4MD5B

Immune receptor
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
190
structure length
190
Chain Sequence
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVVESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A molecular basis for the association of the HLA-DRB1 locus, citrullination, and rheumatoid arthritis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 190
sequence length 190
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4md5B02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4md5B01
5EIQA 3GKWL 1LO5A 4H20L 2E7HA 2NX5B 3EFDL 2BHUA 2BOBB 1AD0B 5DJYA 2GW5A 4WO4D 5DYOB 2OJEA 1EA9C 1JHTB 3LHPH 3LIZL 5IEHB 1GXEA 3A6BL 1QSFB 4HEME 2P8MA 3JUYA 4PGDB 1EIBA 3BPOB 4QTHA 5T3ZE 1BF2A 4PJCE 4KAQL 1MCFA 4YLQT 2B39A 3PHOB 2X1OA 3RKPA 5IWLA 3B3IB 4M03A 5TDOA 3ARGA 4E41B 3TN0D 3ZE2E 4U1MA 2A38A 2VAAB 2VLJE 1ORQA 5IMMB 2R9HD 1FO0H 1FGNH 1A3RL 4P46A 5F44A 3EGSB 5F88B 2G60H 2XKSA 5BOZG 1ZK9A 4BSVA 5D7JB 3GK8L 4O02L 5DGQA 1B2WL 5EO9B 5C0IB 5CCKL 2HRLA 5C2BH 3NZ8B 3RKDD 2CK0H 1XH3B 3W0WB 2XZAL 3C08H 3FQNA 4JRXA 4M6OL 1H15B 1XGPA 1CI5A 3BD3A 3O8XB 3NABH 4HJJL 1AJ7L 3IJHA 3CUPB 4F8TA 1EMTH 2ZUUA 3IS1X 5I8EB 5KJRH 3FOLA 3CFBB 5CP3A 1NBZB 4Z7UF 4RBPH 1EO8L 1T0MA 2FRGP 1DR9A 2EXWD 4JFFD 4MD4B 5C09D 2R69L 5DT1L 2FEDC 3SQBA 5H2BB 25C8H 2FHCA 3U9UA 5EN2A 4KU1A 3NBNA 4MJ4A 1OARL 3IXTB 3U0TA 4XPTL 1UCTA 3DUUB 1D7FA 2LVCA 4OGYH 4Y19B 3A67H 3HZKB 3RVXD 3TT3L 3VXTA 4FABH 4RFOH 4ZAKA 2WWMD 5FUOL 3PHQB 4LSQL 3UZEA 1LEGA 1JGDB 3V4UH 3BRGC 2YZ8A 4X6DF 2HA1A 4Z7WB 1LDPL 1MFEH 3SJVD 1NDGA 4XNXL 4LCWE 3DXAA 5C0GA 4WO4B 3VFOB 3DMMD 2AVGA 3QDJE 1ZT7A 5DD1H 3WFZA 2D4FA 3CDGA 4GMSH 3N1GC 4NDMA 3V5KA 4RAVB 5IQ7H 5BQ7B 4PJBF 1XGYL 3QYCA 3GSUB 1FFRA 3ARFD 4LCCA 1NCWL 2H2PC 4IRSB 2DBLL 1Z5LB 3OGCA 4UDTB 1OAUH 1F4WH 2F15A 5GGRB 5J13B 1CR9H 2DQHH 4NBXB 4WEUD 3MRLA 4NQCB 5BVJB 2FR4B 5E5MB 5D1XD 3MJ6A 3ULUF 4XMKL 3BEWB 3MXVH 3C5SB 5DMGD 5H94A 1EFXD 5GGSA 2D7TL 1CFBA 4F33B 5JW3L 1DBJL 2EDOA 3U0WL 2R2HA 1NFKA 1XIWA 2BC4A 3BFOA 3FO2A 3BP7B 5ACZB 2Y07L 3MRMA 1AY1H 1MUJA 1C08A 4PJCA 2XWJA 4GRLC 4UUJB 4YXKH 4KXZI 5LWYL 3RPIB 4GSDL 3WE6A 2C1PB 1TNNA 5SWZE 1A6UL 4DTGH 1A4KB 3M1BA 4LLAA 4FQ1L 3X3FL 1PAMA 1Z9OA 4GQ9H 4WV1B 4ZUWA 3MUJA 3HNTH 2AEWA 2BSRA 2XQBH 2W65A 1E4JA 2XWTA 4PJHF 1NC2D 5E2VH 2ERJB 4HGWA 3ESUF 4L3EE 4YXHL 1WIUA 4IMLB 3SJVB 1E4XI 4EI5D 5H35A 3SGJC 1M05B 3DMMB 1F11A 2F8VA 3QNZA 3TM6A 1KXQE 4JM4L 2Z8VC 2IQAA 2YWYA 1T5XB 4N9GB 3KPSD 4HC1L 4CW1B 3PGCA 4HHAB 1QSED 4I0PD 3PV6A 3CD4A 1LK2B 4F58L 4Z7VF 3SCMD 4LRIC 3RY4A 5J11B 2PKDA 4NNPH 6FABH 4HK0A 3QB7C 1LP9B 3ULVC 2FX9H 1Z9LA 4M7JL 1FBIH 1JHKL 1T2XA 4HX1A 1FFQA 3QQ4A 1P7HL 1KUMA 3TA3A 1D5IH 5E70A 4QWWD 5IR1A 2WW8A 3IRPX 2HT3C 5DO2D 3X3GL 3UYRH 5JOPE 3EYQD 5HXMA 3CCHA 1SVCP 4CBPA 3BKCH 5FM4A 4NNXA 2EIZB 5CZKA 1EFXB 3ZL4L 4R96A 4LCWA 5ICYA 1AH1A 1JF6A 2OTUB 3QDJA 4GS7C 4U1HB 2HVKA 3IDNB 4K55A 3T77B 1BJMA 3MV8E 3KAAA 3MOBL 1FYTE 4M9PA 2UWEA 2OL3B 2VDQH 4EDXA 1FL6B 1I9EA 2Q76B 1T66D 4RGNC 3U7WH 2QKIA 1V7MH 3I85A 4BQ6A 4G8IA 3LMJL 4MMZC 1OAZL 1AGDA 3JVGC 5KG9B 3BESR 4OIAA 3HE7C 2DQTL 1M6OA 1P5UA 5D5ME 5BZWB 5I16B 2FJHB 2AQ2A 4P5MA 4PGEB 3ZDYF 4HUMB 2AXJA 2Q3ZA 3S6CA 1ZGLB 3V6BR 2NYYD 1FNFA 3SDXB 3STBA 5GRJL 1NC2B 5D4QA 5KBNC 1UXWA 2JJTA 4DN4H 1GAFH 1ZLWH 3QO0B 4K3JH 2OYPA 1Q9LA 1I75A 5HGHB 2OTWA 4EI5B 3W9EA 1G1CA 4JO1H 3TO2A 3LKNB 4XRCB 4RWYL 3BZEA 1VSCA 5SWQA 2AV7A 3GSOB 3SDYL 1GIGH 1FCGA 1T7XA 2M8XA 5GGVY 1E6JH 4KGLA 3KPSB 2BY0A 1ETZB 4OM0L 3CLFL 3QIBA 1OPGL 5CD3B 4I0PB 1Q1JH 3MJ9A 2ICEA 3RL2A 4LEOA 2D7NA 3DSNA 2DKSA 4NQDD 2AABH 4JPKH 4R7DA 3UJIL 4XPBH 1JHLH 4HF5L 1B0RA 5SWZA 4N8PA 4PR5A 1MIEL 1T20A 2A6JB 2EE9A 3CH1B 1X5KA 1J8KA 1QFOA 4GLRI 1JWSB 5DJAA 5DJ2A 3RGVD 1JZ8A 2VC2L 4FQXC 4P48A 2A6DB 5M94B 3WKML 4L8SC 5E5RB 1KJVB 4L4TE 4AEHH 4DOHE 4L3EA 2YPVL 5LAXB 1BD2D 5LGHH 3GNMH 1QYGH 4GBXB 4Q0XL 4NM4L 2VDOL 4RDQF 4ETQA 3DUSB 1UACL 5IHLB 1G0YR 3ARBA 2F8OA 4QXGL 1YMHA 3W11C 1FDLH 4JKWA 2P5WE 3UTZA 1S3KH 1N59B 5ITBH 3BZ4A 1DBBH 3U9PL 1HHKA 3L1OH 2XFXA 1YEJH 5FA3B 1UC6A 3MA7A 3QCUL 1CF8L 4K3EH 3QUYD 1HZHL 3EJYD 3LEXA 1N2RA 1MCPH 4OIIL 2XT1B 2F54D 2BJML 3GM0A 4ZS6C 3GMRA 5TQ0H 2HTKC 2AI0L 3D85B 4BH8A 5EZLB 3RWHB 3RZCC 4NJ9H 2Z35A 4RCAA 3VG0L 3MV8A 5J6HB 5J3HD 3BO8B 2QQKH 5E8EA 5F70A 4OI7A 3GZKA 3NN8B 3O3AB 2KPNA 3QDMD 1FYTA 3MGOA 2A1WL 2W0FB 2VXQH 1N5AB 2J6EA 2OR9H 4XCNB 3HS0B 1BZ7A 3RIAK 3RVWC 1BVLB 5D5MA 3STLB 3MBEB 1IEBA 2QSTA 4HT1L 4MA3A 5J12B 1MCBA 4GG8B 3TYFA 1H8SA 3PG2A 4L5FH 1V3MA 2H2SD 5F1KC 5EC2A 3DTXA 1IGCL 4FQCH 5EBMA 3WBDA 5HPMB 4KI5D 1ZWIA 2E3VA 4FA8A 1OQOA 1W72L 4I18C 4H5SB 3WUZA 4XVSH 3L3KA 3TZVC 5ID0B 4LSRL 1FO0B 4EI6A 3GGWA 1RIUH 4WHYH 4DGYH 1BMGA 3BYTA 1WZMA 2H32H 5TGBA 4IIQC 1RVFL 2JB5L 3U6RB 3RX8A 4MS8C 4P2OD 3LZFH 1FJ1B 2PYFA 3ZT6A 3TO4D 3G5ZA 3O6FC 4MNGB 3T09A 1OGAE 4M7ZB 4G7VH 4ORZC 5CEZH 1OAXH 2R4RL 1DJSA 5E8NB 2DN7A 4M93B 3QG7H 5C0JA 2NCMA 3B9KD 4JN1L 1F45A 3KPNA 5F7DB 1RZJC 1RZIB 4L4TA 2F54B 1QNZH 4H20H 3HB3C 3K0WA 1JI2A 3EFDH 4QRUA 1GYAA 1OP3K 2VNCA 4PJAE 5I6XC 3NPZB 4YEEA 1R3LA 1YPZF 5LGJB 4P5TB 1RD6A 3T4AB 5AAMA 1EAJA 4PJGE 5IK3A 3ILQC 2JCCF 3PNWA 3ZKXB 1SY6L 3BPNC 2AEIT 4D8PA 4DKAA 4NQXA 3EO0B 2DM2A 4RMWA 4OF7A 2P5WA 2X4NB 4P0DA 4AMKH 4RAHA 3O4LB 3EDFA 4G42A 3NPSB 2K7QA 1ND0A 4Y2DA 1U8PB 3HNVH 1A3RH 1UZ6F 12E8L 4B0MM 5KVEL 5D93C 3X17A 2CGRL 2H8PB 3HKFA 4UZGA 4O02H 5CD5C 1U8QB 3JTSB 4HS6B 2R8SL 5KS9E 1T2QL 2O5YH 1B2WH 4XPFL 4JDVB 2OK0L 3F5WA 1C5CL 1F6AA 3OJDB 4M6OH 2J7LA 2PO6D 2V7NB 2ZUWA 4PY7B 3FQUB 5CFHA 2EDBA 4YQXH 3DX6B 1N64H 4X6FA 1OAYL 5D1ZC 4DCQB 2IANE 3I9GL 1CICD 5IQ9B 4GFTB 1M7XA 3UBXA 4Q6IA 3AB0C 3IXAB 5IWLC 2C4FT 2HKHL 3MV9D 3QXUA 4QF1A 2FX8L 1WC7B 3ARGC 4P2OB 5DWUH 2YA1A 4K3HA 3WN5C 3TO4B 4JGJA 4FTVB 4NO0B 2J5LB 2R69H 3ET9F 4P46C 3SPVA 3MRIB 1ZVHA 3L5WA 4XP6H 3TIEA 3HE6B 5JA9A 3T2NL 4XHJD 4XPTH 3TT3H 4EVNA 3BGAA 1FZMB 3B9KB 2JELL 1HNGA 8FABB 3BWUC 5F7HA 3HG1D 3TJEH 5C6TH 1OT1A 1J9CT 2YZ1A 1YN7A 5DEFB 4G8FA 4JO3L 43C9B 1G7LB 3ME0A 3PJSA 4J8RB 4UAOC 5DRNA 1RK0A 3DECA 4U6XA 2YUXA 3UC0L 1NJ9B 1VPOL 1RZKC 4U3XA 1WLHA 3BH9B 2MFNA 3VXMB 2GJZB 3WFEL 4WI9A 3TFKC 4JFXA 1XGYH 2DQIL 1BFVL 3UDWA 3WIIL 3E0GA 2MQCA 4PJEB 3CLEL 2JK5A 5CGYD 3ZHKA 1NGXA 1GZPA 3GRWA 1CLYH 1IE5A 1NCAL 3RDTA 1OGAA 1DN0A 5DRWB 4M1GL 4ZAKC 1KCSL 1U58B 2VQUA 2H41A 4BFIB 4HZLB 3G5YB 2VABA 3DETC 2B20A 1ZLVH 1E28A 4UQ2A 4LLUB 4JREC 2NW2A 1XF4A 3MR9B 1HDMA 1AI1L 1MFBL 2IWGA 4TSBL 4EQ2A 4HXBH 5DF0A 5JW3H 4PJAA 1IGTB 1U42A 2ZJSL 3TBVA 3C6SA 3U1SL 3KPLB 2ZOLB 1MJJB 3OKNA 3V8CA 4PJGA 5JHDD 1AHWA 2Y07H 5B4MD 3L3OA 1D5ZA 4G9DA 4OF3A 4QRTA 4OZFG 3BD5A 5IBUG 5FK9A 4LLYA 4YBLC 1UWXH 3QFJE 4NJAL 1A6UH 5K9KB 4XAWL 4GAGL 2YBRA 5DUPH 3EDEA 4FQ1H 3HI5L 4MVBC 1HSAB 2DWEB 3TBYB 1CXEA 4HIXL 4WVRA 4UT6H 4Y5XA 1U8MB 3TNNB 3AXLA 3FZUC 4UTBL 2CJUH 1QVOB 4YXHH 1J0IA 4AK1A 5KS9A 3OKEA 3HG1B 1CQKA 4XB8A 5MERB 1Q9WB 4PRBB 4Q7DA 4ZO7A 5F93C 3OKMA 3CVHB 4LIQH 1S7RA 3F12B 1XIWC 1G6RL 3F7QA 3SY0B 2ZWLT 4AEIL 4IMKA 1YQ2A 2OI9B 5F21B 1MCOL 4DQOH 1VFAA 1A21A 5T1DH 3WFDL 1AKJD 1DQQB 4GG6B 5ALBH 5IVXA 2IANA 4QT5B 4JAMA 4KC3B 4S1SL 1RUMH 2P45B 1WFUA 2GHWB 1FGVL 2FATL 3FN9A 3HUJF 5JDSA 4N1EA 4H25A 1FVEB 1GHFL 2VITA 3FT3B 1G7QA 1LO0H 3L9RB 5FKPB 2IAMC 1CLZL 3CFEB 3CAFA 3IF1B 5SX4I 1WF5A 1I3GH 3K7UA 2DKMA 2OR8A 1FNSL 4AENB 4CDGC 4Y1AD 3QQ3B 4BA8A 2BOCB 4BQ9A 4Z76B 4GRWE 1DQJA 4XZUB 4WFGE 3QO1B 5INDB 5FUZL 5BS0D 1TZIB 5JHDB 3H0TB 1MY5A 4X8JA 4OZGB 4YHYB 5L8KB 2APXA 5T1KA 4LCUA 5I1IL 3VFGL 1G9MC 4CRPA 4F9LA 1K3IA 2J8UE 5DLML 5JIKA 3H9YA 3MNVB 5I66A 2AJUL 4QOKE 3VFVA 2AK4B 4YNYB 3MRGA 1UVQA 1WBYA 4LHUD 3OB0H 2BNRD 1CD9B 1XMWA 3OX8A 5HI3D 3RTQB 1MVUB 1TZHB 4HV8A 4OLWL 3MJ8B 4D9QE 4CJ0A 1NFDB 3C6LD 4XBPB 3O2WH 4AJ0A 3SDYH 5CEZD 1EV2E 1S9VA 4DEPC 4G8EA 1AKJB 2R1XB 2FL5A 1YEEH 3R06B 1NUGA 2BSSB 3U48A 4U6TA 4U6VH 3UJIH 2QHRH 5C0CE 5HD8D 3O6KL 3KPRB 1EEZA 4Y5VB 3QFJA 3RWCB 1T5WA 1KEGL 2VXUH 1MIEH 5C8JB 3O11B 4NOBA 2JJTC 1WVZA 3AAZB 1W8NA 3PWLA 1MCSA 2VC2H 4Y5YC 2ZOKA 5GZND 3RPKA 2ADGA 1AD9B 3KYOA 3UTQA 3D2UD 3GMPA 1WICA 2Z4QA 4AM0B 3PP3H 4PRDA 4Y1AB 1T1ZA 3MYZA 1EGJH 1RFDL 4YDLC 2HJLB 1X5ZA 1RPQA 3QIBC 4GT7A 4BZYA 3FRUA 5BS0B 2X4RA 1GGTA 1UACH 4N9OB 4QXGH 3ARBD 3SQOL 3V6OE 5HHXH 4ODXB 1DUYB 4B5EA 4NGHL 2GK0A 4KY1H 2GT9A 5EB9A 1BHGA 1KCVL 3U9PH 5MEPA 2M2DA 3VFNB 1UM4L 5E2TL 3KXFE 3QZWB 4PTTA 35C8L 5FCUH 3QCUH 2E6QA 5DUBB 1QP1A 4CMHB 5E00B 4UQ3A 3U82B 1VGEL 1FP5A 1RZKL 2KDGA 4JFYB 3WS3A 5HGBA 4DGVH 2CIKB 4I5BA 1BAFL 5EUOB 5IHBA 2AGJL 2LAGB 5CBAA 4LHUB 5E94A 4GO6B 2C3VA 1WJ3A 1N26A 1M71A 1NBYA 4JB9H 2EZ0D 3HFMH 5L0QC 3EO9L 2IC2A 4JJ5A 5ECJE 1U3HD 1J1OL 3MTRA 3C6LB 1MIML 3QUXA 5AUMA 2AI0H 3UX9B 5EOTA 4K7PY 4OAWB 1CU4L 1RJYB 3RWDA 1ZHBB 2RIKA 3O41A 1ZHKB 5D7IF 1I7RB 4UT7L 1UKQA 5D2LB 5C0FA 4R2GC 2EYRA 2AEPH 3KPOB 3LS5H 4U0RB 1XF2A 2J8UA 3AU1A 3RUGB 1HN1A 1SEBB 3PWVB 3VG9B 3IDIB 1EXUA 4QOKA 5KSUB 5LVEA 3BN9D 1I1RA 3SHSA 1IAOA 3TV3L 4ZS7H 4N0FA 4MCYA 1BIHA 5GS0D 3RI5K 3D2UB 1IGCH 2H1PH 4JFZH 5T33H 2PTTB 1W72H 1VADA 3E6HA 5JNYA 2DAVA 1EBPA 4YO0B 2KZWA 4IRJB 3UYOD 3H3BC 3BQUC 1Z0MA 1JZ7A 3C5JB 4ZUTB 2F58H 4YPJA 1MQ8A 3KR3L 2R0KL 1QD0A 3X13B 4MJID 4XPHH 5KW9L 4X5LA 1WAAE 5EC1A 3OXSA 5F3HB 3TIDA 5C0CA 1LE5B 4G9FB 1FQ9C 3ZKND 2GCYA 3WMSA 1SYVB 3TPUB 3T2QA 3SDCA 4LVHC 1ITCA 4PLKD 1D5BB 3DIFA 4LPWA 3WLBB 3MRKA 1T4KB 3SDDA 3EBAA 3NACL 2P24A 3DURB 2LTQC 4UV7H 4MXVE 1U3HB 3ULVH 4K9EC 1ZHNB 4WFFE 4JKKA 1WISA 4WU7A 1MSPA 5D2NC 3GEWB 5B3NA 3G6JE 5BRZE 4LSDA 2V7HA 3PIQB 3GJFA 4Z7OF 5ISZD 1GGCL 1SJHB 3V6OA 3DVGA 3P40A 4HBCH 5ELIA 5IVOA 1H0DA 3ARUA 3P2TA 4KKBC 3U2SA 3KXFA 4O2FB 4X5WB 3LQAC 2HLAB 3GSQA 4HAGA 2A83A 1INEL 1U8JB 1JGEB 4RX4D 4UINL 2CGRH 5KVFH 2EDWA 1KJ2B 3MLZL 2R8SH 3PXHA 5KSAA 2OK0H 1FFOA 1RMFL 2ESVB 3ZE0F 4ODTH 2LFGA 2XTLA 2G75A 1PX3A 3WD5L 2NTFA 4NN6C 1IAIL 4G6AC 4P3DB 5I1JL 4JZNA 1IARB 1N8ZB 4C56B 3LN5A 1YEIL 2EDEA 3S4SA 3VXUD 3OJVC 5I73B 2FX8H 2Z31D 2N56A 4Y2DC 1TQBB 1VGKB 1MVFA 4P4KB 1R3HB 4K2UL 3T65B 3BPLB 3B9VA 1OWRM 2FB4L 2FHBA 1RJCA 5F7YC 1CGUA 3OAUH 4QHLA 5DJCA 5ESQA 4GW4A 3SGEI 3D69A 1ZANL 3T2NH 5JLZB 3VRLE 2BMKA 5F6HI 2JELH 3L3JA 1XF3A 1ONQA 3UEZA 1GH7A 1BX2B 1KFAL 1OVZA 15C8L 1ZA6A 3I50L 4WI7A 4P2QD 2XQYG 2ZPKL 2IGFL 5KVMC 1DE4A 4JO3H 4JHZA 5TDNA 3STZA 1PZUB 2HN7A 1TPXB 4Q6IC 1SBSL 5DEZA 1CE6B 1VPOH 2CIIA 3D0LB 5DVNA 3BMWA 2NY0D 4FXGB 5ISZB 3O3BA 2D31B 2FECL 2HRPH 2VQTA 3GO1L 4AQ1B 1UM5H 3MO1A 1WAAA 1YNTA 4K94C 3RDTD 3FN0L 5HYQA 3LN4A 1U3YA 3MJ9L 5DD6A 1BJ1J 5ICXB 1GGBL 4M7LL 1CL7I 4NQEB 3VXQB 3C09C 3HN3A 5EORH 4L4VE 1LD9A 3T08A 1SJVA 1NMBH 4G3YL 5JOFA 3F8UB 2BNQE 3H2WA 3MRPA 4UU9B 3FQRA 1MFBH 1YEFL 4TSBH 3VFRB 2W9LA 3W9DA 4ZTOL 3VXSD 3S37X 3VI4F 2OJZL 4OFKA 3UDWC 3IGAB 3LEVL 3G6JA 1RQ5A 5DTFA 5BRZA 4WUUE 1FL5A 3IKKA 3NIFE 5DSCB 3VXPB 2ORBL 5DK2A 1MF2L 5IHZA 4X6BB 4CMMA 3VGBA 3LAFA 4KVCL 2G2RA 2B0SH 3DRQA 4ZMAT 1DVFA 3HC3L 5FGCE 4URTB 2DWDB 2MNUA 2NY1C 4AZ8A 4NO3B 5EOQH 4BK4A 4WY7L 3D18B 4Z78A 1QO3A 4G43A 4XCCH 1CG9B 2H3NB 4HIIB 4LNVA 5T1LA 5DJ6B 4NZTL 4PJ5E 3UTTE 5I75C 4G80A 2I24N 3MRDA 5HY9A 4AEIH 1EJOL 1NMAH 1AHWC 3LB6C 1MCOH 4HWBH 2YD8A 3KGRA 3U0PB 1OD7A 2NY0B 1UJ3C 1CFNB 1G0XA 4LLMB 3VD4A 2YRPA 4R4NC 4Z7WF 1MY7A 2L7UA 2BRQA 3ARWA 2YA0A 3X14B 4XP4H 2B5IB 3MUY1 2KH2B 1HQ4B 3AUVA 4Y5XC 3F7VB 1U8LA 1KT2B 5GRYA 3BW9B 3BP6B 4UV4L 5F7MC 3LV3A 2VLKB 1CLZH 1RY7B 4JCMA 4Z7VE 3C9NA 2Z9TA 5FM8A 2J6EL 3QFDA 3HPJA 2WINB 1F3JA 2XY2A 2MCG1 1NAKL 4L8CB 4Z7NF 3P4LA 2VLRB 2FBJL 2YD9A 4P23A 4FFVD 4Q2ZA 4FG6C 3FB5A 3VXSB 1KELH 4X4YB 2XZQL 2NZ9D 4NWTL 3TT1L 4OGZA 2D0FA 4MNQE 5FUZH 4E42B 4NKDA 3VWJD 1QLFB 3RVVC 2X89A 1RZJH 1Y18B 1EVTC 2GSGA 2BVOA 3GSWA 4KHXL 3T0EE 3VFGH 5I1IH 3LKQA 5IFJA 1TITA 4I0KA 2J12B 3ARPA 4K9EL 5BJTA 2VSCA 1IM9B 4MA7L 1QSVA 2AJUH 4Y4KD 3CGTA 1HOCA 5IB1A 5IOPA 3SGKA 4OCXL 4XWOC 2QV2A 1IGML 5IVZA 5FA4B 3C2SA 4Q9BA 4PV9A 4HMCA 4HULB 4WJ5A 3WNNA 2J2ZA 5I8KL 3RZWA 1Q94B 2BNQA 4HS8L 1A8JH 4JZOB 3DRTB 3LQAL 1YY8B 5GHWL 5ADOH 5L9DL 2X41A 1BFOB 2ZSVB 4HIHA 4LLWA 3AVEA 2NY7L 3VWKC 4WUUA 4EEEA 4NCC1 5C0DA 3SKMA 4PJXB 4PRAB 1A4JB 2JIXA 3QPXL 4JVPA 3UAJD 3N1FC 3ULVD 5CWSB 4EZMA 5ALCH 2M1KA 1P7KB 2CUIA 1NGZA 3NFPB 1BFSA 5JXAH 1I1FB 4GKZA 2X4OB 3B9AA 4Z0BH 1LP9F 1WWBX 4PJ5A 5INCA 3UTTA 4XNQB 4QRPE 4OZFH 1R24B 4GXVH 3FO1B 4YDKL 4XWGH 5J56B 2DM7A 2B1AH 4GRLB 3SQOH 3RGHA 3EKCA 2R0LL 4ZFFB 5DJDA 2P4AB 4F7PA 4NGHH 5ERWA 1P4BH 1C12A 5A2FA 2R0ZL 2R1WB 2CRIA 4P2RE 35C8H 4N5EC 1A1MB 3RNKB 5EU5B 4Y4KB 4GAFB 4HKBA 5FYJD 4EIZC 1VGEH 3H9ZA 1RZKH 5CP3H 4PG9A 3S9DB 2Z91A 1BAFH 5GRUL 2AGJH 32C2B 4Z7VA 4O2CB 2EDJA 5DMKA 3EO9H 3I6KA 1J1OH 1MIMH 4Z8FH 5C0NC 3BZFA 3REVA 2F9BT 3VD9A 1CU4H 1YQVL 1TFHA 1YYML 3DV4B 3SDXF 4MNQA 4TUJA 1ZVSB 4UT7H 2XPGB 3ROOB 5HDOA 4A6YA 3QPQC 4J4PA 3T0EA 1XF5A 1FIGL 3FB8B 4KK8D 1U36A 4I4WA 3PWNA 3I02A 3RVUD 1KIPB 4U2ZA 5JXED 3R1GH 1FIEA 1NGWB 1MFNA 3OAZK 3KNBB 4NN5C 5CP7A 5I1DB 4ELKB 2QSCL 5TE7H 1FVDA 1A7OL 2DIJA 3QUZD 4ODSL 3TV3H 3GRWL 4K7FB 2AV1B 3IKCA 4GMTL 1HHHA 5MEQB 1JUFB 4OB5L 3MNWB 4YDJB 4PJIE 4MWFB 1P84K 4M8VA 4D0BB 1S7WA 1KB9J 1ZHLA 4Y4FA 4D9QD 1TNMA 2P43B 1JPFB 4W70A 2XV6B 5C07B 1P69B 2VH5L 1K3ZA 3QEQE 5E8PB 2D0GA 3KR3H 3EHBD 3IFPB 5TE6H 5AZ2H 4KKAC 2EECA 3Q3GA 3ZDXE 4C4KO 1I9RH 4C54A 1A9BA 5KW9H 4Y2OA 2MQ0A 4XBEL 3HE7B 3AY4C 3WIFA 4F37F 2X4PB 4MDIA 5B3JF 1CE1L 4HS3A 4AG4L 2ZG1A 5BMFL 1U6AL 5DA4A 1JZ6A 5ESVA 5MENE 5T3ZH 4RNRA 4MD5A 4QHNB 1WFNA 4R4BA 2EYSB 4UIKL 1G7PB 2CRYA 4RGOH 1XGUB 1NANI 3NACH 5I1HH 5DZLA 2PYEE 2BFVL 5CBEB 1WCQA 4QRPA 1S7QA 1REIA 1CFTA 1RULH 4APQD 4QYOA 3VW3L 4IOFC 3DI2B 5BV7C 3JUZA 4GW5B 1KOAA 2GJ6E 2VXVH 4CVZA 1QG3A 4WGVB 3BGMB 5HHMB 2F53B 3SDCC 1TJHL 2IADB 3FFCE 4JKLA 4Q58C 5IBLC 5HYSG 5J0BA 1U92B 4KPHH 1U3JA 5KSVA 1INEH 4FQXB 2JJSA 3MMEA 5GQBA 4KK5C 1MNUH 4UINH 1ES0B 3IS0X 5H8DA 3K74B 5FF6A 3EYUL 3C60C 4LLDB 1J5OH 1MCIA 1G9MH 1CGVA 2PW2A 3BHBB 5KSAD 1I7TA 2NY5C 4DK6A 1XR8A 4NP4L 4LU5L 3NCYS 3WV0A 4WHDA 5F7WC 5I1JH 2GY7B 2VMFA 3V6OC 3AM8A 4IS6A 2F5AL 2QQNL 2CDEB 1FNEA 4MNHA 2DTSA 1IGIL 3T0AA 4M3JA 1W0VB 3O6FD 5HDBF 2FB4H 3FFDB 2Q7YA 4L1HA 2XTJD 4NQVA 3GIVA 2DF3A 4YXLL 3P30L 2Y5TB 3O3UN 3O9WD 4NIKB 4CKVX 3BIAX 5EFIB 3PHSA 1KFAH 1NLBL 1RAMA 3I50H 5F97E 1OGTB 3K3QA 1QFWM 4PJIA 3RZCB 3PL6D 2HFGL 5I0ZA 4EN3D 4MXQC 4NM8H 2BVQB 4APQB 4WU5A 4XVUD 2CLZA 1GGIL 3QEQA 1FFPB 5E6ID 1HXYB 5EU6B 2C1OA 2F74B 4OD3L 4JANB 3OGOE 5CZVL 3GO1H 4X99A 3WXWL 3CFDA 5KOVC 1L7IH 1QOKA 4LMQI 2DDQL 1A3LH 2A9NL 2YD3A 4ZFOB 3C5ZD 3FN0H 4ZFGL 2RFXA 1H3WM 1P4LA 2IBZX 5CZXD 4HH9A 2FJGA 2VL5A 1JF1B 3MJ9H 5T3XE 4YHPB 5MENA 1GGBH 3L3HA 1CXKA 1CXHA 1IAKA 2IALA 4NHCH 4NQTA 5CGMA 4LAQL 4LGRB 4QRSB 1NGYB 3P4NA 1DDHB 2A6IA 4G3YH 2DMCA 3H7LA 3AS3A 5BXFB 1IJ9A 2PYEA 2Q6WA 2Y6SC 3D5OF 4Y4HA 1MFCL 3BUYA 1JNJA 4JR9L 3OQ3B 3AREA 5CILH 5C70A 4XI5C 4ZTOH 2DJ4A 2VIRB 3MV7E 3LEVH 5F6HJ 4IIQB 1JRHL 4HIJA 5E03A 3OKLA 2DRUA 4M43H 2HFEA 4PJDE 3WL9B 2GJ6A 2L0DA 5KTEH 3BXNB 2XWBB 3O6FB 1TZGH 1G9EA 1MF2H 4HMDA 4AIZB 1P7QD 4OGXH 1K2DB 1JPST 3M45A 1PYWA 2XKNA 4RZCA 5LCVL 4EQ3A 3HC3H 1J0HA 1J87A 3BKYL 4DAGH 4JJHA 5FAAA 1HIMH 1AE6L 1MAJA 4NC0B 2VDLH 3MXWL 3QRGL 4WY7H 1BZ9A 3UPCA 3S37H 4JKMA 2PR4L 2R2BA 5FYJL 4NUJB 4NZTH 3S4SG 5I6XB 3DLQR 5E9DE 4EN3B 1OF2B 1GCFA 5F89B 5DRZB 4TQEH 2YPLE 2DOCA 3BPNB 5E6IB 1NSNH 1G7JB 1DLHA 2W9EL 1B4RA 5I74C 5DJXB 5JMRA 2KQNA 4HUWA 4ORGA 5FB8A 2UZYB 1WIPA 4XP1L 3U83A 1IBGL 2BNUB 1DVFC 3H6JA 3C5ZB 4HD9A 1FPTH 2WWKO 3WO4C 5D93B 8CGTA 4UV4H 3DETD 3K1DA 3KG5A 5HVWA 5KAQG 3KDMA 1ED3A 1K9TA 1UJTA 5TH2B 4PJEF 2OJEB 2J6EH 5HGAA 1NAKH 4KMQA 4ZTPL 1D9KA 3G08A 4TVPE 2P8MB 2D03L 2AP2A 1HH6B 4BFGA 4H8WC 1RZGA 5D1ZB 2JLLA 1L4IA 5GSVA 4NWTH 1I1AC 1MCRA 2YPKA 3AB0B 5TDOB 3U36A 3MJ7B 5IJVA 1KJ3H 2ITCB 4OFIA 2R4SL 1CZ8H 1XGTA 4PUBL 3WN5B 4NKMA 4RMUA 1ORQB 4XNUL 3OKOB 4K9EH 3PWPB 5K9JH 5FO9B 2SEBA 4OZFB 5E99L 1P7QB 1YEDA 5GJSH 1P4IH 1JK8B 1JPTL 4DUVA 3RRQA 1FSKC 1IGMH 2GUOA 3SKOB 3FZUD 1S9KC 3HI6L 5BV7L 2FX7L 2AK1L 5C08E 3TVMC 5F9JB 2EDFA 4JRXB 4DK3A 1XGPB 3OG6B 1A9EA 3KWWB 4YPGB 5I8KH 4P23C 4ZSOE 5EUKB 3RHWF 5IW3A 2BNQD 4OUUB 5E1AB 4HS8H 4UAOB 2WUBL 3LQAH 5L9DH 3ZYZA 4ODBD 1J11A 4HXAH 3ZTNL 2XICA 3MV7A 4C4KT 3SKNB 3V5DA 4YR6A 3GBLA 4X8XA 4RMTA 3ULUD 1ZLUK 2MHAA 4PJDA 4TSAL 2YD2A 3RL1A 2NY5L 3U9UB 3CSYB 3QPXH 4P9HC 1SMAA 2WIIB 3P9MB 3EYVB 3SGKC 5TQ2L 4ELME 2AQ1A 2EE2A 3UCRA 4WW1B 2UY6A 4DZBA 5CUSL 1HYRC 4K23H 4CNIB 1LEGB 4GG6F 1RHHB 2VYRE 1NDGB 4GXUN 5HI4D 4X9IA 2GTWA 5C0GB 4JN2A 4J3TA 1U41A 3IETA 2DLFL 3KJ6L 2HT2D 5IFAH 4NC2B 1XCQB 2AQ3A 3CDGB 4NDMB 5JO5A 3V5KB 2XACC 4R4FH 2X9WA 2ZCHL 3NGBC 4WWKA 5E9DA 4KJWC 4YDKH 5CS7A 2YPLA 1XF1A 4H0HB 1Q0YL 5J9PA 3GHEL 2K1MA 1IC1A 1T7ZA 4Z7QE 4MCZA 3OGCB 1ZOXA 4S1QH 4X6DB 3G5XA 5D6CA 2R0ZH 4Z5RA 4PP2B 3VFWA 4LSUH 3BRFA 3SE4A 3ARDA 1EERB 2P8PA 3GB7A 2DD8H 3QHTC 4P59H 3EDDA 3WFHA 3MBXH 2QQLL 3ES6A 3G6DL 1A7PH 3E3QE 1NPUA 2WM0A 3ABZA 2V9TA 5H94B 4NWUL 1JPGA 2WBJA 4F2MA 2COQA 4OZGF 1E4XH 3Q1SH 4AQOA 5JHLH 2GQHA 3B2VL 2HVJB 3VRIB 2R2HB 4K94H 4HK3N 1XIWB 1CFSA 1MCLA 3FO2B 3FONB 3H3PH 4X7EC 3N06B 2WAHA 1FAIH 5C7XL 4PGBB 1IEAA 4DKEL 5AD0B 1D5XA 1MUJB 1MAMH 5E4IA 1FN4B 2XWJB 1SBBA 1YYMH 5GGRY 1IT9H 2EIDA 1FC2D 3LQMA 1JE6A 2UUDK 1F13A 1RUQH 2OS7A 3M1BB 5L8LB 1L0YA 3KLSA 2EO9A 4Y16D 1YA5A 1FIGH 2VLJB 3OKDB 4XVTL 1NFDF 4CL7A 3KYNB 2FZ3A 2W65B 2XWTB 5FYLE 4HGWB 1LO3L 1EUTA 2JE8A 3F62A 5C6PB 5A3IC 2IAMB 1T21A 3D0VB 5F1NA 1AGFA 3L6FA 1HINL 5C08A 3PQYE 5IW6B 1OM3L 3GRWH 1KB5H 5AZEL 2X1WL 5LGKA 1X4XA 5I19H 4GMTH 4BSJA 1F11B 4FZ8L 4ZSOA 3GIZH 5FO8B 1KNOA 7FABL 3OZ9L 4XC3L 4Y4FD 3WLWD 1QKZL 3PGCB 1MH5A 2AJ3A 4KHTL 3K2MC 4G6FD 3ZSTA 4PJHB 1BF8A 3BP5B 4J4PC 4HK0B 3T0EC 2Z8WC 4WEBH 3THML 1C16A 1LNUA 5GS2H 2AJYH 4PBVC 3VA2C 1EEYB 4HPYL 1OHQA 4HX1B 3HZYA 3V4PL 2APFA 1I7UB 5B39A 1UXSA 4P3CH 5I71B 4JPVH 2ZUXA 3OV6A 1AGCA 5IIEA 2JJVA 1YDPB 3P9LA 2WZPD 4ELMA 3BMVA 1CE1H 4LSVL 4HKJB 3CCHB 1U6AH 4C59B 2OLDA 1A7QL 2PXYA 2BSTA 1YUHB 2GEEA 5FYKH 1F4YL 1C7SA 1LE9B 2HJKA 5ICYB 4OLZH 3QDJB 1J10A 3MRJA 3PXJA 2BFVH 4GAYA 4YHZL 3RU8L 1F90L 4DEPB 4RMQA 3H7BA 5DD5H 5D1QC 4EDXB 5ICZB 4HKZA 5FOBB 2QKIB 3VW3H 2DICA 4G8IB 5EUOF 2DB8A 1AGDB 2B1HL 4P5KA 2DTMH 4Y16B 4U05A 1VENA 1M6OB 3OSKA 3LEYL 1T22B 3V0WL 4BZ2L 2P49B 4GLRH 3QIUC 1TTUA 4NZDA 4WFED 2ARWA 5E2WH 3MRNA 4KV5E 5EZJB 2X4SA 4LFHD 4Y5YB 4Z7OE 5DK3A 3WNPA 1Z0NA 3GHBL 5JR1L 1JYXA 1Q9LB 5D2LF 2OTWB 4X9GA 4JFHE 3BZEB 3EYUH 5SWQB 3M07A 4R7NA 3O0RL 1EAPA 3I3BA 5CEXA 3VCLB 1VHPA 4LU5H 3RUGF 4YDLB 1JN6A 1B6DA 2I27N 3Q5YA 3BQUD 4MB5A 2ZSWB 1MJUL 2H6PB 3O6MH 4Q6YA 5J1TC 2EH8H 4R7DB 4KJYA 3I2CL 1KULA 3P4MA 2F5AH 2QQNH 1L0XA 2BVPA 1B0RB 3BGFC 1DQDL 2YEZA 1T20B 1MHEA 3QDGE 5TFSH 4OZ4B 2WWKT 3AMKA 1C7TA 4MLSA 3UO1L 2WBWB 4ZQKA 1JYWA 1CQYA 4WI6A 4ZO6A 1KV3A 3BJLA 5HVGB 4YXLH 1KF9B 3P30H 4G8GE 5CSGA 1H3PH 4L3EB 3VXOB 3WFCL 3QBTB 5T5NF 4KK6D 3RWJA 1X6LA 3PQYA 3M17A 2DJUA 1G7HB 1HQRA 3FQTA 1OSZB 3WNKA 2APWA 5L0QB 4U2YA 3IJSA 3Q6FA 4P9HL 3S96A 5HYJD 4PJ8C 5DQJA 1UQSA 4BKLA 1NEZA 3AM8C 4DZ8A 4N68A 2ADJA 4IRZL 1HHGB 1MLBB 1N0LA 4P57B 2XXMB 3CMOH 4AT6B 1GGIH 1YNKH 2R2EB 3MC0A 1T03H 3OHXA 4R2GB 2ITDB 1DEDA 5CZVH 4HWZA 2KBGA 5E8OA 4RAUB 4YX2H 1JV5A 2AXFA 2DDQH 2FIKA 2RCSH 3VMOA 1ZLSL 2A9NH 3BJ91 4XB7A 5CJ5A 1VFBB 4DVRL 5GSRA 1IQWH 4DN3H 2LV4A 3ULUL 5A40E 5FV2A 2VLLA 3QXDA 3B8YA 3P0GB 3MPCA 3OR7A 2EYTA 4XCEA 1ZTXH 5GRWA 5C92A 3QQ9D 1CGWA 3NZHL 4YAQA 2CK2A 2FNBA 2NLJA 1N6QL 5GGVH 3W39A 2Z35B 4OCWL 2DLIA 5D70L 3MV8B 4Y4HD 1U91A 3ELAT 4JR9H 3BQUB 1QSFE 3PWUB 1SJEA 4EOWH 3D6GA 3I6GA 2X5PA 1TETL 4W6WB 2OSLA 5AAWA 5KSBE 4MXWL 4QRRE 4M1CD 5SWSB 5HHOD 2ADIA 5KZCB 4E9LA 2Y72A 4YHIA 3PF2A 3VI4E 3SE3C 4LVHB 5I9QC 1EO5A 3FO0H 3G9AB 2QJDA 3T4YA 3UTSE 5EBMB 1QFUL 4M5ZH 2DI7A 3MXWH 3QRGH 3W0WE 2LTQB 4JFEE 1KLGA 2PR4H 3GGWB 3AREC 3V7MA 4ZUVB 1X6NA 1IRAY 3I6LD 3SO3C 2VZOA 5D2NB 4K7PX 4ODVL 1NL0H 5DMIH 1PJ9A 3HNSL 3HMXA 4AYFA 2NXZD 1JGUH 3LRGA 2W9EH 5CGTA 4OCMC 3WDIA 5D7SL 2YD4A 1TVHA 5I1AA 5JPMA 1CDJA 3EOBA 5GIRA 3QDGA 3JWOC 4XP1H 1H3UA 3MNZB 1IBGH 4GRWH 2ATPA 4HUVA 2X09A 3UJTL 5DDHA 3CNKA 1JFQL 4Y19E 1SEQL 3KPNB 4R26L 4Y88A 4L4TB 4LQFL 2PW1A 3EYSL 4A6YL 4G8GA 1TIUA 3JZ7A 3O81A 1MEXL 4D3CH 1BP3B 2PF6A 3C8KB 3EYFA 4QRUB 3DARA 3FQXA 4QNPF 4Z7WE 1L9MA 3QXVA 4Q9CA 3EIFA 1AR2A 1BGXL 1R3LB 2YD6A 1FFNB 1YEKH 5F3BB 1PQZA 5JIIA 1BVKB 4NN6B 5IK3B 2D03H 4GKNB 4WRLA 2IBGA 5GISL 3FKUS 3KPTA 5JW5A 2P5WB 4HEPG 3R8QA 1EHLH 3HAEA 3QEGL 5EG6C 4G42B 3KPPB 1V3JA 3BX7C 1ND0B 4QXWA 4Y2DB 1KXTB 3CXDL 3KLDA 3ARSA 4XNUH 5LBSL 5IV2B 5E99H 4P49A 4MQ7A 4JM2A 2XZCL 4GW1A 1DANT 3RVTD 3HC0A 4BFEA 1V7NL 2EDQA 3LH2L 4YHOH 5I15L 1FZKA 1QA9A 1OCWL 5BV7H 2AK1H 1BBDL 5HYFA 1OSPH 2AJZA 2DLTA 4AL8H 3HTLX 5FGBA 1D9KC 3OXRA 1AD0A 3DX8A 3WFBH 5DYOA 1LQSR 3QT2A 5DHYB 3O2DH 1JHTA 2WUBH 3EZJB 4OFPA 3OKKB 3S36X 1A6AB 3TLRA 3N1QC 5IEHA 5TPWL 1CBVL 4Q6IB 4OD1L 3FHQA 3ALXA 1II4E 1QSFA 3BKJL 3ZTNH 4QF1B 1RIVL 4PGDA 3WS6A 1M7DA 2NXZB 3OF6A 5CSBA 5FYKD 3PHOA 1PZ5B 4PRID 4LASL 3NA9L 1RZ7L 4JFFE 2C7UB 4NYLB 4TSAH 3L5WB 2NY5H 1YEHL 3P0YL 4QRRA 3TIEB 5IMMA 2Z93B 1FNGB 1PX4A 4M00A 2AJVH 3GJFH 4W4OA 5FO7A 2D0HA 3MRRA 5IJKA 5CUSH 5D7JA 3SKJL 3C09B 4S0TD 3UTSA 3S36L 2HMIC 4G8FB 4I3SH 1Q72L 1D6EA 5GZOD 3NZ8A 3PJSB 3SJVE 3W0WA 3WXVL 3KJ6H 3MQIA 4JFEA 2AKRB 3NMEA 2P5ED 2C3GA 1IKNA 2X1QA 2ZCHH 5E1HB 1A6VL 2BXZA 1O7SA 3ZDZF 3CUPA 4RA0C 1IGJA 1Q0YH 2JK5B 3GHEH 3CFBA 1KB5B 3AS0A 2R2CA 5HHQB 1DN0B 2DLHA 4F7MB 2PN5A 4MD4A 1LP9E 3VH8A 3KHQA 2K3TA 4JDTL 3W5NA 4YHLH 3G04B 1WZLA 1AQKH 3IXTA 2HH0H 3HZMA 1F3RB 3P11L 3D25B 4Y19A 3HZKA 1JTOA 3HHRB 2NY1B 5LKNA 1F4AA 3KYMA 2Q20A 2FJFB 2NW2B 1HDMB 5HVHC 3K4ZA 1JF5A 1JGDA 5EWIL 4KTEL 4Z7WA 4PJAB 2W60A 3KPMB 4WWKC 3B2VH 2BY3A 3C6SB 1QQDB 4WO4A 5I75B 3VFOA 3QNYB 3NCFB 4ONHA 5C7XH 1AHWB 3C87A 3S5LB 4MDJB 5BQ7A 3U46A 1GZQB 1D5ZB 4G9DB 4X4ME 3W2DH 4QRTB 3PP4L 4EXKA 4K8RC 3VWKD 1UJ3B 4BJLA 5FK9B 3ZKMC 3GSUA 4ERSL 2W92A 4MX7B 4C83A 2QADC 2YBRB 3SE4C 3ARDC 4TPRH 1Z5LA 2IMMA 4ZOBA 3WHE0 3NOIA 3TN0A 3HC4H 2W0LA 4F15C 3I3DA 5GGRA 1LO3H 2WBJC 4NQCA 5BVJA 2FR4A 5KS9B 5SX4H 1K5NA 3OKEB 1NGPH 1DQLL 4MAYC 1HINH 4UNTA 1MHPH 3BEWA 1TJGH 5AZEH 5LXGH 1S7RB 2EO1A 4O58L 4PJXF 5C0AD 2P5EB 1I8LA 2DI8A 2Q86A 1VFAB 4F33A 7FABH 2DMKA 4UBDD 3KPSE 3U7YL 2LU4A 5C0RL 5DS8B 4QTIL 4LVOC 3BP7A 2FWOB 3BISA 3BEVB 2A73B 2G5RA 1QRND 4B7IA 3THMH 4XP5L 4PJ7E 5JDSB 5JORB 4H25B 3RPIA 1R6VA 4ISVB 2WUCH 1MCEA 3ESVF 4JFFA 3V4PH 1A4KA 4OCNC 1KYOJ 3TCLB 1IFHH 1RUKL 1HYSC 4WV1A 1MRDH 3IDJB 4BELD 4M1DL 4QXTA 2CLVB 1A7QH 4HWNA 4LBEB 1FE8L 4GQPH 1BZQK 2V9QA 1JIBA 3QH3A 3S3JA 3SJVA 3JWOL 1NEUA 3CSBA 1A14L 1M05A 4TNVK 3DMMA 4S1DD 4WEMB 2VUOA 5F71A 3EO1B 2W59A 1F90H 4X8JB 3FTGB 5J57B 1T5XA 4N9GA 4LCUB 4CW1A 4HHAA 3VWKB 4HJGA 5IG7B 1LK2A 3BOVA 3NH7H 4JFDD 4CU8A 1KPRB 5I30L 5IB3B 2ZG2A 3QQNA 1LP9A 3VXNB 3VFVB 5I17B 3QIWC 1URLA 5GGSY 3P3YA 4I3GA 5EA0L 4H8WH 3MRGB 4I8DA 3OJMB 1FLTX 5FUCE 4MA8L 5D1XA 1T04B 4IOIB 4HV8B 2NW3B 1X5GA 2EIZA 4GUPB 4PD4J 1RIHH 1EFXA 3MRFA 5C0AB 3TBTB 1R3IH 3ULVF 1S9VB 4RRPA 1GJIA 5CLTA 3CX2A 2YN3A 2FL5B 4U1HA 3T77A 1IM3B 3GBNH 4PJ9D 1MJUH 1X4ZA 4MJ5B 1PDKA 4X4MA 2OL3A 2BCKA 1INDL 1FL6A 2Q76A 4HFWB 2UY7A 2DQUL 1Z9SA 5GRVK 4I9WD 5KG9A 3VFMB 3EOYG 4U7MA 2HT4C 1J1PL 2V5SA 4B7LA 1S78C 5I16A 2FJHA 4OF6A 4PGEA 4OD2B 3E3QC 2ZOKB 1ZGLA 5F7UA 5D72L 2ADGB 1F6LL 5IM7B 2IEPA 2HLFD 1NC2A 1FL3A 4PRDB 4X6EB 2VXSL 2VTFA 3EYOB 4PB9H 4GXUM 3PQYD 1BD2E 3JV4B 3QO0A 4FMFA 5FGSA 3K81A 5CINH 4EI5A 5HDBE 4P9HH 2XXCB 4OLEA 4XRCA 3FRUB 3GSOA 2LQRA 5T3XL 4ENEC 4FQQA 3RIFK 2MSPA 5TF1L 2GK2A 1WWAX 1YMMD 3KPSA 4PV8B 1ETZA 2GT9B 5CD3A 4I0PA 4JFDB 4KMTH 2CKBH 4PJ7A 2IFGA 4PJFE 3SDAD 4MNGE 1I8MB 4UQ3B 5HHNB 2A6JA 5HGBB 4LOUC 1XGQA 5IMKB 3CH1A 4CVUA 2NY2D 1JWSA 4IHOB 4LGPB 4NN5B 2DQDH 5E94B 5ADPH 5HYSB 5I1GL 3V79C 2A6DA 4KK5D 2ICES 1KJVA 1IQDB 4NC1E 4LPVA 2Y1VA 2F54E 4JJ5B 3C60D 5FHAL 4NKIH 3LRSA 5LAXA 3KLAB 5IT2L 5EOTB 3LD8C 5DQ9B 4OCWH 3CU7A 4GRWB 3IAPA 4GBXA 3RWDB 2AXGB 5D70H 4HKXB 3ZHLA 5C0FB 4XGZB 4WI2A 3DUSA 1MPAH 3X12B 2XRAH 1XF2B 5J1SC 2NR6C 1IGYA 1N59A 2OX5A 4AEEA 5B38G 5TF0A 43CAA 4E5XA 4WCYH 1KSRA 1EXUB 5FA3A 1OW0A 3H42L 4POZD 2WP3O 4HLJA 1TLKA 2NY6D 1A2YA 4HIEB 4N0FB 4MCYB 4Q97A 3VGAC 3PWJB 1GGYA 2J4WL 4BQ8A 3PDOA 4K8RL 2MTPA 4X4ZA 5JZ7D 5GPRA 4KI5E 3E6HB 1LEIA 4L29B 2VDPL 4XMPH 4RFNC 3NIDE 2P42B 1A6WH 4HPOL 3BVNB 4QXUL 4YUEL 5EZLA 3RWHA 5C9JB 1SMOA 4MXQD 4KDTA 3P0VL 4ODVH 5J6HA 1A7RH 3BO8A 4OCLC 1HCVA 3HNSH 4OCRH 3NN8A 5A16B 5EC1B 5C0CB 4DKDC 3IDMB 1U8KA 4FQLL 4OLXH 5D7SH 2GCYB 2W0FA 3SDAB 1I8KB 4FTVE 3BIBX 1N5AA 5GJTH 4FQJL 3HS0A 5DJ0B 1PLGH 1MCNA 1BVLA 3UJTH 1FG2B 3STLA 1KXVC 1A7NL 1J1XH 2YUWA 1JFQH 3TH3T 4ONOA 4R26H 3CFJB 4GG8A 1AO7D 1K4CA 3MCLL 3EYSH 2P24B 3CJJA 2RBLA 1MEXH 3DX7A 3C60B 3KYAA 4JO2H 1NEZG 4LCIL 5HPMA 4K7PH 5IESL 4XPAL 3E2HC 4JFPA 3FRPG 4H5SA 2Y7QA 4KROD 1SQ2N 1BGXH 1LHZA 3NFNB 5ID0A 1FO0A 3MREB 1AQDA 4Q9QL 5KANG 1QPPA 3GJFB 5GISH 3VXME 4N0CD 1IAII 3ROLB 4YDVA 3DVGB 3TWCL 4NZUL 2FSEB 4PJEE 5I76A 2CD0A 1ZKAA 3ECBB 3U2SB 5GXBB 2WSKA 1FJ1A 3KXFB 5JW4R 3GMLA 4PJFA 4MNGA 4X9BA 3GSQB 5LBSH 2BERA 2YUZA 1P6AB 1YN6B 2NY6B 2XZCH 2FIRT 1HHJB 4UT9L 4K3DL 5E8NA 2ID5A 1BEYL 1V7NH 2E6PA 4M6NL 1FFOB 4QGTA 5FEBA 3QUMH 4CAGA 4XP9H 1E27B 1RZIA 2F54A 1FRGH 3VFSB 2WV3A 2NX5D 2NY3C 4HLZG 5I18L 4I2XE 2V2WB 3ULSB 3G6AB 3LY6A 4KJPC 5TPWH 2VQ1B 5LGJA 1CBVH 3S4SB 4OD1H 3HR6A 2YSSA 3T4AA 1RIVH 5A2IH 4B41A 3MV9E 3NTCL 2AAVA 3EO0A 1F2QA 3V52L 3NA9H 1RZ7H 3MLUH 1BWMA 5FKAA 5DJCB 4JM2C 5ESQB 1YEHH 3P0YH 2P7TA 2FECI 3MA9L 1ZE3C 3VGFA 4E41D 3T1WA 2Y25A 1I7ZB 5C0EA 3HCVA 3F6LA 2CLRB 3L3JB 1OAKL 3ZTJG 2ZCLL 4G6JH 4KKLC 1AO7B 3VFTB 5FGBC 3C8DA 4QHMB 3F58H 1QBML 4EJ1C 1U8QA 3JTSA 4HS6A 4ODWB 3S36H 1QACA 1K8IB 1DE4B 3T0WA 3HG1E 3QWOB 4JDVA 1Q72H 1RUPH 4TSCH 1WITA 3W0WD 4GOSA 2HN7B 2YN5A 3OJDA 1RURL 3NCBB 3FMGL 4TRPL 1B3JA 4PY7A 3MODL 1UA6L 3O8XD 3DX6A 2HFTA 3BPOC 3IJYB 4DCQA 4HUKB 1I1AD 5IQ9A 2O5XL 5EO1B 3IXAA 3BE1L 5AYQA 2X42A 5E5UB 2A0LD 4P2OA 1WC7A 5EIVA 2OBGA 5HYQB 1BOYA 3TO4A 4FTVA 1OAQL 4OBSA 3GJEB 4HW6A 5DD6B 1HH9B 3MRIA 5ENWB 4W4OC 2XY1A 5IJKC 1EHXA 1K4DB 3S88H 1KBGL 1FZMA 3B9KA 1LD9B 4UDUA 1JTTA 1U93B 3L5IA 4H88H 3TVMD 1DLFH 4XCFL 8FABA 3FQRB 1T0NB 5EWIH 1SM3H 1IKNC 2EDLA 4LVNC 4W68A 5M7QA 1J18A 43C9A 5FYLL 1G7LA 3DGGB 4PFEA 3G6JB 3BT2L 1NJ9A 5JHDE 3BH9A 4JY4A 3VXMA 3CX5J 3CXHJ 3FCTB 4JLRB 1NGQL 3PP4H 4EUPB 1IAIM 5I74B 2H45A 4PJEA 5I8CB 2IPTH 2BVUA 4OLVH 3O2VH 3HMWH 5DK2B 4MA1C 5IHZB 4IRSD 1Q0XH 4LSSL 3ARVA 2G2RB 1PKQB 3DRQB 4M48L 3BH8B 3LCYA 3QCVL 1DVFB 5DRWA 4LSTH 3O6LL 4NBZB 1INQB 1TCMA 3WO4B 4UB0H 4HZLA 3MROA 3G5YA 1LGVA 4U1IA 4U1NB 2ICWA 2VDRL 4NQCD 4W81A 4ZPVA 4OT1H 5K59E 1EHAA 1UWGL 1DCLA 4LLUA 4WO4C 3MR9A 3MRDB 4O58H 5HY9B 5IB4B 4OF5A 4I2XA 1ZT1B 2PO6A 1TVBB 1IGTA 1CDCA 3RJQB 4M61B 1WZ1L 1U8IA 4KJWD 4U0QB 1MJJA 1CICA 1I1AB 4QTIH 4L1DA 4RMSA 1CDYA 3CC5B 3MV9A 3TN0C 2R9HC 3SE8L 5K9KA 4NO5A 4HUXA 1CGTA 5HI5D 3LV3B 1RUKH 1VACB 4ZG1A 1HSAA 3TBYA 4XBGA 1FSKB 1Q8MA 1U8MA 4M1DH 3TNNA 4ZXBD 3GSNH 4PP1D 3Q0HA 3TVMB 2R56L 2V6HA 1QVOA 5TJWK 3PDGA 2EC9U 3H9HB 4Y1AE 3HG1A 1Q9WA 3JWOH 4Q2ZB 4PRBA 4JHBA 4U1JB 5MHSD 1N5YL 3CVHA 3LKRB 4J2XA 5EO0B 1A14H 3F12A 3SY0A 1R0AL 1EX0A 5BS0E 3VH8G 5HDQH 1DQQA 4OZHB 4EDWH 1Q9KB 2BVOB 1I3RB 3NAAH 1GPOH 2UWEE 4QT5A 2EXWC 3D9AH 1MWAH 2WP3T 2IG2H 1MJ7L 1NDMA 4LSPL 5IB1B 5CJQL 3VI3F 3K8LA 4JZJC 1UYWL 3RVXC 1OLLA 1FVEA 1A1NA 3WDJA 3V4VL 3NCCB 1AGBB 2WWMC 5EA0H 3HMXL 2ERJC 3SO5A 3L9RA 5FKPA 4L4VB 3RWGB 3UPRB 3CFEA 5AWNL 1I1YB 4MA8H 1CDUA 2BNRE 3IF1A 1KIRB 2CKBB 6CGTA 4WHTB 1MCJA 2E7CA 3DMMC 3ZE2F 5EZOH 2BOCA 4Z76A 4YIQB 2FEEL 5CEZE 2YHGA 4K07A 1PSKH 3RA7L 1CT8A 3S34L 1E6OL 2DQEH 3QO1A 3A6CL 4ONFL 4QO1A 5INDA 3ARFC 3CK0L 2UZXB 5C0DB 5JHDA 3H0TA 3SN6N 1RJZB 1RV6X 1NLDL 1RU9L 2H26B 3V6ZA 3BAEL 1MFAL 4R3SB 5JPNA 3HZVB 3SOBL 3MNVA 3JTTA 4NZRL 1J1PH 4ZOCA 4MSWA 5IVNA 3IAQA 4RISL 5D1XC 2BRRH 2O61A 3L5XL 2Z8SA 4C57C 1A6ZB 2RGSA 2X4QB 4ZXBB 4YNYA 3CFCL 5DMGC 1YY9D 1KN2H 1VKXA 3CSPA 1QBLL 2VAJA 1PY9A 2VXSH 2DYPD 1JZ4A 5INCB 1TZHA 2Z0BA 3DSFL 2VO5A 3QJFB 1OP3H 2YRZA 2VZUA 5T3XH 1UCBL 2EEAA 3Q5TA 5D1QD 4HDIB 3VJ6B 4F7TA 1AKJA 2GTZA 2R1XA 4JO4L 1LWRA 5ERWB 4XC1L 1C12B 3L5JA 4KRLB 4W6YB 2BSSA 2VR4A 1EHNA 1H3XA 4N0YL 4HKBB 4G9FE 4Y5VA 5ID1A 4PG9B 5C8JA 3O11A 4NFBA 1EVUA 3OR6B 4RSVA 3AAZA 2VR5A 5I1GH 2APTA 4JHAL 1SYSB 1DFBL 3DO7A 1YJDC 2BHZA 1WFTA 1JVKA 2IPUK 3L3DB 2BXYA 4EI5C 1AD9A 4N0UB 5FHAH 2YRLA 1QFWH 4AM0A 5DR5L 3VXRB 5IT2H 4Y1AA 3BZDA 4TOYL 3T04D 5L7XH 4PGCB 2HJLA 5IEKA 4GBXD 3IU3B 1HI6B 1CWVA 5L2KD 4I0PC 5BS0A 1N7ML 3SCMC 5GS3A 3T0EB 1XF5B 1KPUA 3QI9C 2GJJA 4NNYB 4ODXA 1DUYA 4I4WB 4PS4L 4KTYA 1IKFH 3PWNB 3I02B 3M8OL 3DV6B 3VFNA 3AS2A 3QZWA 3SE9H 2XA8H 4QWWC 3U30C 1KEMH 4I77H 1NCCL 1X44A 5DO2C 1ACYL 1FVDB 5DJ8B 2Y36L 3EYQC 1XGRB 2CIKA 3C2AL 5J1AB 4JY5H 4RRPG 3T2OA 2IH3B 4K8RH 3NCYP 1QR4A 2G5BA 1NANH 2HKFH 4NZJA 4LHUA 3CDYA 2BNRA 2DYPB 3TGXA 1S7SA 3MLXH 5IMOB 2VDPH 4ODUB 5HYEA 3C6LA 2V5YA 5T5FL 4LF3A 3D85D 1U0QA 4OAWA 4X6CB 1RJYA 5D1QB 1KGCD 3P0VH 1LO4L 1P1ZA 3E6FB 1T66C 1ZHKA 3Q3GB 1I7RA 2AJXL 4MJIE 3QUMB 4KRPD 1OW0C 4PTUB 1U95B 3ZHDA 1E4WL 1QEWB 4TVPH 5I2IB 1TQCB 2XQYK 5IHUL 2QR0B 2CXKA 1SEBA 1EJ6A 2NYYC 3QIUB 3JWDC 2IBZY 3PWVA 4R4BB 3WDHA 3IDIA 5FUCC 1A7NH 3MBED 2E9WA 4OCSH 3MYJB 4J3XA 3MCLH 4FP8H 3D2UA 3L95B 2PETA 2E7LC 1FZJB 4QRPB 1CFTB 1NQBA 3U4BL 4R8WL 3V5HB 2OP4L 1CIDA 5J6GB 3MACL 5IF0A 3WSQL 2AERT 3V6FB 1OP5K 5L2KB 3C5JA 4Q9QH 1FNAA 4JPIB 2YS4A 4CVZB 3LPWA 5FECB 2X10A 1E4KA 3TWCH 4FZEL 5ISZE 3UTPD 2VLMD 3X13A 1IC4L 3BGFB 3P73B 3RWFB 5CJBA 4ACPA 1CDGA 4P2RB 5L8JB 1HEZB 4LIQE 1WV7T 5F3HA 1DBML 3C8HA 4G9FA 2B4CC 3GMMB 5KSVB 4FXKB 3RGVC 3TPUA 3OB8A 1AFVL 4K3DH 4MYWB 3IDXL 1D5BA 3TESA 1BEYH 2L7JA 3WLBA 2PW2B 4M6NH 1MRCL 4H1LB 1Y0LB 5EU3B 3B9DA 1I7TB 1T4KA 1XR8B 4E0RB 5HHVH 3DURA 2GITB 2VJXA 5CJOL 3QWRD 1H5BA 5DZNA 4JQXA 5D5MF 1U3HA 5I18H 3TYGL 1ZHNA 4EBQH 5I1EL 4PJ8B 2XIDA 1DSFL 5D7KD 3MOAL 1KC5L 4OLYL 3D48R 5DGRA 4NOFA 2HFFB 1FNEB 4P5TD 3UJJL 4XXDB 1RZ8A 3VXUE 4HG4J 3E8UH 3NTCH 4KRPB 2J8HA 4NRXB 3V52H 4M7ZC 3O3DB 2Q7YB 3O4LD 1OQXA 3FT4A 1P2CB 3QUYC 1ZSDB 3EJYC 4O2FA 4X5WA 1BJ8A 4IJ3B 1S7TA 1A0QL 3L7EB 2HLAA 4BZ1H 5EU7C 1WSST 4C55A 5CLWA 1JGEA 4NC1C 5L88H 3G5VA 4NN7C 3Q2CA 4RIRA 3IFLL 1KJ2A 1QBMH 2C3XA 2MOVA 3ARXA 2OTPA 1U8OA 4P2QE 1CGSL 4PJIB 2YUVA 3INUH 3DI3B 4FQ2L 1RURH 1NKRA 3FMGH 4TRPH 5J3HC 4P3DA 1UA6H 2A6KB 4TUKH 1N8ZA 4PRNA 3ZKXC 4FFWD 2C1OB 5D7LD 2QQQA 5EOCL 4MJIA 3BE1H 4DGIH 3PGDA 1JRHI 5MP6L 4J7RA 1VGKA 3H9SD 1MREH 1P4LB 4P4KA 4P9ML 4FTVD 1OAQH 4NO0D 3T65A 2VL5B 3KS0H 3ILPA 2VERN 1FV1B 3GMOB 3L3HB 3LVEA 5I9QB 2OL3L 2IALB 3HE6D 1NCNA 3KYKL 2X70A 3L3IB 4X7TA 4MQXD 5JLZA 2H2SC 5GGQL 4KI5C 2OCFD 3SGDH 1P5VA 3T3ME 4FRWA 3RP1A 1BX2A 3GKWH 2Q6WB 1GOHA 3DROB 4J12A 5D8JL 3P77B 5F6IB 3AREB 4LARL 3L3GB 5FYLH 3MFFA 2ATKA 4KKCC 4O51A 2V5TA 3SO3B 3LIZH 3VXSE 4BQBA 1R3KA 4G6ML 3A6BH 1OOAA 4N90E 1YJDL 3GSNB 3B4NA 3VXMD 4ZO8A 3CVIL 1NGQH 4NPYB 5EBWB 5ISZA 3TO4C 4KAQH 2D31A 2J5LC 3P4OB 2K7PA 3RBGA 3FFCB 2X9XA 4M7LT 4LP5A 3NIGF 4L9LB 3QCVH 1T7WA 3Q6GL 3TPKA 5HVFB 3B9KC 2I9TA 3GMQB 5ICXA 5C86A 1JPSL 4RX4A 4JG1L 1KG0A 5EZIL 3MJGX 4D0CB 3GK8H 4D0DA 2R2BB 5K9QG 2HMID 1UWGH 5JUEL 2GFBB 2E27L 1MWAB 3S8WA 5F9WC 3T2PA 1KN4L 5CCKH 4R0LA 4UU9A 3O45B 2XZAH 5DD0L 2X4TA 4OCYL 2E6JA 4U7SA 5DRXA 5HYIA 5DVMA 4HJJH 1MHHB 1AJ7H 1DLHB 5IVXE 5D7LB 2I07B 4ORGB 3MLYL 3VXUA 5C3TA 2Z31A 5GGTL 3VXPA 5JW4N 3IFNL 3H9SB 1CL7L 1EO8H 2A2QT 1GC1L 5DT1H 4X6BA 4OSUL 2E9JA 2NQCA 2XNAB 4HLZH 3KDMB 1ED3B 1OARH 3K2UL 4X9FA 1ZV5A 2DWDA 2V2TB 4V1DD 4G5ZL 4NO3A 1BFTA 1PW3A 1I4FA 5FUOH 2R56H 4LSQH 3ORJA 1MQKL 1D9KB 2UZIL 4KQ4L 1KLUA 1T89A 2PO6C 1CG9A 2H3NA 4HIIA 4P2QA 1LDPH 5DJ6A 3DYOA 1N5YH 4XNXH 5F1IB 3JWDL 5CHNB 5GSVB 5FDWA 1LEKA 1CICC 4L3CA 1QLRB 3BKML 2Y4SA 1OTUD 1XGTB 3U0PA 4NKMB 1S9XA 1IC7L 3ZTJH 2ZKHL 4LLMA 1NCWH 2SEBB 1IGFL 4PJAF 1YEDB 2DBLH 3ZT5A 2J88L 4LSPH 1M4KA 5CJQH 4I0CC 5TE4L 4XHJC 1UYWH 3X14A 5BOPA 1HQ4A 4LDOB 3F7VA 4R97C 3HMXH 3PDDA 1KT2A 2ZCKL 3BW9A 3CFKB 3WUWA 2CDFB 5HHPB 4MAYD 5AWNH 4XMKH 2WINA 5B8CA 3LHPL 4GKOA 3HRZB 5EBLB 4P2YA 1CGXA 2D7TH 2OI9C 2B4CL 5GGUB 3V5DB 1DBJH 1EZVY 3S34H 3VXSA 4X4YA 3U0WH 3A6CH 4E42A 1NFIB 4KK9D 4LCCC 3QUKB 4N8CL 1QLFA 5EU4B 3RL1B 5CGYC 5KS9F 5IKCB 1NLDH 1RU9H 1Y18A 2VISB 2Q87A 1FO0L 4H0IA 1FGNL 3BAEH 3BIKB 5LWYH 1EGJA 1MFAH 4GSDH 3ULVE 5F7KC 1O0VA 4NZRH 4DZBB 1HYSD 4I48B 1CDIA 3X3FH 5I1CL 3DVNB 2EXYD 2QHLA 2AK4D 5K9OB 1KTLB 2Y06L 2NXYD 4O2EB 5C2BL 4V1DB 5FA4A 3IETB 3N85L 3CFCH 1YYLL 3C08L 3PABB 5JO5B 1EO7A 3RTQD 4WWKB 5E9DB 3DSFH 3JV6A 4JZOA 4MQTB 3DRTA 1EMTL 1V8HA 1DL7L 5I8OL 2YPLB 4YFEA 5KJRL 1BFOA 2VDNL 2R1YA 4JM4H 5B4MC 5C9KA 2IBBA 4MCZB 4HC1H 4JO4H 4M4RA 2VN7A 3G5XB 2D4DA 1C1EL 4F58H 3VFWB 25C8L 1MHCA 4PRAA 3GB7B 3TP4A 3RWEA 3KPRD 4CVXA 5CWSA 3A67L 3V8OA 4RFOL 4M7JH 5FYJE 1JHKH 1JPGB 2WBJB 1P7KA 3V4UL 3X3GH 4MAYB 1DFBH 1MFEL 3LDBB 3NFPA 2EDYA 2VN4A 1ZGLP 3TJHD 5DD1L 2X4OA 5ACLA 4OI8A 4GMSL 3B2UC 1IEAB 5HDLA 4QHUA 3WNOA 4TOYH 1D5XB 3MCKB 3ZL4H 1JZ3A 3QXTA 4OQTA 5HGGS 3W82A 1R24A 3E1F1 3FO1A 4LVOB 3MOBH 2CUMA 2UV3A 4F8QA 2JKXA 3VWJA 1NH6A 4ZFFA 3QSKB 4UIMA 4Y5VC 1OAUL 2GAZB 1F4WL 3ZE1E 1MCCA 3LMJH 2VE6B 5ACMA 1OAZH 2R1WA 3M8OH 2VKWA 1CR9L 2DQHL 3TA3C 1FZOA 2P44B 1A1MA 3RNKA 2DQTH 5EU5A 4Y4KA 1T21B 5F1NB 1AGFB 1JMZA 2NXYB 3BP4A 3MXVL 3F7RA 3C2AH 1KPVB 3IFOB 5GRJH 4TUOB 32C2A 3LKPA 4ZSOB 5J06A 5IMLB 1KNOB 4XCYA 1CFQA 2OXHA 4O2CA 5CIPH 5GRXG 4MD0B 2RB8A 3NCEB 3B5TA 2AJ3B 4RWYH 2FYYB 3MV01 4ENED 3GM8A 1IL1B 1AY1L 2XA3A 4GJTB 3BYYA 1NKOA 4YXKL 3DV4A 4OM0H 2BY2A 2AJXH 1ZVSA 1DUZA 2RJMA 3CLFH 4J3WA 4QCIA 1OPGH 2XPGA 3ROOA 4LRIA 1IAMA 4PLOB 2X40A 1AGCB 4IM8A 1X7QA 1F2XK 3HNTL 4HF5H 3QULB 2HG5B 1GVIA 2BDNL 3QIWB 5IHUH 4GKSB 3RQ3A 4J6RL 4WHCA 2WK2A 5ANME 1NGWA 3KNBA 5I1DA 1S5HB 5HI3C 1YZZA 3WKMH 1WTLA 1BREA 3GFUA 5CJ8A 4NCC2 2AV1A 1MOEA 4OTXL 2YPVH 5GS1B 5MEQA 4LHJB 1JUFA 2WANA 3EDKA 4U1LA 4R8WH 2OP4H 1JPFA 4Q0XH 3MGTA 4IRJD 4NM4H 5TDPA 4C58B 4RMRA 2VDOH 4NNPL 6FABL 5E8PA 5D96C 3IFPA 4WUKL 4U0RC 1FNLA 2FX9L 1JP5A 3KLHC 4MMXC 1VERA 3OPZL 1I8IB 4XAKD 3A0OA 4GRWF 4G9FD 5B38B 4X98A 2X4PA 4ZPTA 1CF8H 4UOW0 5E6YA 5GZNC 4OKVB 1HZHH 4LKCB 4QHNA 3IDXH 2H32B 1IC5L 4ZOAA 3Q5OA 4OIIH 1G7PA 1EAPB 1XGUA 2J8UF 1G7IB 2BJMH 4NQSB 5CBEA 3RY6A 2HAZA 1NBQA 1VDGA 5H37G 3S97C 5I1EH 3JV5A 1DSFH 2H9GB 1E4KC 3ARBC 3P4MB 4WI4A 3VG0H 3U7WL 4OLYH 3ARQA 1TCRA 4NUGL 5E95B 2YEZB 3UJJH 1MHEB 3EJZD 4LPXA 3CVHL 5CMAA 4ZQKB 3BGMA 5D9SA 2D2OA 2A1WH 4ZYKA 5JQHC 2MWCA 4ZO9A 5HPOA 2UYLB 2XTJE 3K8KA 4LHUG 2IADA 2EDKA 5JXEA 1A0QH 1ORSB 5EPMA 1U92A 4LAJH 2I9LB 1GAFL 1N6VA 4HT1H 1CXIA 3OL2A 3M17B 2EZ0C 1HQRB 3QUZA 3MLTA 1ES0A 4K3JL 1MCHA 4OV5A 1PEZA 1H5BC 1IILE 4LLDA 3S96B 4JQXC 1UEYA 1BBJA 2C5DC 3LD8B 2ESVD 5DQJB 1UQSB 2BP3A 1E6JL 4BKLB 4DZ8B 3VGDA 2ADJB 3NCJL 4LSRH 1BQLL 3T0DA 1EK3A 1Q1JL 4I1NB 1S9WB 4C56D 2AABL 4XPBL 3VMNA 1OD9A 4HJ0D 5EOCH 1RVFH 2JB5H 4TNWF 5E8OB 2FIKB 4JCLA 1W0VA 4P4KD 4P9MH 5GSRB 3B6SA 2WQRA 4YBHA 2NNAB 2EEBA 3BN9C 3FFDA 1OTSD 1AP2A 2EYTB 3K1KC 5ANMA 4AEHL 2YMXL 2R4RH 2Y5TA 3VGAB 5GS0C 5GGQH 4BSWB 3HR5A 4JN1H 1ZA3B 2WLYA 4LQ1A 1F3DH 1WBXB 5EFIA 3EFFB 4K71C 1U91B 4KUZL 4RFNB 2OZ4A 1OGTA 4D9RD 1KTRL 5JQ6L 3SKUD 1SJEB 4XNZC 4D94A 3I6GB 3RY5A 4APQA 3VFPB 4OFDA 4G6MH 3QWQB 1S3KL 5ITBL 1DBBL 1A7BA 2VB5A 1YJDH 4CDHA 1SY6H 1YEJL 2ADIB 2XN9D 4GH7B 2E8ZA 4X4XB 3U4EA 3ZKNC 2Q7NA 2BX5A 2VOTA 3GSXB 4YHIB 4LNRB 3PWPE 4B50A 4CUCA 4PLKC 4ZFOA 5BO1L 3T4YB 1JF1A 4HWBA 4YHPA 12E8H 5KVEH 4JG1H 4NQED 4X0KB 5DFVD 1P9MA 2EC8A 1KLGB 3RWIB 4QRSA 1NGYA 5TQ0L 1DDHA 1T2QH 4GRMB 3WEXB 4XPFH 1KN4H 3E2HB 5KN5B 1FVCA 3TNMB 5BXFA 1C5CH 5IUSA 1WCBB 4LPUA 3FB7B 2QQKL 4OCYH 1QR1B 5FYJU 1XZ0B 1N6UA 3GSVB 1OAYH 4IIQA 3I9GH 2VXQL 5GIRB 4LHQB 3QDGB 5AYUL 2HKHH 4OIBA 3WL9A 2ATPB 2LVEA 4HUVB 3BXNA 5KAQF 3O6FA 5DDHB 3O4OB 4WW2A 1K8DB 1K2DA 3MRBA 3O9WA 3K2UH 2FDBP 4R0LC 3U4AA 4Z7UE 4NO2B 4XVSL 4KTDL 2UZIH 4KQ4H 3I3EA 1WQVT 2NY3B 2L4OA 2CO7B 2CO6B 4NUJA 4P4RB 4Z9KB 1NAMA 2YXMA 3JWDH 1OB1B 3PL6A 4EN3A 1OF2A 1X5JA 5F89A 5DRZA 3UC0H 2DM3A 3LZFL 2Z31C 3BPCB 5E6IA 3WFEH 1IC7H 3DYPA 1FC1A 2DQIH 1BFVH 1CK0L 2XN9B 3WIIH 4MXVF 4X6DE 4G7VL 5DJXA 1FHGA 1KB9K 3CLEH 1ODAA 5CEZL 1PY4A 2BNUA 4GW1B 1NCAH 2J88H 5DQDL 3FL7A 3C5ZA 5CSZB 3G6JF 4M1GH 1FZKB 4WDIA 1SJXA 3OAZH 1KCSH 2AJZB 5SV4A 2ZCKH 1QNZL 4PJBE 3MRQB 2VLKD 3OXRB 1T89C 5TH2A 3DX8B 1S9YB 3QISA 3VI3E 4NRZA 1G0DA 1ADQA 3MLRL 1DQTA 1AI1H 2XG4A 2B4CH 2VLRD 4ODHL 2EDTA 4ZUSB 1HH6A 2O93L 5J89A 2YWZA 4U1SB 5DEGB 1M7DB 2ZJSH 1CS6A 2NY0C 5D1ZA 3U1SH 3LKOB 1JWMA 1C5DB 3PGFL 2YC1A 4AMKL 2CRZA 3ULUE 5KSBB 4N90D 3MJ7A 4N8CH 1NCTA 2ITCA 4QRRB 3LSOA 3RDTC 2VDKL 3WN5A 3HNVL 2B5IC 3OKOA 2FEDD 2P8LB 3PWPA 1KENL 4NJAH 4XAWH 5FO9A 4OZFA 4GAGH 5FO7B 3MRRB 1IM9D 1P7QA 3HI5H 3UTSB 3OAYK 3QDHA 5I1CH 1JK8A 5D71L 5HBBA 2O5YL 1JJUA 2Y06H 4HIXH 2W1NA 4JVUA 3SKOA 1D6EB 3CIQA 4PRPD 5B8CC 3N85H 5F9JA 3IVKB 1YYLH 4JFEB 3QXAA 4UTBH 3F7PC 3FO9B 3TBSA 3KWWA 4J3OC 4LVNB 4YPGA 5EUKA 4YQXL 1N64L 4OUUA 5E1AA 3UBXG 5J7CC 1DL7H 5I8OH 1IGJB 1G6RH 4HQQL 5ETUB 3VRLF 2VDNH 1W2KT 5SX5K 4PJHE 1FLRL 1WIOA 5F7NC 5DWUL 3SKNA 3WFDH 1BQHA 4DFIA 2VL4A 3VH8B 1T80A 4BQCA 1C1EH 1UH3A 2GY5A 4S1SH 4MA1B 2H2PD 4ONGL 1RJLA 5CIPB 2EIBA 4D9LL 3CSYA 3QAZC 4XP6L 1CD1B 2ED9A 3HZMB 2WIIA 3P9MA 3EYVA 1FGVH 2FATH 2E7MA 3KYMB 1RZFL 2KL6A 1J05B 1GHFH 4WW1A 4CNIA 3LRHA 2VZVA 4OZHF 1RHHA 3TJEL 5C6TL 4OZIB 1OT2A 2W60B 2X2YA 4JY6B 4Z7UA 4J1UB 1S8DA 4ONHB 1FNSH 3ZLQC 4NT6B 1XCQA 4MLIA 4IMKC 1LILA 1IEHA 3S3SA 3VE0B 4NBYB 3U46B 4R6UA 1E0OB 4FOMA 1KCUL 1KJ2L 5GS0L 2K9UA 4MJ6B 4C83B 1LK3L 1CLYL 3O3EB 4GRLD 2MPAL 3TN0B 4X6DA 3WUWG 4PP2A 5DLMH 4BFBD 4QY8B 2VZTA 1K5NB 1QBBA 5F1OB 4PRPB 2HTLC 4PJBA 3NIFF 5MI0C 1MCWW 2R0WL 5F9OL 4RFEA 2Q86B 4HXBL 3N0PB 4FFVC 4HMEA 2HVJA 3VRIA 2ILLA 2A74B 4OLWH 2NZ9C 3F65A 3ZDYE 3FONA 1BVZA 4PGBA 1OTTC 1W0YT 3VWJC 5AD0A 5FFLA 4F80A 1SHMA 1FN4A 1NCDL 4XT1C 4F9LC 3LQZB 4M62L 4JFFB 5C09B 3QEUB 2XG5A 5IP4A 5DUPL 2ZUVA 1QBAA 3KPQA 4OF8A 5JW4M 2VLJA 3OKDA 4Y4KC 4S11A 4Q74A 4JZJB 3O6KH 2BDNH 4LKXB 4UT6L 1IMHC 2FO4B 3KYNA 1KEGH 5J4MA 4QXTB 4J6RH 2R23B 4ZFZA 2CJUL 2IAMA 3QHZL 2HT3D 3BDXA 3D0VA 4F3FA 4I13B 5DC9B 3QH3B 3VDBA 5IW6A 1D5MA 4LIQL 1UZ8B 1B88A 4OTXH 1CD0A 3BDYL 3FB6A 4DQOL 5FO8A 1RFDH 5T1DL 3GSRA 4JFOB 5ALBL 4ZDHB 2CDGB 1KJMB 3CDFA 4HJGB 1R5WB 3ARFB 3GI8L 1RUML 5C07D 4PJHA 3BP5A 3QI9D 2D7MA 3HPLB 4WUKH 3D1MC 4RGND 3UAJC 2VKXA 3R4DA 1EEYA 1H8NA 3DOSA 4F37K 5ESAA 1KCVH 1I7UA 3OPZH 3V9FA 1W72B 1UM4H 1X4YA 3HE7D 5E2TH 4KZEL 1LO0L 1A6TA 4WNQB 1YDPA 2PCPB 4WFEE 4HKJA 3TBWA 5D1XB 1OP9A 3MZTA 1I3GL 2HJFB 2CR3A 1WGOA 1IC5H 4YGVB 4LCYB 1YUHA 3MRFB 4L8BB 2KQMA 1PD6A 1LE9A 3D3VD 2OM5A 2YXFA 4PBWD 3PV7A 1JNHA 3KJ4C 5A1AA 3X11B 3MZGB 3IT8D 1PKOA 1UG9A 2MMXA 5A2KH 4RA3A 3N1MC 1O5DT 3MUGA 1J86A 2WLZA 2BCKB 5ICZA 5FOBA 4M8QB 4MHHI 1B6UA 4NUGH 1NC4D 3MRHB 4Y16A 2JB6A 3CVHH 1A5FL 4LLQB 5SWSE 5L2JB 1X5IA 1T22A 2DQGL 5KVDL 5HHMD 5IB2B 2F53D 4WIQA 3DX9B 4PREB 2VWEE 1R3JB 4X6CF 1WUNT 1FL3B 4M7KL 1LVEA 5EZJA 5IB5B 1OLZA 4FQXD 4QGYA 4Y5YA 1NMCC 4JPWL 4YZFF 1UB5B 4LPTA 4PRHD 5FXCH 3N50A 3O2WL 4WTWA 3RY6C 1ZMYA 3TC9A 5HYJE 3QUXC 4FQQB 3T8XA 3VCLA 1QFWI 1T1WB 3NCJH 4GS7B 5D2NE 2C26A 1QSEB 4Z0XA 1YEEL 5F1SA 1BQLH 3D39D 2ZSWA 2W07A 2H6PA 3SCMB 3MX0A 4PJ7B 4U6VL 2QHRL 3QI9B 5E0QA 2R0KH 4G6KL 1G7MB 3W11D 3DO3A 4RGNB 4KK8C 3HI1B 2DM4A 2VXUL 5T1MB 1XGQB 2MJWA 3RVUC 1A47A 4OZ4A 1BIIA 5JXEC 1DEEB 3QG6B 3U30B 1HILB 3QUZC 2YMXH 4GAJL 2FGWL 3PUCA 3VXOA 3LRSB 2CH8A 2DQFB 4AH2B 4CADB 1EGJL 1EH9A 2NY4C 2W9DL 2YD1A 4F9PA 1G7HA 3D3VB 4KH2A 4ZOEA 1OSZA 1BM3L 2IFFL 3FOMA 4BH7B 4KUZH 2PUQT 3B83A 4WWID 4ZS6D 4U6HB 1S7VB 4ZNEE 5JQ6H 2HTKD 3RZCD 4YFLI 3VDCA 3MLWL 1R5VA 5HHXL 3EHBC 3EW3B 1IGYB 1HHGA 1MLBA 4KY1L 4P57A 4AT6A 1A1OB 1NC4B 2HP4A 1ZLUH 4RBPK 2R2EA 43CAB 4E5XB 4NHUB 4JDZA 1MLCB 4XH2A 1GGCH 5EU6D 5FCUL 4EKXA 1AIFB 2ITDA 5HHOE 1J8HD 4M4PA 3P9WB 4RAUA 1A2YB 4DGVL 3RVWD 1VFBA 1YPZE 4F57L 4XPGL 5BO1H 3PDOB 4JFQB 1Z2KA 2YK1L 1VEOA 1B90A 2IMNA 2JCCE 4JB9L 1LEIB 3HFML 3SDDC 4L8SB 4O4YL 2Y5EA 2B7DT 4U7KA 1T1XA 1MI5D 3IYLW 4PRHB 1H3GA 2AXHA 3CSGA 3MLZH 2J1KA 4NQUA 3ZT7A 4LPYA 4NKOA 4WGWB 3NIGE 2P48B 1RMFH 5DVLA 1JNLL 3MUHL 4APQC 3I75A 4KDVA 3I6LE 3TZVD 3WHXB 1UZ6E 3BQUA 3WD5H 3D39B 1IAIH 3PWUA 4YHNA 1U8KB 1YEIH 4NQDB 1AGEA 2AEPL 3LS5L 4FQHB 4ALAL 2YD5A 5AYUH 1KLFA 4MS8D 4UMGA 2X05A 4OQTL 4PJIF 3F7YB 2Q3AA 5SWSA 4K2UH 4LLVB 3GUTB 3RGVB 1K4CB 1U8HB 1W0WB 4ZS7L 1P9MC 4S2SA 3DX7B 1ZANH 2CXGA 3UZQA 2H1PL 5H37H 1BD2B 4JFZL 2VRAA 4JFPB 3ZDXF 5KSAC 4UOJA 5T33L 2Y7QB 1WBZA 4H0GA 4KTDH 3HB3D 5C0BD 2I60L 1HXMB 3JWNC 15C8H 4IDLA 4FN0A 5HYJA 1AQDB 2IGFH 2ZPKH 4JRYD 4OV6F 3ALWA 4ZUVA 2F58L 4Y8DC 3ZKSD 4KKCD 2N7AA 1BLNB 4YDVB 5D2NA 5I76B 4XPHL 1SBSH 1UB6A 3RNQA