4MCTA

P. vulgaris higba structure, crystal form 1
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
92
structure length
92
Chain Sequence
MRQFKVSHPGEMIARDLEDMGVSGRRFAHNIGVTPATVSRLLAGKTALTPSLSIRIAAALGSTPEFWLRLQSNYDLRQLENQIDTSGIVLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Proteus vulgaris HigB-(HigA)2-HigB Toxin-Antitoxin Complex.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Toxin
molecule keywords Antidote protein
total genus 24
structure length 92
sequence length 92
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4mctA01
1QP7A 2XSDC 1Y7YA 2BJCA 3PXPA 1UTXA 4PU3C 3O9XA 4IWRA 4Z5CA 2JVLA 1PRUA 3L1PA 1AU7A 3U3WA 2O49A 1ZVVA 3OP9A 3R1FA 3F52A 1LQCA 4Y42A 2KEJA 2R1JL 1ZZBA 2XCJA 1B0NA 2XIUA 1RZSA 2ICTA 3BDNA 2KPJA 2XI8A 1ZPQA 2O38A 2PPXA 1R63A 4X4CA 3JXDL 1JH9A 1E3OC 3CLCA 2AWIA 1QP4A 2HSGA 2R63A 1PRVA 5K98B 4X4GA 1RPEL 1LCDA 1ZZ9A 4JCYA 1YSEA 3OMTA 1PERL 1BDIA 4I6TA 4I6RA 4IA8A 4YARA 1RZRA 3OQNA 2PIJA 2BNMA 4MCTA 3SCHA 2PUGA 3KJXA 2PUEA 4OB4A 2PUFA 3F6WA 1POUA 2LYLA 2MQKA 1Y9QA 3LFPA 4GQMA 4JCXA 2CROA 1LMB3 1WH8A 1IC8A 1OCTC 3DNVB 3EUSA 4PU4C 4FN3A 2A6CA 3FYAA 3G5GA 4YBAA 4X4FA 2EF8A 3CECA 3OQMA 3HZIB 1GT0C 4I8TA 3OQOA 2CSFA 1QP0A 2H8RA 2FJRA 2IUOA 3FYMA 1ZZ8A 1VPWA 3IVPA 3ZHIA 1X2LA 2GZUA 2IU7A 3BD1A 2IVQA 4Z58A 2EBYA 4X4HA 1ADRA 4JQDA 1ZS4A 1PNRA 3ZKCA 4YG4A 3F51A 3G7DA 3QQ6A 4GHJA 1O4XA 4FBIA 2KEIA 2LYJA 2LYKA 1HF0A 2HINA 1LLIA 2AW6A 2LYQA 2WUSR 1DWKA 4O8BA 4Z5HA 4X4EA 2WIUB 4J1XA 2GRMA 3ZHMA 2PUDA 2L8NA 2OR1L 1NEQA 2LYRA 1LCCA 3VK0A 1WIZA 3KZ3A 2O4AA 3RZZA 2IV1A 3SCFA 1JFTA 1RZRD 2IVGA 3TRBA 1ZZ7A 1DW9A 2BNNA 3FMYA 4X4DA 1UXCA 4YG7B 4IVZA 3JXCL 1ZZ6A 2BNOA 3H5TA 1XWRA 2MEZA 3MLFA 2AXUA 4I6UA 2PUAA 1SQ8A 1ZZCA 2XJ3A 3B7HA 4MCXA 4F8DA 1NERA 2KZ8A 2PE5A 1OSLA 2AXZA 1QQBA 2L49A 1WETA 1ZAYA 2D5VA 2JCGA 4PU8A 1RIOA 2AXVA 2ICPA 1CJGA 4Z59A 2B5AA 3QYXA 2EWTA 1L1MA 4J1WA 2PUBA 1CQTA 2AUWA 2LYPA 3GN5B 1QPZA 3QF3A 1BDHA 2OFYA 2PUCA 4Z5DA 3LISA 1X57A 4X4IA 1WH6A 3S8QA 4PU7A 3D1NI 2LYSA 3CROL 2LCVA 3QWGA 1UXDA 1ZUGA 4NDWA 3GBFA 4X4BA 3JXBC 4YG1A 2GRLA 3KXAA 3SCGA 1QQAA 3UFDA 5A7LA 1R69A 1JFSA 2KEKA 3GN5A 1S7EA 1PRAA 2IVBA 1EFAA 1JWLA 3BS3A
chains in the Genus database with same CATH superfamily
4EZIA 2J7WA 3O9XA 4IWRA 3L1PA 1ZVVA 2KEJA 1B0NA 1R63A 2FFHA 4OBMA 3JXDL 1E3OC 2PXDA 5K98B 5DTQA 3OMTA 1BDIA 1RZRA 2PIJA 2PUEA 2PUFA 3SX0A 1OCTC 3DNVB 3NZLA 4PU4C 3FYAA 3HZIB 3CECA 2PXLA 3OQOA 2LLWA 3QFIA 2EBYA 4X4HA 3OWQA 3ZKCA 3QQ6A 2LLVA 4FBIA 2LYQA 4Z5HA 2GRMA 2PUDA 2LYRA 3KZ3A 1DW9A 1UXCA 4ER0A 3NROA 1ZZ6A 2BNOA 4I6UA 3B7HA 2PXUA 1NERA 3NXHA 1CJGA 4Z59A 2EWTA 2PUBA 4EK9A 2LYPA 4Z5DA 1X57A 3S8QA 4PU7A 3CROL 1UXDA 3GBFA 4YG1A 3ME5A 1QQAA 1QB2A 2J7UA 3KL4A 1JFSA 3A9XA 5DTMA 2KEKA 3GN5A 1PRAA 2IVBA 1EFAA 1JWLA 3BS3A 3GZCA 2HCNA 4EKGA 3PXPA 4Z5CA 2XXQA 3OP9A 3R1FA 2ICTA 2XI8A 2PPXA 3A9ZA 3CLCA 2HSGA 3GUUA 4EKIA 1YSEA 4I6RA 4YARA 2BNMA 4MCTA 3SCHA 4OB4A 3LFPA 1NW3A 2CROA 1LMB3 1WH8A 3ZPXA 3QOXA 4YBAA 4I8TA 2EF8A 2IUOA 3FYMA 2LNMA 3G0TA 3M9LA 1ZS4A 1PNRA 4YG4A 3DM5A 1O4XA 3VWSA 2LYJA 2LYKA 1HF0A 1LLIA 2AW6A 4X4EA 5GAGi 1NEQA 5JUWA 1LCCA 2O4AA 3LQXA 1WIZA 3SCFA 1JFTA 1RZRD 2PXVA 4X4DA 3JXCL 3H5TA 1XWRA 1SQ8A 2XJ3A 4MCXA 4DE9A 2KZ8A 2PE5A 1OSLA 2D5VA 2HCSA 3TELA 1MFQC 4J1WA 2XXAA 4ER6A 2VEOA 2AUWA 3GN5B 1QPZA 3QF3A 4Q2JA 2PUCA 4X4IA 1WH6A 3D1NI 2YBDA 1ZUGA 4NDWA 4X4BA 1S7EA 2PXQA 3PE5A 1DULA 3R09A 2XSDC 1Y7YA 4WVLA 2O49A 3U3WA 4Y42A 3F52A 1LQCA 2R1JL 2XCJA 1QZXA 2XIUA 3BDNA 2KPJA 1ZPQA 1JH9A 2R63A 1LCDA 3UWPA 4I6TA 3TEPA 3OQNA 2PUGA 2XXPA 2MQKA 4JCXA 4ER5A 3OKZA 4FN3A 2A6CA 4ER3A 2CSFA 1QP0A 2FJRA 3NDBB 3TFLA 3A9YA 3BD1A 4Z58A 1ADRA 4JQDA 3G7DA 4GHJA 2KEIA 2V3CC 2HINA 2WUSR 4O8BA 3QOWA 2IV1A 2IVGA 3TRBA 5DRYA 3FMYA 4ER7A 4YG7B 4IVZA 2MEZA 1U2ZA 2JQEA 3GZDA 1QQBA 1ZAYA 2L49A 2JCGA 4PU8A 2AXVA 2ICPA 2B5AA 3QYXA 1L1MA 4DE8A 2MXDA 1BDHA 3LISA 2L1PA 2GRLA 3UFDA 2M4HA 2PXBA 5DSXA 2PXPA 1QP7A 2BJCA 4HRAA 4PU3C 1UTXA 2JVLA 1PRUA 1AU7A 1ZZBA 5DT2A 1RZSA 2O38A 4X4CA 2AWIA 1QP4A 1PRVA 1RPEL 4X4GA 1ZZ9A 4JCYA 1PERL 3MEJA 4IA8A 3KJXA 3F6WA 1POUA 2LYLA 4GQMA 1Y9QA 1IC8A 3EUSA 3G5GA 4X4FA 3OQMA 2PXTA 1GT0C 2H8RA 1ZZ8A 1VPWA 3IVPA 3ZHIA 1X2LA 2GZUA 2IU7A 5DTRA 2IVQA 4EQZA 2PXKA 2PXFA 3F51A 1DWKA 2WIUB 4J1XA 5GAHi 3ZHMA 2HFZA 2L8NA 3SR4A 2OR1L 3VK0A 3GZDC 3RZZA 1ZZ7A 2BNNA 2ODRD 2PXEA 3MLFA 2AXUA 2PUAA 1ZZCA 4F8DA 2AXZA 1WETA 1RIOA 1CQTA 2OFYA 5DRTA 2LYSA 2LCVA 3QWGA 1HQ1A 3JXBC 3KXAA 3SCGA 5A7LA 1R69A
chains in the Genus database with same CATH topology
1QP7A 2XSDC 1Y7YA 2BJCA 3PXPA 1UTXA 4PU3C 3O9XA 4IWRA 4Z5CA 2JVLA 1PRUA 3L1PA 1AU7A 3U3WA 2O49A 1ZVVA 3OP9A 3R1FA 3F52A 1LQCA 4Y42A 2KEJA 2R1JL 1ZZBA 2XCJA 1B0NA 2XIUA 1RZSA 2ICTA 3BDNA 2KPJA 2XI8A 1ZPQA 2O38A 2PPXA 1R63A 4X4CA 3JXDL 1JH9A 1E3OC 3CLCA 2AWIA 1QP4A 2HSGA 2R63A 1PRVA 5K98B 4X4GA 1RPEL 1LCDA 1ZZ9A 4JCYA 1YSEA 3OMTA 1PERL 1BDIA 4I6TA 4I6RA 4IA8A 4YARA 1RZRA 3OQNA 2PIJA 2BNMA 4MCTA 3SCHA 2PUGA 3KJXA 2PUEA 4OB4A 2PUFA 3F6WA 1POUA 2LYLA 2MQKA 1Y9QA 3LFPA 4GQMA 4JCXA 2CROA 1LMB3 1WH8A 1IC8A 1OCTC 3DNVB 3EUSA 4PU4C 4FN3A 2A6CA 3FYAA 3G5GA 4YBAA 4X4FA 2EF8A 3CECA 3OQMA 3HZIB 1GT0C 4I8TA 3OQOA 2CSFA 1QP0A 2H8RA 2FJRA 2IUOA 3FYMA 1ZZ8A 1VPWA 3IVPA 3ZHIA 1X2LA 2GZUA 2IU7A 3BD1A 2IVQA 4Z58A 2EBYA 4X4HA 1ADRA 4JQDA 1ZS4A 1PNRA 3ZKCA 4YG4A 3F51A 3G7DA 3QQ6A 4GHJA 1O4XA 4FBIA 2KEIA 2LYJA 2LYKA 1HF0A 2HINA 1LLIA 2AW6A 2LYQA 2WUSR 1DWKA 4O8BA 4Z5HA 4X4EA 2WIUB 4J1XA 2GRMA 3ZHMA 2PUDA 2L8NA 2OR1L 1NEQA 2LYRA 1LCCA 3VK0A 1WIZA 3KZ3A 2O4AA 3RZZA 2IV1A 3SCFA 1JFTA 1RZRD 2IVGA 3TRBA 1ZZ7A 1DW9A 2BNNA 3FMYA 4X4DA 1UXCA 4YG7B 4IVZA 3JXCL 1ZZ6A 2BNOA 3H5TA 1XWRA 2MEZA 3MLFA 2AXUA 4I6UA 2PUAA 1SQ8A 1ZZCA 2XJ3A 3B7HA 4MCXA 4F8DA 1NERA 2KZ8A 2PE5A 1OSLA 2AXZA 1QQBA 2L49A 1WETA 1ZAYA 2D5VA 2JCGA 4PU8A 1RIOA 2AXVA 2ICPA 1CJGA 4Z59A 2B5AA 3QYXA 2EWTA 1L1MA 4J1WA 2PUBA 1CQTA 2AUWA 2LYPA 3GN5B 1QPZA 3QF3A 1BDHA 2OFYA 2PUCA 4Z5DA 3LISA 1X57A 4X4IA 1WH6A 3S8QA 4PU7A 3D1NI 2LYSA 3CROL 2LCVA 3QWGA 1UXDA 1ZUGA 4NDWA 3GBFA 4X4BA 3JXBC 4YG1A 2GRLA 3KXAA 3SCGA 1QQAA 3UFDA 5A7LA 1R69A 1JFSA 2KEKA 3GN5A 1S7EA 1PRAA 2IVBA 1EFAA 1JWLA 3BS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QP7 A;  2XSD C;  1Y7Y A;  2BJC A;  3PXP A;  1UTX A;  4PU3 C;  3O9X A;  4IWR A;  4Z5C A;  2JVL A;  1PRU A;  3L1P A;  1AU7 A;  3U3W A;  2O49 A;  1ZVV A;  3OP9 A;  3R1F A;  3F52 A;  1LQC A;  4Y42 A;  2KEJ A;  2R1J L;  1ZZB A;  2XCJ A;  1B0N A;  2XIU A;  1RZS A;  2ICT A;  3BDN A;  2KPJ A;  2XI8 A;  1ZPQ A;  2O38 A;  2PPX A;  1R63 A;  4X4C A;  3JXD L;  1JH9 A;  1E3O C;  3CLC A;  2AWI A;  1QP4 A;  2HSG A;  2R63 A;  1PRV A;  5K98 B;  4X4G A;  1RPE L;  1LCD A;  1ZZ9 A;  4JCY A;  1YSE A;  3OMT A;  1PER L;  1BDI A;  4I6T A;  4I6R A;  4IA8 A;  4YAR A;  1RZR A;  3OQN A;  2PIJ A;  2BNM A;  4MCT A;  3SCH A;  2PUG A;  3KJX A;  2PUE A;  4OB4 A;  2PUF A;  3F6W A;  1POU A;  2LYL A;  2MQK A;  1Y9Q A;  3LFP A;  4GQM A;  4JCX A;  2CRO A;  1LMB 3;  1WH8 A;  1IC8 A;  1OCT C;  3DNV B;  3EUS A;  4PU4 C;  4FN3 A;  2A6C A;  3FYA A;  3G5G A;  4YBA A;  4X4F A;  2EF8 A;  3CEC A;  3OQM A;  3HZI B;  1GT0 C;  4I8T A;  3OQO A;  2CSF A;  1QP0 A;  2H8R A;  2FJR A;  2IUO A;  3FYM A;  1ZZ8 A;  1VPW A;  3IVP A;  3ZHI A;  1X2L A;  2GZU A;  2IU7 A;  3BD1 A;  2IVQ A;  4Z58 A;  2EBY A;  4X4H A;  1ADR A;  4JQD A;  1ZS4 A;  1PNR A;  3ZKC A;  4YG4 A;  3F51 A;  3G7D A;  3QQ6 A;  4GHJ A;  1O4X A;  4FBI A;  2KEI A;  2LYJ A;  2LYK A;  1HF0 A;  2HIN A;  1LLI A;  2AW6 A;  2LYQ A;  2WUS R;  1DWK A;  4O8B A;  4Z5H A;  4X4E A;  2WIU B;  4J1X A;  2GRM A;  3ZHM A;  2PUD A;  2L8N A;  2OR1 L;  1NEQ A;  2LYR A;  1LCC A;  3VK0 A;  1WIZ A;  3KZ3 A;  2O4A A;  3RZZ A;  2IV1 A;  3SCF A;  1JFT A;  1RZR D;  2IVG A;  3TRB A;  1ZZ7 A;  1DW9 A;  2BNN A;  3FMY A;  4X4D A;  1UXC A;  4YG7 B;  4IVZ A;  3JXC L;  1ZZ6 A;  2BNO A;  3H5T A;  1XWR A;  2MEZ A;  3MLF A;  2AXU A;  4I6U A;  2PUA A;  1SQ8 A;  1ZZC A;  2XJ3 A;  3B7H A;  4MCX A;  4F8D A;  1NER A;  2KZ8 A;  2PE5 A;  1OSL A;  2AXZ A;  1QQB A;  2L49 A;  1WET A;  1ZAY A;  2D5V A;  2JCG A;  4PU8 A;  1RIO A;  2AXV A;  2ICP A;  1CJG A;  4Z59 A;  2B5A A;  3QYX A;  2EWT A;  1L1M A;  4J1W A;  2PUB A;  1CQT A;  2AUW A;  2LYP A;  3GN5 B;  1QPZ A;  3QF3 A;  1BDH A;  2OFY A;  2PUC A;  4Z5D A;  3LIS A;  1X57 A;  4X4I A;  1WH6 A;  3S8Q A;  4PU7 A;  3D1N I;  2LYS A;  3CRO L;  2LCV A;  3QWG A;  1UXD A;  1ZUG A;  4NDW A;  3GBF A;  4X4B A;  3JXB C;  4YG1 A;  2GRL A;  3KXA A;  3SCG A;  1QQA A;  3UFD A;  5A7L A;  1R69 A;  1JFS A;  2KEK A;  3GN5 A;  1S7E A;  1PRA A;  2IVB A;  1EFA A;  1JWL A;  3BS3 A; 
#chains in the Genus database with same CATH topology
 4EZI A;  2J7W A;  3O9X A;  4IWR A;  3L1P A;  1ZVV A;  2KEJ A;  1B0N A;  1R63 A;  2FFH A;  4OBM A;  3JXD L;  1E3O C;  2PXD A;  5K98 B;  5DTQ A;  3OMT A;  1BDI A;  1RZR A;  2PIJ A;  2PUE A;  2PUF A;  3SX0 A;  1OCT C;  3DNV B;  3NZL A;  4PU4 C;  3FYA A;  3HZI B;  3CEC A;  2PXL A;  3OQO A;  2LLW A;  3QFI A;  2EBY A;  4X4H A;  3OWQ A;  3ZKC A;  3QQ6 A;  2LLV A;  4FBI A;  2LYQ A;  4Z5H A;  2GRM A;  2PUD A;  2LYR A;  3KZ3 A;  1DW9 A;  1UXC A;  4ER0 A;  3NRO A;  1ZZ6 A;  2BNO A;  4I6U A;  3B7H A;  2PXU A;  1NER A;  3NXH A;  1CJG A;  4Z59 A;  2EWT A;  2PUB A;  4EK9 A;  2LYP A;  4Z5D A;  1X57 A;  3S8Q A;  4PU7 A;  3CRO L;  1UXD A;  3GBF A;  4YG1 A;  3ME5 A;  1QQA A;  1QB2 A;  2J7U A;  3KL4 A;  1JFS A;  3A9X A;  5DTM A;  2KEK A;  3GN5 A;  1PRA A;  2IVB A;  1EFA A;  1JWL A;  3BS3 A;  3GZC A;  2HCN A;  4EKG A;  3PXP A;  4Z5C A;  2XXQ A;  3OP9 A;  3R1F A;  2ICT A;  2XI8 A;  2PPX A;  3A9Z A;  3CLC A;  2HSG A;  3GUU A;  4EKI A;  1YSE A;  4I6R A;  4YAR A;  2BNM A;  4MCT A;  3SCH A;  4OB4 A;  3LFP A;  1NW3 A;  2CRO A;  1LMB 3;  1WH8 A;  3ZPX A;  3QOX A;  4YBA A;  4I8T A;  2EF8 A;  2IUO A;  3FYM A;  2LNM A;  3G0T A;  3M9L A;  1ZS4 A;  1PNR A;  4YG4 A;  3DM5 A;  1O4X A;  3VWS A;  2LYJ A;  2LYK A;  1HF0 A;  1LLI A;  2AW6 A;  4X4E A;  5GAG i;  1NEQ A;  5JUW A;  1LCC A;  2O4A A;  3LQX A;  1WIZ A;  3SCF A;  1JFT A;  1RZR D;  2PXV A;  4X4D A;  3JXC L;  3H5T A;  1XWR A;  1SQ8 A;  2XJ3 A;  4MCX A;  4DE9 A;  2KZ8 A;  2PE5 A;  1OSL A;  2D5V A;  2HCS A;  3TEL A;  1MFQ C;  4J1W A;  2XXA A;  4ER6 A;  2VEO A;  2AUW A;  3GN5 B;  1QPZ A;  3QF3 A;  4Q2J A;  2PUC A;  4X4I A;  1WH6 A;  3D1N I;  2YBD A;  1ZUG A;  4NDW A;  4X4B A;  1S7E A;  2PXQ A;  3PE5 A;  1DUL A;  3R09 A;  2XSD C;  1Y7Y A;  4WVL A;  2O49 A;  3U3W A;  4Y42 A;  3F52 A;  1LQC A;  2R1J L;  2XCJ A;  1QZX A;  2XIU A;  3BDN A;  2KPJ A;  1ZPQ A;  1JH9 A;  2R63 A;  1LCD A;  3UWP A;  4I6T A;  3TEP A;  3OQN A;  2PUG A;  2XXP A;  2MQK A;  4JCX A;  4ER5 A;  3OKZ A;  4FN3 A;  2A6C A;  4ER3 A;  2CSF A;  1QP0 A;  2FJR A;  3NDB B;  3TFL A;  3A9Y A;  3BD1 A;  4Z58 A;  1ADR A;  4JQD A;  3G7D A;  4GHJ A;  2KEI A;  2V3C C;  2HIN A;  2WUS R;  4O8B A;  3QOW A;  2IV1 A;  2IVG A;  3TRB A;  5DRY A;  3FMY A;  4ER7 A;  4YG7 B;  4IVZ A;  2MEZ A;  1U2Z A;  2JQE A;  3GZD A;  1QQB A;  1ZAY A;  2L49 A;  2JCG A;  4PU8 A;  2AXV A;  2ICP A;  2B5A A;  3QYX A;  1L1M A;  4DE8 A;  2MXD A;  1BDH A;  3LIS A;  2L1P A;  2GRL A;  3UFD A;  2M4H A;  2PXB A;  5DSX A;  2PXP A;  1QP7 A;  2BJC A;  4HRA A;  4PU3 C;  1UTX A;  2JVL A;  1PRU A;  1AU7 A;  1ZZB A;  5DT2 A;  1RZS A;  2O38 A;  4X4C A;  2AWI A;  1QP4 A;  1PRV A;  1RPE L;  4X4G A;  1ZZ9 A;  4JCY A;  1PER L;  3MEJ A;  4IA8 A;  3KJX A;  3F6W A;  1POU A;  2LYL A;  4GQM A;  1Y9Q A;  1IC8 A;  3EUS A;  3G5G A;  4X4F A;  3OQM A;  2PXT A;  1GT0 C;  2H8R A;  1ZZ8 A;  1VPW A;  3IVP A;  3ZHI A;  1X2L A;  2GZU A;  2IU7 A;  5DTR A;  2IVQ A;  4EQZ A;  2PXK A;  2PXF A;  3F51 A;  1DWK A;  2WIU B;  4J1X A;  5GAH i;  3ZHM A;  2HFZ A;  2L8N A;  3SR4 A;  2OR1 L;  3VK0 A;  3GZD C;  3RZZ A;  1ZZ7 A;  2BNN A;  2ODR D;  2PXE A;  3MLF A;  2AXU A;  2PUA A;  1ZZC A;  4F8D A;  2AXZ A;  1WET A;  1RIO A;  1CQT A;  2OFY A;  5DRT A;  2LYS A;  2LCV A;  3QWG A;  1HQ1 A;  3JXB C;  3KXA A;  3SCG A;  5A7L A;  1R69 A; 
#chains in the Genus database with same CATH homology
 1QP7 A;  2XSD C;  1Y7Y A;  2BJC A;  3PXP A;  1UTX A;  4PU3 C;  3O9X A;  4IWR A;  4Z5C A;  2JVL A;  1PRU A;  3L1P A;  1AU7 A;  3U3W A;  2O49 A;  1ZVV A;  3OP9 A;  3R1F A;  3F52 A;  1LQC A;  4Y42 A;  2KEJ A;  2R1J L;  1ZZB A;  2XCJ A;  1B0N A;  2XIU A;  1RZS A;  2ICT A;  3BDN A;  2KPJ A;  2XI8 A;  1ZPQ A;  2O38 A;  2PPX A;  1R63 A;  4X4C A;  3JXD L;  1JH9 A;  1E3O C;  3CLC A;  2AWI A;  1QP4 A;  2HSG A;  2R63 A;  1PRV A;  5K98 B;  4X4G A;  1RPE L;  1LCD A;  1ZZ9 A;  4JCY A;  1YSE A;  3OMT A;  1PER L;  1BDI A;  4I6T A;  4I6R A;  4IA8 A;  4YAR A;  1RZR A;  3OQN A;  2PIJ A;  2BNM A;  4MCT A;  3SCH A;  2PUG A;  3KJX A;  2PUE A;  4OB4 A;  2PUF A;  3F6W A;  1POU A;  2LYL A;  2MQK A;  1Y9Q A;  3LFP A;  4GQM A;  4JCX A;  2CRO A;  1LMB 3;  1WH8 A;  1IC8 A;  1OCT C;  3DNV B;  3EUS A;  4PU4 C;  4FN3 A;  2A6C A;  3FYA A;  3G5G A;  4YBA A;  4X4F A;  2EF8 A;  3CEC A;  3OQM A;  3HZI B;  1GT0 C;  4I8T A;  3OQO A;  2CSF A;  1QP0 A;  2H8R A;  2FJR A;  2IUO A;  3FYM A;  1ZZ8 A;  1VPW A;  3IVP A;  3ZHI A;  1X2L A;  2GZU A;  2IU7 A;  3BD1 A;  2IVQ A;  4Z58 A;  2EBY A;  4X4H A;  1ADR A;  4JQD A;  1ZS4 A;  1PNR A;  3ZKC A;  4YG4 A;  3F51 A;  3G7D A;  3QQ6 A;  4GHJ A;  1O4X A;  4FBI A;  2KEI A;  2LYJ A;  2LYK A;  1HF0 A;  2HIN A;  1LLI A;  2AW6 A;  2LYQ A;  2WUS R;  1DWK A;  4O8B A;  4Z5H A;  4X4E A;  2WIU B;  4J1X A;  2GRM A;  3ZHM A;  2PUD A;  2L8N A;  2OR1 L;  1NEQ A;  2LYR A;  1LCC A;  3VK0 A;  1WIZ A;  3KZ3 A;  2O4A A;  3RZZ A;  2IV1 A;  3SCF A;  1JFT A;  1RZR D;  2IVG A;  3TRB A;  1ZZ7 A;  1DW9 A;  2BNN A;  3FMY A;  4X4D A;  1UXC A;  4YG7 B;  4IVZ A;  3JXC L;  1ZZ6 A;  2BNO A;  3H5T A;  1XWR A;  2MEZ A;  3MLF A;  2AXU A;  4I6U A;  2PUA A;  1SQ8 A;  1ZZC A;  2XJ3 A;  3B7H A;  4MCX A;  4F8D A;  1NER A;  2KZ8 A;  2PE5 A;  1OSL A;  2AXZ A;  1QQB A;  2L49 A;  1WET A;  1ZAY A;  2D5V A;  2JCG A;  4PU8 A;  1RIO A;  2AXV A;  2ICP A;  1CJG A;  4Z59 A;  2B5A A;  3QYX A;  2EWT A;  1L1M A;  4J1W A;  2PUB A;  1CQT A;  2AUW A;  2LYP A;  3GN5 B;  1QPZ A;  3QF3 A;  1BDH A;  2OFY A;  2PUC A;  4Z5D A;  3LIS A;  1X57 A;  4X4I A;  1WH6 A;  3S8Q A;  4PU7 A;  3D1N I;  2LYS A;  3CRO L;  2LCV A;  3QWG A;  1UXD A;  1ZUG A;  4NDW A;  3GBF A;  4X4B A;  3JXB C;  4YG1 A;  2GRL A;  3KXA A;  3SCG A;  1QQA A;  3UFD A;  5A7L A;  1R69 A;  1JFS A;  2KEK A;  3GN5 A;  1S7E A;  1PRA A;  2IVB A;  1EFA A;  1JWL A;  3BS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...