4MDAA

Structure of mos1 transposase catalytic domain and raltegravir with mn
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
225
structure length
200
Chain Sequence
PHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFVKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Mos1 Transposase Inhibition by the Anti-retroviral Drug Raltegravir.
pubmed doi rcsb
source organism Drosophila mauritiana
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Mariner Mos1 transposase
total genus 75
structure length 200
sequence length 225
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01359 Transposase_1 Transposase (partial DDE domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4mdaA00
3K9JA 3HOSA 2F7TA 3HOTA 3F2KA 3K9KA 4MDAA 4MDBA 4U7BA 4R79A 5HOOA 5CR4A
chains in the Genus database with same CATH superfamily
3G71N 3NGIA 2NRZA 3RMBA 4FW1A 3QO9A 5AQTA 3I0SA 3NBPA 3TSUA 3GDQA 1I94K 1DEJA 3NMUA 1JL2A 4CK3A 5BR8K 2X74A 3HOTA 3AAPA 2E1ZA 2OPSA 2YNIA 3F73A 3CCMN 3CIPA 3DOKA 5KQ8A 4CJ4A 5LMUK 4WCEL 2WBNA 1S6PA 2A5XA 4FJNA 4ISGA 2HF3A 4DSJA 2JLEA 3FZHA 1E4FT 1RTJA 2ZF5O 5AZJA 3CFOA 1YIJN 3KK7A 3LANA 3CD6N 2A3ZA 3DI6A 2D5RA 5EU7A 2OA8A 3SLCA 4CGFA 2HHQA 1QZ5A 2G8KA 4FVUA 3T1HK 1FK9A 4LY7A 4YY3K 1D9FA 4M3ZA 4O4GA 3T1YK 2I7PA 1C0FA 5AQKA 3WXIA 4CHOA 1RDAA 3LZJA 5JVHL 4Y0WA 3U6FA 4F8RA 4JI2K 3KLFA 3C7NB 2E1YA 4DV4K 3VTIA 3Q7CA 1VSKA 3L3UA 4O55A 5KRSA 5E41A 2YHWA 3WXKA 4BDZA 2E20A 2E8AA 1MU2A 2DTUA 4FJLA 3M8RA 1J53A 4RW6A 2HHUA 4FWSA 4OPJA 2WTUA 2JWKA 4I6MB 4GV3A 3CFPA 2FXUA 4DSLA 3TAGA 1ZC6A 2XY5A 4YDUA 3F9MA 4DHYA 3TARA 2OTJN 4CFCA 4JI6K 4FJ9A 3MCPA 4FM0A 5K14A 1LCUA 4E7JA 4BRNA 3KJVA 2X6SA 1NGHA 2OCEA 3S3OA 4DV2K 3CM5A 5C2DA 4CEDA 1KTQA 3ZEUB 1EO1A 3SBGA 3U9ZA 4CEEA 4W5NA 1LWCA 1SKWA 2W6KA 3OYFA 2QWQA 2R7YA 5AZJB 2ZJPL 3KD5E 3MN7A 1WUAA 2YCHA 4JI0K 3E9LA 3ZSXA 1JLAA 3B6OA 3ZLJA 5BN8A 4OLAA 4CJEA 2FF3B 4FW2A 3OYJA 3OYCA 4CJVA 4IJNA 4M3RA 4NXMK 3CMAN 1S9EA 5HOOA 3VQQA 2Z1GA 2FSNA 4DSIA 3AVAA 1XMQK 5MLCQ 3ZCMA 3VEYA 5HRRA 4KV8A 4B1UB 1C0MA 4BY9C 3NF8A 4MDAA 4QS9A 4WE1A 4MDBA 2W41A 3SAFA 5C42A 3H46O 1TKTA 1NGAA 3O9TA 4U67L 3D2EA 4CIGA 4FLWA 2VG7A 3MXIA 3O4QA 4C8OA 3KTQA 4LSLA 1H1VA 1L3SA 4H4OA 4EZ6A 1O1WA 3D6RA 1WSHA 4R79A 4N76A 1S1TA 4DFJA 5CZ2A 2O8CA 2WONA 3NCIA 1C0UA 1MWMA 4M41A 4AHVA 3TSQA 3D45A 2KZZA 3VF2A 2QEXN 1P90A 3QERA 4IXCA 2NRXA 3ISNC 3HI0A 1K8KB 4X64K 4F4KA 3SUOA 4Q0BA 4CJSA 3CHWA 4DR4K 3OYHA 2QI2A 3AVIA 4CGIA 3J81O 4PY5A 3MXJA 2KLAA 3HBTA 4JLHA 3ZSRA 2EHGA 3TI0A 3NH1A 4JKGB 4A57A 1C0GA 2RPIA 4FPAA 1BQNA 4NCGA 4YOUA 4LFCK 4RTFD 4FWQA 4H0TB 4ICLA 1RT2A 2Q0UA 5GAEP 3TANA 4FLXA 4JRPA 4M63C 2W42A 3AO5A 5J2MA 3HXMA 3ATUA 3PX0A 2UUCK 3LDLA 5FLXO 2KFZA 3L3VA 1BGXT 3KWGA 5FPNA 5FDLA 3DXMA 2HB5A 2W40A 4BC4A 3SAHA 3KLEA 2JWLA 1L5UA 2NRVA 2PYJA 5AQFA 3L2WA 3PIPL 2RF2A 3E01A 2Z1HA 4JKBA 3G0ZA 3T1AA 4B9SA 4CJ3A 3SV3A 2WFBA 3EEQA 3OYBA 3D2EB 4E7KA 3MEEA 5AQUA 3GE1A 1NK4A 3WT0A 5H1SQ 1S1UA 1K73O 1HKCA 4CEOA 4C8LA 4FJKA 2OANA 3CI5A 1ZBHA 2PFUA 4FOIA 2XHBA 4DQ8A 2KHOA 4BR4A 2Q2RA 2B5JA 4E7IA 4DB3A 4MO4A 5AQYA 3U9DA 4JK7A 3V9WA 5ELZA 3U8XA 4CHPA 5C2FA 4NYFA 1KD1O 4CJTA 2O8FA 4M7XA 3F9KA 4IOCL 4EZ9A 4KFBA 2P9NA 5FPMA 4HCCA 3QLHA 3JYTA 5KGXA 4CVNE 3AA2A 1D4XA 3LPTA 3C95A 2D0BA 2GV9A 4B1WB 2VCPA 1JLEA 4NCBA 4CW7B 2HOEA 2DFEA 3I56N 4NXNK 4DTSA 1TK0A 4C1NI 2P51A 3WXMB 4CERA 4DQQA 3CPEA 3VESA 3ULDA 4L8RB 4FK4A 4BR5A 1X3NA 5E26A 3HYFA 4KREA 2I5JA 3EKSA 5KPZA 2YHYA 3LDQA 4B9QA 5JMVA 3S3NA 3NE6A 5J2QA 4IEEA 5CHIA 4DTUA 4K41A 3ID8A 1TYQA 5CYQA 1T7PA 3ZX0A 1TKDA 3AVFA 3CQXA 3MWTA 4BWMA 1U48A 1XQSC 4A2AA 5DM7L 1NOYA 2F4VK 1LW0A 4LH5A 3VQCA 4O0JA 3CJBA 4Z0UA 4PA1A 4PUOA 3OJUA 3JSMA 3LDPA 1KLMA 5AQWA 3SJJA 1ZBUA 3AAQA 3P5JA 3W0LA 1TK5A 3L4QA 3K9KA 4IFEA 2A1RA 5B8HA 1T6CA 3SBTA 4U7BA 4B9MA 4H0VB 2OPPA 4ZTFA 5FRMA 4L3QA 5C10A 4FLTA 1XNRK 1L3UA 1P8ZA 3ZT0A 3VQ4A 1UA1A 3RR7A 2P9PB 1Z25A 4CEBA 1JL1A 3QFPA 4PL7A 4AHSA 1JLCA 3DLGA 1ZBFA 1WSGA 5M1NA 5M1OA 1GLCG 3U4LA 1LW2A 3LM9A 1NJYA 4FWNA 3U3GA 2KQ2A 4BG9A 1WSFA 1QSSA 1RTHA 5TKYA 2KZMA 2QTDA 4CBUA 4OVLA 5IT9O 4CIFA 2D0OA 2QXLA 4X66K 1KLNA 3RSEB 4CIEA 5LMNK 5EX5A 1RTDA 3FLCO 1LAWA 3QMLA 2HMIA 2QKKA 1U2VA 2FC0A 3DRSA 3SUPA 5DM6L 3K5MA 1OH8A 2CH6A 3TAMA 2F7TA 1NU0A 2FF6A 1D5AA 1QHAA 4KI4A 3HK2A 4FJMA 1O13A 1YT3A 4BR2A 5CYMA 4B9TA 3E1YA 4YOYA 4YORA 3KKSA 3V6DA 3E9PA 2NRHA 2ZWHA 1N34K 3SZ2A 3VQPA 1VSFA 1U49A 1E4GT 4QCLA 1R0AA 4FWPA 1ZYQA 5BPMA 1QVGM 1Z26A 3V9ZA 4DUZK 2P9IA 2D0CA 3TSPA 2HNZA 3P83D 4IOXA 2NRTA 4A2BA 5F2RA 3PUFA 4I9LA 4Z4CA 3BY5A 3HT3A 1K9MO 1RDWX 1TL1A 4GMJB 3L2QA 2O8DA 1BCMA 1XC3A 5BREA 3QNOA 1NJXA 2HHTA 4H5TA 4FSVA 5CZ1A 5JVGL 3NDKA 3BZCA 1ZBLA 1Q86O 2P9NB 1SUQA 4DTJA 1BU6O 3J7ZO 4OGCA 1ASVA 2PY5A 2HHXA 4W5TA 1X1PA 3ZETA 1A5XA 4H5NA 4YDUC 4IG0A 3D0PA 3O9UA 1VQPN 2RE2A 3LWMA 3O5BA 3EN9A 4CD3A 4DF4A 3OS1A 1KFDA 1IKXA 3H1VX 4JKAA 5DK5A 3AVMA 1HQEA 4AM6A 1BG3A 2NZTA 4MLHA 5FPDA 5GAGP 1TK8A 4I9QA 4PQUA 2XRIA 3ZEUA 4C8KA 4LF6K 4BREA 3C0BA 4ID5A 3RSEA 3O9RA 3VEVA 1WSEA 3OHRA 3MK6A 4JAXA 4ID1A 1WAJA 3DAWA 3NH2A 3AVCA 1RDDA 3RWUA 3NF7A 5HROA 2A1SA 5M1PA 4F2RA 2BUPA 4FLVA 3B6PA 3KLHA 5SZTA 4OKEA 3BP8A 2P1JA 1YVUA 5AQJA 3PX6A 1U2VB 1YXQA 3FR0A 2P9IB 3K5LA 1TGOA 3MMVA 3IRXA 5BPLA 1Z6RA 3MAQA 3C6AA 3K57A 1IO2A 4C8NA 1DTQA 5AZIB 4JI5K 1CXUA 1HR0K 1REVA 3H6EA 4HWIA 4TSXA 4IFVA 3VOVA 3HPHA 2O8DB 1BIZA 1SKRA 3DXKA 4JKEA 4DCHA 4PKIA 3TTDA 2DY4A 1W97L 4DU1A 4XH4A 3LAMA 2XY6A 4FWLA 4IKFA 4FJXA 4EIAA 4DV6K 4B9UA 2QWRA 1S1WA 1HKBA 4AM7A 4DQPA 4JNEA 3C94A 4IG3A 4GNIA 3DMJA 1NGIA 3VQ7A 3VEXA 2AA4A 4CJ7A 5AQLA 1YITN 3O8MA 1CXQA 2I7NA 2BANA 4DSFA 3VQ9A 1LWEA 4CBWA 3IFRA 3ZSQA 3MWPA 4DLGA 4KB0A 3D2FA 2JGUA 2Y1IA 4K8XA 3VTHA 4B8AB 1S22A 1HYZA 3M6GA 2PYLA 3QEWA 3AO3A 3CC7N 2P5GA 3MX5A 4DS4A 1L3VA 5CY4A 4ISEA 3IMXA 4E89A 3MXMA 4JYAK 3ZSOA 3V1OA 3EL2A 4Y1DA 4CI6A 1N6QA 4QAGA 2QWOA 3M1FA 1XHZA 4DTRA 3WXJA 2F9WA 3CCVN 4CBXA 1IKWA 3O1BA 2XO7A 2VGNA 3HSCA 4CFAA 3TU5A 2YNFA 2Q1NA 1N36K 5AJ3K 3SMSA 1IBLK 4DV3K 4NLCA 5HP1A 4CZLA 3OYGA 1QE1A 1N32K 1BWFO 3O1WA 1U45A 1TUYA 3OYKA 1KVCA 3ENOA 4JD2A 3CERA 3K2PA 5M1FA 1J9AA 3QNNA 1FXXA 3DOLA 4DMNA 5AQHA 3MEGA 3AA4A 3IKMA 2HHVA 3UKRB 2VWJA 2F8TA 3VETA 1VQON 3NGZA 1I3AA 1VSEA 4ISFA 4DQSA 4BQZA 5EOYA 4A62A 3RMAA 2HBKA 4BDYA 1SAZA 1EQYA 3AY9A 1BDGA 5I42A 4BVOA 3LDSA 3ZT1A 1RILA 3K5OA 3ITHA 4OPKA 3LL3A 3VGKA 5HRPA 3CMEN 4IOAL 2UYTA 4CZGA 3WNFA 4DU4A 3HO1A 1IJJA 3VPZA 1IG8A 2GEMA 4BRHA 1YJNN 4BE1A 1N33K 5AQMA 5GADP 2A41A 3ZT4A 5AQOA 4LF5K 1OKJA 4IDKA 1RDUA 4Z4HA 3QEPA 3BEXA 1QSYA 3OYMA 3RRGA 3NHGA 5I9EB 4MQ3A 4EAHD 3WXLA 2P9UB 1LAVA 4LSNA 1T03A 2O8BB 4CF1A 2AP1A 1C1CA 4KTZA 3THYA 3K9JA 4JKHA 2IGIA 3EZ5A 4BROA 3SQ1A 2UXBK 4HTUA 1SQKA 4JKDA 4FJGA 4QOZB 2ASOA 2QWLA 4DTOA 4KH6A 4B3OA 5ADXH 3IAYA 3ASMA 2P9KB 3UKRA 3L6QA 4RW4A 4WQ4A 2IDOA 1NGEA 1YTUA 4DKWA 3AV9A 4XH1A 3ZSYA 2KW4A 4KB1A 3FGUA 4LFBK 4N47A 4NYNA 2FBYA 2NRWA 2IVOA 3P4IA 3TAFA 1A5VA 3AA5X 5BR9A 5KGWA 2QKBA 1HNWK 5AQVA 1DGKN 3I33A 3C65A 5M1QA 3EO3A 3U3YA 2P9UA 4BRCA 1MDUB 2QM1A 3DXMB 3J8AA 1HJOA 1BO5O 4N56A 3CETA 3NH0A 1EKEA 5FRNA 3SI6A 1U47A 3NAEA 1BI4B 2X78A 1TV6A 4X65K 3ZETB 5HLFA 1EP4A 2V7YA 3FZLA 3QEXA 4K42A 4ELTA 2VG5A 3GL1A 3PO4A 2PBDA 1J6ZA 2ZD1A 4Z4IA 1GLEG 3L2RA 4CEQA 3QIOA 4F9OA 3MDQA 5KQDA 4EHUA 3G10A 1JXBA 2XY8A 2A6AA 4UQGA 3SQ2A 1IG9A 3ZX3A 1VRUA 4DWIA 3OBWA 1U4BA 1IH7A 4BRPA 5HRNA 4YHHK 4FK0A 5IWAK 3A5OC 1BOTO 3VN5A 4B3RK 1BA0A 3QEVA 3AO4A 1XI1A 4DU3A 2IAJA 1GLJO 3IG1A 1ITGA 3O08A 4M3UA 1HQUA 1RDCA 5FPEA 1GOCA 4DR7K 5FROA 2E88A 1IBMK 4KHQA 1J5EK 4IDHA 3THWB 4KBOA 1CZ9A 2QWNA 1RT6A 1B9FA 4W5QA 3GBTA 4MFBA 2GTDA 1XHXA 4GV9A 4DLEA 4PHTX 3O9QA 3ZSVA 1WBDA 2UU9K 1ASWA 3LP3A 3E9OA 4H4MA 1NK0A 4CGDA 2KTQA 3AGKA 5GINA 4E1NA 3TWHA 1N5YA 5EY4A 1BA1A 2HF4A 1YVNA 1T05A 3OJSA 4HTLA 1ILYA 3D7EO 2KFNA 1JCEA 4W5RA 3V1RA 4E19A 4HUGA 3DRRA 3AVHA 3W3DA 3E66A 2E5LK 3VMFB 3I55N 2UUBK 1TKXA 5AQPA 3I0RA 1M1KO 1BI4A 1NK8A 4H0PA 1Q9YA 4JHDA 3EYZA 3QINA 1W0HA 1KC8O 3THXB 4WQ5A 3C6HA 1TL3A 4M3XA 2QWMA 4FVMA 3ENBA 1YJ9N 4BACA 1GLAG 1UWBA 3CM6A 3T19A 1NK6A 4JV5K 2QWPA 1EWQA 4IWVA 1JCGA 5AFUH 2HHHK 4X62K 2WOMA 5I3UA 2G8VA 3O4WA 3DRPA 2YKMA 3QETA 1MWKA 1HPMA 1WB9A 3LWLA 4OJRA 4DQRA 1VQ6N 2P9PA 1VSJA 4CZEA 2Y1JA 1TKZA 1VHXA 4H0YB 3L4IA 3LALA 2HHSA 4RWTA 1VSMA 4KAZA 4DV7K 4JK8A 2HVHA 4F3TA 3T69A 5KRTA 4JKFA 4AHCA 3H08A 3CFRA 1K8KA 4CGJA 2E2QA 4QS7A 4V19S 2VQEK 1VSHA 3HP6A 3DLHA 1NBWA 2W6LA 4BG8A 1VAZA 2RHKA 4KI6A 4LF8K 1KAZA 4OX9K 5LY3A 3S41A 4W5OA 4DFKA 4E1MA 2QK9A 2E2PA 3FFKB 5SWMA 4J8FA 4I2QA 1S3XA 4CGHA 3OBYA 1BUPA 3VEOA 3QB0A 3J7AP 2Q36A 2DPNA 3KLGA 3RVCA 3IUCA 2YHBA 3BGRA 4BRDA 3JS6A 1JLFA 3DJCA 4H8KA 1VQNN 4CJQA 1ASUA 4JKCA 4OO1J 4BDPA 3FFIA 3VQDA 4Z94A 5E84A 4BRKA 2D4WA 4AF1A 3O3HA 1NKBA 4A61A 2RKIA 4CJWA 1RT5A 1OVYA 4CHQA 1NGJA 1FJGK 1NGCA 1BQMA 1WLJA 2VWKA 3VF4A 1YF5L 2PZSA 1S72N 3SPYA 4JI8K 3OYLA 3CJAA 3BZKA 3O4NA 1TUUA 4XIUA 4FJ7A 4ILGB 5AQIA 1WN7A 1J5OA 3NVMA 4EP4A 5AR0A 1NKEA 4BRMA 4KTQA 3OTOK 3G25A 1JLQA 4OKKA 4O8UA 4DF8A 1SS6A 3RMDA 1X9JA 4EFHA 2P9SB 3MN5A 4GVMA 4A59A 1S9GA 4Y1CA 1ATSA 4PWDA 2GELA 1F21A 1IKYA 2CH5A 3ZT3A 3PY8A 4BE2A 2E2NA 4JD2B 1RT1A 1WOQA 3AO2A 2A40A 4NLBA 3PIOL 4FWMA 3CF5L 5AQSA 2DFFA 4GKJK 4F2SA 3J7YP 1XC9A 1QQCA 3RTVA 4E7LA 3UB5A 3CCUN 4K8ZA 1ZBIA 1VK0A 1KVAA 1GLFO 3V81A 1ATRA 3EZWA 5C12A 3KZBA 4JN4A 4ELUA 4FZZA 3SV4A 3CCLN 4CCHA 5T7BA 3ULEB 3B8AX 4G1QA 5C24A 3QESA 4AH9A 1NK7A 4KHPK 4GY2B 4IO8A 3HP9A 1Z05A 4O5FA 3HVTA 4FO0A 1E3MA 5J1EA 5HBMA 1UOCA 3TABA 4KRFA 3GOIA 3SJHA 3ENHA 3MEDA 2OZSA 3ZYYX 4KH5A 1X3MA 4B08A 2E6MA 4DR5K 1CZAN 1VQ9N 3NVKA 4AQYK 1RBTA 3K59A 4CECA 3AVLA 3DXKB 5EXWA 4FK2A 4BC2A 3KK1A 3HVRA 4LFAK 4B1VA 3TAPA 1Q9XA 1VQKN 3CCQN 2CGKA 1LWFA 1NMDA 4DR2K 4BR7A 2UXDK 2B6AA 4KHNA 3LP0A 2HMPA 4CJKA 4OPHA 3NF9A 3P39A 4GV6A 3P38A 3DYAA 3DLKA 1VSIA 4NO7A 4FZYA 1NMNA 2P5OA 1U04A 2QA4N 1FKOA 1X9SA 1SL0A 3N4PA 4BR9A 2O8FB 4AHUA 3EY1A 3I8DA 2ITGA 3QBXA 3FZFA 1JLBA 2LSNA 4YOVA 4M3YA 3HZ6A 2ASPA 1HUXA 2ITMA 5AQXA 3PO5A 1B9DA 4NB4A 4RW8A 1C1BA 4Z4GA 2YX6A 4GVEA 5AFUA 3SNNA 4ELVA 4RW7A 4FM1A 1DKGD 3VENA 3TAEA 2Z1JA 2D0AA 1S6QA 3V1QA 4WYBA 2F8SA 1K6YA 4CFBA 4RG8A 4H0XB 3VEWA 5GIPA 4WQ5C 4B3SK 4WQ4C 3O9SA 1BCOA 2O8EA 4HHTA 3VQ5A 2O8CB 1NLVA 1LV5A 3SUQA 3EKUA 4BC5A 4IZ9A 2GBZA 1NK5A 1T6DA 3HM8A 4Z4FA 4FYDA 4DR3K 2YHAA 3DLBA 3ATVA 2IVNA 1S1XA 4BC3A 1VSLA 1RBUA 4H5VA 2UUAK 5BPNA 4IFYA 1KCFA 4CJ5A 4CJLA 1Y64A 1HRHA 4C8MA 4J2AA 2FSKA 2BH1A 4CZKA 4OGEA 3VQ8A 3WQTA 2V52B 3VEZA 3THVA 1YJWN 2YJEA 3SCXA 3MCAB 3CJ1A 2IIRA 5BRDA 3UIQA 4ZHRA 3CPWM 1KAXA 3PSFA 5M1KA 1U6ZA 3UKUA 4KHSA 4XH5A 1MA9B 1WSJA 1X9WA 3OS2A 3VQEA 3A2FA 1RBVA 1OVQA 1NGDA 1KQSM 4UY8O 4WF9L 3HSTB 2IOCA 1NM1A 3DWLA 4HVJA 4O0IA 3R1XA 3G6EN 3RMCA 4FJJA 3V9XA 1VQLN 4FM2A 1Q18A 4FCYA 1RCHA 4FJ5A 3KHYA 3OW2M 3S3MA 3L2UA 2ZGYA 3SYZA 3O3FA 3EE8A 4HUFA 4DS5A 3CCEN 4FOEA 3V9UA 3OY9A 3THXA 3HTVA 2XY7A 4HCBA 2E2OA 2AJQA 5JS1A 3CJ9A 1X9MA 1TAQA 4R5PA 4DV5K 2OPRA 3BUZB 4CGGA 2GWJA 1NOZA 4FWRA 3LP1A 1XNQK 1KRPA 1IKVA 3VGLA 3M3ZA 3VF6A 4B9LA 4FWOA 1HNVA 1SZ2A 4IEIA 4KTWA 5JS2A 4M42A 1RBSA 2ZJRL 1VSDA 1NK9A 3KD1E 3FZKA 2G8HA 1XUPO 4BR0A 2HW3A 2WC9A 2DFHA 3SQ0A 3H3NO 1Q7YO 1RT3A 2FLOA 4CE9A 4WFBL 4QS8A 4FJ8A 1IV0A 4KO0A 4JI3K 4H0OA 4LC9B 4EP5A 1SL1A 3A5MC 4DTPA 2G8IA 1KAYA 3AVNA 2O8BA 4AILC 5LL6Z 3P1GA 4DQIA 3K0SA 4CHZA 4IO9L 2Q97A 3CQYA 1NKCA 3RRHA 4CEAA 1VQMN 3R8EA 1FW6A 1S1VA 3C7NA 3M8SA 4HUEA 3CG7A 3LZIA 1BL3A 4JS4A 1W2BM 1QQNA 2G8UA 1YAGA 1JXEA 2ZGZA 4CJPA 2HBMA 4AHRA 3V4IA 3MN9A 3CJCA 1HNZK 1UA0A 4I6MA 4M3WA 4LF9K 2CGJA 5BRFA 1YUWA 1Y97A 2FBVA 3VQ6A 5D3GA 2D1KA 3ALYA 1V4TA 4J2BA 4CJFA 2HSTA 2QXFA 3H45C 3FE1A 3SUNA 1B92A 4BE0A 1VQ7N 1S5JA 4KKOA 4J2EA 2BE2A 4M45A 3LM2A 1XMOK 3O6WA 4O8KA 1WNSA 1KSPA 1ATNA 3HPGA 3BDPA 3NGYA 4LF4K 4FPBA 1HPZA 3P31A 4BRAA 4BRLA 4OLBA 5GAHP 2EWSA 2OYQA 2IC3A 1C1AA 1WBBA 3WUHA 2RN2A 1K8AO 5JLFA 1QTMA 5EVZA 4CF8A 1VQ5N 3K58A 4C23A 3SK3A 4FXDA 1LOTB 2HVIA 2NNWA 5C25A 1HKGA 4B3TK 3LPUA 1WSIA 4YOWA 4BRIA 3PLAA 3F5TA 4XEIA 2IS3A 3MECA 3T3FA 3OYEA 2Q3SA 3MX2A 4JI7K 3HM9A 4E0DA 4MLEA 2NRRA 4CZFA 3LDOA 3R6MA 1Q82O 3VA3A 4DV0K 1KXPA 2GUPA 2ETJA 3L8BA 4CF2A 4IBNA 5F1XA 3L2VA 4YNQA 1M90O 3ZT2A 3SMPA 3IS9A 4FLYA 1NG9A 3SPZA 3KVGA 4DFPA 5GIOA 5BN9A 5AQGA 1NNEA 3MN6A 2HHWA 4CF9A 1YTAA 2B4JA 1RBRA 1OH7A 4Q5VA 3J80O 3OYIA 1BHLA 4PKHA 3R9PA 4A5BA 4CESA 4ILHA 5CE3A 3AVKA 1RT4A 4KH4A 1JJ2M 4BRQA 2Q0RA 1N8RO 3CC2N 3KK3A 1QS4A 3QDKA 3BF1A 5J2NA 4BVPA 1FKPA 1HMVA 2FBTA 2NLXA 4G9ZA 3VGMA 2A42A 3C6UA 2ASMA 3KIOA 3DLEA 4JK9A 3G4SN 4DG1A 4JHDB 4LD0A 1CZBA 2ZE2A 3ID6A 4WFAL 4CHYA 3SQ4A 1BISA 4C1NK 3WQUA 3JAMO 4FJHA 3S9HA 3CJ7A 4FZXC 3KK2A 4KPYA 4K25A 3WNEA 2YV0X 4CFDA 4ZTJA 4LH4A 3TR8A 4OKJA 4DSKA 2P9KA 3KLIA 4YOXA 5AQNA 1VQ4N 3ZSWA 2OZMA 1W7AA 4KHYA 1OH6A 4N41A 2V7ZA 3AVGA 3N4QA 3C6TA 1TVRA 2UXCK 2WUSA 4DFMA 4DR6K 1NGGA 1NWKA 2GUIA 1VRTA 1V4SA 1DTTA 2CGLA 3TTCA 3QFUA 1HX1A 2Z1IA 2QW9A 3DLLL 1EX4A 4BGAA 3QBWA 5J2PA 4DTNA 3UKUB 1JLGA 4KHWA 5AZIA 4B1XB 2X6NA 2YNGA 3AA3A 1UAXA 5HRSA 3VA0A 1RTIA 4DR1K 5AQZA 2BTFA 2ZJQL 3SAGA 5DMRA 3AVBA 2FBXA 4FWKA 1GOBA 1GLDG 4CZIA 1HLUA 2OTLN 4BQLA 3NFAA 3OS0A 2J4RA 1G15A 5LJWA 1TYQB 4PKGA 1JCFA 4CZHA 3OVNA 4MO5A 2VYPA 1SL2A 3CQ8A 5CR4A 1CLQA 2O4GA 2VWBA 3BF3A 2P9LB 1YHQN 3THWA 4AHTA 3I8BA 5BRHA 4BWJA 1NJZA 4A5AA 1RNHA 4M3TA 2FSJA 3JXUA 3H3OB 3QICA 4FJIA 1GOAA 4H5WA 1ZXOA 4FL9A 3T7ZA 2GX9A 1HJRA 2BGGA 2PAVA 3VQAA 2HNYA 1T8EA 4DTMA 4I7FA 3QIPA 5F0XA 4JEPA 4CK1A 3O80A 2P9SA 3CYMA 1SV5A 3A0IX 2YKNA 1ZBSA 4M7YA 3PX4A 3AVJA 4ILJA 4JKGA 3A5LC 4YOTA 3CXCM 4YFUA 3D2FB 4IJAA 2KKZA 4B9VA 1DT9A 2BDPA 3AGRA 3TAQA 4O5BA 2YJFA 4RW9A 2Q31A 3HOSA 1WAFA 1HYVA 3M5RA 3CCJN 4GW6A 1Q8IA 2F96A 1QHTA 2VQFK 4DSEA 3OYDA 4BGBA 2GWKA 3HPOA 3LDNA 3ULEA 1HYSA 2HBLA 4NCAA 4JI1K 1C0TA 2G8WA 4FLUA 3LP2A 4OPAA 2NUBA 3AO1A 3KWIA 4E3SA 2ZM6K 5AQRA 1D9DA 1HNIA 3DM2A 1NJIO 4B1YB 4JI4K 3ZSZA 1L3TA 4E7HA 5JICA 3OYAA 3CCRN 4B3MK 1QQMA 4H5RA 1GLLO 4GKKK 3WEEA 1QSLA 4H03B 1RDBA 4DV1K 1VQ8N 5JLHA 2IVPA 3F2KA 2D0PA 3TTFA 3OA9A 1SKSA 4EHTA 5KI6A 1R59O 3TPQA 3HRGA 1NGFA 4DUYK 4FLZA 3HJFA 1EETA 3O3GA 3Q7BA 5KTQA 3QEIA 4DTXA 3EE9A 4CD1A 1EWRA 1RT7A 3GG4A 4CZMA 5LJVA 3R3LA 1OH5A 1QVFM 2ZQBA 3VERA 1Q81O 4CEFA 2YI1A 3NF6A 1QZ6A 1RGIA 3DLRA 2P9LA 4CZJA 1JKHA 4O44A 1NJWA 2YHXA 5TKWA 4B1ZA 1NGBA 1DLOA 4CEZA 1W9HA 2YNHA 5KPTA 3ZX2A 2F9TA 4BRGA 1T3VA 3KKRA 3WNHA 1KVBA 4CK2A 5AQQA 3PV8A 3RR8A 4JRQA 3LAKA 3CCSN 3HL8A 4N5SA 4B8CA 1TAUA 3OYNA 3IDHA 3A5NC 5A2QO 2V51B 1C6VA 3M8PA 1KFSA 3UE5A 4KHUA 1G99A 2ATQA 4F3OA 2HNDA 4JS5A 4RCHA 3WNGA 4CJRA 1D8YA 2E4LA 3THYB 1J54A 1ESVA 3A8YA 3CC4N 1XWLA 2EX3A 1HNXK 2G8FA 4K43A 1IBKK 5C0YA 1A5WA 5KPRA 3L0QA 2VGMA 1RFQA 5ADXA 5HL7L 4LF7K 2O4IA 3VQBA 4B9NA 3AARA 2HBJA 4E1JA 3H1QA 3K5NA 4CF0A 3PSIA 4PL8A 4J2DA 3M8QA 2O8EB 1T44A 2OPQA 4WFNL 4CJUA 4CHNA 2E6LA 1YI2N 3FZMA 1BIUA 4I2PA 5C15A 3V9SA 2VG6A 3WEEB 4BRFA 1EXQA 1QQOA 4K0KK 4Z4EA 2H3GX 1GLBG 1I39A
chains in the Genus database with same CATH topology
3G71N 1YAGA 5AQPA 5F2RA 2NRZA 1M1KO 2ZGZA 4H0PA 2HBMA 4JHDA 5AQTA 1KC8O 4WQ5A 3C6HA 3TSUA 3GDQA 3MN9A 2QWMA 3CJCA 1DEJA 1YJ9N 3ENBA 3NMUA 1K9MO 1RDWX 1GLAG 4I6MA 3HOTA 2QWPA 2CGJA 5BRFA 1XC3A 5BREA 4IWVA 1YUWA 3AAPA 1JCGA 4FSVA 4H5TA 5JVGL 1Q86O 2P9NB 2D1KA 5AFUH 1V4TA 2E1ZA 1BU6O 3J7ZO 3O4WA 3CIPA 2HSTA 3CCMN 5KQ8A 3H45C 3FE1A 1MWKA 4WCEL 1HPMA 2WBNA 2A5XA 1VQ7N 4ISGA 2HF3A 1VQ6N 3FZHA 1E4FT 3ZETA 4H5NA 4YDUC 2ZF5O 2P9PA 5AZJA 4CZEA 3LM2A 1YIJN 3O6WA 4H0YB 4O8KA 3L4IA 3KK7A 4RWTA 3O9UA 4JK8A 1VQPN 3CD6N 1ATNA 2A3ZA 4FPBA 2RE2A 3SLCA 3T69A 3P31A 4JKFA 4BRAA 1QZ5A 3O5BA 3EN9A 4FVUA 4CD3A 4BRLA 5GAHP 2EWSA 1K8KA 3H1VX 4JKAA 2I7PA 2E2QA 1C0FA 4QS7A 5AQKA 3WXIA 4AM6A 3WUHA 1NBWA 1BG3A 4BG8A 1VAZA 1K8AO 2RHKA 5JLFA 5JVHL 2NZTA 1KAZA 4Y0WA 4MLHA 5FPDA 3S41A 5LY3A 5EVZA 5GAGP 1VQ5N 3C7NB 4C23A 3SK3A 1LOTB 2E2PA 2E1YA 2NNWA 3FFKB 1HKGA 3VTIA 3ZEUA 3Q7CA 4BREA 4YOWA 3C0BA 4J8FA 1S3XA 2YHWA 3OBYA 1BUPA 3WXKA 2E20A 3RSEA 2E8AA 3O9RA 3VEOA 3VEVA 4BRIA 3OHRA 3QB0A 3MK6A 3PLAA 4JAXA 2Q36A 3DAWA 3F5TA 4XEIA 2DPNA 5M1PA 3RVCA 2BUPA 4FWSA 3IUCA 3MX2A 3BP8A 2JWKA 4BRDA 4I6MB 4GV3A 5AQJA 4MLEA 2NRRA 4CZFA 1U2VB 1YXQA 3DJCA 2FXUA 3FR0A 3JS6A 2P9IB 1ZC6A 3LDOA 1VQNN 3R6MA 4YDUA 3MMVA 3F9MA 1Q82O 4DHYA 4OO1J 4JKCA 2OTJN 5BPLA 1KXPA 1Z6RA 3C6AA 2GUPA 4Z94A 5E84A 3MCPA 5F1XA 4BRKA 2D4WA 5AZIB 4AF1A 1GLBG 4A61A 1M90O 3SMPA 3H6EA 4HWIA 3VOVA 1LCUA 1OVYA 3KVGA 1NGJA 3DXKA 4BRNA 5GIOA 5BN9A 5AQGA 4JKEA 1NGCA 1NGHA 4PKIA 3TTDA 4DCHA 3MN6A 3VF4A 1W97L 1YF5L 5C2DA 1S72N 4XH4A 4FWLA 3CJAA 4EIAA 3ZEUB 1EO1A 3SBGA 4PKHA 3R9PA 2QWRA 3U9ZA 4A5BA 4ILHA 5CE3A 1TUUA 4AM7A 1HKBA 4ILGB 5AQIA 4JNEA 4KH4A 1JJ2M 4BRQA 2Q0RA 2QWQA 5AZJB 2ZJPL 3NVMA 4GNIA 5AR0A 1N8RO 3CC2N 4BRMA 3MN7A 1NGIA 1WUAA 2YCHA 3G25A 3E9LA 3VEXA 4O8UA 1SS6A 1X9JA 3QDKA 2AA4A 3BF1A 4EFHA 2P9SB 3MN5A 4BVPA 4CJ7A 5AQLA 5BN8A 4A59A 1YITN 3O8MA 2NLXA 2FF3B 4G9ZA 2I7NA 3VGMA 2A42A 2ASMA 1ATSA 2GELA 4JK9A 4IJNA 2CH5A 3G4SN 3CMAN 4JHDB 5HOOA 4CBWA 3IFRA 3ID6A 3MWPA 2E2NA 4JD2B 4WFAL 1WOQA 2FSNA 5MLCQ 3D2FA 3VEYA 2A40A 4NLBA 4C1NK 3WQUA 4B1UB 3PIOL 4FWMA 4BY9C 3VTHA 3CF5L 4MDAA 4QS9A 3CJ7A 4MDBA 2W41A 5AQSA 3SAFA 1S22A 3M6GA 3H46O 4K25A 1NGAA 3O9TA 3MX5A 3CC7N 4ISEA 3IMXA 3D2EA 4U67L 2P9KA 4YOXA 5AQNA 3UB5A 3CCUN 1VQ4N 3EL2A 1H1VA 1GLFO 1ATRA 3EZWA 2V7ZA 3D6RA 3KZBA 5C12A 4JN4A 4R79A 3N4QA 4CI6A 3CCLN 2QWOA 2WUSA 3B8AX 3M1FA 3ULEB 1NGGA 1NWKA 1V4SA 3WXJA 2CGLA 4GY2B 2F9WA 4IO8A 1Z05A 4O5FA 3TTCA 4FO0A 3QFUA 4CBXA 3CCVN 1MWMA 1HX1A 3O1BA 3TSQA 2QW9A 2VGNA 3DLLL 3GOIA 3HSCA 3VF2A 3SJHA 4BGAA 2QEXN 3ENHA 3QBWA 3TU5A 1P90A 2Q1NA 3UKUB 3ZYYX 4IXCA 2NRXA 3SMSA 3HI0A 4KH5A 1X3MA 1K8KB 4NLCA 5AZIA 4CZLA 4B1XB 1CZAN 1VQ9N 1BWFO 3O1WA 3NVKA 3CHWA 5AQZA 1TUYA 2BTFA 2QI2A 2ZJQL 3SAGA 3ENOA 2KLAA 4JD2A 3CERA 3DXKB 4FWKA 5M1FA 1GLDG 5EXWA 3HBTA 4CZIA 1HLUA 4BC2A 2OTLN 4BQLA 4B1VA 5AQHA 1VQKN 4JKGB 3CCQN 2J4RA 1C0GA 3IKMA 4FPAA 2CGKA 4A57A 1NMDA 3UKRB 4YOUA 4RTFD 3VETA 4BR7A 5LJWA 4FWQA 1TYQB 4PKGA 1VQON 1JCFA 4CZHA 4H0TB 2VYPA 4MO5A 4ISFA 2Q0UA 2HMPA 5EOYA 4BQZA 4OPHA 4A62A 5GAEP 2HBKA 5CR4A 3P39A 4GV6A 4M63C 2VWBA 3BF3A 2P9LB 1SAZA 1EQYA 3P38A 1YHQN 3ATUA 3LDLA 3I8BA 4NO7A 5BRHA 3AY9A 4A5AA 1BDGA 3KWGA 5FPNA 2QA4N 4BVOA 2FSJA 3DXMA 3N4PA 3JXUA 4BR9A 2W40A 3H3OB 4BC4A 3SAHA 3QICA 2JWLA 2NRVA 3QBXA 3LL3A 3FZFA 4H5WA 5AQFA 3VGKA 4YOVA 3I55N 3CMEN 2UYTA 3HZ6A 3PIPL 4CZGA 4IOAL 1ZXOA 4FL9A 1IJJA 4JKBA 3T7ZA 2ASPA 1HUXA 2GX9A 2ITMA 5AQXA 3VPZA 2PAVA 1IG8A 2GEMA 4BRHA 1YJNN 4NB4A 5AQMA 5GADP 2A41A 5AQOA 2YX6A 4GVEA 2WFBA 1OKJA 5AFUA 1RDUA 1DKGD 5F0XA 3D2EB 4JEPA 3VENA 3O80A 3BEXA 2P9SA 5AQUA 3GE1A 3WT0A 5H1SQ 5I9EB 3A0IX 4WYBA 1K73O 1ZBSA 4M7YA 1HKCA 4EAHD 3WXLA 4ILJA 4JKGA 3A5LC 4YOTA 2P9UB 5GIPA 4H0XB 2OANA 3VEWA 3CI5A 3D2FB 4IJAA 4WQ5C 4WQ4C 3CXCM 3O9SA 2AP1A 2PFUA 4FOIA 2KKZA 4DQ8A 1DT9A 2KHOA 4BR4A 1NLVA 2Q2RA 3AGRA 4DB3A 2YJFA 4MO4A 2Q31A 3K9JA 3HOSA 5AQYA 4JKHA 3U9DA 4BROA 3EKUA 4JK7A 4BC5A 5ELZA 3U8XA 4IZ9A 3M5RA 3CCJN 1SQKA 4JKDA 1T6DA 2ASOA 2QWLA 3HM8A 4KH6A 5ADXH 5C2FA 1KD1O 3ATVA 2P9KB 4M7XA 3UKRA 4IOCL 2IVNA 4BC3A 4BGBA 2GWKA 3LDNA 3L6QA 3ULEA 2P9NA 2HBLA 4H5VA 4WQ4A 5FPMA 5BPNA 1NGEA 4DKWA 1D4XA 4XH1A 1Y64A 4B1WB 2VCPA 2FSKA 2BH1A 3FGUA 4OPAA 4CZKA 3KWIA 3WQTA 2HOEA 2V52B 3VEZA 2NRWA 5AQRA 1YJWN 2IVOA 2YJEA 3MCAB 3I56N 3P4IA 3CJ1A 2IIRA 5BRDA 4C1NI 1NJIO 4B1YB 3WXMB 5BR9A 1KAXA 3CPWM 3CPEA 3VESA 5JICA 5M1KA 1U6ZA 3UKUA 5AQVA 1DGKN 4XH5A 1X3NA 3I33A 5E26A 4BR5A 3C65A 3CCRN 1MA9B 5M1QA 3EO3A 2P9UA 3EKSA 1QQMA 2YHYA 4BRCA 1NGDA 3LDQA 4B9QA 5KPZA 1KQSM 5JMVA 4H5RA 1GLLO 3WEEA 4UY8O 4H03B 4WF9L 1VQ8N 5JLHA 2IVPA 1MDUB 2QM1A 3F2KA 3DXMB 1NM1A 2D0PA 3TTFA 4IEEA 3OA9A 5CHIA 3J8AA 4EHTA 3DWLA 4K41A 1HJOA 1R59O 3HRGA 1NGFA 3ID8A 3TPQA 1BO5O 3R1XA 1TYQA 3G6EN 3Q7BA 3CETA 3ZX0A 1VQLN 4A2BA 3EE9A 4CD1A 1Q18A 3GG4A 4CZMA 5LJVA 1QVFM 3R3LA 3CQXA 3MWTA 1XQSC 3VERA 4A2AA 5DM7L 1Q81O 3ZETB 2YI1A 1QZ6A 1RGIA 2V7YA 3FZLA 2P9LA 4K42A 4CZJA 3CJBA 3KHYA 2YHXA 3GL1A 3OW2M 2PBDA 1J6ZA 3LDPA 5AQWA 1NGBA 5TKWA 4B1ZA 3AAQA 2ZGYA 5KPTA 1GLEG 3ZX2A 2F9TA 4F9OA 3MDQA 3W0LA 3EE8A 5KQDA 3L4QA 3CCEN 3K9KA 4IFEA 4EHUA 4FOEA 1T6CA 3SBTA 5B8HA 4U7BA 4H0VB 4BRGA 2A6AA 3HTVA 2E2OA 1T3VA 3CJ9A 4L3QA 3ZX3A 5C10A 3OBWA 1P8ZA 4BRPA 5AQQA 3CCSN 3BUZB 3A5OC 2P9PB 2GWJA 1BOTO 4FWRA 3IDHA 3A5NC 4PL7A 3QFPA 2V51B 1BA0A 3VGLA 1GLJO 3M3ZA 3VF6A 5M1OA 1GLCG 3UE5A 5M1NA 3U4LA 1SZ2A 1G99A 3LM9A 3O08A 4FWNA 4FWOA 5FPEA 4BG9A 2E88A 4IEIA 5TKYA 2QTDA 4RCHA 4CBUA 4IDHA 4KBOA 2ZJRL 1ESVA 2D0OA 3A8YA 2QWNA 2QXLA 3CC4N 3FZKA 3RSEB 1XUPO 4BR0A 4K43A 5C0YA 3GBTA 2GTDA 5KPRA 5EX5A 3L0QA 3FLCO 2VGMA 4GV9A 1RFQA 3QMLA 2WC9A 1U2VA 5ADXA 5HL7L 3H3NO 3AARA 4PHTX 1Q7YO 2HBJA 2FLOA 3O9QA 4WFBL 4QS8A 4E1JA 4H0OA 5DM6L 4LC9B 3H1QA 2CH6A 2F7TA 2FF6A 3A5MC 3E9OA 1QHAA 4PL8A 1KAYA 1O13A 3AGKA 4BR2A 3E1YA 1T44A 5GINA 4YOYA 4WFNL 4YORA 5EY4A 1BA1A 2Q97A 2HF4A 3CQYA 3E9PA 2NRHA 1YVNA 2ZWHA 4IO9L 1YI2N 3FZMA 4HTLA 1ILYA 1E4GT 3D7EO 1VQMN 3R8EA 1JCEA 4FWPA 5C15A 3C7NA 3WEEB 4BRFA 5BPMA 1QVGM 1QQOA 3W3DA 1W2BM 3E66A 2P9IA 3TSPA 1QQNA 4IOXA 2H3GX 2NRTA 3VMFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9J A;  3HOS A;  2F7T A;  3HOT A;  3F2K A;  3K9K A;  4MDA A;  4MDB A;  4U7B A;  4R79 A;  5HOO A;  5CR4 A; 
#chains in the Genus database with same CATH topology
 3G71 N;  3NGI A;  2NRZ A;  3RMB A;  4FW1 A;  3QO9 A;  5AQT A;  3I0S A;  3NBP A;  3TSU A;  3GDQ A;  1I94 K;  1DEJ A;  3NMU A;  1JL2 A;  4CK3 A;  5BR8 K;  2X74 A;  3HOT A;  3AAP A;  2E1Z A;  2OPS A;  2YNI A;  3F73 A;  3CCM N;  3CIP A;  3DOK A;  5KQ8 A;  4CJ4 A;  5LMU K;  4WCE L;  2WBN A;  1S6P A;  2A5X A;  4FJN A;  4ISG A;  2HF3 A;  4DSJ A;  2JLE A;  3FZH A;  1E4F T;  1RTJ A;  2ZF5 O;  5AZJ A;  3CFO A;  1YIJ N;  3KK7 A;  3LAN A;  3CD6 N;  2A3Z A;  3DI6 A;  2D5R A;  5EU7 A;  2OA8 A;  3SLC A;  4CGF A;  2HHQ A;  1QZ5 A;  2G8K A;  4FVU A;  3T1H K;  1FK9 A;  4LY7 A;  4YY3 K;  1D9F A;  4M3Z A;  4O4G A;  3T1Y K;  2I7P A;  1C0F A;  5AQK A;  3WXI A;  4CHO A;  1RDA A;  3LZJ A;  5JVH L;  4Y0W A;  3U6F A;  4F8R A;  4JI2 K;  3KLF A;  3C7N B;  2E1Y A;  4DV4 K;  3VTI A;  3Q7C A;  1VSK A;  3L3U A;  4O55 A;  5KRS A;  5E41 A;  2YHW A;  3WXK A;  4BDZ A;  2E20 A;  2E8A A;  1MU2 A;  2DTU A;  4FJL A;  3M8R A;  1J53 A;  4RW6 A;  2HHU A;  4FWS A;  4OPJ A;  2WTU A;  2JWK A;  4I6M B;  4GV3 A;  3CFP A;  2FXU A;  4DSL A;  3TAG A;  1ZC6 A;  2XY5 A;  4YDU A;  3F9M A;  4DHY A;  3TAR A;  2OTJ N;  4CFC A;  4JI6 K;  4FJ9 A;  3MCP A;  4FM0 A;  5K14 A;  1LCU A;  4E7J A;  4BRN A;  3KJV A;  2X6S A;  1NGH A;  2OCE A;  3S3O A;  4DV2 K;  3CM5 A;  5C2D A;  4CED A;  1KTQ A;  3ZEU B;  1EO1 A;  3SBG A;  3U9Z A;  4CEE A;  4W5N A;  1LWC A;  1SKW A;  2W6K A;  3OYF A;  2QWQ A;  2R7Y A;  5AZJ B;  2ZJP L;  3KD5 E;  3MN7 A;  1WUA A;  2YCH A;  4JI0 K;  3E9L A;  3ZSX A;  1JLA A;  3B6O A;  3ZLJ A;  5BN8 A;  4OLA A;  4CJE A;  2FF3 B;  4FW2 A;  3OYJ A;  3OYC A;  4CJV A;  4IJN A;  4M3R A;  4NXM K;  3CMA N;  1S9E A;  5HOO A;  3VQQ A;  2Z1G A;  2FSN A;  4DSI A;  3AVA A;  1XMQ K;  5MLC Q;  3ZCM A;  3VEY A;  5HRR A;  4KV8 A;  4B1U B;  1C0M A;  4BY9 C;  3NF8 A;  4MDA A;  4QS9 A;  4WE1 A;  4MDB A;  2W41 A;  3SAF A;  5C42 A;  3H46 O;  1TKT A;  1NGA A;  3O9T A;  4U67 L;  3D2E A;  4CIG A;  4FLW A;  2VG7 A;  3MXI A;  3O4Q A;  4C8O A;  3KTQ A;  4LSL A;  1H1V A;  1L3S A;  4H4O A;  4EZ6 A;  1O1W A;  3D6R A;  1WSH A;  4R79 A;  4N76 A;  1S1T A;  4DFJ A;  5CZ2 A;  2O8C A;  2WON A;  3NCI A;  1C0U A;  1MWM A;  4M41 A;  4AHV A;  3TSQ A;  3D45 A;  2KZZ A;  3VF2 A;  2QEX N;  1P90 A;  3QER A;  4IXC A;  2NRX A;  3ISN C;  3HI0 A;  1K8K B;  4X64 K;  4F4K A;  3SUO A;  4Q0B A;  4CJS A;  3CHW A;  4DR4 K;  3OYH A;  2QI2 A;  3AVI A;  4CGI A;  3J81 O;  4PY5 A;  3MXJ A;  2KLA A;  3HBT A;  4JLH A;  3ZSR A;  2EHG A;  3TI0 A;  3NH1 A;  4JKG B;  4A57 A;  1C0G A;  2RPI A;  4FPA A;  1BQN A;  4NCG A;  4YOU A;  4LFC K;  4RTF D;  4FWQ A;  4H0T B;  4ICL A;  1RT2 A;  2Q0U A;  5GAE P;  3TAN A;  4FLX A;  4JRP A;  4M63 C;  2W42 A;  3AO5 A;  5J2M A;  3HXM A;  3ATU A;  3PX0 A;  2UUC K;  3LDL A;  5FLX O;  2KFZ A;  3L3V A;  1BGX T;  3KWG A;  5FPN A;  5FDL A;  3DXM A;  2HB5 A;  2W40 A;  4BC4 A;  3SAH A;  3KLE A;  2JWL A;  1L5U A;  2NRV A;  2PYJ A;  5AQF A;  3L2W A;  3PIP L;  2RF2 A;  3E01 A;  2Z1H A;  4JKB A;  3G0Z A;  3T1A A;  4B9S A;  4CJ3 A;  3SV3 A;  2WFB A;  3EEQ A;  3OYB A;  3D2E B;  4E7K A;  3MEE A;  5AQU A;  3GE1 A;  1NK4 A;  3WT0 A;  5H1S Q;  1S1U A;  1K73 O;  1HKC A;  4CEO A;  4C8L A;  4FJK A;  2OAN A;  3CI5 A;  1ZBH A;  2PFU A;  4FOI A;  2XHB A;  4DQ8 A;  2KHO A;  4BR4 A;  2Q2R A;  2B5J A;  4E7I A;  4DB3 A;  4MO4 A;  5AQY A;  3U9D A;  4JK7 A;  3V9W A;  5ELZ A;  3U8X A;  4CHP A;  5C2F A;  4NYF A;  1KD1 O;  4CJT A;  2O8F A;  4M7X A;  3F9K A;  4IOC L;  4EZ9 A;  4KFB A;  2P9N A;  5FPM A;  4HCC A;  3QLH A;  3JYT A;  5KGX A;  4CVN E;  3AA2 A;  1D4X A;  3LPT A;  3C95 A;  2D0B A;  2GV9 A;  4B1W B;  2VCP A;  1JLE A;  4NCB A;  4CW7 B;  2HOE A;  2DFE A;  3I56 N;  4NXN K;  4DTS A;  1TK0 A;  4C1N I;  2P51 A;  3WXM B;  4CER A;  4DQQ A;  3CPE A;  3VES A;  3ULD A;  4L8R B;  4FK4 A;  4BR5 A;  1X3N A;  5E26 A;  3HYF A;  4KRE A;  2I5J A;  3EKS A;  5KPZ A;  2YHY A;  3LDQ A;  4B9Q A;  5JMV A;  3S3N A;  3NE6 A;  5J2Q A;  4IEE A;  5CHI A;  4DTU A;  4K41 A;  3ID8 A;  1TYQ A;  5CYQ A;  1T7P A;  3ZX0 A;  1TKD A;  3AVF A;  3CQX A;  3MWT A;  4BWM A;  1U48 A;  1XQS C;  4A2A A;  5DM7 L;  1NOY A;  2F4V K;  1LW0 A;  4LH5 A;  3VQC A;  4O0J A;  3CJB A;  4Z0U A;  4PA1 A;  4PUO A;  3OJU A;  3JSM A;  3LDP A;  1KLM A;  5AQW A;  3SJJ A;  1ZBU A;  3AAQ A;  3P5J A;  3W0L A;  1TK5 A;  3L4Q A;  3K9K A;  4IFE A;  2A1R A;  5B8H A;  1T6C A;  3SBT A;  4U7B A;  4B9M A;  4H0V B;  2OPP A;  4ZTF A;  5FRM A;  4L3Q A;  5C10 A;  4FLT A;  1XNR K;  1L3U A;  1P8Z A;  3ZT0 A;  3VQ4 A;  1UA1 A;  3RR7 A;  2P9P B;  1Z25 A;  4CEB A;  1JL1 A;  3QFP A;  4PL7 A;  4AHS A;  1JLC A;  3DLG A;  1ZBF A;  1WSG A;  5M1N A;  5M1O A;  1GLC G;  3U4L A;  1LW2 A;  3LM9 A;  1NJY A;  4FWN A;  3U3G A;  2KQ2 A;  4BG9 A;  1WSF A;  1QSS A;  1RTH A;  5TKY A;  2KZM A;  2QTD A;  4CBU A;  4OVL A;  5IT9 O;  4CIF A;  2D0O A;  2QXL A;  4X66 K;  1KLN A;  3RSE B;  4CIE A;  5LMN K;  5EX5 A;  1RTD A;  3FLC O;  1LAW A;  3QML A;  2HMI A;  2QKK A;  1U2V A;  2FC0 A;  3DRS A;  3SUP A;  5DM6 L;  3K5M A;  1OH8 A;  2CH6 A;  3TAM A;  2F7T A;  1NU0 A;  2FF6 A;  1D5A A;  1QHA A;  4KI4 A;  3HK2 A;  4FJM A;  1O13 A;  1YT3 A;  4BR2 A;  5CYM A;  4B9T A;  3E1Y A;  4YOY A;  4YOR A;  3KKS A;  3V6D A;  3E9P A;  2NRH A;  2ZWH A;  1N34 K;  3SZ2 A;  3VQP A;  1VSF A;  1U49 A;  1E4G T;  4QCL A;  1R0A A;  4FWP A;  1ZYQ A;  5BPM A;  1QVG M;  1Z26 A;  3V9Z A;  4DUZ K;  2P9I A;  2D0C A;  3TSP A;  2HNZ A;  3P83 D;  4IOX A;  2NRT A;  4A2B A;  5F2R A;  3PUF A;  4I9L A;  4Z4C A;  3BY5 A;  3HT3 A;  1K9M O;  1RDW X;  1TL1 A;  4GMJ B;  3L2Q A;  2O8D A;  1BCM A;  1XC3 A;  5BRE A;  3QNO A;  1NJX A;  2HHT A;  4H5T A;  4FSV A;  5CZ1 A;  5JVG L;  3NDK A;  3BZC A;  1ZBL A;  1Q86 O;  2P9N B;  1SUQ A;  4DTJ A;  1BU6 O;  3J7Z O;  4OGC A;  1ASV A;  2PY5 A;  2HHX A;  4W5T A;  1X1P A;  3ZET A;  1A5X A;  4H5N A;  4YDU C;  4IG0 A;  3D0P A;  3O9U A;  1VQP N;  2RE2 A;  3LWM A;  3O5B A;  3EN9 A;  4CD3 A;  4DF4 A;  3OS1 A;  1KFD A;  1IKX A;  3H1V X;  4JKA A;  5DK5 A;  3AVM A;  1HQE A;  4AM6 A;  1BG3 A;  2NZT A;  4MLH A;  5FPD A;  5GAG P;  1TK8 A;  4I9Q A;  4PQU A;  2XRI A;  3ZEU A;  4C8K A;  4LF6 K;  4BRE A;  3C0B A;  4ID5 A;  3RSE A;  3O9R A;  3VEV A;  1WSE A;  3OHR A;  3MK6 A;  4JAX A;  4ID1 A;  1WAJ A;  3DAW A;  3NH2 A;  3AVC A;  1RDD A;  3RWU A;  3NF7 A;  5HRO A;  2A1S A;  5M1P A;  4F2R A;  2BUP A;  4FLV A;  3B6P A;  3KLH A;  5SZT A;  4OKE A;  3BP8 A;  2P1J A;  1YVU A;  5AQJ A;  3PX6 A;  1U2V B;  1YXQ A;  3FR0 A;  2P9I B;  3K5L A;  1TGO A;  3MMV A;  3IRX A;  5BPL A;  1Z6R A;  3MAQ A;  3C6A A;  3K57 A;  1IO2 A;  4C8N A;  1DTQ A;  5AZI B;  4JI5 K;  1CXU A;  1HR0 K;  1REV A;  3H6E A;  4HWI A;  4TSX A;  4IFV A;  3VOV A;  3HPH A;  2O8D B;  1BIZ A;  1SKR A;  3DXK A;  4JKE A;  4DCH A;  4PKI A;  3TTD A;  2DY4 A;  1W97 L;  4DU1 A;  4XH4 A;  3LAM A;  2XY6 A;  4FWL A;  4IKF A;  4FJX A;  4EIA A;  4DV6 K;  4B9U A;  2QWR A;  1S1W A;  1HKB A;  4AM7 A;  4DQP A;  4JNE A;  3C94 A;  4IG3 A;  4GNI A;  3DMJ A;  1NGI A;  3VQ7 A;  3VEX A;  2AA4 A;  4CJ7 A;  5AQL A;  1YIT N;  3O8M A;  1CXQ A;  2I7N A;  2BAN A;  4DSF A;  3VQ9 A;  1LWE A;  4CBW A;  3IFR A;  3ZSQ A;  3MWP A;  4DLG A;  4KB0 A;  3D2F A;  2JGU A;  2Y1I A;  4K8X A;  3VTH A;  4B8A B;  1S22 A;  1HYZ A;  3M6G A;  2PYL A;  3QEW A;  3AO3 A;  3CC7 N;  2P5G A;  3MX5 A;  4DS4 A;  1L3V A;  5CY4 A;  4ISE A;  3IMX A;  4E89 A;  3MXM A;  4JYA K;  3ZSO A;  3V1O A;  3EL2 A;  4Y1D A;  4CI6 A;  1N6Q A;  4QAG A;  2QWO A;  3M1F A;  1XHZ A;  4DTR A;  3WXJ A;  2F9W A;  3CCV N;  4CBX A;  1IKW A;  3O1B A;  2XO7 A;  2VGN A;  3HSC A;  4CFA A;  3TU5 A;  2YNF A;  2Q1N A;  1N36 K;  5AJ3 K;  3SMS A;  1IBL K;  4DV3 K;  4NLC A;  5HP1 A;  4CZL A;  3OYG A;  1QE1 A;  1N32 K;  1BWF O;  3O1W A;  1U45 A;  1TUY A;  3OYK A;  1KVC A;  3ENO A;  4JD2 A;  3CER A;  3K2P A;  5M1F A;  1J9A A;  3QNN A;  1FXX A;  3DOL A;  4DMN A;  5AQH A;  3MEG A;  3AA4 A;  3IKM A;  2HHV A;  3UKR B;  2VWJ A;  2F8T A;  3VET A;  1VQO N;  3NGZ A;  1I3A A;  1VSE A;  4ISF A;  4DQS A;  4BQZ A;  5EOY A;  4A62 A;  3RMA A;  2HBK A;  4BDY A;  1SAZ A;  1EQY A;  3AY9 A;  1BDG A;  5I42 A;  4BVO A;  3LDS A;  3ZT1 A;  1RIL A;  3K5O A;  3ITH A;  4OPK A;  3LL3 A;  3VGK A;  5HRP A;  3CME N;  4IOA L;  2UYT A;  4CZG A;  3WNF A;  4DU4 A;  3HO1 A;  1IJJ A;  3VPZ A;  1IG8 A;  2GEM A;  4BRH A;  1YJN N;  4BE1 A;  1N33 K;  5AQM A;  5GAD P;  2A41 A;  3ZT4 A;  5AQO A;  4LF5 K;  1OKJ A;  4IDK A;  1RDU A;  4Z4H A;  3QEP A;  3BEX A;  1QSY A;  3OYM A;  3RRG A;  3NHG A;  5I9E B;  4MQ3 A;  4EAH D;  3WXL A;  2P9U B;  1LAV A;  4LSN A;  1T03 A;  2O8B B;  4CF1 A;  2AP1 A;  1C1C A;  4KTZ A;  3THY A;  3K9J A;  4JKH A;  2IGI A;  3EZ5 A;  4BRO A;  3SQ1 A;  2UXB K;  4HTU A;  1SQK A;  4JKD A;  4FJG A;  4QOZ B;  2ASO A;  2QWL A;  4DTO A;  4KH6 A;  4B3O A;  5ADX H;  3IAY A;  3ASM A;  2P9K B;  3UKR A;  3L6Q A;  4RW4 A;  4WQ4 A;  2IDO A;  1NGE A;  1YTU A;  4DKW A;  3AV9 A;  4XH1 A;  3ZSY A;  2KW4 A;  4KB1 A;  3FGU A;  4LFB K;  4N47 A;  4NYN A;  2FBY A;  2NRW A;  2IVO A;  3P4I A;  3TAF A;  1A5V A;  3AA5 X;  5BR9 A;  5KGW A;  2QKB A;  1HNW K;  5AQV A;  1DGK N;  3I33 A;  3C65 A;  5M1Q A;  3EO3 A;  3U3Y A;  2P9U A;  4BRC A;  1MDU B;  2QM1 A;  3DXM B;  3J8A A;  1HJO A;  1BO5 O;  4N56 A;  3CET A;  3NH0 A;  1EKE A;  5FRN A;  3SI6 A;  1U47 A;  3NAE A;  1BI4 B;  2X78 A;  1TV6 A;  4X65 K;  3ZET B;  5HLF A;  1EP4 A;  2V7Y A;  3FZL A;  3QEX A;  4K42 A;  4ELT A;  2VG5 A;  3GL1 A;  3PO4 A;  2PBD A;  1J6Z A;  2ZD1 A;  4Z4I A;  1GLE G;  3L2R A;  4CEQ A;  3QIO A;  4F9O A;  3MDQ A;  5KQD A;  4EHU A;  3G10 A;  1JXB A;  2XY8 A;  2A6A A;  4UQG A;  3SQ2 A;  1IG9 A;  3ZX3 A;  1VRU A;  4DWI A;  3OBW A;  1U4B A;  1IH7 A;  4BRP A;  5HRN A;  4YHH K;  4FK0 A;  5IWA K;  3A5O C;  1BOT O;  3VN5 A;  4B3R K;  1BA0 A;  3QEV A;  3AO4 A;  1XI1 A;  4DU3 A;  2IAJ A;  1GLJ O;  3IG1 A;  1ITG A;  3O08 A;  4M3U A;  1HQU A;  1RDC A;  5FPE A;  1GOC A;  4DR7 K;  5FRO A;  2E88 A;  1IBM K;  4KHQ A;  1J5E K;  4IDH A;  3THW B;  4KBO A;  1CZ9 A;  2QWN A;  1RT6 A;  1B9F A;  4W5Q A;  3GBT A;  4MFB A;  2GTD A;  1XHX A;  4GV9 A;  4DLE A;  4PHT X;  3O9Q A;  3ZSV A;  1WBD A;  2UU9 K;  1ASW A;  3LP3 A;  3E9O A;  4H4M A;  1NK0 A;  4CGD A;  2KTQ A;  3AGK A;  5GIN A;  4E1N A;  3TWH A;  1N5Y A;  5EY4 A;  1BA1 A;  2HF4 A;  1YVN A;  1T05 A;  3OJS A;  4HTL A;  1ILY A;  3D7E O;  2KFN A;  1JCE A;  4W5R A;  3V1R A;  4E19 A;  4HUG A;  3DRR A;  3AVH A;  3W3D A;  3E66 A;  2E5L K;  3VMF B;  3I55 N;  2UUB K;  1TKX A;  5AQP A;  3I0R A;  1M1K O;  1BI4 A;  1NK8 A;  4H0P A;  1Q9Y A;  4JHD A;  3EYZ A;  3QIN A;  1W0H A;  1KC8 O;  3THX B;  4WQ5 A;  3C6H A;  1TL3 A;  4M3X A;  2QWM A;  4FVM A;  3ENB A;  1YJ9 N;  4BAC A;  1GLA G;  1UWB A;  3CM6 A;  3T19 A;  1NK6 A;  4JV5 K;  2QWP A;  1EWQ A;  4IWV A;  1JCG A;  5AFU H;  2HHH K;  4X62 K;  2WOM A;  5I3U A;  2G8V A;  3O4W A;  3DRP A;  2YKM A;  3QET A;  1MWK A;  1HPM A;  1WB9 A;  3LWL A;  4OJR A;  4DQR A;  1VQ6 N;  2P9P A;  1VSJ A;  4CZE A;  2Y1J A;  1TKZ A;  1VHX A;  4H0Y B;  3L4I A;  3LAL A;  2HHS A;  4RWT A;  1VSM A;  4KAZ A;  4DV7 K;  4JK8 A;  2HVH A;  4F3T A;  3T69 A;  5KRT A;  4JKF A;  4AHC A;  3H08 A;  3CFR A;  1K8K A;  4CGJ A;  2E2Q A;  4QS7 A;  4V19 S;  2VQE K;  1VSH A;  3HP6 A;  3DLH A;  1NBW A;  2W6L A;  4BG8 A;  1VAZ A;  2RHK A;  4KI6 A;  4LF8 K;  1KAZ A;  4OX9 K;  5LY3 A;  3S41 A;  4W5O A;  4DFK A;  4E1M A;  2QK9 A;  2E2P A;  3FFK B;  5SWM A;  4J8F A;  4I2Q A;  1S3X A;  4CGH A;  3OBY A;  1BUP A;  3VEO A;  3QB0 A;  3J7A P;  2Q36 A;  2DPN A;  3KLG A;  3RVC A;  3IUC A;  2YHB A;  3BGR A;  4BRD A;  3JS6 A;  1JLF A;  3DJC A;  4H8K A;  1VQN N;  4CJQ A;  1ASU A;  4JKC A;  4OO1 J;  4BDP A;  3FFI A;  3VQD A;  4Z94 A;  5E84 A;  4BRK A;  2D4W A;  4AF1 A;  3O3H A;  1NKB A;  4A61 A;  2RKI A;  4CJW A;  1RT5 A;  1OVY A;  4CHQ A;  1NGJ A;  1FJG K;  1NGC A;  1BQM A;  1WLJ A;  2VWK A;  3VF4 A;  1YF5 L;  2PZS A;  1S72 N;  3SPY A;  4JI8 K;  3OYL A;  3CJA A;  3BZK A;  3O4N A;  1TUU A;  4XIU A;  4FJ7 A;  4ILG B;  5AQI A;  1WN7 A;  1J5O A;  3NVM A;  4EP4 A;  5AR0 A;  1NKE A;  4BRM A;  4KTQ A;  3OTO K;  3G25 A;  1JLQ A;  4OKK A;  4O8U A;  4DF8 A;  1SS6 A;  3RMD A;  1X9J A;  4EFH A;  2P9S B;  3MN5 A;  4GVM A;  4A59 A;  1S9G A;  4Y1C A;  1ATS A;  4PWD A;  2GEL A;  1F21 A;  1IKY A;  2CH5 A;  3ZT3 A;  3PY8 A;  4BE2 A;  2E2N A;  4JD2 B;  1RT1 A;  1WOQ A;  3AO2 A;  2A40 A;  4NLB A;  3PIO L;  4FWM A;  3CF5 L;  5AQS A;  2DFF A;  4GKJ K;  4F2S A;  3J7Y P;  1XC9 A;  1QQC A;  3RTV A;  4E7L A;  3UB5 A;  3CCU N;  4K8Z A;  1ZBI A;  1VK0 A;  1KVA A;  1GLF O;  3V81 A;  1ATR A;  3EZW A;  5C12 A;  3KZB A;  4JN4 A;  4ELU A;  4FZZ A;  3SV4 A;  3CCL N;  4CCH A;  5T7B A;  3ULE B;  3B8A X;  4G1Q A;  5C24 A;  3QES A;  4AH9 A;  1NK7 A;  4KHP K;  4GY2 B;  4IO8 A;  3HP9 A;  1Z05 A;  4O5F A;  3HVT A;  4FO0 A;  1E3M A;  5J1E A;  5HBM A;  1UOC A;  3TAB A;  4KRF A;  3GOI A;  3SJH A;  3ENH A;  3MED A;  2OZS A;  3ZYY X;  4KH5 A;  1X3M A;  4B08 A;  2E6M A;  4DR5 K;  1CZA N;  1VQ9 N;  3NVK A;  4AQY K;  1RBT A;  3K59 A;  4CEC A;  3AVL A;  3DXK B;  5EXW A;  4FK2 A;  4BC2 A;  3KK1 A;  3HVR A;  4LFA K;  4B1V A;  3TAP A;  1Q9X A;  1VQK N;  3CCQ N;  2CGK A;  1LWF A;  1NMD A;  4DR2 K;  4BR7 A;  2UXD K;  2B6A A;  4KHN A;  3LP0 A;  2HMP A;  4CJK A;  4OPH A;  3NF9 A;  3P39 A;  4GV6 A;  3P38 A;  3DYA A;  3DLK A;  1VSI A;  4NO7 A;  4FZY A;  1NMN A;  2P5O A;  1U04 A;  2QA4 N;  1FKO A;  1X9S A;  1SL0 A;  3N4P A;  4BR9 A;  2O8F B;  4AHU A;  3EY1 A;  3I8D A;  2ITG A;  3QBX A;  3FZF A;  1JLB A;  2LSN A;  4YOV A;  4M3Y A;  3HZ6 A;  2ASP A;  1HUX A;  2ITM A;  5AQX A;  3PO5 A;  1B9D A;  4NB4 A;  4RW8 A;  1C1B A;  4Z4G A;  2YX6 A;  4GVE A;  5AFU A;  3SNN A;  4ELV A;  4RW7 A;  4FM1 A;  1DKG D;  3VEN A;  3TAE A;  2Z1J A;  2D0A A;  1S6Q A;  3V1Q A;  4WYB A;  2F8S A;  1K6Y A;  4CFB A;  4RG8 A;  4H0X B;  3VEW A;  5GIP A;  4WQ5 C;  4B3S K;  4WQ4 C;  3O9S A;  1BCO A;  2O8E A;  4HHT A;  3VQ5 A;  2O8C B;  1NLV A;  1LV5 A;  3SUQ A;  3EKU A;  4BC5 A;  4IZ9 A;  2GBZ A;  1NK5 A;  1T6D A;  3HM8 A;  4Z4F A;  4FYD A;  4DR3 K;  2YHA A;  3DLB A;  3ATV A;  2IVN A;  1S1X A;  4BC3 A;  1VSL A;  1RBU A;  4H5V A;  2UUA K;  5BPN A;  4IFY A;  1KCF A;  4CJ5 A;  4CJL A;  1Y64 A;  1HRH A;  4C8M A;  4J2A A;  2FSK A;  2BH1 A;  4CZK A;  4OGE A;  3VQ8 A;  3WQT A;  2V52 B;  3VEZ A;  3THV A;  1YJW N;  2YJE A;  3SCX A;  3MCA B;  3CJ1 A;  2IIR A;  5BRD A;  3UIQ A;  4ZHR A;  3CPW M;  1KAX A;  3PSF A;  5M1K A;  1U6Z A;  3UKU A;  4KHS A;  4XH5 A;  1MA9 B;  1WSJ A;  1X9W A;  3OS2 A;  3VQE A;  3A2F A;  1RBV A;  1OVQ A;  1NGD A;  1KQS M;  4UY8 O;  4WF9 L;  3HST B;  2IOC A;  1NM1 A;  3DWL A;  4HVJ A;  4O0I A;  3R1X A;  3G6E N;  3RMC A;  4FJJ A;  3V9X A;  1VQL N;  4FM2 A;  1Q18 A;  4FCY A;  1RCH A;  4FJ5 A;  3KHY A;  3OW2 M;  3S3M A;  3L2U A;  2ZGY A;  3SYZ A;  3O3F A;  3EE8 A;  4HUF A;  4DS5 A;  3CCE N;  4FOE A;  3V9U A;  3OY9 A;  3THX A;  3HTV A;  2XY7 A;  4HCB A;  2E2O A;  2AJQ A;  5JS1 A;  3CJ9 A;  1X9M A;  1TAQ A;  4R5P A;  4DV5 K;  2OPR A;  3BUZ B;  4CGG A;  2GWJ A;  1NOZ A;  4FWR A;  3LP1 A;  1XNQ K;  1KRP A;  1IKV A;  3VGL A;  3M3Z A;  3VF6 A;  4B9L A;  4FWO A;  1HNV A;  1SZ2 A;  4IEI A;  4KTW A;  5JS2 A;  4M42 A;  1RBS A;  2ZJR L;  1VSD A;  1NK9 A;  3KD1 E;  3FZK A;  2G8H A;  1XUP O;  4BR0 A;  2HW3 A;  2WC9 A;  2DFH A;  3SQ0 A;  3H3N O;  1Q7Y O;  1RT3 A;  2FLO A;  4CE9 A;  4WFB L;  4QS8 A;  4FJ8 A;  1IV0 A;  4KO0 A;  4JI3 K;  4H0O A;  4LC9 B;  4EP5 A;  1SL1 A;  3A5M C;  4DTP A;  2G8I A;  1KAY A;  3AVN A;  2O8B A;  4AIL C;  5LL6 Z;  3P1G A;  4DQI A;  3K0S A;  4CHZ A;  4IO9 L;  2Q97 A;  3CQY A;  1NKC A;  3RRH A;  4CEA A;  1VQM N;  3R8E A;  1FW6 A;  1S1V A;  3C7N A;  3M8S A;  4HUE A;  3CG7 A;  3LZI A;  1BL3 A;  4JS4 A;  1W2B M;  1QQN A;  2G8U A;  1YAG A;  1JXE A;  2ZGZ A;  4CJP A;  2HBM A;  4AHR A;  3V4I A;  3MN9 A;  3CJC A;  1HNZ K;  1UA0 A;  4I6M A;  4M3W A;  4LF9 K;  2CGJ A;  5BRF A;  1YUW A;  1Y97 A;  2FBV A;  3VQ6 A;  5D3G A;  2D1K A;  3ALY A;  1V4T A;  4J2B A;  4CJF A;  2HST A;  2QXF A;  3H45 C;  3FE1 A;  3SUN A;  1B92 A;  4BE0 A;  1VQ7 N;  1S5J A;  4KKO A;  4J2E A;  2BE2 A;  4M45 A;  3LM2 A;  1XMO K;  3O6W A;  4O8K A;  1WNS A;  1KSP A;  1ATN A;  3HPG A;  3BDP A;  3NGY A;  4LF4 K;  4FPB A;  1HPZ A;  3P31 A;  4BRA A;  4BRL A;  4OLB A;  5GAH P;  2EWS A;  2OYQ A;  2IC3 A;  1C1A A;  1WBB A;  3WUH A;  2RN2 A;  1K8A O;  5JLF A;  1QTM A;  5EVZ A;  4CF8 A;  1VQ5 N;  3K58 A;  4C23 A;  3SK3 A;  4FXD A;  1LOT B;  2HVI A;  2NNW A;  5C25 A;  1HKG A;  4B3T K;  3LPU A;  1WSI A;  4YOW A;  4BRI A;  3PLA A;  3F5T A;  4XEI A;  2IS3 A;  3MEC A;  3T3F A;  3OYE A;  2Q3S A;  3MX2 A;  4JI7 K;  3HM9 A;  4E0D A;  4MLE A;  2NRR A;  4CZF A;  3LDO A;  3R6M A;  1Q82 O;  3VA3 A;  4DV0 K;  1KXP A;  2GUP A;  2ETJ A;  3L8B A;  4CF2 A;  4IBN A;  5F1X A;  3L2V A;  4YNQ A;  1M90 O;  3ZT2 A;  3SMP A;  3IS9 A;  4FLY A;  1NG9 A;  3SPZ A;  3KVG A;  4DFP A;  5GIO A;  5BN9 A;  5AQG A;  1NNE A;  3MN6 A;  2HHW A;  4CF9 A;  1YTA A;  2B4J A;  1RBR A;  1OH7 A;  4Q5V A;  3J80 O;  3OYI A;  1BHL A;  4PKH A;  3R9P A;  4A5B A;  4CES A;  4ILH A;  5CE3 A;  3AVK A;  1RT4 A;  4KH4 A;  1JJ2 M;  4BRQ A;  2Q0R A;  1N8R O;  3CC2 N;  3KK3 A;  1QS4 A;  3QDK A;  3BF1 A;  5J2N A;  4BVP A;  1FKP A;  1HMV A;  2FBT A;  2NLX A;  4G9Z A;  3VGM A;  2A42 A;  3C6U A;  2ASM A;  3KIO A;  3DLE A;  4JK9 A;  3G4S N;  4DG1 A;  4JHD B;  4LD0 A;  1CZB A;  2ZE2 A;  3ID6 A;  4WFA L;  4CHY A;  3SQ4 A;  1BIS A;  4C1N K;  3WQU A;  3JAM O;  4FJH A;  3S9H A;  3CJ7 A;  4FZX C;  3KK2 A;  4KPY A;  4K25 A;  3WNE A;  2YV0 X;  4CFD A;  4ZTJ A;  4LH4 A;  3TR8 A;  4OKJ A;  4DSK A;  2P9K A;  3KLI A;  4YOX A;  5AQN A;  1VQ4 N;  3ZSW A;  2OZM A;  1W7A A;  4KHY A;  1OH6 A;  4N41 A;  2V7Z A;  3AVG A;  3N4Q A;  3C6T A;  1TVR A;  2UXC K;  2WUS A;  4DFM A;  4DR6 K;  1NGG A;  1NWK A;  2GUI A;  1VRT A;  1V4S A;  1DTT A;  2CGL A;  3TTC A;  3QFU A;  1HX1 A;  2Z1I A;  2QW9 A;  3DLL L;  1EX4 A;  4BGA A;  3QBW A;  5J2P A;  4DTN A;  3UKU B;  1JLG A;  4KHW A;  5AZI A;  4B1X B;  2X6N A;  2YNG A;  3AA3 A;  1UAX A;  5HRS A;  3VA0 A;  1RTI A;  4DR1 K;  5AQZ A;  2BTF A;  2ZJQ L;  3SAG A;  5DMR A;  3AVB A;  2FBX A;  4FWK A;  1GOB A;  1GLD G;  4CZI A;  1HLU A;  2OTL N;  4BQL A;  3NFA A;  3OS0 A;  2J4R A;  1G15 A;  5LJW A;  1TYQ B;  4PKG A;  1JCF A;  4CZH A;  3OVN A;  4MO5 A;  2VYP A;  1SL2 A;  3CQ8 A;  5CR4 A;  1CLQ A;  2O4G A;  2VWB A;  3BF3 A;  2P9L B;  1YHQ N;  3THW A;  4AHT A;  3I8B A;  5BRH A;  4BWJ A;  1NJZ A;  4A5A A;  1RNH A;  4M3T A;  2FSJ A;  3JXU A;  3H3O B;  3QIC A;  4FJI A;  1GOA A;  4H5W A;  1ZXO A;  4FL9 A;  3T7Z A;  2GX9 A;  1HJR A;  2BGG A;  2PAV A;  3VQA A;  2HNY A;  1T8E A;  4DTM A;  4I7F A;  3QIP A;  5F0X A;  4JEP A;  4CK1 A;  3O80 A;  2P9S A;  3CYM A;  1SV5 A;  3A0I X;  2YKN A;  1ZBS A;  4M7Y A;  3PX4 A;  3AVJ A;  4ILJ A;  4JKG A;  3A5L C;  4YOT A;  3CXC M;  4YFU A;  3D2F B;  4IJA A;  2KKZ A;  4B9V A;  1DT9 A;  2BDP A;  3AGR A;  3TAQ A;  4O5B A;  2YJF A;  4RW9 A;  2Q31 A;  3HOS A;  1WAF A;  1HYV A;  3M5R A;  3CCJ N;  4GW6 A;  1Q8I A;  2F96 A;  1QHT A;  2VQF K;  4DSE A;  3OYD A;  4BGB A;  2GWK A;  3HPO A;  3LDN A;  3ULE A;  1HYS A;  2HBL A;  4NCA A;  4JI1 K;  1C0T A;  2G8W A;  4FLU A;  3LP2 A;  4OPA A;  2NUB A;  3AO1 A;  3KWI A;  4E3S A;  2ZM6 K;  5AQR A;  1D9D A;  1HNI A;  3DM2 A;  1NJI O;  4B1Y B;  4JI4 K;  3ZSZ A;  1L3T A;  4E7H A;  5JIC A;  3OYA A;  3CCR N;  4B3M K;  1QQM A;  4H5R A;  1GLL O;  4GKK K;  3WEE A;  1QSL A;  4H03 B;  1RDB A;  4DV1 K;  1VQ8 N;  5JLH A;  2IVP A;  3F2K A;  2D0P A;  3TTF A;  3OA9 A;  1SKS A;  4EHT A;  5KI6 A;  1R59 O;  3TPQ A;  3HRG A;  1NGF A;  4DUY K;  4FLZ A;  3HJF A;  1EET A;  3O3G A;  3Q7B A;  5KTQ A;  3QEI A;  4DTX A;  3EE9 A;  4CD1 A;  1EWR A;  1RT7 A;  3GG4 A;  4CZM A;  5LJV A;  3R3L A;  1OH5 A;  1QVF M;  2ZQB A;  3VER A;  1Q81 O;  4CEF A;  2YI1 A;  3NF6 A;  1QZ6 A;  1RGI A;  3DLR A;  2P9L A;  4CZJ A;  1JKH A;  4O44 A;  1NJW A;  2YHX A;  5TKW A;  4B1Z A;  1NGB A;  1DLO A;  4CEZ A;  1W9H A;  2YNH A;  5KPT A;  3ZX2 A;  2F9T A;  4BRG A;  1T3V A;  3KKR A;  3WNH A;  1KVB A;  4CK2 A;  5AQQ A;  3PV8 A;  3RR8 A;  4JRQ A;  3LAK A;  3CCS N;  3HL8 A;  4N5S A;  4B8C A;  1TAU A;  3OYN A;  3IDH A;  3A5N C;  5A2Q O;  2V51 B;  1C6V A;  3M8P A;  1KFS A;  3UE5 A;  4KHU A;  1G99 A;  2ATQ A;  4F3O A;  2HND A;  4JS5 A;  4RCH A;  3WNG A;  4CJR A;  1D8Y A;  2E4L A;  3THY B;  1J54 A;  1ESV A;  3A8Y A;  3CC4 N;  1XWL A;  2EX3 A;  1HNX K;  2G8F A;  4K43 A;  1IBK K;  5C0Y A;  1A5W A;  5KPR A;  3L0Q A;  2VGM A;  1RFQ A;  5ADX A;  5HL7 L;  4LF7 K;  2O4I A;  3VQB A;  4B9N A;  3AAR A;  2HBJ A;  4E1J A;  3H1Q A;  3K5N A;  4CF0 A;  3PSI A;  4PL8 A;  4J2D A;  3M8Q A;  2O8E B;  1T44 A;  2OPQ A;  4WFN L;  4CJU A;  4CHN A;  2E6L A;  1YI2 N;  3FZM A;  1BIU A;  4I2P A;  5C15 A;  3V9S A;  2VG6 A;  3WEE B;  4BRF A;  1EXQ A;  1QQO A;  4K0K K;  4Z4E A;  2H3G X;  1GLB G;  1I39 A; 
#chains in the Genus database with same CATH homology
 3G71 N;  1YAG A;  5AQP A;  5F2R A;  2NRZ A;  1M1K O;  2ZGZ A;  4H0P A;  2HBM A;  4JHD A;  5AQT A;  1KC8 O;  4WQ5 A;  3C6H A;  3TSU A;  3GDQ A;  3MN9 A;  2QWM A;  3CJC A;  1DEJ A;  1YJ9 N;  3ENB A;  3NMU A;  1K9M O;  1RDW X;  1GLA G;  4I6M A;  3HOT A;  2QWP A;  2CGJ A;  5BRF A;  1XC3 A;  5BRE A;  4IWV A;  1YUW A;  3AAP A;  1JCG A;  4FSV A;  4H5T A;  5JVG L;  1Q86 O;  2P9N B;  2D1K A;  5AFU H;  1V4T A;  2E1Z A;  1BU6 O;  3J7Z O;  3O4W A;  3CIP A;  2HST A;  3CCM N;  5KQ8 A;  3H45 C;  3FE1 A;  1MWK A;  4WCE L;  1HPM A;  2WBN A;  2A5X A;  1VQ7 N;  4ISG A;  2HF3 A;  1VQ6 N;  3FZH A;  1E4F T;  3ZET A;  4H5N A;  4YDU C;  2ZF5 O;  2P9P A;  5AZJ A;  4CZE A;  3LM2 A;  1YIJ N;  3O6W A;  4H0Y B;  4O8K A;  3L4I A;  3KK7 A;  4RWT A;  3O9U A;  4JK8 A;  1VQP N;  3CD6 N;  1ATN A;  2A3Z A;  4FPB A;  2RE2 A;  3SLC A;  3T69 A;  3P31 A;  4JKF A;  4BRA A;  1QZ5 A;  3O5B A;  3EN9 A;  4FVU A;  4CD3 A;  4BRL A;  5GAH P;  2EWS A;  1K8K A;  3H1V X;  4JKA A;  2I7P A;  2E2Q A;  1C0F A;  4QS7 A;  5AQK A;  3WXI A;  4AM6 A;  3WUH A;  1NBW A;  1BG3 A;  4BG8 A;  1VAZ A;  1K8A O;  2RHK A;  5JLF A;  5JVH L;  2NZT A;  1KAZ A;  4Y0W A;  4MLH A;  5FPD A;  3S41 A;  5LY3 A;  5EVZ A;  5GAG P;  1VQ5 N;  3C7N B;  4C23 A;  3SK3 A;  1LOT B;  2E2P A;  2E1Y A;  2NNW A;  3FFK B;  1HKG A;  3VTI A;  3ZEU A;  3Q7C A;  4BRE A;  4YOW A;  3C0B A;  4J8F A;  1S3X A;  2YHW A;  3OBY A;  1BUP A;  3WXK A;  2E20 A;  3RSE A;  2E8A A;  3O9R A;  3VEO A;  3VEV A;  4BRI A;  3OHR A;  3QB0 A;  3MK6 A;  3PLA A;  4JAX A;  2Q36 A;  3DAW A;  3F5T A;  4XEI A;  2DPN A;  5M1P A;  3RVC A;  2BUP A;  4FWS A;  3IUC A;  3MX2 A;  3BP8 A;  2JWK A;  4BRD A;  4I6M B;  4GV3 A;  5AQJ A;  4MLE A;  2NRR A;  4CZF A;  1U2V B;  1YXQ A;  3DJC A;  2FXU A;  3FR0 A;  3JS6 A;  2P9I B;  1ZC6 A;  3LDO A;  1VQN N;  3R6M A;  4YDU A;  3MMV A;  3F9M A;  1Q82 O;  4DHY A;  4OO1 J;  4JKC A;  2OTJ N;  5BPL A;  1KXP A;  1Z6R A;  3C6A A;  2GUP A;  4Z94 A;  5E84 A;  3MCP A;  5F1X A;  4BRK A;  2D4W A;  5AZI B;  4AF1 A;  1GLB G;  4A61 A;  1M90 O;  3SMP A;  3H6E A;  4HWI A;  3VOV A;  1LCU A;  1OVY A;  3KVG A;  1NGJ A;  3DXK A;  4BRN A;  5GIO A;  5BN9 A;  5AQG A;  4JKE A;  1NGC A;  1NGH A;  4PKI A;  3TTD A;  4DCH A;  3MN6 A;  3VF4 A;  1W97 L;  1YF5 L;  5C2D A;  1S72 N;  4XH4 A;  4FWL A;  3CJA A;  4EIA A;  3ZEU B;  1EO1 A;  3SBG A;  4PKH A;  3R9P A;  2QWR A;  3U9Z A;  4A5B A;  4ILH A;  5CE3 A;  1TUU A;  4AM7 A;  1HKB A;  4ILG B;  5AQI A;  4JNE A;  4KH4 A;  1JJ2 M;  4BRQ A;  2Q0R A;  2QWQ A;  5AZJ B;  2ZJP L;  3NVM A;  4GNI A;  5AR0 A;  1N8R O;  3CC2 N;  4BRM A;  3MN7 A;  1NGI A;  1WUA A;  2YCH A;  3G25 A;  3E9L A;  3VEX A;  4O8U A;  1SS6 A;  1X9J A;  3QDK A;  2AA4 A;  3BF1 A;  4EFH A;  2P9S B;  3MN5 A;  4BVP A;  4CJ7 A;  5AQL A;  5BN8 A;  4A59 A;  1YIT N;  3O8M A;  2NLX A;  2FF3 B;  4G9Z A;  2I7N A;  3VGM A;  2A42 A;  2ASM A;  1ATS A;  2GEL A;  4JK9 A;  4IJN A;  2CH5 A;  3G4S N;  3CMA N;  4JHD B;  5HOO A;  4CBW A;  3IFR A;  3ID6 A;  3MWP A;  2E2N A;  4JD2 B;  4WFA L;  1WOQ A;  2FSN A;  5MLC Q;  3D2F A;  3VEY A;  2A40 A;  4NLB A;  4C1N K;  3WQU A;  4B1U B;  3PIO L;  4FWM A;  4BY9 C;  3VTH A;  3CF5 L;  4MDA A;  4QS9 A;  3CJ7 A;  4MDB A;  2W41 A;  5AQS A;  3SAF A;  1S22 A;  3M6G A;  3H46 O;  4K25 A;  1NGA A;  3O9T A;  3MX5 A;  3CC7 N;  4ISE A;  3IMX A;  3D2E A;  4U67 L;  2P9K A;  4YOX A;  5AQN A;  3UB5 A;  3CCU N;  1VQ4 N;  3EL2 A;  1H1V A;  1GLF O;  1ATR A;  3EZW A;  2V7Z A;  3D6R A;  3KZB A;  5C12 A;  4JN4 A;  4R79 A;  3N4Q A;  4CI6 A;  3CCL N;  2QWO A;  2WUS A;  3B8A X;  3M1F A;  3ULE B;  1NGG A;  1NWK A;  1V4S A;  3WXJ A;  2CGL A;  4GY2 B;  2F9W A;  4IO8 A;  1Z05 A;  4O5F A;  3TTC A;  4FO0 A;  3QFU A;  4CBX A;  3CCV N;  1MWM A;  1HX1 A;  3O1B A;  3TSQ A;  2QW9 A;  2VGN A;  3DLL L;  3GOI A;  3HSC A;  3VF2 A;  3SJH A;  4BGA A;  2QEX N;  3ENH A;  3QBW A;  3TU5 A;  1P90 A;  2Q1N A;  3UKU B;  3ZYY X;  4IXC A;  2NRX A;  3SMS A;  3HI0 A;  4KH5 A;  1X3M A;  1K8K B;  4NLC A;  5AZI A;  4CZL A;  4B1X B;  1CZA N;  1VQ9 N;  1BWF O;  3O1W A;  3NVK A;  3CHW A;  5AQZ A;  1TUY A;  2BTF A;  2QI2 A;  2ZJQ L;  3SAG A;  3ENO A;  2KLA A;  4JD2 A;  3CER A;  3DXK B;  4FWK A;  5M1F A;  1GLD G;  5EXW A;  3HBT A;  4CZI A;  1HLU A;  4BC2 A;  2OTL N;  4BQL A;  4B1V A;  5AQH A;  1VQK N;  4JKG B;  3CCQ N;  2J4R A;  1C0G A;  3IKM A;  4FPA A;  2CGK A;  4A57 A;  1NMD A;  3UKR B;  4YOU A;  4RTF D;  3VET A;  4BR7 A;  5LJW A;  4FWQ A;  1TYQ B;  4PKG A;  1VQO N;  1JCF A;  4CZH A;  4H0T B;  2VYP A;  4MO5 A;  4ISF A;  2Q0U A;  2HMP A;  5EOY A;  4BQZ A;  4OPH A;  4A62 A;  5GAE P;  2HBK A;  5CR4 A;  3P39 A;  4GV6 A;  4M63 C;  2VWB A;  3BF3 A;  2P9L B;  1SAZ A;  1EQY A;  3P38 A;  1YHQ N;  3ATU A;  3LDL A;  3I8B A;  4NO7 A;  5BRH A;  3AY9 A;  4A5A A;  1BDG A;  3KWG A;  5FPN A;  2QA4 N;  4BVO A;  2FSJ A;  3DXM A;  3N4P A;  3JXU A;  4BR9 A;  2W40 A;  3H3O B;  4BC4 A;  3SAH A;  3QIC A;  2JWL A;  2NRV A;  3QBX A;  3LL3 A;  3FZF A;  4H5W A;  5AQF A;  3VGK A;  4YOV A;  3I55 N;  3CME N;  2UYT A;  3HZ6 A;  3PIP L;  4CZG A;  4IOA L;  1ZXO A;  4FL9 A;  1IJJ A;  4JKB A;  3T7Z A;  2ASP A;  1HUX A;  2GX9 A;  2ITM A;  5AQX A;  3VPZ A;  2PAV A;  1IG8 A;  2GEM A;  4BRH A;  1YJN N;  4NB4 A;  5AQM A;  5GAD P;  2A41 A;  5AQO A;  2YX6 A;  4GVE A;  2WFB A;  1OKJ A;  5AFU A;  1RDU A;  1DKG D;  5F0X A;  3D2E B;  4JEP A;  3VEN A;  3O80 A;  3BEX A;  2P9S A;  5AQU A;  3GE1 A;  3WT0 A;  5H1S Q;  5I9E B;  3A0I X;  4WYB A;  1K73 O;  1ZBS A;  4M7Y A;  1HKC A;  4EAH D;  3WXL A;  4ILJ A;  4JKG A;  3A5L C;  4YOT A;  2P9U B;  5GIP A;  4H0X B;  2OAN A;  3VEW A;  3CI5 A;  3D2F B;  4IJA A;  4WQ5 C;  4WQ4 C;  3CXC M;  3O9S A;  2AP1 A;  2PFU A;  4FOI A;  2KKZ A;  4DQ8 A;  1DT9 A;  2KHO A;  4BR4 A;  1NLV A;  2Q2R A;  3AGR A;  4DB3 A;  2YJF A;  4MO4 A;  2Q31 A;  3K9J A;  3HOS A;  5AQY A;  4JKH A;  3U9D A;  4BRO A;  3EKU A;  4JK7 A;  4BC5 A;  5ELZ A;  3U8X A;  4IZ9 A;  3M5R A;  3CCJ N;  1SQK A;  4JKD A;  1T6D A;  2ASO A;  2QWL A;  3HM8 A;  4KH6 A;  5ADX H;  5C2F A;  1KD1 O;  3ATV A;  2P9K B;  4M7X A;  3UKR A;  4IOC L;  2IVN A;  4BC3 A;  4BGB A;  2GWK A;  3LDN A;  3L6Q A;  3ULE A;  2P9N A;  2HBL A;  4H5V A;  4WQ4 A;  5FPM A;  5BPN A;  1NGE A;  4DKW A;  1D4X A;  4XH1 A;  1Y64 A;  4B1W B;  2VCP A;  2FSK A;  2BH1 A;  3FGU A;  4OPA A;  4CZK A;  3KWI A;  3WQT A;  2HOE A;  2V52 B;  3VEZ A;  2NRW A;  5AQR A;  1YJW N;  2IVO A;  2YJE A;  3MCA B;  3I56 N;  3P4I A;  3CJ1 A;  2IIR A;  5BRD A;  4C1N I;  1NJI O;  4B1Y B;  3WXM B;  5BR9 A;  1KAX A;  3CPW M;  3CPE A;  3VES A;  5JIC A;  5M1K A;  1U6Z A;  3UKU A;  5AQV A;  1DGK N;  4XH5 A;  1X3N A;  3I33 A;  5E26 A;  4BR5 A;  3C65 A;  3CCR N;  1MA9 B;  5M1Q A;  3EO3 A;  2P9U A;  3EKS A;  1QQM A;  2YHY A;  4BRC A;  1NGD A;  3LDQ A;  4B9Q A;  5KPZ A;  1KQS M;  5JMV A;  4H5R A;  1GLL O;  3WEE A;  4UY8 O;  4H03 B;  4WF9 L;  1VQ8 N;  5JLH A;  2IVP A;  1MDU B;  2QM1 A;  3F2K A;  3DXM B;  1NM1 A;  2D0P A;  3TTF A;  4IEE A;  3OA9 A;  5CHI A;  3J8A A;  4EHT A;  3DWL A;  4K41 A;  1HJO A;  1R59 O;  3HRG A;  1NGF A;  3ID8 A;  3TPQ A;  1BO5 O;  3R1X A;  1TYQ A;  3G6E N;  3Q7B A;  3CET A;  3ZX0 A;  1VQL N;  4A2B A;  3EE9 A;  4CD1 A;  1Q18 A;  3GG4 A;  4CZM A;  5LJV A;  1QVF M;  3R3L A;  3CQX A;  3MWT A;  1XQS C;  3VER A;  4A2A A;  5DM7 L;  1Q81 O;  3ZET B;  2YI1 A;  1QZ6 A;  1RGI A;  2V7Y A;  3FZL A;  2P9L A;  4K42 A;  4CZJ A;  3CJB A;  3KHY A;  2YHX A;  3GL1 A;  3OW2 M;  2PBD A;  1J6Z A;  3LDP A;  5AQW A;  1NGB A;  5TKW A;  4B1Z A;  3AAQ A;  2ZGY A;  5KPT A;  1GLE G;  3ZX2 A;  2F9T A;  4F9O A;  3MDQ A;  3W0L A;  3EE8 A;  5KQD A;  3L4Q A;  3CCE N;  3K9K A;  4IFE A;  4EHU A;  4FOE A;  1T6C A;  3SBT A;  5B8H A;  4U7B A;  4H0V B;  4BRG A;  2A6A A;  3HTV A;  2E2O A;  1T3V A;  3CJ9 A;  4L3Q A;  3ZX3 A;  5C10 A;  3OBW A;  1P8Z A;  4BRP A;  5AQQ A;  3CCS N;  3BUZ B;  3A5O C;  2P9P B;  2GWJ A;  1BOT O;  4FWR A;  3IDH A;  3A5N C;  4PL7 A;  3QFP A;  2V51 B;  1BA0 A;  3VGL A;  1GLJ O;  3M3Z A;  3VF6 A;  5M1O A;  1GLC G;  3UE5 A;  5M1N A;  3U4L A;  1SZ2 A;  1G99 A;  3LM9 A;  3O08 A;  4FWN A;  4FWO A;  5FPE A;  4BG9 A;  2E88 A;  4IEI A;  5TKY A;  2QTD A;  4RCH A;  4CBU A;  4IDH A;  4KBO A;  2ZJR L;  1ESV A;  2D0O A;  3A8Y A;  2QWN A;  2QXL A;  3CC4 N;  3FZK A;  3RSE B;  1XUP O;  4BR0 A;  4K43 A;  5C0Y A;  3GBT A;  2GTD A;  5KPR A;  5EX5 A;  3L0Q A;  3FLC O;  2VGM A;  4GV9 A;  1RFQ A;  3QML A;  2WC9 A;  1U2V A;  5ADX A;  5HL7 L;  3H3N O;  3AAR A;  4PHT X;  1Q7Y O;  2HBJ A;  2FLO A;  3O9Q A;  4WFB L;  4QS8 A;  4E1J A;  4H0O A;  5DM6 L;  4LC9 B;  3H1Q A;  2CH6 A;  2F7T A;  2FF6 A;  3A5M C;  3E9O A;  1QHA A;  4PL8 A;  1KAY A;  1O13 A;  3AGK A;  4BR2 A;  3E1Y A;  1T44 A;  5GIN A;  4YOY A;  4WFN L;  4YOR A;  5EY4 A;  1BA1 A;  2Q97 A;  2HF4 A;  3CQY A;  3E9P A;  2NRH A;  1YVN A;  2ZWH A;  4IO9 L;  1YI2 N;  3FZM A;  4HTL A;  1ILY A;  1E4G T;  3D7E O;  1VQM N;  3R8E A;  1JCE A;  4FWP A;  5C15 A;  3C7N A;  3WEE B;  4BRF A;  5BPM A;  1QVG M;  1QQO A;  3W3D A;  1W2B M;  3E66 A;  2P9I A;  3TSP A;  1QQN A;  4IOX A;  2H3G X;  2NRT A;  3VMF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...