4MCSA

A high resolution structure of human glutamate carboxypeptidase ii (gcpii) his475tyr variant in complex with glutamic acid
Total Genus 266
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
266
sequence length
696
structure length
691
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVYNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural and biochemical characterization of the folyl-poly-gamma-l-glutamate hydrolyzing activity of human glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 266
structure length 691
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4mcsA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mcsA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4mcsA02
3D66A 1CPSA 4ZI6A 3N5FA 5HVFA 2RFHA 5HXDA 3FH4A 2IJZA 4MHYA 4JYWA 2PJ8A 3FF3A 4RUHA 3L2NA 4ZYQA 1FNOA 4IHMA 1VHOA 1R43A 2AFSA 1BPMA 3B3TA 4NFRA 4DYOA 2OOTA 3KASA 1XRYA 3ISZA 4C9AA 4OMEA 4NGQA 2ZEFA 3RAMA 1GYTA 5HVHA 2RB7A 1ARLA 4P4IA 3IIBA 1YSJA 5LYFA 3ICUA 4MCSA 2O4HA 4ONWA 3VTAA 3JRUA 3KQXA 4C85A 3B3CA 1LAPA 3KGQA 4C9VA 2ZEMA 2BOAA 2JBJA 3HLPA 2C6CA 5CBMA 2ZEEA 1YLOA 1ZG7A 1AMPA 5JH9A 1FT7A 1CPXA 2VL1A 3PB6X 4X8IA 3B35A 4PXCA 4CPAA 1HEEA 4MCPA 3CPAA 4OIWA 1TF9A 4TWEA 3B3VA 4C8FA 2QVPA 4C8PA 2V8HA 4MCQA 2V77A 4PXBA 5LRKA 2PIYA 3D67A 2ZOGA 4P45A 5F09A 2WZNA 4GM5A 2EK9A 4B6ZA 1EE3P 4FUUA 2C6PA 3RBUA 1XMBA 2PJ7A 4OC2A 5LRJA 3IWWA 5K8PA 3I1UA 3S9LA 3GUXA 1BPNA 2WYRA 3BI0A 3IFEA 3K2KA 4MHPA 4C84A 3T8WA 4YN3A 4NGRA 5K8OA 2O53A 2POKA 1VHEA 2AFXA 1VIXA 3IEHA 4A39A 1TKJA 3SI0A 2XEGA 2V8GA 3FJUA 4C8TA 2IQ6A 4P4JA 1TKHA 4ZY1A 2AFMA 3IO1A 2PJ2A 2CTCA 2PJCA 2ZEOA 3FEEA 1JQGA 4EWTA 3PB7X 4MMOA 3CDXA 2AFOA 3KL9A 2FVGA 1PCAA 4PXDA 4ZX9A 4P4BA 1Q7LA 3TC8A 3D7GA 3GB0A 3KZWA 2PJ6A 3FVLA 3PEIA 3DLJA 4IK2A 3KQZA 2QJ8A 4IAVA 5LYLA 2PIZA 3ISXA 3TX8A 4C9RA 1M4LA 1LCPA 3WABA 4MRIA 2JEWA 4FBEA 3H8GA 1TF8A 5LYIA 2NSMA 1NSAA 2PCUA 1LAMA 5JM6A 3WC5A 4DUKA 4WWVA 4TJVA 1TKFA 1V6CA 4P44A 3BI1A 3GLJA 4R6TA 3SI1A 4YU9A 2HB6A 1YW4A 1Y0YA 4JZ0A 3D7DA 3FECA 3H8FA 4PXEA 5LYDA 4MHNA 4ZX8A 1R3NA 4MXUA 1TXRA 5D8NA 3DGVA 1ELMP 3B3WA 2Q43A 4A37A 3WC6A 4C9UA 1XBUA 3VATA 1ZLHA 2PVWA 4TJXA 3MN8A 2F7VA 3RZAA 1Z8LA 3VH9A 5LRGA 2PJAA 4NJQA 3SI2A 2JBKA 2PRQA 2V8DA 4LQGA 4NGNA 4OC3A 2AFUA 3B7IA 4F8ZA 4MCRA 3B3SA 4EMEA 1CG2A 3KR5A 4R7MA 5D29A 4OC0A 2V8VA 3SJGA 4OC5A 1LANA 2EWBA 3PB9X 3SJEA 2QYVA 3MRUA 4O23A 3PRTA 1QMUA 2CTBA 1ELLP 3B2YA 5HVGA 1WVMA 4P10A 4OC4A 3S9NA 3QNVA 4C99A 4NGTA 1HDQA 3LMSA 4OC1A 2BCOA 5K8MA 1IY7A 4BD9A 3NH5A 1Y9ZA 4UF4A 1Z5RA 2PVVA 5I4MA 4P4DA 2XEFA 8CPAA 3H8EA 1ARMA 2ANPA 2PJ0A 2I3CA 2AFWA 5J1QA 1BLLE 1YW6A 4A38A 1LOKA 4AXVA 1HDUA 5ELYA 3KR4A 2J9AA 4YWYA 4OP4A 5DS0A 4Q7AA 1CX8A 1BAVA 1Z2LA 2C1CA 4PQAA 4ZY0A 5THWA 4EFDA 4UEZA 2PJ1A 4CDKA 4P4FA 4C86A 5K8NA 3FEDA 2Q4ZA 3KI9A 3D7HA 1DTDA 1UWYA 2F8HA 3PBBA 3PFEA 4R8FA 2ZELA 1CP6A 3NA6A 4DJLA 2ZOFA 1PYTB 2ABZA 2ZEPA 3SJFA 4F9VA 4X2TA 2ZEHA 4FWUA 1Y7EA 2PJBA 3S9MA 4OKOA 3KHZA 4TNUA 2OR4A 2GU2A 1ZG9A 4ZY2A 3V7ZA 2PJ9A 3CPXA 4UIAA 1CP7A 1H8LA 3CT9A 1F2OA 4UEFA 2CIJA 2PE3A 2EK8A 1OBRA 4A94A 4WJBA 4UEEA 4C8AA 5CPAA 1LFWA 2ZEDA 1DE4C 4MHZA 1ZLIA 3SJXA 2ZENA 4W9YA 1QQ9A 4KNGE 3VARA 2CF4A 4C8CA 3FX6A 3HUVA 2G9DA 4PPZA 3PB8X 2PJ5A 3PB4X 2ZEGA 4UIBA 2NYQA 4X3RA 3BHXA 3LWUA 4OIDA 2C6GA 3K9TA 4C8UA 4C9EA 1AYEA 4FAIA 2XEJA 2XEIA 1ZG8A 1Y0RA 2Q51A 4NGMA 4Z65A 3D7FA 3IJ3A 5IB9A 1VGYA 4K3NA 1KWMA 3FMCA 2PJ3A 1RTQA 3I6SA 3NH8A 2IMOA 7CPAA 3V38A 2GREA 6CPAA 2AFZA 1IGBA 2DEAA 1XFOA 1XJOA 3EIFA 4NGPA 1XF1A 4F9UA 3PBEA 4R76A 2PJ4A 3IC1A 4G1PA 1F2PA 2GLFA 3D4UA 1YMEA 3PFOA 3BXMA 4KSIA 1F57A 4NJRA 3WC7A 3NH4A 1CBXA 3NFZA 2HC9A 4P6YA 3D68A 4P4EA 4H2KA 5JGFA 4NGSA 3WT4A 3KHXA 4CDJA 3I74A 2BO9A 2GLJA
chains in the Genus database with same CATH superfamily
4BMHA 3EC4A 2B58A 1CPSA 3D66A 4ZI6A 3N5FA 1S7KA 5HVFA 2RFHA 5HXDA 3FH4A 2IJZA 3GY9A 4R3LA 5DWMA 4JJXA 4IF5A 2VQYA 4MHYA 4M6IA 4JYWA 2D4PA 2PJ8A 3FF3A 5F48A 2OZUA 2Z3KA 3L2NA 4RUHA 5HVGA 4ZYQA 2YJVA 1FNOA 4CGPA 1UFHA 2VXKA 1VHOA 1R43A 4IHMA 4E94A 2VI7A 2AFSA 1KC7A 1BPMA 3SR3A 1Z4EA 4AVCA 1QSMA 4UWJA 4A33A 3B3TA 4KS9A 5HKWA 4B5OA 2WSAA 2REFA 3R1KA 4NFRA 4DYOA 1RXTA 4QBJA 2OOTA 2X0SA 2B5GB 1KUYA 4ZBGA 3KASA 1XRYA 2O28A 3ISZA 2Y1NA 1CE8B 4ZGYB 4C9AA 4OMEA 3P2FA 4KLWA 4MFLA 3TLBA 2YNCC 4MY3A 4E0AA 2B0AA 1JDEA 4KOWA 5F9MA 4NGQA 4MHDA 2ZEFA 5H84A 1AUGA 5AXIA 2HQYA 3RAMA 1GYTA 5J3XA 5HVHA 2RB7A 5G20A 2CNTA 2WUUA 4F0YA 1ARLA 4P4IA 2E28A 3IIBA 5A28A 3LD2A 1YSJA 3BLNA 3D2MA 4K30A 5LYFA 3T9YA 3ICUA 3PZJA 2G3TA 4B10A 1QSOA 4MFZA 4KSAA 2PCNA 1YVOA 1PU9A 4A31A 2Q4VA 4MCSA 3UY5A 4FD5A 2O4HA 3FIXA 4AG9A 4ONWA 5BY0A 3VTAA 2H5MA 4JLYA 3JRUA 1Q2DA 3KQXA 3ZNIA 4C85A 3B3CA 1LAPA 2C5QA 3KGQA 4GS4A 2ZEMA 4C9VA 2BOAA 2JBJA 4I49A 3HLPA 2C6CA 3FBUA 5CBMA 2ZEEA 3RO0A 2YNDA 1YLOA 5JPHA 4XPDC 1ZG7A 2EZAA 1AMPA 2Q4YA 3D8PA 5JH9A 2HROA 2ODFA 1FT7A 1S7NA 3BJ8A 1CPXA 1DIKA 2OLSA 3BUMB 4H1HA 2VL1A 3PB6X 4B5PA 4X8IA 3B35A 4FD6A 4CAFA 4PXCA 2VZZA 3T90A 3KRVA 4CPAA 3GKRA 1HEEA 5J8CA 4MCPA 1OZPA 3CPAA 4OIWA 3D3SA 1TF9A 4KOVA 3B3VA 4TWEA 2QVPA 5A27A 1L0CA 3EZBA 2V8HA 4A32A 1M4GA 4MCQA 3T07A 4C8PA 4KOTA 2FCKA 2V77A 4CYPA 2P0WA 1ZL0A 4KOYA 4NSQA 4PXBA 5ISVA 3TLAA 4KOXA 5LRKA 5C88A 3NFQA 1KUVA 2PIYA 2BEIA 3D67A 4KVXA 2A4NA 2ZOGA 4P45A 4M6GA 3TOAA 5F09A 2BSWA 2WZNA 3W91A 2ZPAA 5I0CA 1EZAA 4BPXB 1Q2CA 4GM5A 2JDDA 2BL1A 2EK9A 2KCWA 1PUAA 5C82A 4CAWA 4B6ZA 4J3GA 1EE3P 1ON0A 4KVOE 4LUAA 4CAXA 4FUUA 4M8DA 4MI4A 2C6PA 4CO9A 3RBUA 1IICA 1M4DA 2Q0YA 1Y9KA 5F46A 1QSNA 1XMBA 1P4NA 2PRBA 2PJ7A 1QSRA 4JVOA 1S5KA 4OC2A 2PR1A 4KUBA 2QMLA 5LRJA 1R61A 3IWWA 2Z10A 4FD4A 3PFVA 5K8PA 3BJ7A 3S9LA 3I1UA 1BPNA 3GUXA 2WYRA 3TLEA 3BI0A 4RR2B 2R1IA 2ZW4A 2ZW7A 3IFEA 2XPOA 4M3SA 3IGRA 3K2KA 4IIXA 4MHPA 4C84A 4B11A 5JVLA 3T8WA 4YN3A 4NGRA 1SQHA 5K8OA 4KSFA 2O53A 3C26A 2POKA 1VHEA 2Z0ZA 2AFXA 3EY5A 4L8AA 3W6SA 4UCMA 1VIXA 2Z3PA 3IEHA 4A39A 2CBLA 3S6KA 1I1DA 1TKJA 1B6BA 4QC6A 2EVNA 2XEGA 2ZXVA 3SI0A 5F1YA 2IL4A 2V8GA 4Q36A 2Y1MA 3FJUA 5F13A 1BXRB 2IQ6A 1FY7A 4C8TA 2CY2A 2DF5A 4P4JA 1TKHA 4ZY1A 2R98A 2AFMA 3IO1A 2PJ2A 4RN7A 4GPLB 2CTCA 2PJCA 3TO9A 2ZEOA 1XEBA 1Y9WA 5FVJA 3FEEA 1JQGA 3ZZIA 3PB7X 4EWTA 3U88C 4MMOA 3TCVA 3CDXA 2AFOA 3IWEA 2FVGA 3KL9A 4Q38A 1PCAA 5AG6A 3R9GA 4PXDA 4ZX9A 1M1DA 4P4BA 1Q7LA 2Q04A 3N7ZA 2HUZA 3EFAA 3TC8A 3D7GA 3GB0A 3VRRA 2PJ6A 1XIXA 2K5TA 2G3AA 2YGWA 1GHEA 3FVLA 3KZWA 2PSWA 3PEIA 4CRYB 3TLYA 1MK4A 3DLJA 4IK2A 4LX9A 3KQZA 4MFPA 4XPDB 2QJ8A 5AG7A 4CGLA 1QSTA 3VRNA 4IAVA 5LYLA 1KBLA 2PIZA 3NE8A 3FRMA 3ISXA 3P2HA 3TX8A 4C9RA 4M85A 4UCNA 1M4LA 2CXAA 4MJXA 3IU1A 5IV0A 1LCPA 5IR2A 3I9SA 3OP0A 3WABA 4MRIA 2JEWA 4FBEA 3VROA 3CXQA 3H8GA 5F49A 4F0XA 4EYSA 3LODA 4PK2A 3S6FA 3GJZA 4CYNA 3F0AA 3EO4A 2HI6A 1IIDA 1YGHA 3RYOA 2EZBA 3QAYA 1TF8A 4UWIA 5LYIA 3DNSA 4CAEA 2NSMA 4HNXB 3CZXA 1NSAA 2PCUA 3PP9A 1LAMA 5JM6A 3WC5A 4DUKA 3R95A 1M4IA 4UFWA 4U9YA 1XE4A 4WWVA 4TJVA 4BPWB 1TKFA 1VHSA 1V6CA 2Q44A 4P44A 4ORFA 3QB8A 2P6EA 3ZJ0A 1KEEB 5F5XA 2FL4A 3BI1A 1C30B 4INJA 4UFXA 3GLJA 4R6TA 2GP4A 3SI1A 2B4DA 2EZCA 4YU9A 3TFYA 2HB6A 4AG7A 2DPTA 2ARHA 1S60A 4CZ1A 1YW4A 1GGOA 1Y0YA 4JZ0A 3D7DA 3FECA 3H8FA 3TLGB 4PXEA 4XPKA 5LYDA 3NOJA 2I00A 3TLZA 4MHNA 4ZX8A 4COBA 5EBVA 4AB7A 2GE3A 2Z3OA 1R3NA 4B13A 2DPSA 3TOBA 2MP0A 1M6VB 4MXUA 1TXRA 3BUOB 5D8NA 2YNEA 3DGVA 1ELMP 3B3WA 3HPHE 2Q43A 2YJTA 4A37A 3WC6A 4C9UA 1NE9A 1XBUA 1NXJA 3VATA 1ZLHA 5E96A 2PVWA 4TJXA 3G8WA 3MN8A 4R9MA 2F7VA 3FB3A 4A4BA 3JVNA 3RZAA 5EMIA 1Z8LA 5G22A 2BUEA 3VH9A 5LRGA 2PJAA 4R87A 4KZTA 4NJQA 4AVBA 4MFKA 2JBKA 2PRQA 3SI2A 5AG5A 2V8DA 4LQGA 3IWGA 3FXTA 3LACA 3K9UA 4C2ZA 4BTFA 4NGNA 2AE6A 4OC3A 2AFUA 2G0BA 3B7IA 3O8ZA 1YVHA 5JYBA 4MY0A 5EC4A 4F8ZA 3FNCA 4MCRA 2PDOA 3B3SA 1CG2A 3KR5A 3OAKA 2FIAA 5D29A 4OC0A 2OZGA 4R7MA 4EMEA 2V8VA 3SJGA 1ZRSA 4OC5A 1Z8WA 1LANA 2FM4A 2EWBA 3PB9X 3SJEA 2QYVA 3K4IA 4XPLA 3MRUA 4O23A 1XF8A 2GIVA 3PRTA 4H89A 1QMUA 1VBHA 3GYAA 2HWGA 1YQEA 2VZYA 4CGOA 1TIQA 1ELLP 2CTBA 3B2YA 4KLVA 4F6AA 4P10A 4OC4A 3S9NA 2HV2A 1IYKA 2B4JC 3MGDA 3QNVA 4XNHC 4E8OA 4C99A 4NGTA 3VRQA 1HDQA 1M44A 1EO0A 3LMSA 2D0OA 4OC1A 2BCOA 4JWPA 5K8MA 4PK3A 1LRZA 1IY7A 1JWQA 1Z4RA 3HPGG 4BD9A 4PV6A 5JQ4A 3NH5A 3RNZA 1Y9ZA 4UF4A 3T05A 1Z5RA 2PVVA 4R3KA 4CYOA 3B8GA 4P4DA 2XEFA 4NF1A 5I4MA 4E2AA 2Q7SA 1Z8XA 2WPWA 4OADA 5G1ZA 8CPAA 1CS0B 1ARMA 3H8EA 1Q5XA 2ANPA 2PJ0A 5DWNA 2I3CA 3R96A 2AFWA 4OLLA 5J1QA 1JDBC 2FXFA 1BLLE 3PT1A 4YFJA 4HKFA 1YW6A 4A38A 1LOKA 4J0NA 3KKWA 1HDUA 4AXVA 2VKZG 2AUNA 4CAVA 2B3UA 5ELYA 2OB0A 3KR4A 2J9AA 3S6GA 3V8IA 4YWYA 4RI1A 4OP4A 5DS0A 1VI4A 4Q7AA 1CX8A 1BAVA 1Z2LA 2EBJA 2C1CA 2F5IA 4PSXA 4PQAA 2CNMA 4ZY0A 5THWA 4DNCA 4R57A 4EFDA 1WWZA 4UEZA 2PJ1A 4CDKA 3GIUA 2Z3NA 4P4FA 2C27A 4C86A 4CRZB 4NCZA 4OAEA 5K8NA 3EZAA 3FEDA 1MJBA 2Q4ZA 2OZHA 1MJ9A 3KI9A 2B4DB 3D7HA 2NMTA 3F8KA 5G21A 3SHPA 1FBVA 1DTDA 4CGNA 1KZFA 1UWYA 2B4BA 3H4QA 4H6UA 4Y49C 2J8RA 4A4CA 2DXQA 2F8HA 5AGEA 3PBBA 3PFEA 4IIYA 4R8FA 3CXPA 2OU2A 2ZELA 3EXNA 1CP6A 3NA6A 3JUWA 1S3ZA 4HPSA 1BO4A 2GFQA 4FD7A 1P0HA 1XMTA 3DSBA 2ZOFA 3OWCA 4DJLA 3PGPA 1EZBA 1PYTB 4A30A 2ABZA 2VEZA 2ZEPA 2DIKA 4QUSA 3SJFA 2D4OA 4F9VA 4X2TA 5GCNA 3IU2A 2ZEHA 4JD6A 4FWUA 4MJ8A 1Y7EA 4X5KA 4M6HA 1IYLA 2PJBA 3S9MA 4OKOA 2FSRA 2ZW6A 4C7IA 5FD8A 2JDCA 4MI1A 3KHZA 4TNUA 2OR4A 3W6XA 3T5MA 2UV8G 2GU2A 4JXRA 4NEXA 3TO7A 1R57A 1YR0A 1ZG9A 4KUAA 5AG4A 2YNCA 4ZY2A 1IU8A 2VBQA 4COGA 2AUMA 2AJ6A 2B3VA 1S7FA 3SXNA 1A9XB 2ZW5A 3H5ZA 2R7HA 3V7ZA 1Y7RA 2PJ9A 1Z9EA 5HH1A 3CPXA 4GXHA 4UIAA 1T36B 2J8MA 4XNHB 1YX0A 1CP7A 1H8LA 2J8NA 3CT9A 2REEA 2Z3LA 1F2OA 2EUIA 5BWAB 3T0TA 1XOVA 4UEFA 2EO8A 2CIJA 2PE3A 4CS0B 3BUNB 2EK8A 3EZEA 1BOBA 1OBRA 4E5SA 1VKCA 1N71A 4LQ6A 4UA3A 1C3OB 3VWEA 1WJTA 4MFQA 4B12A 3SXOA 2PR8A 2RC4A 4A94A 2P6FA 4WJBA 1I12A 3QAHA 4U9ZA 3OB2B 4KVME 4UEEA 1WK4A 2FE7A 4C8AA 4BBHA 3DR6A 5HKZA 4UFVA 1CM0A 5CPAA 4A2ZA 5CNPA 4C68A 1LFWA 1Q2YA 2JLMA 2ZEDA 2X7BA 1IOFA 3TYXA 1DE4C 4KORA 2D0PA 4KOSA 3I3GA 4L89A 3S6HA 2FS5A 4MHZA 1ZLIA 3SJXA 1KUXA 2ZENA 4HNWB 3A9LA 1VBGA 2PC1A 3G23A 4W9YA 1QQ9A 3TT2A 2Z3MA 4KNGE 2Z11A 5H86A 3VARA 2CF4A 2XPNA 2B5GA 3FYNA 1YREA 4C8CA 1J4JA 3FX6A 3HUVA 3VGOA 2G9DA 4PPZA 3PB8X 4AVAA 3DDDA 2PJ5A 3VWDA 3JTKA 4UCPA 5IX3A 2GANA 3PB4X 1YK3A 2ZEGA 4C2YA 1Z8TA 4UIBA 4Y49B 2NYQA 3TO6A 1A2ZA 4X3RA 4ONUA 5KTCA 3BHXA 3LWUA 3F9KC 2I79A 4OIDA 2C6GA 4B5PB 1IB1E 3U1BA 2WPXA 3K9TA 2ATRA 4C8UA 1ZYMA 5IB0A 3TLCA 4C2XA 4C9EA 1AYEA 4FAIA 5HMNA 2XEJA 1YLEA 1Z9UA 2XEIA 2R82A 1ZG8A 3OB1B 1Y0RA 2P6GA 4MBUA 4U5YA 2Q51A 3BUXB 2N3AB 4NGMA 2QIRA 4Z65A 3D7FA 3CXSA 3IJ3A 3DR8A 4BINA 5IB9A 5J8FA 1VGYA 4K3NA 2PQ8A 1NMTA 1KWMA 3FMCA 2PJ3A 4UBRA 1RTQA 4BPUB 3I6SA 3NH8A 3TLGA 2IMOA 5F47A 1B87A 1B47A 2QECA 7CPAA 3V38A 2GREA 6CPAA 2FT0A 4KOUA 2AFZA 1IGBA 1J3LA 2DEAA 4CGMA 1XFOA 2Q7BA 3TE4A 3NE7A 1XJOA 3EIFA 3VRPA 4MFJA 5K99A 4NGPA 1K4JA 4PSWA 4A95A 5HKYA 3R9EA 1XF1A 4II9A 4H6ZA 3F5BA 1NSLA 2FIWA 4JXQA 4RS2A 4F9UA 4C8FA 3PBEA 3G3SA 4QB9A 1WVMA 2CNSA 4R76A 5KTDA 1NBWA 2XPLA 2PJ4A 3IC1A 4G1PA 1I21A 1F2PA 2GLFA 3D4UA 1YMEA 3PFOA 3BXMA 4KSIA 4YRHA 3WR7A 1F57A 4NJRA 1CJWA 3WC7A 3E0KA 5KTAA 1YVKA 3NH4A 3TTHA 1CBXA 3NFZA 2HC9A 4B14A 4EVYA 1IOIA 4P6YA 3D68A 4P4EA 4H2KA 4YGOA 2JEVA 5JGFA 4NGSA 2XPPA 4C7HA 3D2PA 3WT4A 1ZO0A 1S7LA 2OH1A 3KHXA 2DLAA 3C8OA 4CDJA 1U6MA 3PLFB 3HMJG 3R9FA 1RO5A 3I74A 3BUWB 2BO9A 2R8VA 1X12A 2Y0MA 4IUSA 4CYQA 1MJAA 1V0CA 1X10A 2GLJA 4NXYA 4QVTA 4HNYB
chains in the Genus database with same CATH topology
3D66A 1CPSA 4ZI6A 3N5FA 5HVFA 2RFHA 5HXDA 3FH4A 2IJZA 4MHYA 4JYWA 2PJ8A 3FF3A 4RUHA 3L2NA 4ZYQA 1FNOA 4IHMA 1VHOA 1R43A 2AFSA 1BPMA 3B3TA 4NFRA 4DYOA 2OOTA 3KASA 1XRYA 3ISZA 4C9AA 4OMEA 4NGQA 2ZEFA 3RAMA 1GYTA 5HVHA 2RB7A 1ARLA 4P4IA 3IIBA 1YSJA 5LYFA 3ICUA 4MCSA 2O4HA 4ONWA 3VTAA 3JRUA 3KQXA 4C85A 3B3CA 1LAPA 2C5QA 3KGQA 4C9VA 2ZEMA 2BOAA 2JBJA 3HLPA 2C6CA 5CBMA 2ZEEA 1YLOA 1ZG7A 1AMPA 5JH9A 1FT7A 1CPXA 2VL1A 3PB6X 4X8IA 3B35A 4PXCA 4CPAA 1HEEA 4MCPA 3CPAA 4OIWA 1TF9A 4TWEA 3B3VA 4C8FA 2QVPA 4C8PA 2V8HA 4MCQA 2V77A 4PXBA 5LRKA 2PIYA 3D67A 2ZOGA 4P45A 5F09A 2WZNA 4GM5A 2EK9A 4B6ZA 1EE3P 4FUUA 2C6PA 3RBUA 1XMBA 2PJ7A 4OC2A 5LRJA 3IWWA 5K8PA 3I1UA 3S9LA 3GUXA 1BPNA 2WYRA 3BI0A 3IFEA 3K2KA 4MHPA 4C84A 3T8WA 4YN3A 4NGRA 5K8OA 2O53A 2POKA 1VHEA 2AFXA 1VIXA 3IEHA 4A39A 1TKJA 3SI0A 2XEGA 2V8GA 3FJUA 4C8TA 2IQ6A 4P4JA 1TKHA 4ZY1A 2AFMA 3IO1A 2PJ2A 2CTCA 2PJCA 2ZEOA 3FEEA 1JQGA 4EWTA 3PB7X 4MMOA 3CDXA 2AFOA 3KL9A 2FVGA 1PCAA 4PXDA 4ZX9A 4P4BA 1Q7LA 3TC8A 3D7GA 3GB0A 3KZWA 2PJ6A 3FVLA 3PEIA 3DLJA 4IK2A 3KQZA 2QJ8A 4IAVA 5LYLA 2PIZA 3ISXA 3TX8A 4C9RA 1M4LA 1LCPA 5IR2A 3WABA 4MRIA 2JEWA 4FBEA 3H8GA 1TF8A 5LYIA 2NSMA 1NSAA 2PCUA 1LAMA 5JM6A 3WC5A 4DUKA 4WWVA 4TJVA 1TKFA 1V6CA 4P44A 3BI1A 3GLJA 4R6TA 2GP4A 3SI1A 4YU9A 2HB6A 1YW4A 1Y0YA 4JZ0A 3D7DA 3FECA 3H8FA 4PXEA 5LYDA 4MHNA 4ZX8A 1R3NA 4MXUA 1TXRA 5D8NA 3DGVA 1ELMP 3B3WA 2Q43A 4A37A 3WC6A 4C9UA 1XBUA 3VATA 1ZLHA 2PVWA 4TJXA 3MN8A 2F7VA 3RZAA 1Z8LA 3VH9A 5LRGA 2PJAA 4NJQA 3SI2A 2JBKA 2PRQA 2V8DA 4LQGA 4NGNA 4OC3A 2AFUA 3B7IA 4F8ZA 4MCRA 3B3SA 4EMEA 1CG2A 3KR5A 4R7MA 5D29A 4OC0A 2V8VA 3SJGA 4OC5A 1LANA 2EWBA 3PB9X 3SJEA 2QYVA 3MRUA 4O23A 3PRTA 1QMUA 2CTBA 1ELLP 3B2YA 5HVGA 1WVMA 4P10A 4OC4A 3S9NA 3QNVA 4C99A 4NGTA 1HDQA 3LMSA 4OC1A 2BCOA 5K8MA 1IY7A 4BD9A 3NH5A 1Y9ZA 4UF4A 1Z5RA 2PVVA 5I4MA 4P4DA 2XEFA 8CPAA 3H8EA 1ARMA 2ANPA 2PJ0A 2I3CA 2AFWA 5J1QA 1BLLE 1YW6A 4A38A 1LOKA 4AXVA 1HDUA 5ELYA 3KR4A 2J9AA 4YWYA 4OP4A 5DS0A 4Q7AA 1CX8A 1BAVA 1Z2LA 2C1CA 4PQAA 4ZY0A 5THWA 4EFDA 4UEZA 2PJ1A 4CDKA 4P4FA 4C86A 5K8NA 3FEDA 2Q4ZA 3KI9A 3D7HA 1DTDA 1UWYA 2F8HA 3PBBA 3PFEA 4R8FA 2ZELA 1CP6A 3NA6A 4DJLA 2ZOFA 1PYTB 2ABZA 2ZEPA 3SJFA 4F9VA 4X2TA 2ZEHA 4FWUA 1Y7EA 2PJBA 3S9MA 4OKOA 3KHZA 4TNUA 2OR4A 2GU2A 1ZG9A 4ZY2A 3V7ZA 2PJ9A 3CPXA 4UIAA 1CP7A 1H8LA 3CT9A 1F2OA 4UEFA 2CIJA 2PE3A 2EK8A 1OBRA 4A94A 4WJBA 4UEEA 4C8AA 5CPAA 1LFWA 2ZEDA 1DE4C 4MHZA 1ZLIA 3SJXA 2ZENA 4W9YA 1QQ9A 4KNGE 3VARA 2CF4A 4C8CA 3FX6A 3HUVA 2G9DA 4PPZA 3PB8X 2PJ5A 3PB4X 2ZEGA 4UIBA 2NYQA 4X3RA 3BHXA 3LWUA 4OIDA 2C6GA 3K9TA 4C8UA 4C9EA 1AYEA 4FAIA 2XEJA 2XEIA 1ZG8A 1Y0RA 2Q51A 4NGMA 4Z65A 3D7FA 3IJ3A 5IB9A 1VGYA 4K3NA 1KWMA 3FMCA 2PJ3A 1RTQA 3I6SA 3NH8A 2IMOA 7CPAA 3V38A 2GREA 6CPAA 2AFZA 1IGBA 2DEAA 1XFOA 1XJOA 3EIFA 4NGPA 1XF1A 4F9UA 3PBEA 4R76A 2PJ4A 3IC1A 4G1PA 1F2PA 2GLFA 3D4UA 1YMEA 3PFOA 3BXMA 4KSIA 1F57A 4NJRA 3WC7A 3NH4A 1CBXA 3NFZA 2HC9A 4P6YA 3D68A 4P4EA 4H2KA 5JGFA 4NGSA 3WT4A 3KHXA 4CDJA 3I74A 2BO9A 2GLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D66 A;  1CPS A;  4ZI6 A;  3N5F A;  5HVF A;  2RFH A;  5HXD A;  3FH4 A;  2IJZ A;  4MHY A;  4JYW A;  2PJ8 A;  3FF3 A;  4RUH A;  3L2N A;  4ZYQ A;  1FNO A;  4IHM A;  1VHO A;  1R43 A;  2AFS A;  1BPM A;  3B3T A;  4NFR A;  4DYO A;  2OOT A;  3KAS A;  1XRY A;  3ISZ A;  4C9A A;  4OME A;  4NGQ A;  2ZEF A;  3RAM A;  1GYT A;  5HVH A;  2RB7 A;  1ARL A;  4P4I A;  3IIB A;  1YSJ A;  5LYF A;  3ICU A;  4MCS A;  2O4H A;  4ONW A;  3VTA A;  3JRU A;  3KQX A;  4C85 A;  3B3C A;  1LAP A;  3KGQ A;  4C9V A;  2ZEM A;  2BOA A;  2JBJ A;  3HLP A;  2C6C A;  5CBM A;  2ZEE A;  1YLO A;  1ZG7 A;  1AMP A;  5JH9 A;  1FT7 A;  1CPX A;  2VL1 A;  3PB6 X;  4X8I A;  3B35 A;  4PXC A;  4CPA A;  1HEE A;  4MCP A;  3CPA A;  4OIW A;  1TF9 A;  4TWE A;  3B3V A;  4C8F A;  2QVP A;  4C8P A;  2V8H A;  4MCQ A;  2V77 A;  4PXB A;  5LRK A;  2PIY A;  3D67 A;  2ZOG A;  4P45 A;  5F09 A;  2WZN A;  4GM5 A;  2EK9 A;  4B6Z A;  1EE3 P;  4FUU A;  2C6P A;  3RBU A;  1XMB A;  2PJ7 A;  4OC2 A;  5LRJ A;  3IWW A;  5K8P A;  3I1U A;  3S9L A;  3GUX A;  1BPN A;  2WYR A;  3BI0 A;  3IFE A;  3K2K A;  4MHP A;  4C84 A;  3T8W A;  4YN3 A;  4NGR A;  5K8O A;  2O53 A;  2POK A;  1VHE A;  2AFX A;  1VIX A;  3IEH A;  4A39 A;  1TKJ A;  3SI0 A;  2XEG A;  2V8G A;  3FJU A;  4C8T A;  2IQ6 A;  4P4J A;  1TKH A;  4ZY1 A;  2AFM A;  3IO1 A;  2PJ2 A;  2CTC A;  2PJC A;  2ZEO A;  3FEE A;  1JQG A;  4EWT A;  3PB7 X;  4MMO A;  3CDX A;  2AFO A;  3KL9 A;  2FVG A;  1PCA A;  4PXD A;  4ZX9 A;  4P4B A;  1Q7L A;  3TC8 A;  3D7G A;  3GB0 A;  3KZW A;  2PJ6 A;  3FVL A;  3PEI A;  3DLJ A;  4IK2 A;  3KQZ A;  2QJ8 A;  4IAV A;  5LYL A;  2PIZ A;  3ISX A;  3TX8 A;  4C9R A;  1M4L A;  1LCP A;  3WAB A;  4MRI A;  2JEW A;  4FBE A;  3H8G A;  1TF8 A;  5LYI A;  2NSM A;  1NSA A;  2PCU A;  1LAM A;  5JM6 A;  3WC5 A;  4DUK A;  4WWV A;  4TJV A;  1TKF A;  1V6C A;  4P44 A;  3BI1 A;  3GLJ A;  4R6T A;  3SI1 A;  4YU9 A;  2HB6 A;  1YW4 A;  1Y0Y A;  4JZ0 A;  3D7D A;  3FEC A;  3H8F A;  4PXE A;  5LYD A;  4MHN A;  4ZX8 A;  1R3N A;  4MXU A;  1TXR A;  5D8N A;  3DGV A;  1ELM P;  3B3W A;  2Q43 A;  4A37 A;  3WC6 A;  4C9U A;  1XBU A;  3VAT A;  1ZLH A;  2PVW A;  4TJX A;  3MN8 A;  2F7V A;  3RZA A;  1Z8L A;  3VH9 A;  5LRG A;  2PJA A;  4NJQ A;  3SI2 A;  2JBK A;  2PRQ A;  2V8D A;  4LQG A;  4NGN A;  4OC3 A;  2AFU A;  3B7I A;  4F8Z A;  4MCR A;  3B3S A;  4EME A;  1CG2 A;  3KR5 A;  4R7M A;  5D29 A;  4OC0 A;  2V8V A;  3SJG A;  4OC5 A;  1LAN A;  2EWB A;  3PB9 X;  3SJE A;  2QYV A;  3MRU A;  4O23 A;  3PRT A;  1QMU A;  2CTB A;  1ELL P;  3B2Y A;  5HVG A;  1WVM A;  4P10 A;  4OC4 A;  3S9N A;  3QNV A;  4C99 A;  4NGT A;  1HDQ A;  3LMS A;  4OC1 A;  2BCO A;  5K8M A;  1IY7 A;  4BD9 A;  3NH5 A;  1Y9Z A;  4UF4 A;  1Z5R A;  2PVV A;  5I4M A;  4P4D A;  2XEF A;  8CPA A;  3H8E A;  1ARM A;  2ANP A;  2PJ0 A;  2I3C A;  2AFW A;  5J1Q A;  1BLL E;  1YW6 A;  4A38 A;  1LOK A;  4AXV A;  1HDU A;  5ELY A;  3KR4 A;  2J9A A;  4YWY A;  4OP4 A;  5DS0 A;  4Q7A A;  1CX8 A;  1BAV A;  1Z2L A;  2C1C A;  4PQA A;  4ZY0 A;  5THW A;  4EFD A;  4UEZ A;  2PJ1 A;  4CDK A;  4P4F A;  4C86 A;  5K8N A;  3FED A;  2Q4Z A;  3KI9 A;  3D7H A;  1DTD A;  1UWY A;  2F8H A;  3PBB A;  3PFE A;  4R8F A;  2ZEL A;  1CP6 A;  3NA6 A;  4DJL A;  2ZOF A;  1PYT B;  2ABZ A;  2ZEP A;  3SJF A;  4F9V A;  4X2T A;  2ZEH A;  4FWU A;  1Y7E A;  2PJB A;  3S9M A;  4OKO A;  3KHZ A;  4TNU A;  2OR4 A;  2GU2 A;  1ZG9 A;  4ZY2 A;  3V7Z A;  2PJ9 A;  3CPX A;  4UIA A;  1CP7 A;  1H8L A;  3CT9 A;  1F2O A;  4UEF A;  2CIJ A;  2PE3 A;  2EK8 A;  1OBR A;  4A94 A;  4WJB A;  4UEE A;  4C8A A;  5CPA A;  1LFW A;  2ZED A;  1DE4 C;  4MHZ A;  1ZLI A;  3SJX A;  2ZEN A;  4W9Y A;  1QQ9 A;  4KNG E;  3VAR A;  2CF4 A;  4C8C A;  3FX6 A;  3HUV A;  2G9D A;  4PPZ A;  3PB8 X;  2PJ5 A;  3PB4 X;  2ZEG A;  4UIB A;  2NYQ A;  4X3R A;  3BHX A;  3LWU A;  4OID A;  2C6G A;  3K9T A;  4C8U A;  4C9E A;  1AYE A;  4FAI A;  2XEJ A;  2XEI A;  1ZG8 A;  1Y0R A;  2Q51 A;  4NGM A;  4Z65 A;  3D7F A;  3IJ3 A;  5IB9 A;  1VGY A;  4K3N A;  1KWM A;  3FMC A;  2PJ3 A;  1RTQ A;  3I6S A;  3NH8 A;  2IMO A;  7CPA A;  3V38 A;  2GRE A;  6CPA A;  2AFZ A;  1IGB A;  2DEA A;  1XFO A;  1XJO A;  3EIF A;  4NGP A;  1XF1 A;  4F9U A;  3PBE A;  4R76 A;  2PJ4 A;  3IC1 A;  4G1P A;  1F2P A;  2GLF A;  3D4U A;  1YME A;  3PFO A;  3BXM A;  4KSI A;  1F57 A;  4NJR A;  3WC7 A;  3NH4 A;  1CBX A;  3NFZ A;  2HC9 A;  4P6Y A;  3D68 A;  4P4E A;  4H2K A;  5JGF A;  4NGS A;  3WT4 A;  3KHX A;  4CDJ A;  3I74 A;  2BO9 A;  2GLJ A; 
#chains in the Genus database with same CATH topology
 4BMH A;  3EC4 A;  2B58 A;  1CPS A;  3D66 A;  4ZI6 A;  3N5F A;  1S7K A;  5HVF A;  2RFH A;  5HXD A;  3FH4 A;  2IJZ A;  3GY9 A;  4R3L A;  5DWM A;  4JJX A;  4IF5 A;  2VQY A;  4MHY A;  4M6I A;  4JYW A;  2D4P A;  2PJ8 A;  3FF3 A;  5F48 A;  2OZU A;  2Z3K A;  3L2N A;  4RUH A;  5HVG A;  4ZYQ A;  2YJV A;  1FNO A;  4CGP A;  1UFH A;  2VXK A;  1VHO A;  1R43 A;  4IHM A;  4E94 A;  2VI7 A;  2AFS A;  1KC7 A;  1BPM A;  3SR3 A;  1Z4E A;  4AVC A;  1QSM A;  4UWJ A;  4A33 A;  3B3T A;  4KS9 A;  5HKW A;  4B5O A;  2WSA A;  2REF A;  3R1K A;  4NFR A;  4DYO A;  1RXT A;  4QBJ A;  2OOT A;  2X0S A;  2B5G B;  1KUY A;  4ZBG A;  3KAS A;  1XRY A;  2O28 A;  3ISZ A;  2Y1N A;  1CE8 B;  4ZGY B;  4C9A A;  4OME A;  3P2F A;  4KLW A;  4MFL A;  3TLB A;  2YNC C;  4MY3 A;  4E0A A;  2B0A A;  1JDE A;  4KOW A;  5F9M A;  4NGQ A;  4MHD A;  2ZEF A;  5H84 A;  1AUG A;  5AXI A;  2HQY A;  3RAM A;  1GYT A;  5J3X A;  5HVH A;  2RB7 A;  5G20 A;  2CNT A;  2WUU A;  4F0Y A;  1ARL A;  4P4I A;  2E28 A;  3IIB A;  5A28 A;  3LD2 A;  1YSJ A;  3BLN A;  3D2M A;  4K30 A;  5LYF A;  3T9Y A;  3ICU A;  3PZJ A;  2G3T A;  4B10 A;  1QSO A;  4MFZ A;  4KSA A;  2PCN A;  1YVO A;  1PU9 A;  4A31 A;  2Q4V A;  4MCS A;  3UY5 A;  4FD5 A;  2O4H A;  3FIX A;  4AG9 A;  4ONW A;  5BY0 A;  3VTA A;  2H5M A;  4JLY A;  3JRU A;  1Q2D A;  3KQX A;  3ZNI A;  4C85 A;  3B3C A;  1LAP A;  2C5Q A;  3KGQ A;  4GS4 A;  2ZEM A;  4C9V A;  2BOA A;  2JBJ A;  4I49 A;  3HLP A;  2C6C A;  3FBU A;  5CBM A;  2ZEE A;  3RO0 A;  2YND A;  1YLO A;  5JPH A;  4XPD C;  1ZG7 A;  2EZA A;  1AMP A;  2Q4Y A;  3D8P A;  5JH9 A;  2HRO A;  2ODF A;  1FT7 A;  1S7N A;  3BJ8 A;  1CPX A;  1DIK A;  2OLS A;  3BUM B;  4H1H A;  2VL1 A;  3PB6 X;  4B5P A;  4X8I A;  3B35 A;  4FD6 A;  4CAF A;  4PXC A;  2VZZ A;  3T90 A;  3KRV A;  4CPA A;  3GKR A;  1HEE A;  5J8C A;  4MCP A;  1OZP A;  3CPA A;  4OIW A;  3D3S A;  1TF9 A;  4KOV A;  3B3V A;  4TWE A;  2QVP A;  5A27 A;  1L0C A;  3EZB A;  2V8H A;  4A32 A;  1M4G A;  4MCQ A;  3T07 A;  4C8P A;  4KOT A;  2FCK A;  2V77 A;  4CYP A;  2P0W A;  1ZL0 A;  4KOY A;  4NSQ A;  4PXB A;  5ISV A;  3TLA A;  4KOX A;  5LRK A;  5C88 A;  3NFQ A;  1KUV A;  2PIY A;  2BEI A;  3D67 A;  4KVX A;  2A4N A;  2ZOG A;  4P45 A;  4M6G A;  3TOA A;  5F09 A;  2BSW A;  2WZN A;  3W91 A;  2ZPA A;  5I0C A;  1EZA A;  4BPX B;  1Q2C A;  4GM5 A;  2JDD A;  2BL1 A;  2EK9 A;  2KCW A;  1PUA A;  5C82 A;  4CAW A;  4B6Z A;  4J3G A;  1EE3 P;  1ON0 A;  4KVO E;  4LUA A;  4CAX A;  4FUU A;  4M8D A;  4MI4 A;  2C6P A;  4CO9 A;  3RBU A;  1IIC A;  1M4D A;  2Q0Y A;  1Y9K A;  5F46 A;  1QSN A;  1XMB A;  1P4N A;  2PRB A;  2PJ7 A;  1QSR A;  4JVO A;  1S5K A;  4OC2 A;  2PR1 A;  4KUB A;  2QML A;  5LRJ A;  1R61 A;  3IWW A;  2Z10 A;  4FD4 A;  3PFV A;  5K8P A;  3BJ7 A;  3S9L A;  3I1U A;  1BPN A;  3GUX A;  2WYR A;  3TLE A;  3BI0 A;  4RR2 B;  2R1I A;  2ZW4 A;  2ZW7 A;  3IFE A;  2XPO A;  4M3S A;  3IGR A;  3K2K A;  4IIX A;  4MHP A;  4C84 A;  4B11 A;  5JVL A;  3T8W A;  4YN3 A;  4NGR A;  1SQH A;  5K8O A;  4KSF A;  2O53 A;  3C26 A;  2POK A;  1VHE A;  2Z0Z A;  2AFX A;  3EY5 A;  4L8A A;  3W6S A;  4UCM A;  1VIX A;  2Z3P A;  3IEH A;  4A39 A;  2CBL A;  3S6K A;  1I1D A;  1TKJ A;  1B6B A;  4QC6 A;  2EVN A;  2XEG A;  2ZXV A;  3SI0 A;  5F1Y A;  2IL4 A;  2V8G A;  4Q36 A;  2Y1M A;  3FJU A;  5F13 A;  1BXR B;  2IQ6 A;  1FY7 A;  4C8T A;  2CY2 A;  2DF5 A;  4P4J A;  1TKH A;  4ZY1 A;  2R98 A;  2AFM A;  3IO1 A;  2PJ2 A;  4RN7 A;  4GPL B;  2CTC A;  2PJC A;  3TO9 A;  2ZEO A;  1XEB A;  1Y9W A;  5FVJ A;  3FEE A;  1JQG A;  3ZZI A;  3PB7 X;  4EWT A;  3U88 C;  4MMO A;  3TCV A;  3CDX A;  2AFO A;  3IWE A;  2FVG A;  3KL9 A;  4Q38 A;  1PCA A;  5AG6 A;  3R9G A;  4PXD A;  4ZX9 A;  1M1D A;  4P4B A;  1Q7L A;  2Q04 A;  3N7Z A;  2HUZ A;  3EFA A;  3TC8 A;  3D7G A;  3GB0 A;  3VRR A;  2PJ6 A;  1XIX A;  2K5T A;  2G3A A;  2YGW A;  1GHE A;  3FVL A;  3KZW A;  2PSW A;  3PEI A;  4CRY B;  3TLY A;  1MK4 A;  3DLJ A;  4IK2 A;  4LX9 A;  3KQZ A;  4MFP A;  4XPD B;  2QJ8 A;  5AG7 A;  4CGL A;  1QST A;  3VRN A;  4IAV A;  5LYL A;  1KBL A;  2PIZ A;  3NE8 A;  3FRM A;  3ISX A;  3P2H A;  3TX8 A;  4C9R A;  4M85 A;  4UCN A;  1M4L A;  2CXA A;  4MJX A;  3IU1 A;  5IV0 A;  1LCP A;  5IR2 A;  3I9S A;  3OP0 A;  3WAB A;  4MRI A;  2JEW A;  4FBE A;  3VRO A;  3CXQ A;  3H8G A;  5F49 A;  4F0X A;  4EYS A;  3LOD A;  4PK2 A;  3S6F A;  3GJZ A;  4CYN A;  3F0A A;  3EO4 A;  2HI6 A;  1IID A;  1YGH A;  3RYO A;  2EZB A;  3QAY A;  1TF8 A;  4UWI A;  5LYI A;  3DNS A;  4CAE A;  2NSM A;  4HNX B;  3CZX A;  1NSA A;  2PCU A;  3PP9 A;  1LAM A;  5JM6 A;  3WC5 A;  4DUK A;  3R95 A;  1M4I A;  4UFW A;  4U9Y A;  1XE4 A;  4WWV A;  4TJV A;  4BPW B;  1TKF A;  1VHS A;  1V6C A;  2Q44 A;  4P44 A;  4ORF A;  3QB8 A;  2P6E A;  3ZJ0 A;  1KEE B;  5F5X A;  2FL4 A;  3BI1 A;  1C30 B;  4INJ A;  4UFX A;  3GLJ A;  4R6T A;  2GP4 A;  3SI1 A;  2B4D A;  2EZC A;  4YU9 A;  3TFY A;  2HB6 A;  4AG7 A;  2DPT A;  2ARH A;  1S60 A;  4CZ1 A;  1YW4 A;  1GGO A;  1Y0Y A;  4JZ0 A;  3D7D A;  3FEC A;  3H8F A;  3TLG B;  4PXE A;  4XPK A;  5LYD A;  3NOJ A;  2I00 A;  3TLZ A;  4MHN A;  4ZX8 A;  4COB A;  5EBV A;  4AB7 A;  2GE3 A;  2Z3O A;  1R3N A;  4B13 A;  2DPS A;  3TOB A;  2MP0 A;  1M6V B;  4MXU A;  1TXR A;  3BUO B;  5D8N A;  2YNE A;  3DGV A;  1ELM P;  3B3W A;  3HPH E;  2Q43 A;  2YJT A;  4A37 A;  3WC6 A;  4C9U A;  1NE9 A;  1XBU A;  1NXJ A;  3VAT A;  1ZLH A;  5E96 A;  2PVW A;  4TJX A;  3G8W A;  3MN8 A;  4R9M A;  2F7V A;  3FB3 A;  4A4B A;  3JVN A;  3RZA A;  5EMI A;  1Z8L A;  5G22 A;  2BUE A;  3VH9 A;  5LRG A;  2PJA A;  4R87 A;  4KZT A;  4NJQ A;  4AVB A;  4MFK A;  2JBK A;  2PRQ A;  3SI2 A;  5AG5 A;  2V8D A;  4LQG A;  3IWG A;  3FXT A;  3LAC A;  3K9U A;  4C2Z A;  4BTF A;  4NGN A;  2AE6 A;  4OC3 A;  2AFU A;  2G0B A;  3B7I A;  3O8Z A;  1YVH A;  5JYB A;  4MY0 A;  5EC4 A;  4F8Z A;  3FNC A;  4MCR A;  2PDO A;  3B3S A;  1CG2 A;  3KR5 A;  3OAK A;  2FIA A;  5D29 A;  4OC0 A;  2OZG A;  4R7M A;  4EME A;  2V8V A;  3SJG A;  1ZRS A;  4OC5 A;  1Z8W A;  1LAN A;  2FM4 A;  2EWB A;  3PB9 X;  3SJE A;  2QYV A;  3K4I A;  4XPL A;  3MRU A;  4O23 A;  1XF8 A;  2GIV A;  3PRT A;  4H89 A;  1QMU A;  1VBH A;  3GYA A;  2HWG A;  1YQE A;  2VZY A;  4CGO A;  1TIQ A;  1ELL P;  2CTB A;  3B2Y A;  4KLV A;  4F6A A;  4P10 A;  4OC4 A;  3S9N A;  2HV2 A;  1IYK A;  2B4J C;  3MGD A;  3QNV A;  4XNH C;  4E8O A;  4C99 A;  4NGT A;  3VRQ A;  1HDQ A;  1M44 A;  1EO0 A;  3LMS A;  2D0O A;  4OC1 A;  2BCO A;  4JWP A;  5K8M A;  4PK3 A;  1LRZ A;  1IY7 A;  1JWQ A;  1Z4R A;  3HPG G;  4BD9 A;  4PV6 A;  5JQ4 A;  3NH5 A;  3RNZ A;  1Y9Z A;  4UF4 A;  3T05 A;  1Z5R A;  2PVV A;  4R3K A;  4CYO A;  3B8G A;  4P4D A;  2XEF A;  4NF1 A;  5I4M A;  4E2A A;  2Q7S A;  1Z8X A;  2WPW A;  4OAD A;  5G1Z A;  8CPA A;  1CS0 B;  1ARM A;  3H8E A;  1Q5X A;  2ANP A;  2PJ0 A;  5DWN A;  2I3C A;  3R96 A;  2AFW A;  4OLL A;  5J1Q A;  1JDB C;  2FXF A;  1BLL E;  3PT1 A;  4YFJ A;  4HKF A;  1YW6 A;  4A38 A;  1LOK A;  4J0N A;  3KKW A;  1HDU A;  4AXV A;  2VKZ G;  2AUN A;  4CAV A;  2B3U A;  5ELY A;  2OB0 A;  3KR4 A;  2J9A A;  3S6G A;  3V8I A;  4YWY A;  4RI1 A;  4OP4 A;  5DS0 A;  1VI4 A;  4Q7A A;  1CX8 A;  1BAV A;  1Z2L A;  2EBJ A;  2C1C A;  2F5I A;  4PSX A;  4PQA A;  2CNM A;  4ZY0 A;  5THW A;  4DNC A;  4R57 A;  4EFD A;  1WWZ A;  4UEZ A;  2PJ1 A;  4CDK A;  3GIU A;  2Z3N A;  4P4F A;  2C27 A;  4C86 A;  4CRZ B;  4NCZ A;  4OAE A;  5K8N A;  3EZA A;  3FED A;  1MJB A;  2Q4Z A;  2OZH A;  1MJ9 A;  3KI9 A;  2B4D B;  3D7H A;  2NMT A;  3F8K A;  5G21 A;  3SHP A;  1FBV A;  1DTD A;  4CGN A;  1KZF A;  1UWY A;  2B4B A;  3H4Q A;  4H6U A;  4Y49 C;  2J8R A;  4A4C A;  2DXQ A;  2F8H A;  5AGE A;  3PBB A;  3PFE A;  4IIY A;  4R8F A;  3CXP A;  2OU2 A;  2ZEL A;  3EXN A;  1CP6 A;  3NA6 A;  3JUW A;  1S3Z A;  4HPS A;  1BO4 A;  2GFQ A;  4FD7 A;  1P0H A;  1XMT A;  3DSB A;  2ZOF A;  3OWC A;  4DJL A;  3PGP A;  1EZB A;  1PYT B;  4A30 A;  2ABZ A;  2VEZ A;  2ZEP A;  2DIK A;  4QUS A;  3SJF A;  2D4O A;  4F9V A;  4X2T A;  5GCN A;  3IU2 A;  2ZEH A;  4JD6 A;  4FWU A;  4MJ8 A;  1Y7E A;  4X5K A;  4M6H A;  1IYL A;  2PJB A;  3S9M A;  4OKO A;  2FSR A;  2ZW6 A;  4C7I A;  5FD8 A;  2JDC A;  4MI1 A;  3KHZ A;  4TNU A;  2OR4 A;  3W6X A;  3T5M A;  2UV8 G;  2GU2 A;  4JXR A;  4NEX A;  3TO7 A;  1R57 A;  1YR0 A;  1ZG9 A;  4KUA A;  5AG4 A;  2YNC A;  4ZY2 A;  1IU8 A;  2VBQ A;  4COG A;  2AUM A;  2AJ6 A;  2B3V A;  1S7F A;  3SXN A;  1A9X B;  2ZW5 A;  3H5Z A;  2R7H A;  3V7Z A;  1Y7R A;  2PJ9 A;  1Z9E A;  5HH1 A;  3CPX A;  4GXH A;  4UIA A;  1T36 B;  2J8M A;  4XNH B;  1YX0 A;  1CP7 A;  1H8L A;  2J8N A;  3CT9 A;  2REE A;  2Z3L A;  1F2O A;  2EUI A;  5BWA B;  3T0T A;  1XOV A;  4UEF A;  2EO8 A;  2CIJ A;  2PE3 A;  4CS0 B;  3BUN B;  2EK8 A;  3EZE A;  1BOB A;  1OBR A;  4E5S A;  1VKC A;  1N71 A;  4LQ6 A;  4UA3 A;  1C3O B;  3VWE A;  1WJT A;  4MFQ A;  4B12 A;  3SXO A;  2PR8 A;  2RC4 A;  4A94 A;  2P6F A;  4WJB A;  1I12 A;  3QAH A;  4U9Z A;  3OB2 B;  4KVM E;  4UEE A;  1WK4 A;  2FE7 A;  4C8A A;  4BBH A;  3DR6 A;  5HKZ A;  4UFV A;  1CM0 A;  5CPA A;  4A2Z A;  5CNP A;  4C68 A;  1LFW A;  1Q2Y A;  2JLM A;  2ZED A;  2X7B A;  1IOF A;  3TYX A;  1DE4 C;  4KOR A;  2D0P A;  4KOS A;  3I3G A;  4L89 A;  3S6H A;  2FS5 A;  4MHZ A;  1ZLI A;  3SJX A;  1KUX A;  2ZEN A;  4HNW B;  3A9L A;  1VBG A;  2PC1 A;  3G23 A;  4W9Y A;  1QQ9 A;  3TT2 A;  2Z3M A;  4KNG E;  2Z11 A;  5H86 A;  3VAR A;  2CF4 A;  2XPN A;  2B5G A;  3FYN A;  1YRE A;  4C8C A;  1J4J A;  3FX6 A;  3HUV A;  3VGO A;  2G9D A;  4PPZ A;  3PB8 X;  4AVA A;  3DDD A;  2PJ5 A;  3VWD A;  3JTK A;  4UCP A;  5IX3 A;  2GAN A;  3PB4 X;  1YK3 A;  2ZEG A;  4C2Y A;  1Z8T A;  4UIB A;  4Y49 B;  2NYQ A;  3TO6 A;  1A2Z A;  4X3R A;  4ONU A;  5KTC A;  3BHX A;  3LWU A;  3F9K C;  2I79 A;  4OID A;  2C6G A;  4B5P B;  1IB1 E;  3U1B A;  2WPX A;  3K9T A;  2ATR A;  4C8U A;  1ZYM A;  5IB0 A;  3TLC A;  4C2X A;  4C9E A;  1AYE A;  4FAI A;  5HMN A;  2XEJ A;  1YLE A;  1Z9U A;  2XEI A;  2R82 A;  1ZG8 A;  3OB1 B;  1Y0R A;  2P6G A;  4MBU A;  4U5Y A;  2Q51 A;  3BUX B;  2N3A B;  4NGM A;  2QIR A;  4Z65 A;  3D7F A;  3CXS A;  3IJ3 A;  3DR8 A;  4BIN A;  5IB9 A;  5J8F A;  1VGY A;  4K3N A;  2PQ8 A;  1NMT A;  1KWM A;  3FMC A;  2PJ3 A;  4UBR A;  1RTQ A;  4BPU B;  3I6S A;  3NH8 A;  3TLG A;  2IMO A;  5F47 A;  1B87 A;  1B47 A;  2QEC A;  7CPA A;  3V38 A;  2GRE A;  6CPA A;  2FT0 A;  4KOU A;  2AFZ A;  1IGB A;  1J3L A;  2DEA A;  4CGM A;  1XFO A;  2Q7B A;  3TE4 A;  3NE7 A;  1XJO A;  3EIF A;  3VRP A;  4MFJ A;  5K99 A;  4NGP A;  1K4J A;  4PSW A;  4A95 A;  5HKY A;  3R9E A;  1XF1 A;  4II9 A;  4H6Z A;  3F5B A;  1NSL A;  2FIW A;  4JXQ A;  4RS2 A;  4F9U A;  4C8F A;  3PBE A;  3G3S A;  4QB9 A;  1WVM A;  2CNS A;  4R76 A;  5KTD A;  1NBW A;  2XPL A;  2PJ4 A;  3IC1 A;  4G1P A;  1I21 A;  1F2P A;  2GLF A;  3D4U A;  1YME A;  3PFO A;  3BXM A;  4KSI A;  4YRH A;  3WR7 A;  1F57 A;  4NJR A;  1CJW A;  3WC7 A;  3E0K A;  5KTA A;  1YVK A;  3NH4 A;  3TTH A;  1CBX A;  3NFZ A;  2HC9 A;  4B14 A;  4EVY A;  1IOI A;  4P6Y A;  3D68 A;  4P4E A;  4H2K A;  4YGO A;  2JEV A;  5JGF A;  4NGS A;  2XPP A;  4C7H A;  3D2P A;  3WT4 A;  1ZO0 A;  1S7L A;  2OH1 A;  3KHX A;  2DLA A;  3C8O A;  4CDJ A;  1U6M A;  3PLF B;  3HMJ G;  3R9F A;  1RO5 A;  3I74 A;  3BUW B;  2BO9 A;  2R8V A;  1X12 A;  2Y0M A;  4IUS A;  4CYQ A;  1MJA A;  1V0C A;  1X10 A;  2GLJ A;  4NXY A;  4QVT A;  4HNY B; 
#chains in the Genus database with same CATH homology
 3D66 A;  1CPS A;  4ZI6 A;  3N5F A;  5HVF A;  2RFH A;  5HXD A;  3FH4 A;  2IJZ A;  4MHY A;  4JYW A;  2PJ8 A;  3FF3 A;  4RUH A;  3L2N A;  4ZYQ A;  1FNO A;  4IHM A;  1VHO A;  1R43 A;  2AFS A;  1BPM A;  3B3T A;  4NFR A;  4DYO A;  2OOT A;  3KAS A;  1XRY A;  3ISZ A;  4C9A A;  4OME A;  4NGQ A;  2ZEF A;  3RAM A;  1GYT A;  5HVH A;  2RB7 A;  1ARL A;  4P4I A;  3IIB A;  1YSJ A;  5LYF A;  3ICU A;  4MCS A;  2O4H A;  4ONW A;  3VTA A;  3JRU A;  3KQX A;  4C85 A;  3B3C A;  1LAP A;  2C5Q A;  3KGQ A;  4C9V A;  2ZEM A;  2BOA A;  2JBJ A;  3HLP A;  2C6C A;  5CBM A;  2ZEE A;  1YLO A;  1ZG7 A;  1AMP A;  5JH9 A;  1FT7 A;  1CPX A;  2VL1 A;  3PB6 X;  4X8I A;  3B35 A;  4PXC A;  4CPA A;  1HEE A;  4MCP A;  3CPA A;  4OIW A;  1TF9 A;  4TWE A;  3B3V A;  4C8F A;  2QVP A;  4C8P A;  2V8H A;  4MCQ A;  2V77 A;  4PXB A;  5LRK A;  2PIY A;  3D67 A;  2ZOG A;  4P45 A;  5F09 A;  2WZN A;  4GM5 A;  2EK9 A;  4B6Z A;  1EE3 P;  4FUU A;  2C6P A;  3RBU A;  1XMB A;  2PJ7 A;  4OC2 A;  5LRJ A;  3IWW A;  5K8P A;  3I1U A;  3S9L A;  3GUX A;  1BPN A;  2WYR A;  3BI0 A;  3IFE A;  3K2K A;  4MHP A;  4C84 A;  3T8W A;  4YN3 A;  4NGR A;  5K8O A;  2O53 A;  2POK A;  1VHE A;  2AFX A;  1VIX A;  3IEH A;  4A39 A;  1TKJ A;  3SI0 A;  2XEG A;  2V8G A;  3FJU A;  4C8T A;  2IQ6 A;  4P4J A;  1TKH A;  4ZY1 A;  2AFM A;  3IO1 A;  2PJ2 A;  2CTC A;  2PJC A;  2ZEO A;  3FEE A;  1JQG A;  4EWT A;  3PB7 X;  4MMO A;  3CDX A;  2AFO A;  3KL9 A;  2FVG A;  1PCA A;  4PXD A;  4ZX9 A;  4P4B A;  1Q7L A;  3TC8 A;  3D7G A;  3GB0 A;  3KZW A;  2PJ6 A;  3FVL A;  3PEI A;  3DLJ A;  4IK2 A;  3KQZ A;  2QJ8 A;  4IAV A;  5LYL A;  2PIZ A;  3ISX A;  3TX8 A;  4C9R A;  1M4L A;  1LCP A;  5IR2 A;  3WAB A;  4MRI A;  2JEW A;  4FBE A;  3H8G A;  1TF8 A;  5LYI A;  2NSM A;  1NSA A;  2PCU A;  1LAM A;  5JM6 A;  3WC5 A;  4DUK A;  4WWV A;  4TJV A;  1TKF A;  1V6C A;  4P44 A;  3BI1 A;  3GLJ A;  4R6T A;  2GP4 A;  3SI1 A;  4YU9 A;  2HB6 A;  1YW4 A;  1Y0Y A;  4JZ0 A;  3D7D A;  3FEC A;  3H8F A;  4PXE A;  5LYD A;  4MHN A;  4ZX8 A;  1R3N A;  4MXU A;  1TXR A;  5D8N A;  3DGV A;  1ELM P;  3B3W A;  2Q43 A;  4A37 A;  3WC6 A;  4C9U A;  1XBU A;  3VAT A;  1ZLH A;  2PVW A;  4TJX A;  3MN8 A;  2F7V A;  3RZA A;  1Z8L A;  3VH9 A;  5LRG A;  2PJA A;  4NJQ A;  3SI2 A;  2JBK A;  2PRQ A;  2V8D A;  4LQG A;  4NGN A;  4OC3 A;  2AFU A;  3B7I A;  4F8Z A;  4MCR A;  3B3S A;  4EME A;  1CG2 A;  3KR5 A;  4R7M A;  5D29 A;  4OC0 A;  2V8V A;  3SJG A;  4OC5 A;  1LAN A;  2EWB A;  3PB9 X;  3SJE A;  2QYV A;  3MRU A;  4O23 A;  3PRT A;  1QMU A;  2CTB A;  1ELL P;  3B2Y A;  5HVG A;  1WVM A;  4P10 A;  4OC4 A;  3S9N A;  3QNV A;  4C99 A;  4NGT A;  1HDQ A;  3LMS A;  4OC1 A;  2BCO A;  5K8M A;  1IY7 A;  4BD9 A;  3NH5 A;  1Y9Z A;  4UF4 A;  1Z5R A;  2PVV A;  5I4M A;  4P4D A;  2XEF A;  8CPA A;  3H8E A;  1ARM A;  2ANP A;  2PJ0 A;  2I3C A;  2AFW A;  5J1Q A;  1BLL E;  1YW6 A;  4A38 A;  1LOK A;  4AXV A;  1HDU A;  5ELY A;  3KR4 A;  2J9A A;  4YWY A;  4OP4 A;  5DS0 A;  4Q7A A;  1CX8 A;  1BAV A;  1Z2L A;  2C1C A;  4PQA A;  4ZY0 A;  5THW A;  4EFD A;  4UEZ A;  2PJ1 A;  4CDK A;  4P4F A;  4C86 A;  5K8N A;  3FED A;  2Q4Z A;  3KI9 A;  3D7H A;  1DTD A;  1UWY A;  2F8H A;  3PBB A;  3PFE A;  4R8F A;  2ZEL A;  1CP6 A;  3NA6 A;  4DJL A;  2ZOF A;  1PYT B;  2ABZ A;  2ZEP A;  3SJF A;  4F9V A;  4X2T A;  2ZEH A;  4FWU A;  1Y7E A;  2PJB A;  3S9M A;  4OKO A;  3KHZ A;  4TNU A;  2OR4 A;  2GU2 A;  1ZG9 A;  4ZY2 A;  3V7Z A;  2PJ9 A;  3CPX A;  4UIA A;  1CP7 A;  1H8L A;  3CT9 A;  1F2O A;  4UEF A;  2CIJ A;  2PE3 A;  2EK8 A;  1OBR A;  4A94 A;  4WJB A;  4UEE A;  4C8A A;  5CPA A;  1LFW A;  2ZED A;  1DE4 C;  4MHZ A;  1ZLI A;  3SJX A;  2ZEN A;  4W9Y A;  1QQ9 A;  4KNG E;  3VAR A;  2CF4 A;  4C8C A;  3FX6 A;  3HUV A;  2G9D A;  4PPZ A;  3PB8 X;  2PJ5 A;  3PB4 X;  2ZEG A;  4UIB A;  2NYQ A;  4X3R A;  3BHX A;  3LWU A;  4OID A;  2C6G A;  3K9T A;  4C8U A;  4C9E A;  1AYE A;  4FAI A;  2XEJ A;  2XEI A;  1ZG8 A;  1Y0R A;  2Q51 A;  4NGM A;  4Z65 A;  3D7F A;  3IJ3 A;  5IB9 A;  1VGY A;  4K3N A;  1KWM A;  3FMC A;  2PJ3 A;  1RTQ A;  3I6S A;  3NH8 A;  2IMO A;  7CPA A;  3V38 A;  2GRE A;  6CPA A;  2AFZ A;  1IGB A;  2DEA A;  1XFO A;  1XJO A;  3EIF A;  4NGP A;  1XF1 A;  4F9U A;  3PBE A;  4R76 A;  2PJ4 A;  3IC1 A;  4G1P A;  1F2P A;  2GLF A;  3D4U A;  1YME A;  3PFO A;  3BXM A;  4KSI A;  1F57 A;  4NJR A;  3WC7 A;  3NH4 A;  1CBX A;  3NFZ A;  2HC9 A;  4P6Y A;  3D68 A;  4P4E A;  4H2K A;  5JGF A;  4NGS A;  3WT4 A;  3KHX A;  4CDJ A;  3I74 A;  2BO9 A;  2GLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...