4MCSA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) his475tyr variant in complex with glutamic acid
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVYNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 266
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcsA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcsA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcsA02
2XEJA 4K3NA 1AYEA 1BPMA 3WC7A 2CF4A 3BHXA 1GYTA 1XRYA 3D66A 3KR4A 4C9AA 1TF9A 1DTDA 5HVFA 4R8FA 3GB0A 3MN8A 3N5FA 3NH4A 3CDXA 3KL9A 4P6YA 3NFZA 5IB9A 3PB8X 3H8GA 2NYQA 2Q51A 4P10A 2O4HA 2ANPA 4ZX8A 1XBUA 4ZY0A 4TJXA 2AFSA 1ZLIA 4IHMA 2AFWA 3FEEA 2XEFA 3B35A 2V8VA 4RUHA 1UWYA 1PCAA 1HEEA 2AFOA 4AXVA 1TKJA 2CTCA 4DYOA 4GM5A 4P4DA 1CP7A 3SJGA 3D68A 4PQAA 1F2OA 5I4MA 2BCOA 2C6PA 4TNUA 3B3TA 4A94A 3D7GA 3SJEA 1OBRA 4P4JA 7CPAA 4C9RA 3BXMA 1XFOA 3JRUA 4NGMA 4MRIA 3FF3A 1LANA 2PJ1A 1R43A 3VATA 3WABA 3FECA 3FJUA 2V8HA 3B2YA 2ZEFA 2F7VA 2AFZA 4UEFA 4LQGA 2IMOA 3DGVA 4P45A 1VHOA 1YMEA 3VTAA 4Z65A 2WZNA 3IC1A 1YW4A 2PJAA 3K9TA 3S9NA 3RBUA 2AFUA 2HB6A 4OMEA 4ZY1A 1LAPA 4X8IA 2ZENA 2DEAA 4F9VA 1ARLA 4OC1A 2PJBA 4OP4A 3ICUA 1ZG7A 3BI1A 4DJLA 3PBEA 4NGRA 3PRTA 4NFRA 1BPNA 2BO9A 5LYDA 3KASA 3CT9A 4OC5A 4C8AA 6CPAA 3K2KA 2XEIA 3B3WA 5LRKA 2PJ3A 3IEHA 4JYWA 4EFDA 1H8LA 5ELYA 4C9EA 4NGPA 4ZY2A 2AFMA 2C1CA 1ZG8A 4C9VA 4UIAA 3PB4X 4A39A 1HDQA 3TX8A 1F57A 4MCPA 2POKA 3IWWA 1CP6A 3BI0A 4R7MA 4X2TA 3KHZA 1V6CA 5HVHA 1CPSA 1YW6A 3PBBA 3HUVA 2PVVA 3V38A 4TWEA 3PB6X 1YSJA 5DS0A 2JBKA 1CG2A 1Z2LA 2O53A 1ZG9A 3D7HA 1Y7EA 2PJ7A 3S9LA 2PJCA 5JH9A 4X3RA 4FWUA 2PIZA 5CPAA 1RTQA 3DLJA 3NH5A 4C8TA 4W9YA 2V77A 5LYFA 3IIBA 3VARA 1EE3P 4A37A 3D67A 8CPAA 3GUXA 1TXRA 4MXUA 1TKHA 1JQGA 3KQZA 3PB7X 2EK9A 2GLJA 4P4BA 1VHEA 3NH8A 4MHNA 2PCUA 2ZEOA 2Q4ZA 4C9UA 3KI9A 1F2PA 2G9DA 4H2KA 2ZEEA 3D7FA 3SI2A 4C85A 4ZI6A 1ELLP 3KQXA 3KHXA 4P44A 1VIXA 1CX8A 2OR4A 1YLOA 4C8UA 4MHPA 5CBMA 2ZEGA 4CPAA 1Y0RA 2I3CA 3LWUA 4NJRA 3HLPA 2ZOFA 5J1QA 4F8ZA 4F9UA 1BLLE 3V7ZA 1HDUA 3PFOA 3IJ3A 1ZLHA 3LMSA 4YWYA 4PXCA 2V8DA 4UEZA 4OC0A 1LOKA 4OC2A 4CDJA 3H8FA 4C8FA 3CPAA 2JBJA 4KSIA 3D4UA 5D8NA 3H8EA 3I1UA 3FH4A 2C6GA 2JEWA 3ISXA 2ZELA 1BAVA 2QJ8A 4C8CA 3L2NA 4OC3A 3SJFA 3SJXA 1CPXA 4ZYQA 1IY7A 3PB9X 4C84A 2J9AA 2PJ4A 4OIWA 4NGNA 4MCQA 5LYLA 4OKOA 2WYRA 3KR5A 1XMBA 2RFHA 4UIBA 5D29A 1QMUA 4FUUA 1Y0YA 4WWVA 2ZOGA 1LAMA 3CPXA 4C86A 1FNOA 4MCRA 1QQ9A 3IFEA 4MHZA 4FAIA 3QNVA 3B3CA 4WJBA 4UEEA 4YU9A 2PJ0A 3KZWA 4O23A 4ONWA 5THWA 3SI0A 2GU2A 1AMPA 2PE3A 5K8NA 3WC6A 4UF4A 4YN3A 4BD9A 1ELMP 2PRQA 3IO1A 2EK8A 4IK2A 2VL1A 3FMCA 4MCSA 5F09A 3RAMA 4NGQA 2PJ8A 3WT4A 1PYTB 3VH9A 1WVMA 1Z5RA 1NSAA 5HVGA 5K8OA 1XJOA 3GLJA 4R76A 5K8MA 3D7DA 4NJQA 1DE4C 3FX6A 4MHYA 4NGSA 2PJ9A 3WC5A 1TF8A 3TC8A 4ZX9A 3NA6A 3KGQA 2ZEHA 2PJ6A 1R3NA 2GREA 4PXEA 4MMOA 2EWBA 1M4LA 2ZEMA 2RB7A 2C6CA 2XEGA 2FVGA 3FVLA 5K8PA 4PPZA 3EIFA 4C99A 4CDKA 3PEIA 4C8PA 2NSMA 3I6SA 3B3VA 3B7IA 2ZEDA 3ISZA 2F8HA 4Q7AA 2AFXA 5HXDA 2CTBA 2CIJA 2IQ6A 1CBXA 1LCPA 1ARMA 2ZEPA 4PXBA 4EMEA 1IGBA 1VGYA 4A38A 3RZAA 4R6TA 4KNGE 5JM6A 3SI1A 2QVPA 2GLFA 2V8GA 3I74A 4OIDA 1TKFA 1Y9ZA 4P4IA 4PXDA 2ABZA 5JGFA 2IJZA 1Z8LA 5LYIA 5LRGA 3FEDA 3PFEA 2PVWA 4IAVA 1LFWA 3B3SA 4G1PA 4EWTA 2BOAA 4B6ZA 4TJVA 5LRJA 1Q7LA 2OOTA 4P4EA 4NGTA 2HC9A 2Q43A 2PJ2A 1FT7A 4P4FA 4DUKA 2PJ5A 3MRUA 3T8WA 4JZ0A 4FBEA 2PIYA 1KWMA 1XF1A 4OC4A 3S9MA 2QYVA
chains in the Genus database with same CATH superfamily
2B5GB 4XPKA 4R87A 2XEJA 5KTAA 5BY0A 2QMLA 4K3NA 1AYEA 5HKYA 1BPMA 1I21A 2CF4A 4ORFA 3WC7A 3BHXA 1GYTA 1XRYA 3D66A 3KR4A 4KOUA 1TF9A 2CY2A 5A28A 1NXJA 4C9AA 1DTDA 2WSAA 3F5BA 1ZRSA 1X12A 2VKZG 5HVFA 4R8FA 2YNCA 3F9KC 5HKWA 3GB0A 3JUWA 4UWJA 5H84A 4XNHB 1SQHA 2WUUA 3FB3A 3MN8A 3TCVA 4F0XA 3P2FA 3BUMB 2JLMA 3N5FA 1QSNA 3NH4A 2BL1A 3CDXA 3KL9A 2DIKA 2Y1MA 1KUXA 2REEA 3NFZA 4P6YA 4YRHA 4BPWB 1S7KA 3TO6A 5IB9A 5AG6A 4HPSA 2ZXVA 3PB8X 3H8GA 3BUWB 3OAKA 2NYQA 2Q51A 2O4HA 5AXIA 1Y9WA 2RC4A 4P10A 1KUVA 1MJAA 3FXTA 2ANPA 4ZX8A 3GIUA 4M85A 4L8AA 1XBUA 1NE9A 2REFA 4ZY0A 4TJXA 2VI7A 2AFSA 2YNEA 3CXQA 3FBUA 1ZLIA 3T9YA 1YVOA 4IHMA 1ZYMA 3T5MA 2AFWA 3FEEA 2XEFA 3B35A 2V8VA 4RUHA 1UWYA 1ZL0A 1Y9KA 4UWIA 1PCAA 2ATRA 1P4NA 5F48A 2CXAA 2XPPA 1HEEA 2AFOA 4RI1A 1Q5XA 4C2ZA 4UBRA 4A4CA 3PFVA 4AXVA 1TKJA 2CTCA 1MJ9A 3EFAA 2AUNA 5EC4A 2EUIA 2Y0MA 3S6FA 1K4JA 2DXQA 4PSWA 2P6FA 4GM5A 4DYOA 4P4DA 1BO4A 1CP7A 2R8VA 4JXRA 5IV0A 1GGOA 1IOIA 3SJGA 2ZW6A 3D68A 4FD7A 4PQAA 1F2OA 5I4MA 3EZEA 2BCOA 3D3SA 3EXNA 3WR7A 4AG7A 1C3OB 2C6PA 4C2XA 4YFJA 5KTCA 1ZO0A 5EBVA 1Q2YA 3B3TA 4TNUA 3A9LA 3TO9A 4A94A 1IICA 2D4PA 2J8MA 3W6SA 3D7GA 2FXFA 3SJEA 4R3LA 4U9ZA 1OBRA 2C5QA 2YGWA 4B5PA 4P4JA 4H1HA 7CPAA 3TYXA 4C9RA 3BXMA 1XFOA 3JRUA 4NGMA 4MRIA 3FF3A 5BWAB 1LANA 4M8DA 1NSLA 3H4QA 3IU2A 2PJ1A 1R43A 3VATA 3WABA 3FECA 4A32A 4CRZB 2Z3OA 3FJUA 2V8HA 4NEXA 1M4IA 2PSWA 3B2YA 2EZBA 2ZEFA 2FIWA 2FSRA 2F7VA 4GXHA 4Q38A 3FIXA 4R9MA 5IB0A 2AFZA 4C7HA 1I1DA 2H5MA 1J3LA 4UEFA 3GYAA 4LQGA 2IMOA 3DGVA 1BOBA 3SHPA 4P45A 2EZAA 1VHOA 1YMEA 2JDCA 3VTAA 4Z65A 2WZNA 3R96A 3IC1A 1WJTA 1T36B 2ODFA 1YW4A 2PJAA 3K9TA 3S9NA 3RBUA 2AFUA 2HV2A 2I00A 2HB6A 4OMEA 4ZY1A 1LAPA 1YK3A 1IOFA 2Z3KA 2G3AA 4X8IA 2ZENA 4AVBA 2DEAA 1L0CA 5F46A 4F9VA 4BINA 4XPLA 1XF8A 1ARLA 4OC1A 1YLEA 2PJBA 3D2PA 4OP4A 1UFHA 3ICUA 1ZG7A 3R9GA 4RS2A 4KOSA 3BI1A 3G8WA 4AVCA 4DJLA 1IYKA 3PBEA 4NGRA 3PRTA 1S7FA 1BPNA 2BO9A 4HNXB 4NFRA 5DWMA 5LYDA 3LD2A 3SR3A 3KASA 3VGOA 1B87A 3U88C 3CT9A 4KUBA 4OC5A 3D2MA 4C8AA 1S3ZA 4B14A 6CPAA 3K4IA 4JXQA 3K2KA 1S7LA 3HMJG 2XEIA 3B3WA 1Z8TA 5LRKA 2PJ3A 3EO4A 5FD8A 4EVYA 3IEHA 4JYWA 5DWNA 3VRNA 5J3XA 4EFDA 3O8ZA 1A2ZA 1H8LA 1XIXA 4CAFA 5ELYA 4II9A 3TLYA 3EY5A 5H86A 4LUAA 3TLGB 4C9EA 3W6XA 1IYLA 3JTKA 4NGPA 4ZY2A 3FNCA 3DDDA 5I0CA 2AFMA 2C1CA 4BTFA 2GE3A 1ZG8A 1RXTA 2B4JC 3EZAA 3OP0A 2HWGA 4XPDC 1BXRB 4EYSA 4KVXA 4Y49C 3I3GA 3F8KA 4C9VA 2YJVA 4KS9A 4UIAA 3PB4X 3TLEA 4NCZA 4A39A 2X0SA 1HDQA 2XPNA 2EBJA 2R7HA 2N3AB 4KOTA 5E96A 3TX8A 1VBGA 2ZW5A 5JPHA 1YQEA 1M1DA 4CAVA 1I12A 1F57A 1M44A 4MCPA 2POKA 2J8RA 2ZW7A 3IWWA 4UCPA 3RNZA 1CP6A 4CS0B 3BI0A 3FRMA 3PP9A 4R7MA 4B5OA 1LRZA 2EVNA 1Z9UA 3UY5A 4X2TA 2GIVA 3KHZA 1V6CA 4MFPA 5HVHA 5IX3A 1CPSA 1YW6A 3PBBA 3HUVA 4YGOA 2PVVA 4H6ZA 4TWEA 3V38A 4BMHA 1R57A 4CGNA 4A4BA 4HNYB 2PQ8A 3PB6X 3T90A 1YSJA 1Q2DA 4IIXA 1S5KA 2P0WA 5DS0A 2Z3NA 3DSBA 1DIKA 2Q44A 3CXPA 1FBVA 4KOYA 4X5KA 4COBA 4KZTA 2JBKA 4E5SA 1CG2A 1CJWA 1Z2LA 2O53A 1ZG9A 3D7HA 1Y7EA 2PJ7A 3S9LA 2PJCA 4C2YA 4X3RA 4FWUA 5JH9A 2PIZA 2Z0ZA 4CGOA 5CPAA 1RTQA 3BLNA 1M4DA 3DLJA 3NH5A 3R95A 4W9YA 2V77A 1QSOA 4A33A 4C8TA 1QSMA 5LYFA 3IIBA 2FT0A 1YR0A 3VARA 5AG5A 3LACA 2GANA 1EE3P 1X10A 5ISVA 4MFQA 4A37A 3D67A 1XOVA 2WPXA 8CPAA 3GUXA 3TLCA 1TXRA 4MXUA 1TKHA 1JQGA 2D4OA 3KQZA 2B4BA 3PB7X 1YGHA 3VWEA 1ON0A 3QAHA 2EK9A 2GLJA 3VWDA 4P4BA 1VHEA 3NH8A 4K30A 4MHNA 5F47A 2PCUA 2ZEOA 2Q4ZA 4C9UA 3VROA 3KI9A 1EO0A 4MI4A 1F2PA 2G9DA 4H2KA 2ZEEA 3D7FA 3SI2A 4C85A 2ZW4A 4ZI6A 3T05A 3NOJA 1ELLP 3KHXA 3KQXA 4KOWA 4P44A 1EZBA 1VIXA 1CX8A 2OR4A 1YLOA 2JEVA 3D8PA 4C8UA 4MHPA 5CBMA 2PR8A 3GY9A 2XPLA 2ZEGA 3BUNB 1IIDA 2B3VA 4CPAA 1Y0RA 2G0BA 2YJTA 2VEZA 5JVLA 3E0KA 2I3CA 3LWUA 4U9YA 2B0AA 4NJRA 4JWPA 4QVTA 1M6VB 3HLPA 2ZOFA 2F5IA 5J8CA 5G1ZA 4ZBGA 5J1QA 4FD4A 4F8ZA 4F9UA 2CBLA 1BLLE 3HPHE 4KVME 3V7ZA 5KTDA 3RYOA 5AG7A 4RR2B 1HDUA 2J8NA 3PFOA 3IJ3A 1QSRA 1V0CA 1N71A 1ZLHA 3LMSA 3S6KA 4CYPA 2UV8G 2ARHA 3B8GA 3CXSA 2V8DA 4JD6A 4PXCA 4UEZA 4YWYA 3CZXA 4ZGYB 4PK2A 2OB0A 5A27A 3TLGA 4OC0A 5F13A 2IL4A 4QC6A 1LOKA 4NF1A 4OC2A 3TOBA 4CDJA 3H8FA 4C8FA 3CPAA 3C26A 4B10A 2JBJA 4MJ8A 1RO5A 2B58A 4KSIA 1U6MA 3D4UA 4LQ6A 5D8NA 2Q7SA 3H8EA 2DPSA 3I1UA 4J0NA 4HNWB 1OZPA 3FH4A 2Z3MA 2FM4A 2C6GA 2JEWA 4A30A 4CGMA 3ISXA 1PU9A 2ZELA 1BAVA 2QJ8A 3DNSA 4UFXA 3TOAA 3VRRA 3TTHA 4C8CA 3LODA 2OLSA 3BJ7A 2K5TA 2GFQA 3L2NA 4OC3A 3SJFA 4UFWA 3T07A 1MK4A 3SJXA 1CPXA 4ZYQA 1KEEB 3PLFB 1IY7A 3PB9X 3R1KA 4QUSA 4C84A 2J9AA 4OLLA 5AGEA 3BJ8A 1VBHA 2PJ4A 4MFLA 4OIWA 4NGNA 1QSTA 2AJ6A 4MCQA 3DR8A 4C7IA 4QB9A 4AVAA 5LYLA 4OKOA 5K99A 4J3GA 2PDOA 2WYRA 3KR5A 1Z4EA 4KSAA 4CYOA 1XMBA 4L89A 2RFHA 3GKRA 4UIBA 2Y1NA 1VKCA 2Z10A 5D29A 2Q7BA 1QMUA 3S6HA 3QAYA 4FUUA 2CNTA 4XNHC 1Y0YA 4WWVA 2ZOGA 2HQYA 3TLZA 1LAMA 3CPXA 4FD5A 4C86A 5HH1A 2PRBA 1FNOA 4MCRA 1QQ9A 3IFEA 5AG4A 3KRVA 4MHZA 2EO8A 4FAIA 3ZNIA 3QNVA 3KKWA 3B3CA 4CO9A 4CAWA 4FD6A 4WJBA 4KSFA 3NE7A 4UEEA 4YU9A 1JWQA 4LX9A 2PJ0A 3KZWA 5HKZA 4O23A 4ONWA 5THWA 2OZHA 1JDEA 4MHDA 3SI0A 2GU2A 2QECA 3JVNA 4KUAA 2KCWA 1AMPA 4BPUB 4CRYB 2PE3A 5F49A 5K8NA 1B6BA 4CAEA 5EMIA 2OH1A 4I49A 3WC6A 3C8OA 4KORA 2XPOA 3R9FA 1YVHA 4KLVA 3G3SA 4UF4A 3BUXB 4MY3A 4YN3A 1YREA 1WK4A 2G3TA 2WPWA 4PV6A 4BD9A 4UCNA 1GHEA 2X7BA 1ELMP 2B4DB 4F6AA 2PRQA 3IO1A 2D0OA 3EC4A 2EK8A 4IK2A 3IU1A 2YNCC 5JYBA 2VZZA 2YNDA 2Z3LA 2Q4VA 4NXYA 2VL1A 3IWEA 1S60A 1Z9EA 2ZPAA 4MCSA 3FMCA 5F09A 4HKFA 4AB7A 2B3UA 4NGQA 4U5YA 2PJ8A 3RAMA 2FS5A 4IUSA 1JDBC 4MBUA 1Z8XA 3T0TA 4XPDB 5IR2A 2HUZA 2P6EA 4CDKA 3WT4A 4Y49B 3SXNA 1IB1E 1XMTA 1PYTB 3VH9A 1WVMA 1Z5RA 1NSAA 3MGDA 3R9EA 5HVGA 5K8OA 1XJOA 2BEIA 4A2ZA 3TLBA 4BBHA 4R3KA 3GLJA 2I79A 3TO7A 4DNCA 4R76A 2P6GA 3D7DA 5K8MA 4NJQA 4RN7A 4AG9A 1DE4C 1C30B 3FX6A 2D0PA 4MHYA 4NGSA 4E2AA 4CGPA 2PJ9A 4KVOE 3WC5A 1TF8A 3TFYA 1Q2CA 3I9SA 2VXKA 3TC8A 4E8OA 4NSQA 2AUMA 3EZBA 3NE8A 4ZX9A 3NA6A 3KGQA 2ZEHA 2PJ6A 1TIQA 4MJXA 1R3NA 2GREA 4PXEA 4KLWA 4MMOA 3TLAA 2Q0YA 4CZ1A 2HI6A 2EWBA 4M6GA 1FY7A 1M4LA 4M6HA 2ZEMA 2RB7A 2C6CA 2Q4YA 1XE4A 3ZJ0A 2XEGA 2FVGA 3FVLA 5K8PA 3OB1B 1KUYA 2CNMA 4PPZA 1A9XB 3EIFA 3PEIA 4C99A 1KZFA 4C8PA 3DR6A 4H89A 3PT1A 4B12A 2BUEA 2NSMA 3I6SA 3IWGA 3B3VA 4MFZA 3B7IA 3GJZA 1KBLA 1VHSA 2ZEDA 1IU8A 1YX0A 5C82A 3ISZA 3OWCA 3H5ZA 4M6IA 4MFJA 1S7NA 2F8HA 2AFXA 4GS4A 4Q7AA 5HXDA 2CTBA 3S6GA 2CIJA 4OAEA 2A4NA 3F0AA 3RO0A 1VI4A 2IQ6A 1Z4RA 1CBXA 4C68A 3P2HA 4JLYA 4OADA 2DLAA 1LCPA 4PK3A 2E28A 4F0YA 3TE4A 1ARMA 1XEBA 2FIAA 2ZEPA 3ZZIA 2MP0A 4PSXA 2Z11A 2OU2A 4CYNA 4UCMA 4MFKA 4PXBA 4EMEA 1IGBA 1M4GA 1VGYA 3U1BA 2GP4A 4A38A 3G23A 3RZAA 4R6TA 1Z8WA 5JM6A 4KNGE 2HROA 3SI1A 4MY0A 3HPGG 3BUOB 2GLFA 2C27A 2NMTA 2QVPA 2V8GA 2R82A 4JVOA 3I74A 1CM0A 4INJA 4OIDA 1NMTA 1TKFA 1CS0B 1Y9ZA 2JDDA 2OZUA 2FCKA 3PZJA 4R57A 3NFQA 5JQ4A 5F5XA 4P4IA 2PCNA 2VQYA 4PXDA 1EZAA 2ABZA 5G22A 5JGFA 1Y7RA 5G20A 1AUGA 4M3SA 2IJZA 1Z8LA 2DF5A 4Q36A 2B5GA 1WWZA 2Q04A 5G21A 2FL4A 2B4DA 3PGPA 4A95A 4CYQA 5LYIA 3VRQA 2PR1A 4B5PB 4KOXA 5LRGA 4CGLA 3FEDA 3VRPA 3PFEA 2VBQA 4IIYA 4QBJA 5HMNA 1KC7A 2R98A 2O28A 3IGRA 4E94A 3SXOA 2Z3PA 2PVWA 2FE7A 3N7ZA 4IAVA 1LFWA 4GPLB 1MJBA 2DPTA 3B3SA 4G1PA 1CE8B 4EWTA 2BOAA 2BSWA 3V8IA 4B6ZA 5LRJA 4TJVA 1Q7LA 2OOTA 2R1IA 5CNPA 2OZGA 3OB2B 2QIRA 1NBWA 4P4EA 4UFVA 5C88A 4B11A 4NGTA 4JJXA 5FVJA 2HC9A 5J8FA 2Q43A 1PUAA 2AE6A 3FYNA 2PJ2A 4CAXA 1FT7A 4B13A 4P4FA 3W91A 2PJ5A 3MRUA 4DUKA 1P0HA 2VZYA 4H6UA 3K9UA 3T8WA 3TT2A 5F9MA 1R61A 4JZ0A 2EZCA 5F1YA 1B47A 2CNSA 4KOVA 4FBEA 4ONUA 4UA3A 4E0AA 1YVKA 4IF5A 4BPXB 2PIYA 4MI1A 3QB8A 1KWMA 5GCNA 1J4JA 1XF1A 4COGA 4A31A 4OC4A 3S9MA 2PC1A 2QYVA
chains in the Genus database with same CATH topology
2XEJA 4K3NA 1AYEA 1BPMA 3WC7A 2CF4A 3BHXA 1GYTA 1XRYA 3D66A 3KR4A 4C9AA 1TF9A 1DTDA 5HVFA 4R8FA 3GB0A 3MN8A 3N5FA 3NH4A 3CDXA 3KL9A 4P6YA 3NFZA 5IB9A 3PB8X 3H8GA 2NYQA 2Q51A 4P10A 2O4HA 2ANPA 4ZX8A 1XBUA 4ZY0A 4TJXA 2AFSA 1ZLIA 4IHMA 2AFWA 3FEEA 2XEFA 3B35A 2V8VA 4RUHA 1UWYA 1PCAA 1HEEA 2AFOA 4AXVA 1TKJA 2CTCA 4DYOA 4GM5A 4P4DA 1CP7A 3SJGA 3D68A 4PQAA 1F2OA 5I4MA 2BCOA 2C6PA 4TNUA 3B3TA 4A94A 3D7GA 3SJEA 1OBRA 2C5QA 4P4JA 7CPAA 4C9RA 3BXMA 1XFOA 3JRUA 4NGMA 4MRIA 3FF3A 1LANA 2PJ1A 1R43A 3VATA 3WABA 3FECA 3FJUA 2V8HA 3B2YA 2ZEFA 2F7VA 2AFZA 4UEFA 4LQGA 2IMOA 3DGVA 4P45A 1VHOA 1YMEA 3VTAA 4Z65A 2WZNA 3IC1A 1YW4A 2PJAA 3K9TA 3S9NA 3RBUA 2AFUA 2HB6A 4OMEA 4ZY1A 1LAPA 4X8IA 2ZENA 2DEAA 4F9VA 1ARLA 4OC1A 2PJBA 4OP4A 3ICUA 1ZG7A 3BI1A 4DJLA 3PBEA 4NGRA 3PRTA 4NFRA 1BPNA 2BO9A 5LYDA 3KASA 3CT9A 4OC5A 4C8AA 6CPAA 3K2KA 2XEIA 3B3WA 5LRKA 2PJ3A 3IEHA 4JYWA 4EFDA 1H8LA 5ELYA 4C9EA 4NGPA 4ZY2A 2AFMA 2C1CA 1ZG8A 4C9VA 4UIAA 3PB4X 4A39A 1HDQA 3TX8A 1F57A 4MCPA 2POKA 3IWWA 1CP6A 3BI0A 4R7MA 4X2TA 3KHZA 1V6CA 5HVHA 1CPSA 1YW6A 3PBBA 3HUVA 2PVVA 3V38A 4TWEA 3PB6X 1YSJA 5DS0A 2JBKA 1CG2A 1Z2LA 2O53A 1ZG9A 3D7HA 1Y7EA 2PJ7A 3S9LA 2PJCA 5JH9A 4X3RA 4FWUA 2PIZA 5CPAA 1RTQA 3DLJA 3NH5A 4C8TA 4W9YA 2V77A 5LYFA 3IIBA 3VARA 1EE3P 4A37A 3D67A 8CPAA 3GUXA 1TXRA 4MXUA 1TKHA 1JQGA 3KQZA 3PB7X 2EK9A 2GLJA 4P4BA 1VHEA 3NH8A 4MHNA 2PCUA 2ZEOA 2Q4ZA 4C9UA 3KI9A 1F2PA 2G9DA 4H2KA 2ZEEA 3D7FA 3SI2A 4C85A 4ZI6A 1ELLP 3KQXA 3KHXA 4P44A 1VIXA 1CX8A 2OR4A 1YLOA 4C8UA 4MHPA 5CBMA 2ZEGA 4CPAA 1Y0RA 2I3CA 3LWUA 4NJRA 3HLPA 2ZOFA 5J1QA 4F8ZA 4F9UA 1BLLE 3V7ZA 1HDUA 3PFOA 3IJ3A 1ZLHA 3LMSA 4YWYA 4PXCA 2V8DA 4UEZA 4OC0A 1LOKA 4OC2A 4CDJA 3H8FA 4C8FA 3CPAA 2JBJA 4KSIA 3D4UA 5D8NA 3H8EA 3I1UA 3FH4A 2C6GA 2JEWA 3ISXA 2ZELA 1BAVA 2QJ8A 4C8CA 3L2NA 4OC3A 3SJFA 3SJXA 1CPXA 4ZYQA 1IY7A 3PB9X 4C84A 2J9AA 2PJ4A 4OIWA 4NGNA 4MCQA 5LYLA 4OKOA 2WYRA 3KR5A 1XMBA 2RFHA 4UIBA 5D29A 1QMUA 4FUUA 1Y0YA 4WWVA 2ZOGA 1LAMA 3CPXA 4C86A 1FNOA 4MCRA 1QQ9A 3IFEA 4MHZA 4FAIA 3QNVA 3B3CA 4WJBA 4UEEA 4YU9A 2PJ0A 3KZWA 4O23A 4ONWA 5THWA 3SI0A 2GU2A 1AMPA 2PE3A 5K8NA 3WC6A 4UF4A 4YN3A 4BD9A 1ELMP 2PRQA 3IO1A 2EK8A 4IK2A 2VL1A 3FMCA 4MCSA 5F09A 3RAMA 4NGQA 2PJ8A 5IR2A 3WT4A 1PYTB 3VH9A 1WVMA 1Z5RA 1NSAA 5HVGA 5K8OA 1XJOA 3GLJA 4R76A 5K8MA 3D7DA 4NJQA 1DE4C 3FX6A 4MHYA 4NGSA 2PJ9A 3WC5A 1TF8A 3TC8A 4ZX9A 3NA6A 3KGQA 2ZEHA 2PJ6A 1R3NA 2GREA 4PXEA 4MMOA 2EWBA 1M4LA 2ZEMA 2RB7A 2C6CA 2XEGA 2FVGA 3FVLA 5K8PA 4PPZA 3EIFA 4C99A 4CDKA 3PEIA 4C8PA 2NSMA 3I6SA 3B3VA 3B7IA 2ZEDA 3ISZA 2F8HA 4Q7AA 2AFXA 5HXDA 2CTBA 2CIJA 2IQ6A 1CBXA 1LCPA 1ARMA 2ZEPA 4PXBA 4EMEA 1IGBA 1VGYA 2GP4A 4A38A 3RZAA 4R6TA 4KNGE 5JM6A 3SI1A 2QVPA 2GLFA 2V8GA 3I74A 4OIDA 1TKFA 1Y9ZA 4P4IA 4PXDA 2ABZA 5JGFA 2IJZA 1Z8LA 5LYIA 5LRGA 3FEDA 3PFEA 2PVWA 4IAVA 1LFWA 3B3SA 4G1PA 4EWTA 2BOAA 4B6ZA 4TJVA 5LRJA 1Q7LA 2OOTA 4P4EA 4NGTA 2HC9A 2Q43A 2PJ2A 1FT7A 4P4FA 4DUKA 2PJ5A 3MRUA 3T8WA 4JZ0A 4FBEA 2PIYA 1KWMA 1XF1A 4OC4A 3S9MA 2QYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XEJ A;  4K3N A;  1AYE A;  1BPM A;  3WC7 A;  2CF4 A;  3BHX A;  1GYT A;  1XRY A;  3D66 A;  3KR4 A;  4C9A A;  1TF9 A;  1DTD A;  5HVF A;  4R8F A;  3GB0 A;  3MN8 A;  3N5F A;  3NH4 A;  3CDX A;  3KL9 A;  4P6Y A;  3NFZ A;  5IB9 A;  3PB8 X;  3H8G A;  2NYQ A;  2Q51 A;  4P10 A;  2O4H A;  2ANP A;  4ZX8 A;  1XBU A;  4ZY0 A;  4TJX A;  2AFS A;  1ZLI A;  4IHM A;  2AFW A;  3FEE A;  2XEF A;  3B35 A;  2V8V A;  4RUH A;  1UWY A;  1PCA A;  1HEE A;  2AFO A;  4AXV A;  1TKJ A;  2CTC A;  4DYO A;  4GM5 A;  4P4D A;  1CP7 A;  3SJG A;  3D68 A;  4PQA A;  1F2O A;  5I4M A;  2BCO A;  2C6P A;  4TNU A;  3B3T A;  4A94 A;  3D7G A;  3SJE A;  1OBR A;  4P4J A;  7CPA A;  4C9R A;  3BXM A;  1XFO A;  3JRU A;  4NGM A;  4MRI A;  3FF3 A;  1LAN A;  2PJ1 A;  1R43 A;  3VAT A;  3WAB A;  3FEC A;  3FJU A;  2V8H A;  3B2Y A;  2ZEF A;  2F7V A;  2AFZ A;  4UEF A;  4LQG A;  2IMO A;  3DGV A;  4P45 A;  1VHO A;  1YME A;  3VTA A;  4Z65 A;  2WZN A;  3IC1 A;  1YW4 A;  2PJA A;  3K9T A;  3S9N A;  3RBU A;  2AFU A;  2HB6 A;  4OME A;  4ZY1 A;  1LAP A;  4X8I A;  2ZEN A;  2DEA A;  4F9V A;  1ARL A;  4OC1 A;  2PJB A;  4OP4 A;  3ICU A;  1ZG7 A;  3BI1 A;  4DJL A;  3PBE A;  4NGR A;  3PRT A;  4NFR A;  1BPN A;  2BO9 A;  5LYD A;  3KAS A;  3CT9 A;  4OC5 A;  4C8A A;  6CPA A;  3K2K A;  2XEI A;  3B3W A;  5LRK A;  2PJ3 A;  3IEH A;  4JYW A;  4EFD A;  1H8L A;  5ELY A;  4C9E A;  4NGP A;  4ZY2 A;  2AFM A;  2C1C A;  1ZG8 A;  4C9V A;  4UIA A;  3PB4 X;  4A39 A;  1HDQ A;  3TX8 A;  1F57 A;  4MCP A;  2POK A;  3IWW A;  1CP6 A;  3BI0 A;  4R7M A;  4X2T A;  3KHZ A;  1V6C A;  5HVH A;  1CPS A;  1YW6 A;  3PBB A;  3HUV A;  2PVV A;  3V38 A;  4TWE A;  3PB6 X;  1YSJ A;  5DS0 A;  2JBK A;  1CG2 A;  1Z2L A;  2O53 A;  1ZG9 A;  3D7H A;  1Y7E A;  2PJ7 A;  3S9L A;  2PJC A;  5JH9 A;  4X3R A;  4FWU A;  2PIZ A;  5CPA A;  1RTQ A;  3DLJ A;  3NH5 A;  4C8T A;  4W9Y A;  2V77 A;  5LYF A;  3IIB A;  3VAR A;  1EE3 P;  4A37 A;  3D67 A;  8CPA A;  3GUX A;  1TXR A;  4MXU A;  1TKH A;  1JQG A;  3KQZ A;  3PB7 X;  2EK9 A;  2GLJ A;  4P4B A;  1VHE A;  3NH8 A;  4MHN A;  2PCU A;  2ZEO A;  2Q4Z A;  4C9U A;  3KI9 A;  1F2P A;  2G9D A;  4H2K A;  2ZEE A;  3D7F A;  3SI2 A;  4C85 A;  4ZI6 A;  1ELL P;  3KQX A;  3KHX A;  4P44 A;  1VIX A;  1CX8 A;  2OR4 A;  1YLO A;  4C8U A;  4MHP A;  5CBM A;  2ZEG A;  4CPA A;  1Y0R A;  2I3C A;  3LWU A;  4NJR A;  3HLP A;  2ZOF A;  5J1Q A;  4F8Z A;  4F9U A;  1BLL E;  3V7Z A;  1HDU A;  3PFO A;  3IJ3 A;  1ZLH A;  3LMS A;  4YWY A;  4PXC A;  2V8D A;  4UEZ A;  4OC0 A;  1LOK A;  4OC2 A;  4CDJ A;  3H8F A;  4C8F A;  3CPA A;  2JBJ A;  4KSI A;  3D4U A;  5D8N A;  3H8E A;  3I1U A;  3FH4 A;  2C6G A;  2JEW A;  3ISX A;  2ZEL A;  1BAV A;  2QJ8 A;  4C8C A;  3L2N A;  4OC3 A;  3SJF A;  3SJX A;  1CPX A;  4ZYQ A;  1IY7 A;  3PB9 X;  4C84 A;  2J9A A;  2PJ4 A;  4OIW A;  4NGN A;  4MCQ A;  5LYL A;  4OKO A;  2WYR A;  3KR5 A;  1XMB A;  2RFH A;  4UIB A;  5D29 A;  1QMU A;  4FUU A;  1Y0Y A;  4WWV A;  2ZOG A;  1LAM A;  3CPX A;  4C86 A;  1FNO A;  4MCR A;  1QQ9 A;  3IFE A;  4MHZ A;  4FAI A;  3QNV A;  3B3C A;  4WJB A;  4UEE A;  4YU9 A;  2PJ0 A;  3KZW A;  4O23 A;  4ONW A;  5THW A;  3SI0 A;  2GU2 A;  1AMP A;  2PE3 A;  5K8N A;  3WC6 A;  4UF4 A;  4YN3 A;  4BD9 A;  1ELM P;  2PRQ A;  3IO1 A;  2EK8 A;  4IK2 A;  2VL1 A;  3FMC A;  4MCS A;  5F09 A;  3RAM A;  4NGQ A;  2PJ8 A;  3WT4 A;  1PYT B;  3VH9 A;  1WVM A;  1Z5R A;  1NSA A;  5HVG A;  5K8O A;  1XJO A;  3GLJ A;  4R76 A;  5K8M A;  3D7D A;  4NJQ A;  1DE4 C;  3FX6 A;  4MHY A;  4NGS A;  2PJ9 A;  3WC5 A;  1TF8 A;  3TC8 A;  4ZX9 A;  3NA6 A;  3KGQ A;  2ZEH A;  2PJ6 A;  1R3N A;  2GRE A;  4PXE A;  4MMO A;  2EWB A;  1M4L A;  2ZEM A;  2RB7 A;  2C6C A;  2XEG A;  2FVG A;  3FVL A;  5K8P A;  4PPZ A;  3EIF A;  4C99 A;  4CDK A;  3PEI A;  4C8P A;  2NSM A;  3I6S A;  3B3V A;  3B7I A;  2ZED A;  3ISZ A;  2F8H A;  4Q7A A;  2AFX A;  5HXD A;  2CTB A;  2CIJ A;  2IQ6 A;  1CBX A;  1LCP A;  1ARM A;  2ZEP A;  4PXB A;  4EME A;  1IGB A;  1VGY A;  4A38 A;  3RZA A;  4R6T A;  4KNG E;  5JM6 A;  3SI1 A;  2QVP A;  2GLF A;  2V8G A;  3I74 A;  4OID A;  1TKF A;  1Y9Z A;  4P4I A;  4PXD A;  2ABZ A;  5JGF A;  2IJZ A;  1Z8L A;  5LYI A;  5LRG A;  3FED A;  3PFE A;  2PVW A;  4IAV A;  1LFW A;  3B3S A;  4G1P A;  4EWT A;  2BOA A;  4B6Z A;  4TJV A;  5LRJ A;  1Q7L A;  2OOT A;  4P4E A;  4NGT A;  2HC9 A;  2Q43 A;  2PJ2 A;  1FT7 A;  4P4F A;  4DUK A;  2PJ5 A;  3MRU A;  3T8W A;  4JZ0 A;  4FBE A;  2PIY A;  1KWM A;  1XF1 A;  4OC4 A;  3S9M A;  2QYV A; 
#chains in the Genus database with same CATH topology
 2B5G B;  4XPK A;  4R87 A;  2XEJ A;  5KTA A;  5BY0 A;  2QML A;  4K3N A;  1AYE A;  5HKY A;  1BPM A;  1I21 A;  2CF4 A;  4ORF A;  3WC7 A;  3BHX A;  1GYT A;  1XRY A;  3D66 A;  3KR4 A;  4KOU A;  1TF9 A;  2CY2 A;  5A28 A;  1NXJ A;  4C9A A;  1DTD A;  2WSA A;  3F5B A;  1ZRS A;  1X12 A;  2VKZ G;  5HVF A;  4R8F A;  2YNC A;  3F9K C;  5HKW A;  3GB0 A;  3JUW A;  4UWJ A;  5H84 A;  4XNH B;  1SQH A;  2WUU A;  3FB3 A;  3MN8 A;  3TCV A;  4F0X A;  3P2F A;  3BUM B;  2JLM A;  3N5F A;  1QSN A;  3NH4 A;  2BL1 A;  3CDX A;  3KL9 A;  2DIK A;  2Y1M A;  1KUX A;  2REE A;  3NFZ A;  4P6Y A;  4YRH A;  4BPW B;  1S7K A;  3TO6 A;  5IB9 A;  5AG6 A;  4HPS A;  2ZXV A;  3PB8 X;  3H8G A;  3BUW B;  3OAK A;  2NYQ A;  2Q51 A;  2O4H A;  5AXI A;  1Y9W A;  2RC4 A;  4P10 A;  1KUV A;  1MJA A;  3FXT A;  2ANP A;  4ZX8 A;  3GIU A;  4M85 A;  4L8A A;  1XBU A;  1NE9 A;  2REF A;  4ZY0 A;  4TJX A;  2VI7 A;  2AFS A;  2YNE A;  3CXQ A;  3FBU A;  1ZLI A;  3T9Y A;  1YVO A;  4IHM A;  1ZYM A;  3T5M A;  2AFW A;  3FEE A;  2XEF A;  3B35 A;  2V8V A;  4RUH A;  1UWY A;  1ZL0 A;  1Y9K A;  4UWI A;  1PCA A;  2ATR A;  1P4N A;  5F48 A;  2CXA A;  2XPP A;  1HEE A;  2AFO A;  4RI1 A;  1Q5X A;  4C2Z A;  4UBR A;  4A4C A;  3PFV A;  4AXV A;  1TKJ A;  2CTC A;  1MJ9 A;  3EFA A;  2AUN A;  5EC4 A;  2EUI A;  2Y0M A;  3S6F A;  1K4J A;  2DXQ A;  4PSW A;  2P6F A;  4GM5 A;  4DYO A;  4P4D A;  1BO4 A;  1CP7 A;  2R8V A;  4JXR A;  5IV0 A;  1GGO A;  1IOI A;  3SJG A;  2ZW6 A;  3D68 A;  4FD7 A;  4PQA A;  1F2O A;  5I4M A;  3EZE A;  2BCO A;  3D3S A;  3EXN A;  3WR7 A;  4AG7 A;  1C3O B;  2C6P A;  4C2X A;  4YFJ A;  5KTC A;  1ZO0 A;  5EBV A;  1Q2Y A;  3B3T A;  4TNU A;  3A9L A;  3TO9 A;  4A94 A;  1IIC A;  2D4P A;  2J8M A;  3W6S A;  3D7G A;  2FXF A;  3SJE A;  4R3L A;  4U9Z A;  1OBR A;  2C5Q A;  2YGW A;  4B5P A;  4P4J A;  4H1H A;  7CPA A;  3TYX A;  4C9R A;  3BXM A;  1XFO A;  3JRU A;  4NGM A;  4MRI A;  3FF3 A;  5BWA B;  1LAN A;  4M8D A;  1NSL A;  3H4Q A;  3IU2 A;  2PJ1 A;  1R43 A;  3VAT A;  3WAB A;  3FEC A;  4A32 A;  4CRZ B;  2Z3O A;  3FJU A;  2V8H A;  4NEX A;  1M4I A;  2PSW A;  3B2Y A;  2EZB A;  2ZEF A;  2FIW A;  2FSR A;  2F7V A;  4GXH A;  4Q38 A;  3FIX A;  4R9M A;  5IB0 A;  2AFZ A;  4C7H A;  1I1D A;  2H5M A;  1J3L A;  4UEF A;  3GYA A;  4LQG A;  2IMO A;  3DGV A;  1BOB A;  3SHP A;  4P45 A;  2EZA A;  1VHO A;  1YME A;  2JDC A;  3VTA A;  4Z65 A;  2WZN A;  3R96 A;  3IC1 A;  1WJT A;  1T36 B;  2ODF A;  1YW4 A;  2PJA A;  3K9T A;  3S9N A;  3RBU A;  2AFU A;  2HV2 A;  2I00 A;  2HB6 A;  4OME A;  4ZY1 A;  1LAP A;  1YK3 A;  1IOF A;  2Z3K A;  2G3A A;  4X8I A;  2ZEN A;  4AVB A;  2DEA A;  1L0C A;  5F46 A;  4F9V A;  4BIN A;  4XPL A;  1XF8 A;  1ARL A;  4OC1 A;  1YLE A;  2PJB A;  3D2P A;  4OP4 A;  1UFH A;  3ICU A;  1ZG7 A;  3R9G A;  4RS2 A;  4KOS A;  3BI1 A;  3G8W A;  4AVC A;  4DJL A;  1IYK A;  3PBE A;  4NGR A;  3PRT A;  1S7F A;  1BPN A;  2BO9 A;  4HNX B;  4NFR A;  5DWM A;  5LYD A;  3LD2 A;  3SR3 A;  3KAS A;  3VGO A;  1B87 A;  3U88 C;  3CT9 A;  4KUB A;  4OC5 A;  3D2M A;  4C8A A;  1S3Z A;  4B14 A;  6CPA A;  3K4I A;  4JXQ A;  3K2K A;  1S7L A;  3HMJ G;  2XEI A;  3B3W A;  1Z8T A;  5LRK A;  2PJ3 A;  3EO4 A;  5FD8 A;  4EVY A;  3IEH A;  4JYW A;  5DWN A;  3VRN A;  5J3X A;  4EFD A;  3O8Z A;  1A2Z A;  1H8L A;  1XIX A;  4CAF A;  5ELY A;  4II9 A;  3TLY A;  3EY5 A;  5H86 A;  4LUA A;  3TLG B;  4C9E A;  3W6X A;  1IYL A;  3JTK A;  4NGP A;  4ZY2 A;  3FNC A;  3DDD A;  5I0C A;  2AFM A;  2C1C A;  4BTF A;  2GE3 A;  1ZG8 A;  1RXT A;  2B4J C;  3EZA A;  3OP0 A;  2HWG A;  4XPD C;  1BXR B;  4EYS A;  4KVX A;  4Y49 C;  3I3G A;  3F8K A;  4C9V A;  2YJV A;  4KS9 A;  4UIA A;  3PB4 X;  3TLE A;  4NCZ A;  4A39 A;  2X0S A;  1HDQ A;  2XPN A;  2EBJ A;  2R7H A;  2N3A B;  4KOT A;  5E96 A;  3TX8 A;  1VBG A;  2ZW5 A;  5JPH A;  1YQE A;  1M1D A;  4CAV A;  1I12 A;  1F57 A;  1M44 A;  4MCP A;  2POK A;  2J8R A;  2ZW7 A;  3IWW A;  4UCP A;  3RNZ A;  1CP6 A;  4CS0 B;  3BI0 A;  3FRM A;  3PP9 A;  4R7M A;  4B5O A;  1LRZ A;  2EVN A;  1Z9U A;  3UY5 A;  4X2T A;  2GIV A;  3KHZ A;  1V6C A;  4MFP A;  5HVH A;  5IX3 A;  1CPS A;  1YW6 A;  3PBB A;  3HUV A;  4YGO A;  2PVV A;  4H6Z A;  4TWE A;  3V38 A;  4BMH A;  1R57 A;  4CGN A;  4A4B A;  4HNY B;  2PQ8 A;  3PB6 X;  3T90 A;  1YSJ A;  1Q2D A;  4IIX A;  1S5K A;  2P0W A;  5DS0 A;  2Z3N A;  3DSB A;  1DIK A;  2Q44 A;  3CXP A;  1FBV A;  4KOY A;  4X5K A;  4COB A;  4KZT A;  2JBK A;  4E5S A;  1CG2 A;  1CJW A;  1Z2L A;  2O53 A;  1ZG9 A;  3D7H A;  1Y7E A;  2PJ7 A;  3S9L A;  2PJC A;  4C2Y A;  4X3R A;  4FWU A;  5JH9 A;  2PIZ A;  2Z0Z A;  4CGO A;  5CPA A;  1RTQ A;  3BLN A;  1M4D A;  3DLJ A;  3NH5 A;  3R95 A;  4W9Y A;  2V77 A;  1QSO A;  4A33 A;  4C8T A;  1QSM A;  5LYF A;  3IIB A;  2FT0 A;  1YR0 A;  3VAR A;  5AG5 A;  3LAC A;  2GAN A;  1EE3 P;  1X10 A;  5ISV A;  4MFQ A;  4A37 A;  3D67 A;  1XOV A;  2WPX A;  8CPA A;  3GUX A;  3TLC A;  1TXR A;  4MXU A;  1TKH A;  1JQG A;  2D4O A;  3KQZ A;  2B4B A;  3PB7 X;  1YGH A;  3VWE A;  1ON0 A;  3QAH A;  2EK9 A;  2GLJ A;  3VWD A;  4P4B A;  1VHE A;  3NH8 A;  4K30 A;  4MHN A;  5F47 A;  2PCU A;  2ZEO A;  2Q4Z A;  4C9U A;  3VRO A;  3KI9 A;  1EO0 A;  4MI4 A;  1F2P A;  2G9D A;  4H2K A;  2ZEE A;  3D7F A;  3SI2 A;  4C85 A;  2ZW4 A;  4ZI6 A;  3T05 A;  3NOJ A;  1ELL P;  3KHX A;  3KQX A;  4KOW A;  4P44 A;  1EZB A;  1VIX A;  1CX8 A;  2OR4 A;  1YLO A;  2JEV A;  3D8P A;  4C8U A;  4MHP A;  5CBM A;  2PR8 A;  3GY9 A;  2XPL A;  2ZEG A;  3BUN B;  1IID A;  2B3V A;  4CPA A;  1Y0R A;  2G0B A;  2YJT A;  2VEZ A;  5JVL A;  3E0K A;  2I3C A;  3LWU A;  4U9Y A;  2B0A A;  4NJR A;  4JWP A;  4QVT A;  1M6V B;  3HLP A;  2ZOF A;  2F5I A;  5J8C A;  5G1Z A;  4ZBG A;  5J1Q A;  4FD4 A;  4F8Z A;  4F9U A;  2CBL A;  1BLL E;  3HPH E;  4KVM E;  3V7Z A;  5KTD A;  3RYO A;  5AG7 A;  4RR2 B;  1HDU A;  2J8N A;  3PFO A;  3IJ3 A;  1QSR A;  1V0C A;  1N71 A;  1ZLH A;  3LMS A;  3S6K A;  4CYP A;  2UV8 G;  2ARH A;  3B8G A;  3CXS A;  2V8D A;  4JD6 A;  4PXC A;  4UEZ A;  4YWY A;  3CZX A;  4ZGY B;  4PK2 A;  2OB0 A;  5A27 A;  3TLG A;  4OC0 A;  5F13 A;  2IL4 A;  4QC6 A;  1LOK A;  4NF1 A;  4OC2 A;  3TOB A;  4CDJ A;  3H8F A;  4C8F A;  3CPA A;  3C26 A;  4B10 A;  2JBJ A;  4MJ8 A;  1RO5 A;  2B58 A;  4KSI A;  1U6M A;  3D4U A;  4LQ6 A;  5D8N A;  2Q7S A;  3H8E A;  2DPS A;  3I1U A;  4J0N A;  4HNW B;  1OZP A;  3FH4 A;  2Z3M A;  2FM4 A;  2C6G A;  2JEW A;  4A30 A;  4CGM A;  3ISX A;  1PU9 A;  2ZEL A;  1BAV A;  2QJ8 A;  3DNS A;  4UFX A;  3TOA A;  3VRR A;  3TTH A;  4C8C A;  3LOD A;  2OLS A;  3BJ7 A;  2K5T A;  2GFQ A;  3L2N A;  4OC3 A;  3SJF A;  4UFW A;  3T07 A;  1MK4 A;  3SJX A;  1CPX A;  4ZYQ A;  1KEE B;  3PLF B;  1IY7 A;  3PB9 X;  3R1K A;  4QUS A;  4C84 A;  2J9A A;  4OLL A;  5AGE A;  3BJ8 A;  1VBH A;  2PJ4 A;  4MFL A;  4OIW A;  4NGN A;  1QST A;  2AJ6 A;  4MCQ A;  3DR8 A;  4C7I A;  4QB9 A;  4AVA A;  5LYL A;  4OKO A;  5K99 A;  4J3G A;  2PDO A;  2WYR A;  3KR5 A;  1Z4E A;  4KSA A;  4CYO A;  1XMB A;  4L89 A;  2RFH A;  3GKR A;  4UIB A;  2Y1N A;  1VKC A;  2Z10 A;  5D29 A;  2Q7B A;  1QMU A;  3S6H A;  3QAY A;  4FUU A;  2CNT A;  4XNH C;  1Y0Y A;  4WWV A;  2ZOG A;  2HQY A;  3TLZ A;  1LAM A;  3CPX A;  4FD5 A;  4C86 A;  5HH1 A;  2PRB A;  1FNO A;  4MCR A;  1QQ9 A;  3IFE A;  5AG4 A;  3KRV A;  4MHZ A;  2EO8 A;  4FAI A;  3ZNI A;  3QNV A;  3KKW A;  3B3C A;  4CO9 A;  4CAW A;  4FD6 A;  4WJB A;  4KSF A;  3NE7 A;  4UEE A;  4YU9 A;  1JWQ A;  4LX9 A;  2PJ0 A;  3KZW A;  5HKZ A;  4O23 A;  4ONW A;  5THW A;  2OZH A;  1JDE A;  4MHD A;  3SI0 A;  2GU2 A;  2QEC A;  3JVN A;  4KUA A;  2KCW A;  1AMP A;  4BPU B;  4CRY B;  2PE3 A;  5F49 A;  5K8N A;  1B6B A;  4CAE A;  5EMI A;  2OH1 A;  4I49 A;  3WC6 A;  3C8O A;  4KOR A;  2XPO A;  3R9F A;  1YVH A;  4KLV A;  3G3S A;  4UF4 A;  3BUX B;  4MY3 A;  4YN3 A;  1YRE A;  1WK4 A;  2G3T A;  2WPW A;  4PV6 A;  4BD9 A;  4UCN A;  1GHE A;  2X7B A;  1ELM P;  2B4D B;  4F6A A;  2PRQ A;  3IO1 A;  2D0O A;  3EC4 A;  2EK8 A;  4IK2 A;  3IU1 A;  2YNC C;  5JYB A;  2VZZ A;  2YND A;  2Z3L A;  2Q4V A;  4NXY A;  2VL1 A;  3IWE A;  1S60 A;  1Z9E A;  2ZPA A;  4MCS A;  3FMC A;  5F09 A;  4HKF A;  4AB7 A;  2B3U A;  4NGQ A;  4U5Y A;  2PJ8 A;  3RAM A;  2FS5 A;  4IUS A;  1JDB C;  4MBU A;  1Z8X A;  3T0T A;  4XPD B;  5IR2 A;  2HUZ A;  2P6E A;  4CDK A;  3WT4 A;  4Y49 B;  3SXN A;  1IB1 E;  1XMT A;  1PYT B;  3VH9 A;  1WVM A;  1Z5R A;  1NSA A;  3MGD A;  3R9E A;  5HVG A;  5K8O A;  1XJO A;  2BEI A;  4A2Z A;  3TLB A;  4BBH A;  4R3K A;  3GLJ A;  2I79 A;  3TO7 A;  4DNC A;  4R76 A;  2P6G A;  3D7D A;  5K8M A;  4NJQ A;  4RN7 A;  4AG9 A;  1DE4 C;  1C30 B;  3FX6 A;  2D0P A;  4MHY A;  4NGS A;  4E2A A;  4CGP A;  2PJ9 A;  4KVO E;  3WC5 A;  1TF8 A;  3TFY A;  1Q2C A;  3I9S A;  2VXK A;  3TC8 A;  4E8O A;  4NSQ A;  2AUM A;  3EZB A;  3NE8 A;  4ZX9 A;  3NA6 A;  3KGQ A;  2ZEH A;  2PJ6 A;  1TIQ A;  4MJX A;  1R3N A;  2GRE A;  4PXE A;  4KLW A;  4MMO A;  3TLA A;  2Q0Y A;  4CZ1 A;  2HI6 A;  2EWB A;  4M6G A;  1FY7 A;  1M4L A;  4M6H A;  2ZEM A;  2RB7 A;  2C6C A;  2Q4Y A;  1XE4 A;  3ZJ0 A;  2XEG A;  2FVG A;  3FVL A;  5K8P A;  3OB1 B;  1KUY A;  2CNM A;  4PPZ A;  1A9X B;  3EIF A;  3PEI A;  4C99 A;  1KZF A;  4C8P A;  3DR6 A;  4H89 A;  3PT1 A;  4B12 A;  2BUE A;  2NSM A;  3I6S A;  3IWG A;  3B3V A;  4MFZ A;  3B7I A;  3GJZ A;  1KBL A;  1VHS A;  2ZED A;  1IU8 A;  1YX0 A;  5C82 A;  3ISZ A;  3OWC A;  3H5Z A;  4M6I A;  4MFJ A;  1S7N A;  2F8H A;  2AFX A;  4GS4 A;  4Q7A A;  5HXD A;  2CTB A;  3S6G A;  2CIJ A;  4OAE A;  2A4N A;  3F0A A;  3RO0 A;  1VI4 A;  2IQ6 A;  1Z4R A;  1CBX A;  4C68 A;  3P2H A;  4JLY A;  4OAD A;  2DLA A;  1LCP A;  4PK3 A;  2E28 A;  4F0Y A;  3TE4 A;  1ARM A;  1XEB A;  2FIA A;  2ZEP A;  3ZZI A;  2MP0 A;  4PSX A;  2Z11 A;  2OU2 A;  4CYN A;  4UCM A;  4MFK A;  4PXB A;  4EME A;  1IGB A;  1M4G A;  1VGY A;  3U1B A;  2GP4 A;  4A38 A;  3G23 A;  3RZA A;  4R6T A;  1Z8W A;  5JM6 A;  4KNG E;  2HRO A;  3SI1 A;  4MY0 A;  3HPG G;  3BUO B;  2GLF A;  2C27 A;  2NMT A;  2QVP A;  2V8G A;  2R82 A;  4JVO A;  3I74 A;  1CM0 A;  4INJ A;  4OID A;  1NMT A;  1TKF A;  1CS0 B;  1Y9Z A;  2JDD A;  2OZU A;  2FCK A;  3PZJ A;  4R57 A;  3NFQ A;  5JQ4 A;  5F5X A;  4P4I A;  2PCN A;  2VQY A;  4PXD A;  1EZA A;  2ABZ A;  5G22 A;  5JGF A;  1Y7R A;  5G20 A;  1AUG A;  4M3S A;  2IJZ A;  1Z8L A;  2DF5 A;  4Q36 A;  2B5G A;  1WWZ A;  2Q04 A;  5G21 A;  2FL4 A;  2B4D A;  3PGP A;  4A95 A;  4CYQ A;  5LYI A;  3VRQ A;  2PR1 A;  4B5P B;  4KOX A;  5LRG A;  4CGL A;  3FED A;  3VRP A;  3PFE A;  2VBQ A;  4IIY A;  4QBJ A;  5HMN A;  1KC7 A;  2R98 A;  2O28 A;  3IGR A;  4E94 A;  3SXO A;  2Z3P A;  2PVW A;  2FE7 A;  3N7Z A;  4IAV A;  1LFW A;  4GPL B;  1MJB A;  2DPT A;  3B3S A;  4G1P A;  1CE8 B;  4EWT A;  2BOA A;  2BSW A;  3V8I A;  4B6Z A;  5LRJ A;  4TJV A;  1Q7L A;  2OOT A;  2R1I A;  5CNP A;  2OZG A;  3OB2 B;  2QIR A;  1NBW A;  4P4E A;  4UFV A;  5C88 A;  4B11 A;  4NGT A;  4JJX A;  5FVJ A;  2HC9 A;  5J8F A;  2Q43 A;  1PUA A;  2AE6 A;  3FYN A;  2PJ2 A;  4CAX A;  1FT7 A;  4B13 A;  4P4F A;  3W91 A;  2PJ5 A;  3MRU A;  4DUK A;  1P0H A;  2VZY A;  4H6U A;  3K9U A;  3T8W A;  3TT2 A;  5F9M A;  1R61 A;  4JZ0 A;  2EZC A;  5F1Y A;  1B47 A;  2CNS A;  4KOV A;  4FBE A;  4ONU A;  4UA3 A;  4E0A A;  1YVK A;  4IF5 A;  4BPX B;  2PIY A;  4MI1 A;  3QB8 A;  1KWM A;  5GCN A;  1J4J A;  1XF1 A;  4COG A;  4A31 A;  4OC4 A;  3S9M A;  2PC1 A;  2QYV A; 
#chains in the Genus database with same CATH homology
 2XEJ A;  4K3N A;  1AYE A;  1BPM A;  3WC7 A;  2CF4 A;  3BHX A;  1GYT A;  1XRY A;  3D66 A;  3KR4 A;  4C9A A;  1TF9 A;  1DTD A;  5HVF A;  4R8F A;  3GB0 A;  3MN8 A;  3N5F A;  3NH4 A;  3CDX A;  3KL9 A;  4P6Y A;  3NFZ A;  5IB9 A;  3PB8 X;  3H8G A;  2NYQ A;  2Q51 A;  4P10 A;  2O4H A;  2ANP A;  4ZX8 A;  1XBU A;  4ZY0 A;  4TJX A;  2AFS A;  1ZLI A;  4IHM A;  2AFW A;  3FEE A;  2XEF A;  3B35 A;  2V8V A;  4RUH A;  1UWY A;  1PCA A;  1HEE A;  2AFO A;  4AXV A;  1TKJ A;  2CTC A;  4DYO A;  4GM5 A;  4P4D A;  1CP7 A;  3SJG A;  3D68 A;  4PQA A;  1F2O A;  5I4M A;  2BCO A;  2C6P A;  4TNU A;  3B3T A;  4A94 A;  3D7G A;  3SJE A;  1OBR A;  2C5Q A;  4P4J A;  7CPA A;  4C9R A;  3BXM A;  1XFO A;  3JRU A;  4NGM A;  4MRI A;  3FF3 A;  1LAN A;  2PJ1 A;  1R43 A;  3VAT A;  3WAB A;  3FEC A;  3FJU A;  2V8H A;  3B2Y A;  2ZEF A;  2F7V A;  2AFZ A;  4UEF A;  4LQG A;  2IMO A;  3DGV A;  4P45 A;  1VHO A;  1YME A;  3VTA A;  4Z65 A;  2WZN A;  3IC1 A;  1YW4 A;  2PJA A;  3K9T A;  3S9N A;  3RBU A;  2AFU A;  2HB6 A;  4OME A;  4ZY1 A;  1LAP A;  4X8I A;  2ZEN A;  2DEA A;  4F9V A;  1ARL A;  4OC1 A;  2PJB A;  4OP4 A;  3ICU A;  1ZG7 A;  3BI1 A;  4DJL A;  3PBE A;  4NGR A;  3PRT A;  4NFR A;  1BPN A;  2BO9 A;  5LYD A;  3KAS A;  3CT9 A;  4OC5 A;  4C8A A;  6CPA A;  3K2K A;  2XEI A;  3B3W A;  5LRK A;  2PJ3 A;  3IEH A;  4JYW A;  4EFD A;  1H8L A;  5ELY A;  4C9E A;  4NGP A;  4ZY2 A;  2AFM A;  2C1C A;  1ZG8 A;  4C9V A;  4UIA A;  3PB4 X;  4A39 A;  1HDQ A;  3TX8 A;  1F57 A;  4MCP A;  2POK A;  3IWW A;  1CP6 A;  3BI0 A;  4R7M A;  4X2T A;  3KHZ A;  1V6C A;  5HVH A;  1CPS A;  1YW6 A;  3PBB A;  3HUV A;  2PVV A;  3V38 A;  4TWE A;  3PB6 X;  1YSJ A;  5DS0 A;  2JBK A;  1CG2 A;  1Z2L A;  2O53 A;  1ZG9 A;  3D7H A;  1Y7E A;  2PJ7 A;  3S9L A;  2PJC A;  5JH9 A;  4X3R A;  4FWU A;  2PIZ A;  5CPA A;  1RTQ A;  3DLJ A;  3NH5 A;  4C8T A;  4W9Y A;  2V77 A;  5LYF A;  3IIB A;  3VAR A;  1EE3 P;  4A37 A;  3D67 A;  8CPA A;  3GUX A;  1TXR A;  4MXU A;  1TKH A;  1JQG A;  3KQZ A;  3PB7 X;  2EK9 A;  2GLJ A;  4P4B A;  1VHE A;  3NH8 A;  4MHN A;  2PCU A;  2ZEO A;  2Q4Z A;  4C9U A;  3KI9 A;  1F2P A;  2G9D A;  4H2K A;  2ZEE A;  3D7F A;  3SI2 A;  4C85 A;  4ZI6 A;  1ELL P;  3KQX A;  3KHX A;  4P44 A;  1VIX A;  1CX8 A;  2OR4 A;  1YLO A;  4C8U A;  4MHP A;  5CBM A;  2ZEG A;  4CPA A;  1Y0R A;  2I3C A;  3LWU A;  4NJR A;  3HLP A;  2ZOF A;  5J1Q A;  4F8Z A;  4F9U A;  1BLL E;  3V7Z A;  1HDU A;  3PFO A;  3IJ3 A;  1ZLH A;  3LMS A;  4YWY A;  4PXC A;  2V8D A;  4UEZ A;  4OC0 A;  1LOK A;  4OC2 A;  4CDJ A;  3H8F A;  4C8F A;  3CPA A;  2JBJ A;  4KSI A;  3D4U A;  5D8N A;  3H8E A;  3I1U A;  3FH4 A;  2C6G A;  2JEW A;  3ISX A;  2ZEL A;  1BAV A;  2QJ8 A;  4C8C A;  3L2N A;  4OC3 A;  3SJF A;  3SJX A;  1CPX A;  4ZYQ A;  1IY7 A;  3PB9 X;  4C84 A;  2J9A A;  2PJ4 A;  4OIW A;  4NGN A;  4MCQ A;  5LYL A;  4OKO A;  2WYR A;  3KR5 A;  1XMB A;  2RFH A;  4UIB A;  5D29 A;  1QMU A;  4FUU A;  1Y0Y A;  4WWV A;  2ZOG A;  1LAM A;  3CPX A;  4C86 A;  1FNO A;  4MCR A;  1QQ9 A;  3IFE A;  4MHZ A;  4FAI A;  3QNV A;  3B3C A;  4WJB A;  4UEE A;  4YU9 A;  2PJ0 A;  3KZW A;  4O23 A;  4ONW A;  5THW A;  3SI0 A;  2GU2 A;  1AMP A;  2PE3 A;  5K8N A;  3WC6 A;  4UF4 A;  4YN3 A;  4BD9 A;  1ELM P;  2PRQ A;  3IO1 A;  2EK8 A;  4IK2 A;  2VL1 A;  3FMC A;  4MCS A;  5F09 A;  3RAM A;  4NGQ A;  2PJ8 A;  5IR2 A;  3WT4 A;  1PYT B;  3VH9 A;  1WVM A;  1Z5R A;  1NSA A;  5HVG A;  5K8O A;  1XJO A;  3GLJ A;  4R76 A;  5K8M A;  3D7D A;  4NJQ A;  1DE4 C;  3FX6 A;  4MHY A;  4NGS A;  2PJ9 A;  3WC5 A;  1TF8 A;  3TC8 A;  4ZX9 A;  3NA6 A;  3KGQ A;  2ZEH A;  2PJ6 A;  1R3N A;  2GRE A;  4PXE A;  4MMO A;  2EWB A;  1M4L A;  2ZEM A;  2RB7 A;  2C6C A;  2XEG A;  2FVG A;  3FVL A;  5K8P A;  4PPZ A;  3EIF A;  4C99 A;  4CDK A;  3PEI A;  4C8P A;  2NSM A;  3I6S A;  3B3V A;  3B7I A;  2ZED A;  3ISZ A;  2F8H A;  4Q7A A;  2AFX A;  5HXD A;  2CTB A;  2CIJ A;  2IQ6 A;  1CBX A;  1LCP A;  1ARM A;  2ZEP A;  4PXB A;  4EME A;  1IGB A;  1VGY A;  2GP4 A;  4A38 A;  3RZA A;  4R6T A;  4KNG E;  5JM6 A;  3SI1 A;  2QVP A;  2GLF A;  2V8G A;  3I74 A;  4OID A;  1TKF A;  1Y9Z A;  4P4I A;  4PXD A;  2ABZ A;  5JGF A;  2IJZ A;  1Z8L A;  5LYI A;  5LRG A;  3FED A;  3PFE A;  2PVW A;  4IAV A;  1LFW A;  3B3S A;  4G1P A;  4EWT A;  2BOA A;  4B6Z A;  4TJV A;  5LRJ A;  1Q7L A;  2OOT A;  4P4E A;  4NGT A;  2HC9 A;  2Q43 A;  2PJ2 A;  1FT7 A;  4P4F A;  4DUK A;  2PJ5 A;  3MRU A;  3T8W A;  4JZ0 A;  4FBE A;  2PIY A;  1KWM A;  1XF1 A;  4OC4 A;  3S9M A;  2QYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...