4MCXA

P. vulgaris higba structure, crystal form 2
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
93
structure length
93
Chain Sequence
MRQFKVSHPGEMIARDLEDMGVSGRRFAHNIGVTPATVSRLLAGKTALTPSLSIRIAAALGSTPEFWLRLQSNYDLRQLENQIDTSGIVLYGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Proteus vulgaris HigB-(HigA)2-HigB Toxin-Antitoxin Complex.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Toxin
molecule keywords Antidote protein
total genus 28
structure length 93
sequence length 93
chains with identical sequence C, E
ec nomenclature
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4mcxA01
2LYQA 1L1MA 2LYPA 4YG7B 3SCHA 2KEIA 4I6RA 3ZHIA 4X4BA 1Y7YA 2WUSR 4X4IA 3RZZA 1B0NA 2FJRA 3OQNA 2LCVA 4JCYA 1ZZ9A 1PRVA 3BS3A 2BNMA 4X4FA 1RZSA 3DNVB 2AW6A 1E3OC 2GRLA 1IC8A 3QWGA 2PUCA 1QP0A 2B5AA 1LQCA 4I6UA 1BDHA 2XCJA 3PXPA 3FYAA 2XI8A 1PRAA 4FN3A 1WIZA 2EF8A 4YG4A 1JFTA 1POUA 1ZZBA 3R1FA 1RZRD 2L49A 4YBAA 3JXDL 2BNNA 1RZRA 1QQBA 1WETA 2JCGA 3F52A 1CQTA 2AXZA 2KEKA 2LYJA 1HF0A 4GQMA 1LLIA 3U3WA 2LYKA 2R1JL 2EWTA 3JXBC 2PUDA 4I8TA 2D5VA 2GZUA 2IVBA 1ZZ6A 3G5GA 3OMTA 2IVGA 2PE5A 3CLCA 5A7LA 2KPJA 4MCTA 1ADRA 4NDWA 1AU7A 2JVLA 2WIUB 1ZUGA 1X57A 3FYMA 2AWIA 4Z5DA 1PERL 3VK0A 3OQOA 1R69A 1JH9A 3IVPA 3OP9A 1ZZCA 2MQKA 4O8BA 3GN5A 3F51A 1X2LA 2O38A 3ZKCA 1ZAYA 2OR1L 4Z59A 3QYXA 2PUFA 4JQDA 2LYSA 3EUSA 1EFAA 2BNOA 2IUOA 4PU3C 3SCGA 1GT0C 3G7DA 1O4XA 2O49A 1DWKA 3TRBA 4Z5HA 1VPWA 2CROA 1UTXA 4Y42A 1LCDA 1YSEA 1ZPQA 5K98B 1WH8A 3KXAA 1Y9QA 2AXVA 2R63A 4F8DA 3L1PA 1BDIA 1WH6A 2XJ3A 1CJGA 3CROL 2IU7A 1QPZA 4FBIA 4PU7A 3MLFA 2LYLA 3H5TA 1S7EA 2LYRA 4IVZA 2O4AA 2AUWA 4X4HA 2L8NA 2BJCA 2PUAA 1LMB3 3UFDA 4X4DA 3CECA 2KEJA 4OB4A 1JWLA 2PUBA 4X4CA 2IVQA 2OFYA 3B7HA 2PUGA 2IV1A 3HZIB 3SCFA 2PIJA 1QP4A 2PUEA 3O9XA 4YARA 1ZZ8A 4JCXA 4PU8A 3LFPA 1ZVVA 4GHJA 4J1XA 2CSFA 2HINA 2XSDC 4YG1A 1SQ8A 3BD1A 1ZZ7A 3S8QA 3KJXA 2HSGA 1OSLA 3D1NI 2MEZA 3BDNA 1RIOA 1JFSA 1UXCA 4J1WA 2KZ8A 1RPEL 1LCCA 3F6WA 1QP7A 2AXUA 3FMYA 1OCTC 2H8RA 1NERA 1QQAA 2EBYA 2ICTA 1NEQA 3QF3A 1DW9A 2A6CA 3ZHMA 3KZ3A 4X4GA 1PNRA 4IWRA 4I6TA 4PU4C 1R63A 1XWRA 1PRUA 3LISA 1ZS4A 3GBFA 4MCXA 4X4EA 2XIUA 3QQ6A 2PPXA 3GN5B 4Z5CA 2ICPA 1UXDA 4IA8A 3JXCL 2GRMA 3OQMA 4Z58A
chains in the Genus database with same CATH superfamily
4I6RA 2LCVA 4JCYA 3BS3A 1PRVA 5DTMA 1RZSA 3NXHA 1E3OC 2GRLA 1IC8A 3DM5A 1QP0A 2B5AA 4I6UA 1BDHA 2XCJA 3GZDA 3FYAA 2J7WA 2XI8A 4FN3A 2EF8A 2YBDA 3R1FA 1RZRA 2BNNA 2XXPA 3F52A 2AXZA 2KEKA 4ER6A 4GQMA 3U3WA 2R1JL 2ODRD 5DT2A 2PE5A 5A7LA 4MCTA 1ADRA 2JVLA 4WVLA 1PERL 1JH9A 3IVPA 1U2ZA 3OP9A 1ZZCA 2PXVA 1X2LA 1ZAYA 3UWPA 2BNOA 3SCGA 1GT0C 1DWKA 3TRBA 4Z5HA 1VPWA 1QB2A 3L1PA 2XJ3A 1QPZA 3NROA 4FBIA 3H5TA 1LMB3 4X4DA 2IVQA 2OFYA 3HZIB 3O9XA 1ZZ8A 2LLWA 3LFPA 4GHJA 2CSFA 1SQ8A 2PXKA 1DULA 1JFSA 2EBYA 3QF3A 2A6CA 3NZLA 3KZ3A 4X4GA 1R63A 3GBFA 4X4EA 5DRTA 2XIUA 2HCSA 5DTQA 1UXDA 3OQMA 1L1MA 2LYPA 4YG7B 1Y7YA 1HQ1A 4X4IA 3RZZA 1ZZ9A 4X4FA 2AW6A 5JUWA 3TFLA 3QWGA 1LQCA 3MEJA 3QFIA 3PXPA 2PXEA 4YG4A 3JXDL 2PXUA 1CQTA 2LYJA 1HF0A 3A9YA 5DRYA 2EWTA 4I8TA 2GZUA 3GZCA 4ER3A 3FYMA 2WIUB 1ZUGA 1X57A 4Z5DA 3VK0A 2MQKA 4O8BA 2XXAA 3OWQA 3EUSA 1NW3A 3LQXA 3R09A 2O49A 2CROA 4Y42A 5K98B 1ZPQA 1Y9QA 2R63A 3CROL 2LYLA 3OKZA 2KEJA 3QOXA 1QP4A 2HINA 4HRAA 4EK9A 1ZZ7A 2HSGA 3D1NI 2MEZA 2VEOA 5DTRA 3BDNA 1RIOA 2KZ8A 5GAGi 2PXPA 3F6WA 3QOWA 4DE8A 1QP7A 2AXUA 1OCTC 1QQAA 1NEQA 3ME5A 1PNRA 4IWRA 4PU4C 3VWSA 1XWRA 1PRUA 1ZS4A 2PXBA 2PXQA 3QQ6A 2PPXA 4Z5CA 4IA8A 2KEIA 4X4BA 2WUSR 3OQNA 3DNVB 3ZPXA 2XXQA 2PUCA 1PRAA 2HCNA 3GUUA 1POUA 2PXDA 1ZZBA 1QQBA 2L49A 2JCGA 2JQEA 2LYKA 2PUDA 3M9LA 2IVBA 2IVGA 1AU7A 2AWIA 4ER5A 3F51A 2J7UA 2PUFA 4JQDA 2LYSA 1EFAA 2IUOA 3PE5A 1O4XA 1UTXA 1LCDA 1YSEA 1WH8A 1BDIA 2AXVA 1MFQC 1S7EA 2LYRA 4IVZA 2BJCA 4X4HA 2L8NA 3UFDA 3CECA 2PUGA 3B7HA 2IV1A 2PIJA 2PUEA 4YARA 4PU8A 1ZVVA 4J1XA 2XSDC 4YG1A 3BD1A 3S8QA 3KJXA 1OSLA 4J1WA 3FMYA 1NERA 2FFHA 2ICTA 5GAHi 1DW9A 2V3CC 3LISA 4MCXA 4EQZA 3GN5B 3NDBB 4Z58A 2LYQA 3SCHA 3ZHIA 3A9ZA 3SR4A 1B0NA 2FJRA 2PXLA 3G0TA 2BNMA 2LLVA 1WIZA 1JFTA 1WETA 1RZRD 4YBAA 2MXDA 3CLCA 2LNMA 2HFZA 3KL4A 2L1PA 1LLIA 4ER7A 3JXBC 2D5VA 1ZZ6A 3G5GA 3OMTA 2KPJA 2PXTA 4NDWA 1QZXA 3OQOA 1R69A 3GN5A 4ER0A 2OR1L 2O38A 3ZKCA 4Z59A 4Q2JA 3QYXA 3TEPA 4PU3C 3G7DA 3SX0A 5DSXA 4EKIA 3KXAA 4F8DA 1WH6A 1CJGA 2IU7A 4PU7A 3MLFA 2M4HA 2O4AA 4EKGA 4DE9A 2AUWA 2PUAA 4OB4A 1JWLA 2PUBA 3TELA 4X4CA 3SCFA 4JCXA 4OBMA 1UXCA 1RPEL 1LCCA 2H8RA 2PXFA 3ZHMA 3GZDC 4I6TA 3A9XA 4EZIA 2ICPA 3JXCL 2GRMA
chains in the Genus database with same CATH topology
2LYQA 1L1MA 2LYPA 4YG7B 3SCHA 2KEIA 4I6RA 3ZHIA 4X4BA 1Y7YA 2WUSR 4X4IA 3RZZA 1B0NA 2FJRA 3OQNA 2LCVA 4JCYA 1ZZ9A 1PRVA 3BS3A 2BNMA 4X4FA 1RZSA 3DNVB 2AW6A 1E3OC 2GRLA 1IC8A 3QWGA 2PUCA 1QP0A 2B5AA 1LQCA 4I6UA 1BDHA 2XCJA 3PXPA 3FYAA 2XI8A 1PRAA 4FN3A 1WIZA 2EF8A 4YG4A 1JFTA 1POUA 1ZZBA 3R1FA 1RZRD 2L49A 4YBAA 3JXDL 2BNNA 1RZRA 1QQBA 1WETA 2JCGA 3F52A 1CQTA 2AXZA 2KEKA 2LYJA 1HF0A 4GQMA 1LLIA 3U3WA 2LYKA 2R1JL 2EWTA 3JXBC 2PUDA 4I8TA 2D5VA 2GZUA 2IVBA 1ZZ6A 3G5GA 3OMTA 2IVGA 2PE5A 3CLCA 5A7LA 2KPJA 4MCTA 1ADRA 4NDWA 1AU7A 2JVLA 2WIUB 1ZUGA 1X57A 3FYMA 2AWIA 4Z5DA 1PERL 3VK0A 3OQOA 1R69A 1JH9A 3IVPA 3OP9A 1ZZCA 2MQKA 4O8BA 3GN5A 3F51A 1X2LA 2O38A 3ZKCA 1ZAYA 2OR1L 4Z59A 3QYXA 2PUFA 4JQDA 2LYSA 3EUSA 1EFAA 2BNOA 2IUOA 4PU3C 3SCGA 1GT0C 3G7DA 1O4XA 2O49A 1DWKA 3TRBA 4Z5HA 1VPWA 2CROA 1UTXA 4Y42A 1LCDA 1YSEA 1ZPQA 5K98B 1WH8A 3KXAA 1Y9QA 2AXVA 2R63A 4F8DA 3L1PA 1BDIA 1WH6A 2XJ3A 1CJGA 3CROL 2IU7A 1QPZA 4FBIA 4PU7A 3MLFA 2LYLA 3H5TA 1S7EA 2LYRA 4IVZA 2O4AA 2AUWA 4X4HA 2L8NA 2BJCA 2PUAA 1LMB3 3UFDA 4X4DA 3CECA 2KEJA 4OB4A 1JWLA 2PUBA 4X4CA 2IVQA 2OFYA 3B7HA 2PUGA 2IV1A 3HZIB 3SCFA 2PIJA 1QP4A 2PUEA 3O9XA 4YARA 1ZZ8A 4JCXA 4PU8A 3LFPA 1ZVVA 4GHJA 4J1XA 2CSFA 2HINA 2XSDC 4YG1A 1SQ8A 3BD1A 1ZZ7A 3S8QA 3KJXA 2HSGA 1OSLA 3D1NI 2MEZA 3BDNA 1RIOA 1JFSA 1UXCA 4J1WA 2KZ8A 1RPEL 1LCCA 3F6WA 1QP7A 2AXUA 3FMYA 1OCTC 2H8RA 1NERA 1QQAA 2EBYA 2ICTA 1NEQA 3QF3A 1DW9A 2A6CA 3ZHMA 3KZ3A 4X4GA 1PNRA 4IWRA 4I6TA 4PU4C 1R63A 1XWRA 1PRUA 3LISA 1ZS4A 3GBFA 4MCXA 4X4EA 2XIUA 3QQ6A 2PPXA 3GN5B 4Z5CA 2ICPA 1UXDA 4IA8A 3JXCL 2GRMA 3OQMA 4Z58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LYQ A;  1L1M A;  2LYP A;  4YG7 B;  3SCH A;  2KEI A;  4I6R A;  3ZHI A;  4X4B A;  1Y7Y A;  2WUS R;  4X4I A;  3RZZ A;  1B0N A;  2FJR A;  3OQN A;  2LCV A;  4JCY A;  1ZZ9 A;  1PRV A;  3BS3 A;  2BNM A;  4X4F A;  1RZS A;  3DNV B;  2AW6 A;  1E3O C;  2GRL A;  1IC8 A;  3QWG A;  2PUC A;  1QP0 A;  2B5A A;  1LQC A;  4I6U A;  1BDH A;  2XCJ A;  3PXP A;  3FYA A;  2XI8 A;  1PRA A;  4FN3 A;  1WIZ A;  2EF8 A;  4YG4 A;  1JFT A;  1POU A;  1ZZB A;  3R1F A;  1RZR D;  2L49 A;  4YBA A;  3JXD L;  2BNN A;  1RZR A;  1QQB A;  1WET A;  2JCG A;  3F52 A;  1CQT A;  2AXZ A;  2KEK A;  2LYJ A;  1HF0 A;  4GQM A;  1LLI A;  3U3W A;  2LYK A;  2R1J L;  2EWT A;  3JXB C;  2PUD A;  4I8T A;  2D5V A;  2GZU A;  2IVB A;  1ZZ6 A;  3G5G A;  3OMT A;  2IVG A;  2PE5 A;  3CLC A;  5A7L A;  2KPJ A;  4MCT A;  1ADR A;  4NDW A;  1AU7 A;  2JVL A;  2WIU B;  1ZUG A;  1X57 A;  3FYM A;  2AWI A;  4Z5D A;  1PER L;  3VK0 A;  3OQO A;  1R69 A;  1JH9 A;  3IVP A;  3OP9 A;  1ZZC A;  2MQK A;  4O8B A;  3GN5 A;  3F51 A;  1X2L A;  2O38 A;  3ZKC A;  1ZAY A;  2OR1 L;  4Z59 A;  3QYX A;  2PUF A;  4JQD A;  2LYS A;  3EUS A;  1EFA A;  2BNO A;  2IUO A;  4PU3 C;  3SCG A;  1GT0 C;  3G7D A;  1O4X A;  2O49 A;  1DWK A;  3TRB A;  4Z5H A;  1VPW A;  2CRO A;  1UTX A;  4Y42 A;  1LCD A;  1YSE A;  1ZPQ A;  5K98 B;  1WH8 A;  3KXA A;  1Y9Q A;  2AXV A;  2R63 A;  4F8D A;  3L1P A;  1BDI A;  1WH6 A;  2XJ3 A;  1CJG A;  3CRO L;  2IU7 A;  1QPZ A;  4FBI A;  4PU7 A;  3MLF A;  2LYL A;  3H5T A;  1S7E A;  2LYR A;  4IVZ A;  2O4A A;  2AUW A;  4X4H A;  2L8N A;  2BJC A;  2PUA A;  1LMB 3;  3UFD A;  4X4D A;  3CEC A;  2KEJ A;  4OB4 A;  1JWL A;  2PUB A;  4X4C A;  2IVQ A;  2OFY A;  3B7H A;  2PUG A;  2IV1 A;  3HZI B;  3SCF A;  2PIJ A;  1QP4 A;  2PUE A;  3O9X A;  4YAR A;  1ZZ8 A;  4JCX A;  4PU8 A;  3LFP A;  1ZVV A;  4GHJ A;  4J1X A;  2CSF A;  2HIN A;  2XSD C;  4YG1 A;  1SQ8 A;  3BD1 A;  1ZZ7 A;  3S8Q A;  3KJX A;  2HSG A;  1OSL A;  3D1N I;  2MEZ A;  3BDN A;  1RIO A;  1JFS A;  1UXC A;  4J1W A;  2KZ8 A;  1RPE L;  1LCC A;  3F6W A;  1QP7 A;  2AXU A;  3FMY A;  1OCT C;  2H8R A;  1NER A;  1QQA A;  2EBY A;  2ICT A;  1NEQ A;  3QF3 A;  1DW9 A;  2A6C A;  3ZHM A;  3KZ3 A;  4X4G A;  1PNR A;  4IWR A;  4I6T A;  4PU4 C;  1R63 A;  1XWR A;  1PRU A;  3LIS A;  1ZS4 A;  3GBF A;  4MCX A;  4X4E A;  2XIU A;  3QQ6 A;  2PPX A;  3GN5 B;  4Z5C A;  2ICP A;  1UXD A;  4IA8 A;  3JXC L;  2GRM A;  3OQM A;  4Z58 A; 
#chains in the Genus database with same CATH topology
 4I6R A;  2LCV A;  4JCY A;  3BS3 A;  1PRV A;  5DTM A;  1RZS A;  3NXH A;  1E3O C;  2GRL A;  1IC8 A;  3DM5 A;  1QP0 A;  2B5A A;  4I6U A;  1BDH A;  2XCJ A;  3GZD A;  3FYA A;  2J7W A;  2XI8 A;  4FN3 A;  2EF8 A;  2YBD A;  3R1F A;  1RZR A;  2BNN A;  2XXP A;  3F52 A;  2AXZ A;  2KEK A;  4ER6 A;  4GQM A;  3U3W A;  2R1J L;  2ODR D;  5DT2 A;  2PE5 A;  5A7L A;  4MCT A;  1ADR A;  2JVL A;  4WVL A;  1PER L;  1JH9 A;  3IVP A;  1U2Z A;  3OP9 A;  1ZZC A;  2PXV A;  1X2L A;  1ZAY A;  3UWP A;  2BNO A;  3SCG A;  1GT0 C;  1DWK A;  3TRB A;  4Z5H A;  1VPW A;  1QB2 A;  3L1P A;  2XJ3 A;  1QPZ A;  3NRO A;  4FBI A;  3H5T A;  1LMB 3;  4X4D A;  2IVQ A;  2OFY A;  3HZI B;  3O9X A;  1ZZ8 A;  2LLW A;  3LFP A;  4GHJ A;  2CSF A;  1SQ8 A;  2PXK A;  1DUL A;  1JFS A;  2EBY A;  3QF3 A;  2A6C A;  3NZL A;  3KZ3 A;  4X4G A;  1R63 A;  3GBF A;  4X4E A;  5DRT A;  2XIU A;  2HCS A;  5DTQ A;  1UXD A;  3OQM A;  1L1M A;  2LYP A;  4YG7 B;  1Y7Y A;  1HQ1 A;  4X4I A;  3RZZ A;  1ZZ9 A;  4X4F A;  2AW6 A;  5JUW A;  3TFL A;  3QWG A;  1LQC A;  3MEJ A;  3QFI A;  3PXP A;  2PXE A;  4YG4 A;  3JXD L;  2PXU A;  1CQT A;  2LYJ A;  1HF0 A;  3A9Y A;  5DRY A;  2EWT A;  4I8T A;  2GZU A;  3GZC A;  4ER3 A;  3FYM A;  2WIU B;  1ZUG A;  1X57 A;  4Z5D A;  3VK0 A;  2MQK A;  4O8B A;  2XXA A;  3OWQ A;  3EUS A;  1NW3 A;  3LQX A;  3R09 A;  2O49 A;  2CRO A;  4Y42 A;  5K98 B;  1ZPQ A;  1Y9Q A;  2R63 A;  3CRO L;  2LYL A;  3OKZ A;  2KEJ A;  3QOX A;  1QP4 A;  2HIN A;  4HRA A;  4EK9 A;  1ZZ7 A;  2HSG A;  3D1N I;  2MEZ A;  2VEO A;  5DTR A;  3BDN A;  1RIO A;  2KZ8 A;  5GAG i;  2PXP A;  3F6W A;  3QOW A;  4DE8 A;  1QP7 A;  2AXU A;  1OCT C;  1QQA A;  1NEQ A;  3ME5 A;  1PNR A;  4IWR A;  4PU4 C;  3VWS A;  1XWR A;  1PRU A;  1ZS4 A;  2PXB A;  2PXQ A;  3QQ6 A;  2PPX A;  4Z5C A;  4IA8 A;  2KEI A;  4X4B A;  2WUS R;  3OQN A;  3DNV B;  3ZPX A;  2XXQ A;  2PUC A;  1PRA A;  2HCN A;  3GUU A;  1POU A;  2PXD A;  1ZZB A;  1QQB A;  2L49 A;  2JCG A;  2JQE A;  2LYK A;  2PUD A;  3M9L A;  2IVB A;  2IVG A;  1AU7 A;  2AWI A;  4ER5 A;  3F51 A;  2J7U A;  2PUF A;  4JQD A;  2LYS A;  1EFA A;  2IUO A;  3PE5 A;  1O4X A;  1UTX A;  1LCD A;  1YSE A;  1WH8 A;  1BDI A;  2AXV A;  1MFQ C;  1S7E A;  2LYR A;  4IVZ A;  2BJC A;  4X4H A;  2L8N A;  3UFD A;  3CEC A;  2PUG A;  3B7H A;  2IV1 A;  2PIJ A;  2PUE A;  4YAR A;  4PU8 A;  1ZVV A;  4J1X A;  2XSD C;  4YG1 A;  3BD1 A;  3S8Q A;  3KJX A;  1OSL A;  4J1W A;  3FMY A;  1NER A;  2FFH A;  2ICT A;  5GAH i;  1DW9 A;  2V3C C;  3LIS A;  4MCX A;  4EQZ A;  3GN5 B;  3NDB B;  4Z58 A;  2LYQ A;  3SCH A;  3ZHI A;  3A9Z A;  3SR4 A;  1B0N A;  2FJR A;  2PXL A;  3G0T A;  2BNM A;  2LLV A;  1WIZ A;  1JFT A;  1WET A;  1RZR D;  4YBA A;  2MXD A;  3CLC A;  2LNM A;  2HFZ A;  3KL4 A;  2L1P A;  1LLI A;  4ER7 A;  3JXB C;  2D5V A;  1ZZ6 A;  3G5G A;  3OMT A;  2KPJ A;  2PXT A;  4NDW A;  1QZX A;  3OQO A;  1R69 A;  3GN5 A;  4ER0 A;  2OR1 L;  2O38 A;  3ZKC A;  4Z59 A;  4Q2J A;  3QYX A;  3TEP A;  4PU3 C;  3G7D A;  3SX0 A;  5DSX A;  4EKI A;  3KXA A;  4F8D A;  1WH6 A;  1CJG A;  2IU7 A;  4PU7 A;  3MLF A;  2M4H A;  2O4A A;  4EKG A;  4DE9 A;  2AUW A;  2PUA A;  4OB4 A;  1JWL A;  2PUB A;  3TEL A;  4X4C A;  3SCF A;  4JCX A;  4OBM A;  1UXC A;  1RPE L;  1LCC A;  2H8R A;  2PXF A;  3ZHM A;  3GZD C;  4I6T A;  3A9X A;  4EZI A;  2ICP A;  3JXC L;  2GRM A; 
#chains in the Genus database with same CATH homology
 2LYQ A;  1L1M A;  2LYP A;  4YG7 B;  3SCH A;  2KEI A;  4I6R A;  3ZHI A;  4X4B A;  1Y7Y A;  2WUS R;  4X4I A;  3RZZ A;  1B0N A;  2FJR A;  3OQN A;  2LCV A;  4JCY A;  1ZZ9 A;  1PRV A;  3BS3 A;  2BNM A;  4X4F A;  1RZS A;  3DNV B;  2AW6 A;  1E3O C;  2GRL A;  1IC8 A;  3QWG A;  2PUC A;  1QP0 A;  2B5A A;  1LQC A;  4I6U A;  1BDH A;  2XCJ A;  3PXP A;  3FYA A;  2XI8 A;  1PRA A;  4FN3 A;  1WIZ A;  2EF8 A;  4YG4 A;  1JFT A;  1POU A;  1ZZB A;  3R1F A;  1RZR D;  2L49 A;  4YBA A;  3JXD L;  2BNN A;  1RZR A;  1QQB A;  1WET A;  2JCG A;  3F52 A;  1CQT A;  2AXZ A;  2KEK A;  2LYJ A;  1HF0 A;  4GQM A;  1LLI A;  3U3W A;  2LYK A;  2R1J L;  2EWT A;  3JXB C;  2PUD A;  4I8T A;  2D5V A;  2GZU A;  2IVB A;  1ZZ6 A;  3G5G A;  3OMT A;  2IVG A;  2PE5 A;  3CLC A;  5A7L A;  2KPJ A;  4MCT A;  1ADR A;  4NDW A;  1AU7 A;  2JVL A;  2WIU B;  1ZUG A;  1X57 A;  3FYM A;  2AWI A;  4Z5D A;  1PER L;  3VK0 A;  3OQO A;  1R69 A;  1JH9 A;  3IVP A;  3OP9 A;  1ZZC A;  2MQK A;  4O8B A;  3GN5 A;  3F51 A;  1X2L A;  2O38 A;  3ZKC A;  1ZAY A;  2OR1 L;  4Z59 A;  3QYX A;  2PUF A;  4JQD A;  2LYS A;  3EUS A;  1EFA A;  2BNO A;  2IUO A;  4PU3 C;  3SCG A;  1GT0 C;  3G7D A;  1O4X A;  2O49 A;  1DWK A;  3TRB A;  4Z5H A;  1VPW A;  2CRO A;  1UTX A;  4Y42 A;  1LCD A;  1YSE A;  1ZPQ A;  5K98 B;  1WH8 A;  3KXA A;  1Y9Q A;  2AXV A;  2R63 A;  4F8D A;  3L1P A;  1BDI A;  1WH6 A;  2XJ3 A;  1CJG A;  3CRO L;  2IU7 A;  1QPZ A;  4FBI A;  4PU7 A;  3MLF A;  2LYL A;  3H5T A;  1S7E A;  2LYR A;  4IVZ A;  2O4A A;  2AUW A;  4X4H A;  2L8N A;  2BJC A;  2PUA A;  1LMB 3;  3UFD A;  4X4D A;  3CEC A;  2KEJ A;  4OB4 A;  1JWL A;  2PUB A;  4X4C A;  2IVQ A;  2OFY A;  3B7H A;  2PUG A;  2IV1 A;  3HZI B;  3SCF A;  2PIJ A;  1QP4 A;  2PUE A;  3O9X A;  4YAR A;  1ZZ8 A;  4JCX A;  4PU8 A;  3LFP A;  1ZVV A;  4GHJ A;  4J1X A;  2CSF A;  2HIN A;  2XSD C;  4YG1 A;  1SQ8 A;  3BD1 A;  1ZZ7 A;  3S8Q A;  3KJX A;  2HSG A;  1OSL A;  3D1N I;  2MEZ A;  3BDN A;  1RIO A;  1JFS A;  1UXC A;  4J1W A;  2KZ8 A;  1RPE L;  1LCC A;  3F6W A;  1QP7 A;  2AXU A;  3FMY A;  1OCT C;  2H8R A;  1NER A;  1QQA A;  2EBY A;  2ICT A;  1NEQ A;  3QF3 A;  1DW9 A;  2A6C A;  3ZHM A;  3KZ3 A;  4X4G A;  1PNR A;  4IWR A;  4I6T A;  4PU4 C;  1R63 A;  1XWR A;  1PRU A;  3LIS A;  1ZS4 A;  3GBF A;  4MCX A;  4X4E A;  2XIU A;  3QQ6 A;  2PPX A;  3GN5 B;  4Z5C A;  2ICP A;  1UXD A;  4IA8 A;  3JXC L;  2GRM A;  3OQM A;  4Z58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...