5CPAA 4NGTA 4P4JA 1YMEA 3H8FA 5LRKA 3I74A 3IWWA 3BHXA 3PB6X 4R7MA 4P45A 3TX8A 4RUHA 4JZ0A 4YN3A 1AYEA 2AFZA 2I3CA 3PBBA 1ELLP 2C6GA 3KQZA 1UWYA 2PVWA 4OC3A 4MHZA 4FBEA 1PCAA 3K9TA 4MHNA 3V7ZA 2AFSA 4PXDA 4TWEA 4TJXA 4OMEA 4DYOA 4TJVA 1TXRA 1CP7A 2BCOA 4MRIA 4F9UA 2GLJA 5HVFA 2Q43A 3D7GA 3HUVA 2GREA 3SI1A 2PJ6A 2XEIA 4PQAA 4ZI6A 2OOTA 2PIZA 1YW6A 4CDJA 3B3VA 1XMBA 2C6PA 3D68A 2JBKA 2FVGA 2NYQA 4C9UA 3D66A 4R76A 2ZELA 1ZG9A 3MN8A 2ZEOA 4IK2A 4ZY0A 5K8PA 2PJ9A 1LAMA 1M4LA 4ONWA 4A39A 4O23A 2V8HA 3PB4X 2CTBA 1IY7A 2V8GA 2WYRA 3N5FA 3JRUA 5JM6A 2XEJA 3LWUA 3SJEA 4W9YA 4C99A 1HEEA 3CPAA 3S9MA 1TF8A 1VIXA 2PCUA 4OIWA 3D7FA 2EK8A 2AFWA 4OC2A
chains in the Genus database with same CATH superfamily
4C9EA 2GIVA 5HMNA 4MCPA 2K5TA 4UWIA 1Y9ZA 4COBA 2XPOA 4KVME 3FF3A 1P4NA 3E0KA 3IU2A 4KOYA 3WC7A 4C86A 4JD6A 2XPNA 1XFOA 3I9SA 5H84A 3PZJA 2Q7SA 1S7KA 1FT7A 4M85A 4G1PA 2Z3OA 1U6MA 1JWQA 2FIAA 3I6SA 3JUWA 4Z65A 3FH4A 2NMTA 1QQ9A 1VHEA 5GCNA 1Z9UA 3GKRA 4ZY2A 4C85A 1LFWA 5LRGA 4A95A 4R8FA 3SR3A 1HDQA 5K8MA 4LQGA 3B3CA 3IEHA 4FD7A 4JLYA 3NOJA 2EWBA 1Z4EA 4KSIA 2VQYA 4HPSA 5J8FA 3V8IA 4X8IA 1IGBA 2RB7A 3BXMA 2YGWA 2AFOA 1YVHA 4MFJA 4PK2A 4XPDB 3EY5A 2WSAA 2QYVA 2RFHA 2ZW6A 2V8VA 5G1ZA 3S6HA 5IV0A 1A2ZA 1VBGA 4M8DA 3FECA 3P2HA 1ZLIA 4C8TA 1YLOA 3DLJA 4DNCA 2ANPA 2AE6A 3HMJG 1EO0A 3NA6A 1F57A 1JQGA 4M6IA 3IWEA 1ARLA 2FM4A 4NSQA 3QB8A 2B3UA 5AG4A 3BI1A 3W6SA 2PCNA 5G22A 4UCNA 3NE7A 2ZEEA 3B35A 4FD6A 5ELYA 5DWMA 5KTCA 3K4IA 2PRBA 3B3WA 3C8OA 4B6ZA 4KNGE 3TLEA 4CAXA 1YQEA 4QB9A 4P4IA 2DPTA 3KR5A 2CNSA 2IQ6A 1IYLA 3BUOB 1BPMA 5AG6A 3F8KA 4U5YA 4A31A 3EXNA 4CAEA 5J1QA 1J3LA 5F49A 2HROA 4B12A 4PXEA 5D8NA 2F8HA 3EFAA 4YWYA 3T0TA 1OBRA 3NFQA 1YSJA 4PSWA 2PJBA 3IJ3A 4CYQA 4MHYA 1XIXA 2V8DA 3TOAA 4PXCA 1M44A 4C7IA 4H1HA 4CZ1A 3GUXA 1V6CA 1IOFA 3DNSA 1YVKA 3LMSA 1LAPA 1BLLE 3DR6A 2I00A 1R3NA 1XMTA 2J8MA 1ZLHA 3N7ZA 4E2AA 3KZWA 2JDDA 4KVOE 4KVXA 4WJBA 5BY0A 3SXNA 1VHSA 4UIAA 3OB1B 3U88C 2BOAA 2HQYA 3RO0A 5HVHA 4MFLA 4AG7A 4NGSA 1LCPA 1Y0RA 5IB0A 3GB0A 1ZYMA 4MI1A 1EE3P 1XRYA 2B5GA 3KR4A 4KORA 3FBUA 2VXKA 1CX8A 4P4FA 1TKJA 1KUVA 1GYTA 3KQXA 4LX9A 4MY0A 3DDDA 4CAWA 2FXFA 3CPXA 3SJFA 1CBXA 3UY5A 2P6EA 2Q7BA 4CAFA 2AJ6A 3TT2A 2WPWA 4II9A 3WABA 2HWGA 1ZL0A 4MI4A 1T36B 2ARHA 2QECA 3WC6A 4OC5A 1B47A 1Z4RA 2J9AA 4UF4A 3H5ZA 4UEEA 3SI0A 2PJ3A 2J8RA 1NBWA 2VZZA 3EC4A 4A33A 1C30B 2CNMA 2Q51A 2FE7A 4M6GA 2MP0A 2G0BA 2OU2A 3IIBA 2OZUA 2PE3A 3TFYA 2ZEFA 4YRHA 1MJ9A 3PP9A 2PJCA 4XNHC 2P0WA 4MMOA 4RR2B 1Y7EA 2C6CA 3B3TA 1J4JA 4A30A 2QJ8A 3S6FA 3SI2A 5IB9A 3ISZA 4Q7AA 5A27A 4QBJA 4MCSA 3FX6A 3FRMA 4BPUB 1XJOA 3VGOA 3PB8X 4P6YA 4OC1A 1ARMA 2PJ7A 1ZG8A 2B3VA 2UV8G 1Z8LA 2PJ5A 1M4DA 1PUAA 4C68A 2H5MA 4OP4A 2PIYA 2OLSA 3PT1A 2ZW5A 4BPWB 4PXBA 1NSLA 3H8EA 5G20A 2Q44A 4F9VA 5A28A 4OC4A 4B14A 1S7LA 5CBMA 1XF1A 2EUIA 1YREA 4EWTA 4FAIA 3T90A 2DEAA 2Z0ZA 3K2KA 4F8ZA 5F09A 5HKYA 4OIDA 1QSMA 2PJ1A 2Z3LA 4WWVA 3VRRA 1KUXA 2EZAA 5HH1A 2PQ8A 1AMPA 2Y0MA 2PJ0A 3I3GA 3TO7A 2JEWA 1WVMA 1Z5RA 2QIRA 4NGMA 4KOVA 2ZEPA 4ZY1A 3SJXA 2POKA 3B7IA 5HXDA 5F46A 3FNCA 4IIXA 2VL1A 2Q4YA 3NH4A 2B4JC 1YK3A 2GANA 5LYFA 4CRZB 1IIDA 2C1CA 2Q04A 2IL4A 1Q7LA 1MK4A 4QVTA 4RS2A 3ICUA 4UCPA 2R8VA 3NH5A 3WT4A 4C2YA 2CTCA 3CXSA 2R1IA 3T8WA 1F2PA 5EMIA 3CZXA 2DPSA 3P2FA 1S5KA 4OKOA 3RBUA 2EK9A 2BSWA 3WR7A 2YJTA 4XPKA 4J0NA 2PR8A 3NH8A 2HB6A 3R1KA 4CGLA 2HC9A 5C82A 2HUZA 2R82A 2F7VA 3F5BA 1Q2YA 1M1DA 1RXTA 3R96A 1YX0A 3KGQA 5HVGA 3O8ZA 1VGYA 4C2XA 2AFXA 1TIQA 3RAMA 4ZX8A 5F47A 4ZBGA 2QMLA 3KL9A 3QNVA 1CPSA 2JDCA 7CPAA 1BXRB 4C8UA 3ISXA 4B5PA 4R87A 2IMOA 4CRYB 2PJAA 3HPHE 3B2YA 3DSBA 3GY9A 4MFPA 3PLFB 3BUMB 1VKCA 4NCZA 1IICA 5IX3A 3EIFA 1Y9KA 4R3KA 3R9EA 2G3AA 1WWZA 4KZTA 4ZX9A 3FEEA 2ZEHA 3L2NA 5CNPA 2Z3NA 4IHMA 4AVCA 2HI6A 4C8PA 2ZEGA 1Y9WA 4CDKA 4NXYA 2PJ4A 1Q2DA 1I21A 4JWPA 4R9MA 4CYPA 3U1BA 4KOXA 3RYOA 2BL1A 1CG2A 1FY7A 1TKHA 3S9LA 1H8LA 2EBJA 4MJXA 3C26A 4AXVA 3VH9A 3GLJA 4P10A 3FJUA 3PB9X 3G23A 5G21A 2ZEMA 3S9NA 4EYSA 5AXIA 1LANA 2Z3MA 4ZYQA 2ABZA 2KCWA 3LACA 3PFOA 3LODA 4JXQA 5AG7A 5K8OA 4E8OA 2FS5A 5DS0A 5JH9A 4OLLA 3IO1A 1Z2LA 1HDUA 4BTFA 2EO8A 3NE8A 3PEIA 4UIBA 3PFVA 2OZGA 3JTKA 4HKFA 4J3GA 4KUBA 2FCKA 3I1UA 2PR1A 4CGMA 2ZXVA 5I4MA 5JPHA 2B4DB 5AG5A 4A38A 1DE4C 5E96A 3CT9A 4QUSA 4H2KA 4OADA 3EZAA 4MCRA 3PB7X 3TC8A 6CPAA 2BEIA 4IAVA 2PVVA 1LOKA 1CPXA 2FIWA 2B0AA 3IU1A 3D3SA 3FYNA 2GU2A 4HNXB 5F5XA 1KUYA 1B87A 2G9DA 4A37A 4P4EA 2IJZA 4KS9A 5F13A 3FMCA 1GGOA 4L8AA 3S6KA 2EZCA 3OP0A 4AG9A 2ZPAA 3BJ7A 4ORFA 4GPLB 4F0YA 3TYXA 4C9RA 4B10A 4MCQA 1KZFA 3SXOA 2XPLA 3HLPA 4Y49B 3S6GA 4BINA 4NEXA 1YW4A 2CIJA 2WUUA 4KOUA 4DJLA 1EZAA 4UBRA 1WK4A 4HNYB 4Q36A 4RN7A 1DIKA 1CS0B 2PSWA 1BAVA 4INJA 1KC7A 4A32A 2OR4A 3LD2A 4BD9A 5J8CA 1RTQA 2B4DA 2I79A 2ZOFA 3A9LA 4X3RA 3D67A 4CGNA 4NGPA 3FEDA 2VZYA 3D2MA 3PBEA 4XPDC 3RZAA 1R43A 2CNTA 2PJ8A 3KKWA 2P6FA 4UEZA 1S7FA 4CPAA 1CE8B 2X0SA 2AFMA 5DWNA 4NGRA 3DGVA 2GE3A 4PK3A 4UEFA 3V38A 4BBHA 3T07A 4JYWA 1KEEB 3R9GA 2NSMA 1BPNA 1EZBA 2D4OA 4UFXA 4P44A 4HNWB 2ZOGA 4KLVA 4F0XA 1IOIA 3CXQA 3KI9A 4NGQA 2XPPA 2BO9A 4FD5A 5LYDA 5IR2A 3KASA 3TLGB 2CXAA 1TF9A 2P6GA 3T5MA 4GM5A 1TKFA 4GXHA 4TNUA 1XOVA 3IFEA 4R57A 3TLZA 2YNDA 4MHPA 3TTHA 5BWAB 2ZW4A 2ZENA 3TLBA 3D7HA 4C9AA 2GLFA 4DUKA 1CP6A 3BUXB 5LYIA 4P4BA 2Z3PA 4KSFA 1XBUA 1Z8WA 2VI7A 3B8GA 3CXPA 2R7HA 3EO4A 3H8GA 4LUAA 4NFRA 4NJRA 4X5KA 3R95A 1SQHA 5HKZA 1ELMP 4MXUA 1LRZA 4K3NA 3WC5A 4C8AA 2G3TA 4KOWA 3ZNIA 1ZRSA 5EBVA 2JBJA 4M3SA 1YLEA 4A4BA 4NJQA 2V77A 4C8CA 3KHXA 1VHOA 3QAYA 4B11A 4ONUA 5LYLA 4K30A 4R6TA 1NSAA 4E5SA 5ISVA 4FUUA 3GYAA 3PRTA 2FL4A 2D0OA 3TLGA 1Q2CA 4BPXB 1YR0A 4PPZA 1A9XB 3TLCA 4PV6A 5THWA 4OC0A 4CGPA 1UFHA 3F0AA 2O4HA 2PRQA 4C8FA 3D4UA 8CPAA 2FSRA 2B4BA 3NFZA 2ZEDA 4F6AA 1CJWA 1MJBA 3VARA 2DIKA 4C84A 2OZHA 5I0CA 4FWUA 4UWJA 2OB0A 3CDXA 1ZO0A 5FVJA 4MFQA 4YU9A 3B3SA 1BOBA 5LRJA 1JDEA 2GP4A 1QMUA 5F1YA 5F9MA 3SJGA 2B58A 1PYTB 2XEGA 5JYBA 3IWGA 4X2TA 2O53A 1Y0YA 2Q0YA 2Q4ZA 2VKZG 3R9FA 5D29A 5JVLA 3VRPA 2DF5A 4L89A 1NXJA 3W6XA 2CY2A 2PDOA 4YGOA 4CGOA 1DTDA 2JLMA 2EVNA 1R57A 4E94A 2XEFA 2WZNA 3PFEA 4UA3A 3VTAA 1Z8TA 1ON0A 1KWMA 4RI1A 4NGNA 5K8NA 3BUNB 3MRUA 2YNCC 4EMEA 1FNOA 2CF4A 1IYKA 1IU8A 5K99A 4P4DA 2AFUA 4A94A 3VATA 4A2ZA 2QVPA 3IGRA 3T05A 1F2OA 1Y7RA 4H6ZA 3GIUA 4Q38A 2VEZA 2PC1A 3G3SA 3FB3A 2N3AB 3VRNA 1QSRA 3D7DA 2PJ2A 3SHPA 2O28A 1X12A 1P0HA 3KHZA 5F48A 3DR8A 1C3OB 4MJ8A 1I1DA 1Z9EA 1MJAA 4EFDA 3BI0A 4XNHB 1M6VB 5JGFA 3KRVA 1YVOA 3TCVA 3F9KC 4KOSA 1S60A 3MGDA 4C9VA 3IC1A 4JVOA 2D4PA 1M4IA 2RC4A 4H89A 4PSXA 3FVLA 4U9ZA 1ZG7A 5CPAA 4NGTA 4UFVA 2DXQA 2Z11A 4MBUA 4MFZA 1FBVA 4P4JA 1QSNA 1YMEA 2C27A 4CS0B 4UFWA 1QSTA 2Y1MA 1XE4A 3H8FA 1Z8XA 4CYOA 5LRKA 3I74A 3IWWA 3BHXA 4IF5A 3PB6X 4MY3A 4R7MA 1I12A 5C88A 1S7NA 4P45A 3TX8A 4RUHA 4IIYA 3VRQA 2HV2A 2A4NA 4ZGYB 4JZ0A 4YN3A 3TLYA 1AYEA 2AFZA 2I3CA 1N71A 3OAKA 3TO6A 3PBBA 4R3LA 3BUWB 3D8PA 1ELLP 5JQ4A 3EZEA 3VROA 2C6GA 3QAHA 4AVAA 2AUNA 3KQZA 1UWYA 3TE4A 2PVWA 2F5IA 4OC3A 2FT0A 4QC6A 4YFJA 4JJXA 2VBQA 4MHZA 4FD4A 4CO9A 4GS4A 3EZBA 4FBEA 3OB2B 3JVNA 1PCAA 4KUAA 3VWDA 5AGEA 3K9TA 5FD8A 2ZW7A 2ODFA 5EC4A 1OZPA 4MHNA 3V7ZA 4C7HA 2AFSA 2DLAA 4PXDA 3K9UA 4TWEA 1XEBA 4B5PB 4OMEA 4DYOA 4TJXA 5KTAA 1Q5XA 2EZBA 1QSOA 4TJVA 1TXRA 4C2ZA 1CP7A 3H4QA 2BCOA 2YNEA 4MRIA 4F9UA 3GJZA 4A4CA 4KLWA 4JXRA 3HPGG 2GLJA 5HVFA 1PU9A 1V0CA 2Q43A 3D7GA 2Z10A 2GREA 3G8WA 3D2PA 3HUVA 4I49A 5H86A 3BLNA 3SI1A 4AB7A 1R61A 2AUMA 4EVYA 2PJ6A 3FIXA 4LQ6A 3RNZA 4H6UA 4CYNA 1S3ZA 4MFKA 1VBHA 2XEIA 4PQAA 4ZI6A 2C5QA 2OOTA 2PIZA 1YW6A 4CDJA 4B5OA 2ATRA 3B3VA 3TO9A 4AVBA 4COGA 1NE9A 1WJTA 1XMBA 2C6PA 5J3XA 2JBKA 1AUGA 3D68A 4CAVA 2FVGA 2NYQA 4Y49C 1B6BA 2BUEA 4C9UA 1KBLA 1NMTA 3VWEA 1GHEA 2Z3KA 3D66A 2ZELA 3FXTA 1ZG9A 4R76A 3PGPA 3ZJ0A 3MN8A 2ZEOA 4IK2A 4ZY0A 4M6HA 5K8PA 2PJ9A 4IUSA 4OAEA 1M4GA 1LAMA 1M4LA 4ONWA 1RO5A 4A39A 4O23A 2V8HA 2B5GB 1CM0A 3PB4X 2CTBA 4UCMA 4E0AA 5KTDA 2YNCA 2Y1NA 1IY7A 2V8GA 2WYRA 3N5FA 3JRUA 5JM6A 2XEJA 2X7BA 2GFQA 2R98A 2REEA 2Q4VA 4BMHA 3LWUA 4KSAA 4U9YA 1XF8A 1X10A 1VI4A 2YJVA 3SJEA 4W9YA 3T9YA 4NF1A 3ZZIA 2D0PA 4C99A 1K4JA 1HEEA 2J8NA 3W91A 2CBLA 1IB1E 2JEVA 3CPAA 3BJ8A 4MHDA 3S9MA 4KOTA 3OWCA 1TF8A 1VIXA 2PCUA 2WPXA 4OIWA 3D7FA 3TOBA 4B13A 1JDBC 2E28A 2EK8A 2AFWA 3TLAA 4OC2A 2OH1A 1YGHA 2REFA 4XPLA 5HKWA 1L0CA 1BO4A
chains in the Genus database with same CATH topology
4C9EA 4MCPA 1Y9ZA 3FF3A 3WC7A 4C86A 1XFOA 1FT7A 4G1PA 3I6SA 4Z65A 3FH4A 1QQ9A 1VHEA 4C85A 4ZY2A 1LFWA 5LRGA 4R8FA 1HDQA 5K8MA 4LQGA 3B3CA 3IEHA 2EWBA 4KSIA 4X8IA 1IGBA 2RB7A 3BXMA 2AFOA 2QYVA 2RFHA 2V8VA 3FECA 4C8TA 1ZLIA 1YLOA 3DLJA 2ANPA 3NA6A 1F57A 1JQGA 1ARLA 3BI1A 2ZEEA 3B35A 5ELYA 4KNGE 3B3WA 4B6ZA 4P4IA 3KR5A 2IQ6A 1BPMA 5J1QA 4PXEA 5D8NA 2F8HA 4YWYA 1OBRA 1YSJA 2PJBA 3IJ3A 4MHYA 2V8DA 4PXCA 3GUXA 1V6CA 3LMSA 1LAPA 1BLLE 1R3NA 1ZLHA 3KZWA 4WJBA 4UIAA 2BOAA 5HVHA 4NGSA 1LCPA 1Y0RA 3GB0A 1EE3P 1XRYA 3KR4A 1CX8A 4P4FA 1TKJA 3KQXA 1GYTA 3CPXA 1CBXA 3SJFA 3WABA 3WC6A 4OC5A 2J9AA 4UF4A 4UEEA 3SI0A 2PJ3A 2Q51A 3IIBA 2PE3A 2ZEFA 2PJCA 4MMOA 1Y7EA 3B3TA 2C6CA 2QJ8A 3SI2A 5IB9A 3ISZA 4Q7AA 4MCSA 3FX6A 1XJOA 3PB8X 4P6YA 2PJ7A 4OC1A 1ARMA 1ZG8A 1Z8LA 2PJ5A 4OP4A 2PIYA 4PXBA 3H8EA 4F9VA 5CBMA 4OC4A 1XF1A 4EWTA 4FAIA 2DEAA 3K2KA 4F8ZA 5F09A 4OIDA 2PJ1A 4WWVA 1AMPA 2PJ0A 2JEWA 1WVMA 1Z5RA 4NGMA 4ZY1A 2ZEPA 5HXDA 3SJXA 2POKA 3B7IA 2VL1A 3NH4A 5LYFA 2C1CA 1Q7LA 3ICUA 3WT4A 3NH5A 2CTCA 3T8WA 1F2PA 4OKOA 3RBUA 2EK9A 3NH8A 2HB6A 2HC9A 2F7VA 3KGQA 5HVGA 1VGYA 2AFXA 3RAMA 4ZX8A 3KL9A 3QNVA 1CPSA 7CPAA 4C8UA 3ISXA 2IMOA 2PJAA 3B2YA 3EIFA 4ZX9A 3FEEA 2ZEHA 3L2NA 4IHMA 4C8PA 2ZEGA 4CDKA 2PJ4A 1CG2A 1TKHA 3S9LA 1H8LA 4AXVA 3VH9A 3GLJA 4P10A 3FJUA 3PB9X 2ZEMA 3S9NA 1LANA 4ZYQA 2ABZA 3PFOA 5K8OA 5DS0A 5JH9A 3IO1A 1Z2LA 1HDUA 3PEIA 4UIBA 3I1UA 5I4MA 4A38A 1DE4C 3CT9A 4H2KA 4MCRA 3PB7X 3TC8A 6CPAA 4IAVA 2PVVA 1LOKA 1CPXA 2GU2A 2G9DA 4A37A 4P4EA 2IJZA 3FMCA 4C9RA 4MCQA 3HLPA 1YW4A 2CIJA 4DJLA 1BAVA 4BD9A 2OR4A 1RTQA 2ZOFA 4X3RA 3D67A 4NGPA 3FEDA 3PBEA 3RZAA 1R43A 2PJ8A 4UEZA 4CPAA 2AFMA 4NGRA 3DGVA 4UEFA 3V38A 4JYWA 2NSMA 1BPNA 4P44A 2ZOGA 3KI9A 4NGQA 2BO9A 5LYDA 5IR2A 3KASA 1TF9A 4GM5A 1TKFA 4TNUA 3IFEA 4MHPA 4C9AA 2ZENA 3D7HA 2GLFA 4DUKA 1CP6A 5LYIA 4P4BA 1XBUA 4NJRA 3H8GA 4NFRA 1ELMP 4MXUA 4K3NA 4C8AA 3WC5A 2JBJA 4NJQA 2V77A 4C8CA 3KHXA 1VHOA 5LYLA 4R6TA 1NSAA 4FUUA 3PRTA 4PPZA 5THWA 4OC0A 2O4HA 2PRQA 4C8FA 3D4UA 8CPAA 3NFZA 2ZEDA 3VARA 4C84A 4FWUA 3CDXA 4YU9A 3B3SA 5LRJA 2GP4A 1QMUA 3SJGA 1PYTB 2XEGA 4X2TA 2O53A 1Y0YA 2Q4ZA 5D29A 1DTDA 2XEFA 2WZNA 3PFEA 3VTAA 1KWMA 4NGNA 5K8NA 3MRUA 4EMEA 1FNOA 2CF4A 4P4DA 2AFUA 4A94A 3VATA 2QVPA 1F2OA 3D7DA 2PJ2A 3KHZA 4EFDA 3BI0A 5JGFA 4C9VA 3IC1A 3FVLA 1ZG7A 5CPAA 4NGTA 4P4JA 1YMEA 3H8FA 5LRKA 3I74A 3IWWA 3BHXA 3PB6X 4R7MA 4P45A 3TX8A 4RUHA 4JZ0A 4YN3A 1AYEA 2AFZA 2I3CA 3PBBA 1ELLP 2C6GA 3KQZA 1UWYA 2PVWA 4OC3A 4MHZA 4FBEA 1PCAA 3K9TA 4MHNA 3V7ZA 2AFSA 4PXDA 4TWEA 4TJXA 4OMEA 4DYOA 4TJVA 1TXRA 1CP7A 2BCOA 4MRIA 4F9UA 2GLJA 5HVFA 2Q43A 3D7GA 3HUVA 2GREA 3SI1A 2PJ6A 2XEIA 4PQAA 4ZI6A 2C5QA 2OOTA 2PIZA 1YW6A 4CDJA 3B3VA 1XMBA 2C6PA 3D68A 2JBKA 2FVGA 2NYQA 4C9UA 3D66A 4R76A 2ZELA 1ZG9A 3MN8A 2ZEOA 4IK2A 4ZY0A 5K8PA 2PJ9A 1LAMA 1M4LA 4ONWA 4A39A 4O23A 2V8HA 3PB4X 2CTBA 1IY7A 2V8GA 2WYRA 3N5FA 3JRUA 5JM6A 2XEJA 3LWUA 3SJEA 4W9YA 4C99A 1HEEA 3CPAA 3S9MA 1TF8A 1VIXA 2PCUA 4OIWA 3D7FA 2EK8A 2AFWA 4OC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C9E A;  4MCP A;  1Y9Z A;  3FF3 A;  3WC7 A;  4C86 A;  1XFO A;  1FT7 A;  4G1P A;  3I6S A;  4Z65 A;  3FH4 A;  1QQ9 A;  1VHE A;  4C85 A;  4ZY2 A;  1LFW A;  5LRG A;  4R8F A;  1HDQ A;  5K8M A;  4LQG A;  3B3C A;  3IEH A;  2EWB A;  4KSI A;  4X8I A;  1IGB A;  2RB7 A;  3BXM A;  2AFO A;  2QYV A;  2RFH A;  2V8V A;  3FEC A;  4C8T A;  1ZLI A;  1YLO A;  3DLJ A;  2ANP A;  3NA6 A;  1F57 A;  1JQG A;  1ARL A;  3BI1 A;  2ZEE A;  3B35 A;  5ELY A;  4KNG E;  3B3W A;  4B6Z A;  4P4I A;  3KR5 A;  2IQ6 A;  1BPM A;  5J1Q A;  4PXE A;  5D8N A;  2F8H A;  4YWY A;  1OBR A;  1YSJ A;  2PJB A;  3IJ3 A;  4MHY A;  2V8D A;  4PXC A;  3GUX A;  1V6C A;  3LMS A;  1LAP A;  1BLL E;  1R3N A;  1ZLH A;  3KZW A;  4WJB A;  4UIA A;  2BOA A;  5HVH A;  4NGS A;  1LCP A;  1Y0R A;  3GB0 A;  1EE3 P;  1XRY A;  3KR4 A;  1CX8 A;  4P4F A;  1TKJ A;  3KQX A;  1GYT A;  3CPX A;  1CBX A;  3SJF A;  3WAB A;  3WC6 A;  4OC5 A;  2J9A A;  4UF4 A;  4UEE A;  3SI0 A;  2PJ3 A;  2Q51 A;  3IIB A;  2PE3 A;  2ZEF A;  2PJC A;  4MMO A;  1Y7E A;  3B3T A;  2C6C A;  2QJ8 A;  3SI2 A;  5IB9 A;  3ISZ A;  4Q7A A;  4MCS A;  3FX6 A;  1XJO A;  3PB8 X;  4P6Y A;  2PJ7 A;  4OC1 A;  1ARM A;  1ZG8 A;  1Z8L A;  2PJ5 A;  4OP4 A;  2PIY A;  4PXB A;  3H8E A;  4F9V A;  5CBM A;  4OC4 A;  1XF1 A;  4EWT A;  4FAI A;  2DEA A;  3K2K A;  4F8Z A;  5F09 A;  4OID A;  2PJ1 A;  4WWV A;  1AMP A;  2PJ0 A;  2JEW A;  1WVM A;  1Z5R A;  4NGM A;  4ZY1 A;  2ZEP A;  5HXD A;  3SJX A;  2POK A;  3B7I A;  2VL1 A;  3NH4 A;  5LYF A;  2C1C A;  1Q7L A;  3ICU A;  3WT4 A;  3NH5 A;  2CTC A;  3T8W A;  1F2P A;  4OKO A;  3RBU A;  2EK9 A;  3NH8 A;  2HB6 A;  2HC9 A;  2F7V A;  3KGQ A;  5HVG A;  1VGY A;  2AFX A;  3RAM A;  4ZX8 A;  3KL9 A;  3QNV A;  1CPS A;  7CPA A;  4C8U A;  3ISX A;  2IMO A;  2PJA A;  3B2Y A;  3EIF A;  4ZX9 A;  3FEE A;  2ZEH A;  3L2N A;  4IHM A;  4C8P A;  2ZEG A;  4CDK A;  2PJ4 A;  1CG2 A;  1TKH A;  3S9L A;  1H8L A;  4AXV A;  3VH9 A;  3GLJ A;  4P10 A;  3FJU A;  3PB9 X;  2ZEM A;  3S9N A;  1LAN A;  4ZYQ A;  2ABZ A;  3PFO A;  5K8O A;  5DS0 A;  5JH9 A;  3IO1 A;  1Z2L A;  1HDU A;  3PEI A;  4UIB A;  3I1U A;  5I4M A;  4A38 A;  1DE4 C;  3CT9 A;  4H2K A;  4MCR A;  3PB7 X;  3TC8 A;  6CPA A;  4IAV A;  2PVV A;  1LOK A;  1CPX A;  2GU2 A;  2G9D A;  4A37 A;  4P4E A;  2IJZ A;  3FMC A;  4C9R A;  4MCQ A;  3HLP A;  1YW4 A;  2CIJ A;  4DJL A;  1BAV A;  4BD9 A;  2OR4 A;  1RTQ A;  2ZOF A;  4X3R A;  3D67 A;  4NGP A;  3FED A;  3PBE A;  3RZA A;  1R43 A;  2PJ8 A;  4UEZ A;  4CPA A;  2AFM A;  4NGR A;  3DGV A;  4UEF A;  3V38 A;  4JYW A;  2NSM A;  1BPN A;  4P44 A;  2ZOG A;  3KI9 A;  4NGQ A;  2BO9 A;  5LYD A;  3KAS A;  1TF9 A;  4GM5 A;  1TKF A;  4TNU A;  3IFE A;  4MHP A;  4C9A A;  2ZEN A;  3D7H A;  2GLF A;  4DUK A;  1CP6 A;  5LYI A;  4P4B A;  1XBU A;  4NJR A;  3H8G A;  4NFR A;  1ELM P;  4MXU A;  4K3N A;  4C8A A;  3WC5 A;  2JBJ A;  4NJQ A;  2V77 A;  4C8C A;  3KHX A;  1VHO A;  5LYL A;  4R6T A;  1NSA A;  4FUU A;  3PRT A;  4PPZ A;  5THW A;  4OC0 A;  2O4H A;  2PRQ A;  4C8F A;  3D4U A;  8CPA A;  3NFZ A;  2ZED A;  3VAR A;  4C84 A;  4FWU A;  3CDX A;  4YU9 A;  3B3S A;  5LRJ A;  1QMU A;  3SJG A;  1PYT B;  2XEG A;  4X2T A;  2O53 A;  1Y0Y A;  2Q4Z A;  5D29 A;  1DTD A;  2XEF A;  2WZN A;  3PFE A;  3VTA A;  1KWM A;  4NGN A;  5K8N A;  3MRU A;  4EME A;  1FNO A;  2CF4 A;  4P4D A;  2AFU A;  4A94 A;  3VAT A;  2QVP A;  1F2O A;  3D7D A;  2PJ2 A;  3KHZ A;  4EFD A;  3BI0 A;  5JGF A;  4C9V A;  3IC1 A;  3FVL A;  1ZG7 A;  5CPA A;  4NGT A;  4P4J A;  1YME A;  3H8F A;  5LRK A;  3I74 A;  3IWW A;  3BHX A;  3PB6 X;  4R7M A;  4P45 A;  3TX8 A;  4RUH A;  4JZ0 A;  4YN3 A;  1AYE A;  2AFZ A;  2I3C A;  3PBB A;  1ELL P;  2C6G A;  3KQZ A;  1UWY A;  2PVW A;  4OC3 A;  4MHZ A;  4FBE A;  1PCA A;  3K9T A;  4MHN A;  3V7Z A;  2AFS A;  4PXD A;  4TWE A;  4TJX A;  4OME A;  4DYO A;  4TJV A;  1TXR A;  1CP7 A;  2BCO A;  4MRI A;  4F9U A;  2GLJ A;  5HVF A;  2Q43 A;  3D7G A;  3HUV A;  2GRE A;  3SI1 A;  2PJ6 A;  2XEI A;  4PQA A;  4ZI6 A;  2OOT A;  2PIZ A;  1YW6 A;  4CDJ A;  3B3V A;  1XMB A;  2C6P A;  3D68 A;  2JBK A;  2FVG A;  2NYQ A;  4C9U A;  3D66 A;  4R76 A;  2ZEL A;  1ZG9 A;  3MN8 A;  2ZEO A;  4IK2 A;  4ZY0 A;  5K8P A;  2PJ9 A;  1LAM A;  1M4L A;  4ONW A;  4A39 A;  4O23 A;  2V8H A;  3PB4 X;  2CTB A;  1IY7 A;  2V8G A;  2WYR A;  3N5F A;  3JRU A;  5JM6 A;  2XEJ A;  3LWU A;  3SJE A;  4W9Y A;  4C99 A;  1HEE A;  3CPA A;  3S9M A;  1TF8 A;  1VIX A;  2PCU A;  4OIW A;  3D7F A;  2EK8 A;  2AFW A;  4OC2 A; 
#chains in the Genus database with same CATH topology
 4C9E A;  2GIV A;  5HMN A;  4MCP A;  2K5T A;  4UWI A;  1Y9Z A;  4COB A;  2XPO A;  4KVM E;  3FF3 A;  1P4N A;  3E0K A;  3IU2 A;  4KOY A;  3WC7 A;  4C86 A;  4JD6 A;  2XPN A;  1XFO A;  3I9S A;  5H84 A;  3PZJ A;  2Q7S A;  1S7K A;  1FT7 A;  4M85 A;  4G1P A;  2Z3O A;  1U6M A;  1JWQ A;  2FIA A;  3I6S A;  3JUW A;  4Z65 A;  3FH4 A;  2NMT A;  1QQ9 A;  1VHE A;  5GCN A;  1Z9U A;  3GKR A;  4ZY2 A;  4C85 A;  1LFW A;  5LRG A;  4A95 A;  4R8F A;  3SR3 A;  1HDQ A;  5K8M A;  4LQG A;  3B3C A;  3IEH A;  4FD7 A;  4JLY A;  3NOJ A;  2EWB A;  1Z4E A;  4KSI A;  2VQY A;  4HPS A;  5J8F A;  3V8I A;  4X8I A;  1IGB A;  2RB7 A;  3BXM A;  2YGW A;  2AFO A;  1YVH A;  4MFJ A;  4PK2 A;  4XPD B;  3EY5 A;  2WSA A;  2QYV A;  2RFH A;  2ZW6 A;  2V8V A;  5G1Z A;  3S6H A;  5IV0 A;  1A2Z A;  1VBG A;  4M8D A;  3FEC A;  3P2H A;  1ZLI A;  4C8T A;  1YLO A;  3DLJ A;  4DNC A;  2ANP A;  2AE6 A;  3HMJ G;  1EO0 A;  3NA6 A;  1F57 A;  1JQG A;  4M6I A;  3IWE A;  1ARL A;  2FM4 A;  4NSQ A;  3QB8 A;  2B3U A;  5AG4 A;  3BI1 A;  3W6S A;  2PCN A;  5G22 A;  4UCN A;  3NE7 A;  2ZEE A;  3B35 A;  4FD6 A;  5ELY A;  5DWM A;  5KTC A;  3K4I A;  2PRB A;  3B3W A;  3C8O A;  4B6Z A;  4KNG E;  3TLE A;  4CAX A;  1YQE A;  4QB9 A;  4P4I A;  2DPT A;  3KR5 A;  2CNS A;  2IQ6 A;  1IYL A;  3BUO B;  1BPM A;  5AG6 A;  3F8K A;  4U5Y A;  4A31 A;  3EXN A;  4CAE A;  5J1Q A;  1J3L A;  5F49 A;  2HRO A;  4B12 A;  4PXE A;  5D8N A;  2F8H A;  3EFA A;  4YWY A;  3T0T A;  1OBR A;  3NFQ A;  1YSJ A;  4PSW A;  2PJB A;  3IJ3 A;  4CYQ A;  4MHY A;  1XIX A;  2V8D A;  3TOA A;  4PXC A;  1M44 A;  4C7I A;  4H1H A;  4CZ1 A;  3GUX A;  1V6C A;  1IOF A;  3DNS A;  1YVK A;  3LMS A;  1LAP A;  1BLL E;  3DR6 A;  2I00 A;  1R3N A;  1XMT A;  2J8M A;  1ZLH A;  3N7Z A;  4E2A A;  3KZW A;  2JDD A;  4KVO E;  4KVX A;  4WJB A;  5BY0 A;  3SXN A;  1VHS A;  4UIA A;  3OB1 B;  3U88 C;  2BOA A;  2HQY A;  3RO0 A;  5HVH A;  4MFL A;  4AG7 A;  4NGS A;  1LCP A;  1Y0R A;  5IB0 A;  3GB0 A;  1ZYM A;  4MI1 A;  1EE3 P;  1XRY A;  2B5G A;  3KR4 A;  4KOR A;  3FBU A;  2VXK A;  1CX8 A;  4P4F A;  1TKJ A;  1KUV A;  1GYT A;  3KQX A;  4LX9 A;  4MY0 A;  3DDD A;  4CAW A;  2FXF A;  3CPX A;  3SJF A;  1CBX A;  3UY5 A;  2P6E A;  2Q7B A;  4CAF A;  2AJ6 A;  3TT2 A;  2WPW A;  4II9 A;  3WAB A;  2HWG A;  1ZL0 A;  4MI4 A;  1T36 B;  2ARH A;  2QEC A;  3WC6 A;  4OC5 A;  1B47 A;  1Z4R A;  2J9A A;  4UF4 A;  3H5Z A;  4UEE A;  3SI0 A;  2PJ3 A;  2J8R A;  1NBW A;  2VZZ A;  3EC4 A;  4A33 A;  1C30 B;  2CNM A;  2Q51 A;  2FE7 A;  4M6G A;  2MP0 A;  2G0B A;  2OU2 A;  3IIB A;  2OZU A;  2PE3 A;  3TFY A;  2ZEF A;  4YRH A;  1MJ9 A;  3PP9 A;  2PJC A;  4XNH C;  2P0W A;  4MMO A;  4RR2 B;  1Y7E A;  2C6C A;  3B3T A;  1J4J A;  4A30 A;  2QJ8 A;  3S6F A;  3SI2 A;  5IB9 A;  3ISZ A;  4Q7A A;  5A27 A;  4QBJ A;  4MCS A;  3FX6 A;  3FRM A;  4BPU B;  1XJO A;  3VGO A;  3PB8 X;  4P6Y A;  4OC1 A;  1ARM A;  2PJ7 A;  1ZG8 A;  2B3V A;  2UV8 G;  1Z8L A;  2PJ5 A;  1M4D A;  1PUA A;  4C68 A;  2H5M A;  4OP4 A;  2PIY A;  2OLS A;  3PT1 A;  2ZW5 A;  4BPW B;  4PXB A;  1NSL A;  3H8E A;  5G20 A;  2Q44 A;  4F9V A;  5A28 A;  4OC4 A;  4B14 A;  1S7L A;  5CBM A;  1XF1 A;  2EUI A;  1YRE A;  4EWT A;  4FAI A;  3T90 A;  2DEA A;  2Z0Z A;  3K2K A;  4F8Z A;  5F09 A;  5HKY A;  4OID A;  1QSM A;  2PJ1 A;  2Z3L A;  4WWV A;  3VRR A;  1KUX A;  2EZA A;  5HH1 A;  2PQ8 A;  1AMP A;  2Y0M A;  2PJ0 A;  3I3G A;  3TO7 A;  2JEW A;  1WVM A;  1Z5R A;  2QIR A;  4NGM A;  4KOV A;  2ZEP A;  4ZY1 A;  3SJX A;  2POK A;  3B7I A;  5HXD A;  5F46 A;  3FNC A;  4IIX A;  2VL1 A;  2Q4Y A;  3NH4 A;  2B4J C;  1YK3 A;  2GAN A;  5LYF A;  4CRZ B;  1IID A;  2C1C A;  2Q04 A;  2IL4 A;  1Q7L A;  1MK4 A;  4QVT A;  4RS2 A;  3ICU A;  4UCP A;  2R8V A;  3NH5 A;  3WT4 A;  4C2Y A;  2CTC A;  3CXS A;  2R1I A;  3T8W A;  1F2P A;  5EMI A;  3CZX A;  2DPS A;  3P2F A;  1S5K A;  4OKO A;  3RBU A;  2EK9 A;  2BSW A;  3WR7 A;  2YJT A;  4XPK A;  4J0N A;  2PR8 A;  3NH8 A;  2HB6 A;  3R1K A;  4CGL A;  2HC9 A;  5C82 A;  2HUZ A;  2R82 A;  2F7V A;  3F5B A;  1Q2Y A;  1M1D A;  1RXT A;  3R96 A;  1YX0 A;  3KGQ A;  5HVG A;  3O8Z A;  1VGY A;  4C2X A;  2AFX A;  1TIQ A;  3RAM A;  4ZX8 A;  5F47 A;  4ZBG A;  2QML A;  3KL9 A;  3QNV A;  1CPS A;  2JDC A;  7CPA A;  1BXR B;  4C8U A;  3ISX A;  4B5P A;  4R87 A;  2IMO A;  4CRY B;  2PJA A;  3HPH E;  3B2Y A;  3DSB A;  3GY9 A;  4MFP A;  3PLF B;  3BUM B;  1VKC A;  4NCZ A;  1IIC A;  5IX3 A;  3EIF A;  1Y9K A;  4R3K A;  3R9E A;  2G3A A;  1WWZ A;  4KZT A;  4ZX9 A;  3FEE A;  2ZEH A;  3L2N A;  5CNP A;  2Z3N A;  4IHM A;  4AVC A;  2HI6 A;  4C8P A;  2ZEG A;  1Y9W A;  4CDK A;  4NXY A;  2PJ4 A;  1Q2D A;  1I21 A;  4JWP A;  4R9M A;  4CYP A;  3U1B A;  4KOX A;  3RYO A;  2BL1 A;  1CG2 A;  1FY7 A;  1TKH A;  3S9L A;  1H8L A;  2EBJ A;  4MJX A;  3C26 A;  4AXV A;  3VH9 A;  3GLJ A;  4P10 A;  3FJU A;  3PB9 X;  3G23 A;  5G21 A;  2ZEM A;  3S9N A;  4EYS A;  5AXI A;  1LAN A;  2Z3M A;  4ZYQ A;  2ABZ A;  2KCW A;  3LAC A;  3PFO A;  3LOD A;  4JXQ A;  5AG7 A;  5K8O A;  4E8O A;  2FS5 A;  5DS0 A;  5JH9 A;  4OLL A;  3IO1 A;  1Z2L A;  1HDU A;  4BTF A;  2EO8 A;  3NE8 A;  3PEI A;  4UIB A;  3PFV A;  2OZG A;  3JTK A;  4HKF A;  4J3G A;  4KUB A;  2FCK A;  3I1U A;  2PR1 A;  4CGM A;  2ZXV A;  5I4M A;  5JPH A;  2B4D B;  5AG5 A;  4A38 A;  1DE4 C;  5E96 A;  3CT9 A;  4QUS A;  4H2K A;  4OAD A;  3EZA A;  4MCR A;  3PB7 X;  3TC8 A;  6CPA A;  2BEI A;  4IAV A;  2PVV A;  1LOK A;  1CPX A;  2FIW A;  2B0A A;  3IU1 A;  3D3S A;  3FYN A;  2GU2 A;  4HNX B;  5F5X A;  1KUY A;  1B87 A;  2G9D A;  4A37 A;  4P4E A;  2IJZ A;  4KS9 A;  5F13 A;  3FMC A;  1GGO A;  4L8A A;  3S6K A;  2EZC A;  3OP0 A;  4AG9 A;  2ZPA A;  3BJ7 A;  4ORF A;  4GPL B;  4F0Y A;  3TYX A;  4C9R A;  4B10 A;  4MCQ A;  1KZF A;  3SXO A;  2XPL A;  3HLP A;  4Y49 B;  3S6G A;  4BIN A;  4NEX A;  1YW4 A;  2CIJ A;  2WUU A;  4KOU A;  4DJL A;  1EZA A;  4UBR A;  1WK4 A;  4HNY B;  4Q36 A;  4RN7 A;  1DIK A;  1CS0 B;  2PSW A;  1BAV A;  4INJ A;  1KC7 A;  4A32 A;  2OR4 A;  3LD2 A;  4BD9 A;  5J8C A;  1RTQ A;  2B4D A;  2I79 A;  2ZOF A;  3A9L A;  4X3R A;  3D67 A;  4CGN A;  4NGP A;  3FED A;  2VZY A;  3D2M A;  3PBE A;  4XPD C;  3RZA A;  1R43 A;  2CNT A;  2PJ8 A;  3KKW A;  2P6F A;  4UEZ A;  1S7F A;  4CPA A;  1CE8 B;  2X0S A;  2AFM A;  5DWN A;  4NGR A;  3DGV A;  2GE3 A;  4PK3 A;  4UEF A;  3V38 A;  4BBH A;  3T07 A;  4JYW A;  1KEE B;  3R9G A;  2NSM A;  1BPN A;  1EZB A;  2D4O A;  4UFX A;  4P44 A;  4HNW B;  2ZOG A;  4KLV A;  4F0X A;  1IOI A;  3CXQ A;  3KI9 A;  4NGQ A;  2XPP A;  2BO9 A;  4FD5 A;  5LYD A;  5IR2 A;  3KAS A;  3TLG B;  2CXA A;  1TF9 A;  2P6G A;  3T5M A;  4GM5 A;  1TKF A;  4GXH A;  4TNU A;  1XOV A;  3IFE A;  4R57 A;  3TLZ A;  2YND A;  4MHP A;  3TTH A;  5BWA B;  2ZW4 A;  2ZEN A;  3TLB A;  3D7H A;  4C9A A;  2GLF A;  4DUK A;  1CP6 A;  3BUX B;  5LYI A;  4P4B A;  2Z3P A;  4KSF A;  1XBU A;  1Z8W A;  2VI7 A;  3B8G A;  3CXP A;  2R7H A;  3EO4 A;  3H8G A;  4LUA A;  4NFR A;  4NJR A;  4X5K A;  3R95 A;  1SQH A;  5HKZ A;  1ELM P;  4MXU A;  1LRZ A;  4K3N A;  3WC5 A;  4C8A A;  2G3T A;  4KOW A;  3ZNI A;  1ZRS A;  5EBV A;  2JBJ A;  4M3S A;  1YLE A;  4A4B A;  4NJQ A;  2V77 A;  4C8C A;  3KHX A;  1VHO A;  3QAY A;  4B11 A;  4ONU A;  5LYL A;  4K30 A;  4R6T A;  1NSA A;  4E5S A;  5ISV A;  4FUU A;  3GYA A;  3PRT A;  2FL4 A;  2D0O A;  3TLG A;  1Q2C A;  4BPX B;  1YR0 A;  4PPZ A;  1A9X B;  3TLC A;  4PV6 A;  5THW A;  4OC0 A;  4CGP A;  1UFH A;  3F0A A;  2O4H A;  2PRQ A;  4C8F A;  3D4U A;  8CPA A;  2FSR A;  2B4B A;  3NFZ A;  2ZED A;  4F6A A;  1CJW A;  1MJB A;  3VAR A;  2DIK A;  4C84 A;  2OZH A;  5I0C A;  4FWU A;  4UWJ A;  2OB0 A;  3CDX A;  1ZO0 A;  5FVJ A;  4MFQ A;  4YU9 A;  3B3S A;  1BOB A;  5LRJ A;  1JDE A;  2GP4 A;  1QMU A;  5F1Y A;  5F9M A;  3SJG A;  2B58 A;  1PYT B;  2XEG A;  5JYB A;  3IWG A;  4X2T A;  2O53 A;  1Y0Y A;  2Q0Y A;  2Q4Z A;  2VKZ G;  3R9F A;  5D29 A;  5JVL A;  3VRP A;  2DF5 A;  4L89 A;  1NXJ A;  3W6X A;  2CY2 A;  2PDO A;  4YGO A;  4CGO A;  1DTD A;  2JLM A;  2EVN A;  1R57 A;  4E94 A;  2XEF A;  2WZN A;  3PFE A;  4UA3 A;  3VTA A;  1Z8T A;  1ON0 A;  1KWM A;  4RI1 A;  4NGN A;  5K8N A;  3BUN B;  3MRU A;  2YNC C;  4EME A;  1FNO A;  2CF4 A;  1IYK A;  1IU8 A;  5K99 A;  4P4D A;  2AFU A;  4A94 A;  3VAT A;  4A2Z A;  2QVP A;  3IGR A;  3T05 A;  1F2O A;  1Y7R A;  4H6Z A;  3GIU A;  4Q38 A;  2VEZ A;  2PC1 A;  3G3S A;  3FB3 A;  2N3A B;  3VRN A;  1QSR A;  3D7D A;  2PJ2 A;  3SHP A;  2O28 A;  1X12 A;  1P0H A;  3KHZ A;  5F48 A;  3DR8 A;  1C3O B;  4MJ8 A;  1I1D A;  1Z9E A;  1MJA A;  4EFD A;  3BI0 A;  4XNH B;  1M6V B;  5JGF A;  3KRV A;  1YVO A;  3TCV A;  3F9K C;  4KOS A;  1S60 A;  3MGD A;  4C9V A;  3IC1 A;  4JVO A;  2D4P A;  1M4I A;  2RC4 A;  4H89 A;  4PSX A;  3FVL A;  4U9Z A;  1ZG7 A;  5CPA A;  4NGT A;  4UFV A;  2DXQ A;  2Z11 A;  4MBU A;  4MFZ A;  1FBV A;  4P4J A;  1QSN A;  1YME A;  2C27 A;  4CS0 B;  4UFW A;  1QST A;  2Y1M A;  1XE4 A;  3H8F A;  1Z8X A;  4CYO A;  5LRK A;  3I74 A;  3IWW A;  3BHX A;  4IF5 A;  3PB6 X;  4MY3 A;  4R7M A;  1I12 A;  5C88 A;  1S7N A;  4P45 A;  3TX8 A;  4RUH A;  4IIY A;  3VRQ A;  2HV2 A;  2A4N A;  4ZGY B;  4JZ0 A;  4YN3 A;  3TLY A;  1AYE A;  2AFZ A;  2I3C A;  1N71 A;  3OAK A;  3TO6 A;  3PBB A;  4R3L A;  3BUW B;  3D8P A;  1ELL P;  5JQ4 A;  3EZE A;  3VRO A;  2C6G A;  3QAH A;  4AVA A;  2AUN A;  3KQZ A;  1UWY A;  3TE4 A;  2PVW A;  2F5I A;  4OC3 A;  2FT0 A;  4QC6 A;  4YFJ A;  4JJX A;  2VBQ A;  4MHZ A;  4FD4 A;  4CO9 A;  4GS4 A;  3EZB A;  4FBE A;  3OB2 B;  3JVN A;  1PCA A;  4KUA A;  3VWD A;  5AGE A;  3K9T A;  5FD8 A;  2ZW7 A;  2ODF A;  5EC4 A;  1OZP A;  4MHN A;  3V7Z A;  4C7H A;  2AFS A;  2DLA A;  4PXD A;  3K9U A;  4TWE A;  1XEB A;  4B5P B;  4OME A;  4DYO A;  4TJX A;  5KTA A;  1Q5X A;  2EZB A;  1QSO A;  4TJV A;  1TXR A;  4C2Z A;  1CP7 A;  3H4Q A;  2BCO A;  2YNE A;  4MRI A;  4F9U A;  3GJZ A;  4A4C A;  4KLW A;  4JXR A;  3HPG G;  2GLJ A;  5HVF A;  1PU9 A;  1V0C A;  2Q43 A;  3D7G A;  2Z10 A;  2GRE A;  3G8W A;  3D2P A;  3HUV A;  4I49 A;  5H86 A;  3BLN A;  3SI1 A;  4AB7 A;  1R61 A;  2AUM A;  4EVY A;  2PJ6 A;  3FIX A;  4LQ6 A;  3RNZ A;  4H6U A;  4CYN A;  1S3Z A;  4MFK A;  1VBH A;  2XEI A;  4PQA A;  4ZI6 A;  2C5Q A;  2OOT A;  2PIZ A;  1YW6 A;  4CDJ A;  4B5O A;  2ATR A;  3B3V A;  3TO9 A;  4AVB A;  4COG A;  1NE9 A;  1WJT A;  1XMB A;  2C6P A;  5J3X A;  2JBK A;  1AUG A;  3D68 A;  4CAV A;  2FVG A;  2NYQ A;  4Y49 C;  1B6B A;  2BUE A;  4C9U A;  1KBL A;  1NMT A;  3VWE A;  1GHE A;  2Z3K A;  3D66 A;  2ZEL A;  3FXT A;  1ZG9 A;  4R76 A;  3PGP A;  3ZJ0 A;  3MN8 A;  2ZEO A;  4IK2 A;  4ZY0 A;  4M6H A;  5K8P A;  2PJ9 A;  4IUS A;  4OAE A;  1M4G A;  1LAM A;  1M4L A;  4ONW A;  1RO5 A;  4A39 A;  4O23 A;  2V8H A;  2B5G B;  1CM0 A;  3PB4 X;  2CTB A;  4UCM A;  4E0A A;  5KTD A;  2YNC A;  2Y1N A;  1IY7 A;  2V8G A;  2WYR A;  3N5F A;  3JRU A;  5JM6 A;  2XEJ A;  2X7B A;  2GFQ A;  2R98 A;  2REE A;  2Q4V A;  4BMH A;  3LWU A;  4KSA A;  4U9Y A;  1XF8 A;  1X10 A;  1VI4 A;  2YJV A;  3SJE A;  4W9Y A;  3T9Y A;  4NF1 A;  3ZZI A;  2D0P A;  4C99 A;  1K4J A;  1HEE A;  2J8N A;  3W91 A;  2CBL A;  1IB1 E;  2JEV A;  3CPA A;  3BJ8 A;  4MHD A;  3S9M A;  4KOT A;  3OWC A;  1TF8 A;  1VIX A;  2PCU A;  2WPX A;  4OIW A;  3D7F A;  3TOB A;  4B13 A;  1JDB C;  2E28 A;  2EK8 A;  2AFW A;  3TLA A;  4OC2 A;  2OH1 A;  1YGH A;  2REF A;  4XPL A;  5HKW A;  1L0C A;  1BO4 A; 
#chains in the Genus database with same CATH homology
 4C9E A;  4MCP A;  1Y9Z A;  3FF3 A;  3WC7 A;  4C86 A;  1XFO A;  1FT7 A;  4G1P A;  3I6S A;  4Z65 A;  3FH4 A;  1QQ9 A;  1VHE A;  4C85 A;  4ZY2 A;  1LFW A;  5LRG A;  4R8F A;  1HDQ A;  5K8M A;  4LQG A;  3B3C A;  3IEH A;  2EWB A;  4KSI A;  4X8I A;  1IGB A;  2RB7 A;  3BXM A;  2AFO A;  2QYV A;  2RFH A;  2V8V A;  3FEC A;  4C8T A;  1ZLI A;  1YLO A;  3DLJ A;  2ANP A;  3NA6 A;  1F57 A;  1JQG A;  1ARL A;  3BI1 A;  2ZEE A;  3B35 A;  5ELY A;  4KNG E;  3B3W A;  4B6Z A;  4P4I A;  3KR5 A;  2IQ6 A;  1BPM A;  5J1Q A;  4PXE A;  5D8N A;  2F8H A;  4YWY A;  1OBR A;  1YSJ A;  2PJB A;  3IJ3 A;  4MHY A;  2V8D A;  4PXC A;  3GUX A;  1V6C A;  3LMS A;  1LAP A;  1BLL E;  1R3N A;  1ZLH A;  3KZW A;  4WJB A;  4UIA A;  2BOA A;  5HVH A;  4NGS A;  1LCP A;  1Y0R A;  3GB0 A;  1EE3 P;  1XRY A;  3KR4 A;  1CX8 A;  4P4F A;  1TKJ A;  3KQX A;  1GYT A;  3CPX A;  1CBX A;  3SJF A;  3WAB A;  3WC6 A;  4OC5 A;  2J9A A;  4UF4 A;  4UEE A;  3SI0 A;  2PJ3 A;  2Q51 A;  3IIB A;  2PE3 A;  2ZEF A;  2PJC A;  4MMO A;  1Y7E A;  3B3T A;  2C6C A;  2QJ8 A;  3SI2 A;  5IB9 A;  3ISZ A;  4Q7A A;  4MCS A;  3FX6 A;  1XJO A;  3PB8 X;  4P6Y A;  2PJ7 A;  4OC1 A;  1ARM A;  1ZG8 A;  1Z8L A;  2PJ5 A;  4OP4 A;  2PIY A;  4PXB A;  3H8E A;  4F9V A;  5CBM A;  4OC4 A;  1XF1 A;  4EWT A;  4FAI A;  2DEA A;  3K2K A;  4F8Z A;  5F09 A;  4OID A;  2PJ1 A;  4WWV A;  1AMP A;  2PJ0 A;  2JEW A;  1WVM A;  1Z5R A;  4NGM A;  4ZY1 A;  2ZEP A;  5HXD A;  3SJX A;  2POK A;  3B7I A;  2VL1 A;  3NH4 A;  5LYF A;  2C1C A;  1Q7L A;  3ICU A;  3WT4 A;  3NH5 A;  2CTC A;  3T8W A;  1F2P A;  4OKO A;  3RBU A;  2EK9 A;  3NH8 A;  2HB6 A;  2HC9 A;  2F7V A;  3KGQ A;  5HVG A;  1VGY A;  2AFX A;  3RAM A;  4ZX8 A;  3KL9 A;  3QNV A;  1CPS A;  7CPA A;  4C8U A;  3ISX A;  2IMO A;  2PJA A;  3B2Y A;  3EIF A;  4ZX9 A;  3FEE A;  2ZEH A;  3L2N A;  4IHM A;  4C8P A;  2ZEG A;  4CDK A;  2PJ4 A;  1CG2 A;  1TKH A;  3S9L A;  1H8L A;  4AXV A;  3VH9 A;  3GLJ A;  4P10 A;  3FJU A;  3PB9 X;  2ZEM A;  3S9N A;  1LAN A;  4ZYQ A;  2ABZ A;  3PFO A;  5K8O A;  5DS0 A;  5JH9 A;  3IO1 A;  1Z2L A;  1HDU A;  3PEI A;  4UIB A;  3I1U A;  5I4M A;  4A38 A;  1DE4 C;  3CT9 A;  4H2K A;  4MCR A;  3PB7 X;  3TC8 A;  6CPA A;  4IAV A;  2PVV A;  1LOK A;  1CPX A;  2GU2 A;  2G9D A;  4A37 A;  4P4E A;  2IJZ A;  3FMC A;  4C9R A;  4MCQ A;  3HLP A;  1YW4 A;  2CIJ A;  4DJL A;  1BAV A;  4BD9 A;  2OR4 A;  1RTQ A;  2ZOF A;  4X3R A;  3D67 A;  4NGP A;  3FED A;  3PBE A;  3RZA A;  1R43 A;  2PJ8 A;  4UEZ A;  4CPA A;  2AFM A;  4NGR A;  3DGV A;  4UEF A;  3V38 A;  4JYW A;  2NSM A;  1BPN A;  4P44 A;  2ZOG A;  3KI9 A;  4NGQ A;  2BO9 A;  5LYD A;  5IR2 A;  3KAS A;  1TF9 A;  4GM5 A;  1TKF A;  4TNU A;  3IFE A;  4MHP A;  4C9A A;  2ZEN A;  3D7H A;  2GLF A;  4DUK A;  1CP6 A;  5LYI A;  4P4B A;  1XBU A;  4NJR A;  3H8G A;  4NFR A;  1ELM P;  4MXU A;  4K3N A;  4C8A A;  3WC5 A;  2JBJ A;  4NJQ A;  2V77 A;  4C8C A;  3KHX A;  1VHO A;  5LYL A;  4R6T A;  1NSA A;  4FUU A;  3PRT A;  4PPZ A;  5THW A;  4OC0 A;  2O4H A;  2PRQ A;  4C8F A;  3D4U A;  8CPA A;  3NFZ A;  2ZED A;  3VAR A;  4C84 A;  4FWU A;  3CDX A;  4YU9 A;  3B3S A;  5LRJ A;  2GP4 A;  1QMU A;  3SJG A;  1PYT B;  2XEG A;  4X2T A;  2O53 A;  1Y0Y A;  2Q4Z A;  5D29 A;  1DTD A;  2XEF A;  2WZN A;  3PFE A;  3VTA A;  1KWM A;  4NGN A;  5K8N A;  3MRU A;  4EME A;  1FNO A;  2CF4 A;  4P4D A;  2AFU A;  4A94 A;  3VAT A;  2QVP A;  1F2O A;  3D7D A;  2PJ2 A;  3KHZ A;  4EFD A;  3BI0 A;  5JGF A;  4C9V A;  3IC1 A;  3FVL A;  1ZG7 A;  5CPA A;  4NGT A;  4P4J A;  1YME A;  3H8F A;  5LRK A;  3I74 A;  3IWW A;  3BHX A;  3PB6 X;  4R7M A;  4P45 A;  3TX8 A;  4RUH A;  4JZ0 A;  4YN3 A;  1AYE A;  2AFZ A;  2I3C A;  3PBB A;  1ELL P;  2C6G A;  3KQZ A;  1UWY A;  2PVW A;  4OC3 A;  4MHZ A;  4FBE A;  1PCA A;  3K9T A;  4MHN A;  3V7Z A;  2AFS A;  4PXD A;  4TWE A;  4TJX A;  4OME A;  4DYO A;  4TJV A;  1TXR A;  1CP7 A;  2BCO A;  4MRI A;  4F9U A;  2GLJ A;  5HVF A;  2Q43 A;  3D7G A;  3HUV A;  2GRE A;  3SI1 A;  2PJ6 A;  2XEI A;  4PQA A;  4ZI6 A;  2C5Q A;  2OOT A;  2PIZ A;  1YW6 A;  4CDJ A;  3B3V A;  1XMB A;  2C6P A;  3D68 A;  2JBK A;  2FVG A;  2NYQ A;  4C9U A;  3D66 A;  4R76 A;  2ZEL A;  1ZG9 A;  3MN8 A;  2ZEO A;  4IK2 A;  4ZY0 A;  5K8P A;  2PJ9 A;  1LAM A;  1M4L A;  4ONW A;  4A39 A;  4O23 A;  2V8H A;  3PB4 X;  2CTB A;  1IY7 A;  2V8G A;  2WYR A;  3N5F A;  3JRU A;  5JM6 A;  2XEJ A;  3LWU A;  3SJE A;  4W9Y A;  4C99 A;  1HEE A;  3CPA A;  3S9M A;  1TF8 A;  1VIX A;  2PCU A;  4OIW A;  3D7F A;  2EK8 A;  2AFW A;  4OC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...