4MDAA

Structure of mos1 transposase catalytic domain and raltegravir with mn
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
225
structure length
200
Chain Sequence
PHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFVKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Mos1 Transposase Inhibition by the Anti-retroviral Drug Raltegravir.
pubmed doi rcsb
source organism Drosophila mauritiana
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Mariner Mos1 transposase
total genus 75
structure length 200
sequence length 225
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01359 Transposase_1 Transposase (partial DDE domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4mdaA00
3HOSA 3HOTA 4R79A 5CR4A 5HOOA 4U7BA 4MDAA 3K9KA 3F2KA 3K9JA 4MDBA 2F7TA
chains in the Genus database with same CATH superfamily
4FWQA 3P39A 2HW3A 4CGDA 3TARA 3Q7BA 3ALYA 4C8OA 4OGEA 4CJKA 4W5RA 4HCBA 3HPGA 4KKOA 4H0PA 1HNXK 3HI0A 3LP1A 4DCHA 4B3RK 1ZYQA 3H45C 5E84A 1TL1A 2D5RA 4YNQA 3H3NO 1RT5A 4B9VA 1IKXA 1BWFO 4I6MB 5C15A 4CERA 3CJCA 5TKYA 1VHXA 2A1RA 1S1UA 1S9GA 2NRWA 4B1UB 4FWLA 1C0MA 3WXIA 3L2QA 3V1RA 1HKCA 1MU2A 1S1WA 4BRAA 4E7JA 1U45A 5KTQA 3GL1A 4A61A 2W42A 1K8AO 4FZXC 4B9QA 2YKNA 2Q2RA 3A5LC 4JKEA 1UOCA 2X6SA 3NH0A 2Q0RA 4EHUA 3A0IX 3OYFA 1FK9A 1YIJN 3QEIA 2ZWHA 4FPBA 4DV5K 4DQPA 3DXKA 1DEJA 4FJXA 2OPQA 5CYMA 4JD2A 3T3FA 3WXKA 1JLGA 4FJ5A 3VPZA 3WEEA 4BREA 4E3SA 3VQ7A 3VESA 2H3GX 3P31A 2RPIA 5FRMA 2Z1JA 3AVCA 1S1XA 3MXMA 1BQMA 4UY8O 4KV8A 5K14A 4DHYA 4RW6A 1QZ5A 1VQ5N 3L2WA 3E9PA 4IZ9A 4F2RA 1BA0A 4Q0BA 1LCUA 2HHWA 1C1AA 2P5GA 4DTSA 3DLBA 4ISFA 1Q86O 3E1YA 5BRHA 3PO5A 4PWDA 1JLFA 4WQ5C 4UQGA 4ISEA 2YHAA 3PLAA 4DFJA 2QXFA 4YOWA 3CERA 3D7EO 4LH4A 1XC9A 4DV1K 1RTJA 3VOVA 3VENA 3SUQA 2RHKA 3UKRB 2Y1IA 5BR8K 3AV9A 4CBUA 3E01A 1ATSA 4B3MK 3PIPL 4F4KA 2UXCK 3HVTA 1HJOA 4B9SA 4BRIA 5GINA 4KPYA 3KJVA 1YXQA 4H8KA 4K0KK 2GEMA 3VEVA 1IBKK 1HLUA 1B9FA 2A1SA 5AQVA 3DLLL 2X6NA 3EZWA 2OZSA 1GLAG 1GLLO 2ZF5O 4C1NI 1Z26A 1XUPO 1C0GA 4CZHA 4BE1A 1YT3A 2UUBK 1IBLK 1B9DA 3OYLA 3LDPA 3SAGA 3K59A 1RT1A 3AAQA 4CW7B 3L0QA 5M1FA 4J2AA 3QO9A 1OH5A 3U4LA 2V7ZA 3KKRA 2D0BA 3N4PA 5C24A 3BUZB 4JKHA 3C0BA 1RDCA 3TR8A 1J9AA 3HK2A 2NLXA 1YITN 4XEIA 5EY4A 4GNIA 1O1WA 3LDLA 2HF4A 1U04A 3WQTA 3U9ZA 3SCXA 4KH6A 2YX6A 4X65K 4BR7A 3S9HA 3CC4N 4LF9K 3AO3A 4IG0A 5M1KA 1RT3A 4JI0K 2P51A 3IDHA 3WQUA 5FDLA 1LV5A 5AQXA 1WSIA 1VQMN 3V1QA 1VSMA 1QZ6A 4BRDA 3CIPA 3MXIA 1GLCG 2OPPA 1JLEA 1Q9XA 4DR6K 1W9HA 3LM2A 3WNGA 1NJZA 4FWKA 1DTTA 2NRZA 4KH4A 1WN7A 1JCGA 3CCVN 5MLCQ 4BE2A 1NKCA 3MN6A 5AQLA 1MA9B 1XC3A 3AVGA 1UAXA 4FJGA 1EX4A 5I3UA 5CZ1A 2O8CB 1S1VA 2G8WA 4BRNA 5KQ8A 4JLHA 2Q1NA 1BIUA 3ZCMA 1FJGK 1K9MO 3VQCA 2IOCA 1UWBA 4NYFA 3IMXA 1G99A 3AVJA 5AQQA 1KRPA 5I9EB 4DQIA 4DTPA 2E6LA 4BE0A 1NU0A 3LP2A 3SV3A 4PY5A 1DTQA 3EE8A 4C23A 2OCEA 4YOVA 1KLMA 2PBDA 4B9TA 2XRIA 3DRPA 2VG7A 4BVOA 4BRGA 3V9UA 4BY9C 3CQXA 4DF4A 3THYA 1RTIA 4JK8A 2FXUA 3P1GA 5AQGA 5H1SQ 4CFAA 3AO5A 3LPUA 3MEGA 1KFSA 1QSSA 1XHXA 2WTUA 4DWIA 1IKYA 4I2QA 4PQUA 1WLJA 3A2FA 1NK4A 2OANA 3S3NA 3L2VA 2P9KB 3R6MA 3THWA 4K25A 2P5OA 1X3MA 4N5SA 2QWLA 1XQSC 4CI6A 3IFRA 2DFFA 3MECA 4KB1A 1E4FT 3WNHA 2ASOA 2P9PA 3O3FA 3CCLN 1S6QA 3MXJA 1SV5A 3LP3A 3O9SA 1KD1O 1S6PA 2P9LB 4CJWA 4FCYA 4FJLA 4KRFA 1T7PA 4BDYA 2E1ZA 2F96A 1NGDA 5D3GA 2IVPA 1RGIA 3CCEN 3D6RA 1VQKN 2QWPA 4ELUA 1Q81O 1KSPA 4O8KA 4FPAA 1VSKA 1L3SA 2D0PA 4JAXA 4CEAA 1J5EK 4DSIA 1ILYA 3NF9A 5KPRA 3EL2A 3ITHA 3HVRA 3PO4A 3CJAA 4K8XA 3MN9A 4Z94A 4YHHK 1XMQK 1VQ8N 1SUQA 1WSFA 2NRRA 1BCOA 4FM2A 3OHRA 2G8KA 1C6VA 5AQKA 5AQZA 4BRKA 5EXWA 1VSLA 3KK3A 3BF3A 1QHAA 4FJHA 4IOAL 3J7AP 2VYPA 5AZJA 4FM1A 4E7KA 5C0YA 4FJKA 1HR0K 3FLCO 1TL3A 5J2PA 4PA1A 5B8HA 4ILJA 2RF2A 3K58A 3BGRA 2VWBA 3DXMA 3J81O 3AO1A 3CPWM 3KK7A 3QBWA 4CJEA 1WBDA 3C6UA 4RW7A 5ELZA 2UXDK 4NCBA 4CFBA 4DQSA 4WQ4C 5GIPA 3VQ4A 1SS6A 5KPZA 3CM6A 3TAFA 3CCJN 4BRPA 3CFPA 3VEOA 2WFBA 4IFYA 3ZSRA 4M7XA 2E2OA 3O9TA 4CZKA 4YDUC 3CCSN 4DR5K 2E1YA 5JLFA 4CBXA 4IFVA 3L2UA 4E7HA 4J2EA 3NHGA 4H5NA 4MO4A 1BCMA 3RMAA 3THVA 3TSUA 3UKUB 3ENBA 2YNIA 3SK3A 3HM9A 3LWMA 3WT0A 1YTAA 1C1BA 1ZXOA 2DFHA 5LJVA 3ULDA 3W0LA 4QAGA 3VEZA 1IKWA 1RDBA 3DJCA 3DOKA 3AVHA 4K43A 4BR9A 4AHVA 5C25A 1HQUA 3NF6A 3WXMB 3P5JA 3KK1A 4CBWA 4PHTX 4CF9A 3OBWA 4ICLA 2HHHK 2F9TA 4LFCK 3LDQA 5HRPA 3RWUA 1CXQA 4BR0A 1WB9A 5FROA 1X9SA 5M1NA 1EQYA 4IJAA 1RCHA 2X78A 1RBVA 1Y97A 2ZJQL 3L4IA 2KLAA 3AARA 3BDPA 4RW8A 3FFIA 3CQYA 4W5QA 4M45A 2BANA 4CZEA 4FJ9A 4K8ZA 1QTMA 1YTUA 3D2FB 2V51B 2P9SB 3IAYA 2O8FB 3CMAN 3E9LA 4DTRA 1DKGD 4M3RA 3IUCA 4B08A 3H6EA 5AQTA 2ZM6K 2D0OA 3UB5A 3FZMA 5AQJA 3F9KA 5AZIB 3VQAA 4ILHA 4AHSA 4HHTA 3K5MA 4N76A 2FC0A 5AQHA 1L3VA 1T6CA 3VF2A 2DPNA 3TSPA 1NKBA 4Z4CA 1R0AA 3VQPA 3AO2A 3HPHA 4ELVA 4YOUA 1NK6A 3BF1A 3IG1A 1BQNA 3TPQA 2PFUA 5DMRA 5F0XA 3DYAA 5FPEA 4O55A 1WAJA 4CHZA 3VERA 3L2RA 4GV6A 1BDGA 4A5BA 2BUPA 2QWMA 3AY9A 1YAGA 2NZTA 1QQNA 3MMVA 4I2PA 4B9UA 4E1MA 4XH5A 4OLBA 4B1YB 2HB5A 4DTUA 3V4IA 4YORA 4DTNA 3QESA 3JXUA 3BZKA 1NGJA 4GY2B 5FRNA 2FF3B 3TWHA 4FK4A 2HVHA 2IIRA 4PKIA 5AQMA 4CECA 1VSHA 3ENHA 5J2QA 1Y64A 4IJNA 3DLEA 4A62A 4KHSA 3KIOA 3OYBA 1QHTA 4A59A 4JNEA 1U2VB 3D2EA 3S3OA 2Q97A 4H4OA 5FPMA 1VSFA 2BDPA 5C2FA 3IKMA 4EP5A 4J8FA 3EZ5A 4LFAK 3UE5A 3MDQA 4QS9A 4FJ8A 4DR7K 4Z4IA 1E4GT 5AZJB 3ZX0A 2P9UA 3LDOA 2GWJA 5GAEP 2O8CA 1JXBA 3ZSYA 2QM1A 2I7PA 4CZJA 2VQFK 2GUIA 3O6WA 3KLFA 4KHYA 4DFMA 5SWMA 1S9EA 1VQON 1XI1A 1H1VA 3L3VA 4BACA 2W40A 1N5YA 4OPKA 4EAHD 4I9QA 3RR7A 1NGHA 3ZT3A 1R59O 3O9QA 3QB0A 1QQMA 3KD1E 1L5UA 2FF6A 2OTLN 2XY8A 1P8ZA 2Y1JA 1NBWA 2BTFA 4DV2K 3ZX2A 1RT4A 4CFCA 4JRQA 5GIOA 3CF5L 3RMBA 3C7NA 4MDAA 2JLEA 3ZT1A 4L8RB 3O4QA 5AQRA 1K8KA 2HMPA 1D9FA 5AQPA 2GV9A 4FZZA 1VQ4N 3RSEA 4CIEA 4FJNA 3DLKA 4CIFA 1C1CA 3VTHA 4J2DA 1BA1A 5KGWA 5JICA 4HUEA 3K5NA 3SPYA 1WSGA 1ZBUA 3HM8A 4CJ3A 4YOYA 3NGZA 3I8DA 1CZ9A 4M3XA 2IC3A 5GAGP 3NMUA 3AA5X 4NXMK 2F7TA 4B1ZA 4H5WA 3SV4A 3CCRN 3MX5A 3HJFA 4QS8A 1Z6RA 3CYMA 4M7YA 2OYQA 5CYQA 1KQSM 3F9MA 3NDKA 4JHDB 3CXCM 4CEFA 3C94A 3FR0A 1GLFO 2UUAK 4C1NK 3CMEN 4C8KA 3L6QA 4MLEA 3HL8A 4MO5A 3OY9A 5JMVA 1SZ2A 1WSJA 3SQ4A 4CJRA 1LOTB 1OVYA 1QE1A 4CK1A 1IBMK 1JLQA 1X3NA 3OYHA 3KTQA 4R79A 1KCFA 5LY3A 2KFZA 1BHLA 4LF8K 4FLYA 1BOTO 3T69A 5FPDA 3HYFA 1VSDA 4Y1DA 1A5VA 3NH2A 2E88A 3R9PA 1G15A 2F9WA 3HTVA 4OGCA 3OS0A 1IKVA 3EN9A 3OYJA 1T03A 3WXLA 1OH7A 4IDKA 1RT2A 2IVOA 5F2RA 2YJEA 3KLEA 4KTQA 3QFUA 4FW1A 2IDOA 3BY5A 2E2QA 1YJWN 1HNVA 1KAZA 5AQYA 5ADXH 4ID1A 1S72N 4IEIA 1BI4A 1KAYA 2IS3A 4B9NA 3QEWA 4HUGA 4I7FA 3DM2A 1QQOA 1YHQN 3MCAB 3TABA 1VRTA 3AGKA 3FGUA 3SUOA 2PZSA 3FZFA 4LH5A 1WUAA 1S3XA 3LAKA 4H5RA 1T44A 3GBTA 4LF4K 3OJUA 4DR4K 4W5NA 3G4SN 3KZBA 3I0RA 4CGFA 1NM1A 2E4LA 1N36K 2E20A 1TGOA 2ITMA 3QIOA 3CM5A 4NB4A 2FBVA 5JVHL 4AHRA 4HTUA 3HOTA 1TK0A 4K42A 3ZLJA 2Q3SA 1LAVA 2P9SA 4LF6K 3AA4A 3OYCA 4LSLA 3WNFA 2P9KA 1F21A 3ZT0A 3QEVA 2ZJPL 3HPOA 2GWKA 4CEZA 3D0PA 3PIOL 5AZIA 1TKTA 4XH1A 2B4JA 5C10A 1HJRA 5C42A 4FLVA 3AVBA 1XHZA 3R8EA 3PV8A 3RRGA 3O1WA 2DFEA 3HO1A 1NK9A 3C95A 3AVIA 4BWJA 3RRHA 1VQ6N 3VTIA 4CHQA 3DRSA 4B3SK 2O8DA 2JWKA 4FVUA 4HTLA 3VQQA 4DFPA 3PSFA 1QSYA 5HRRA 4M3YA 4B9LA 4IEEA 3ID8A 3O08A 5FPNA 4BGAA 3JSMA 4DSEA 4KHWA 1HKGA 2HNYA 1KFDA 2VCPA 3R1XA 3HBTA 3D2EB 3A8YA 2HNZA 1HNWK 2ZGZA 4AF1A 4RW4A 1FKPA 3U8XA 4CFDA 1NJXA 3A5OC 3ATVA 3NFAA 4JKCA 3AGRA 1GLJO 3G6EN 1T6DA 1KC8O 3UKRA 3ZX3A 2NRTA 1SKWA 5EU7A 4E89A 3QEXA 1W2BM 4HCCA 3QLHA 4KREA 4DS4A 1TUYA 3U9DA 4WFAL 3I56N 5IT9O 2HHQA 4E1NA 1MWKA 4KI4A 2VWKA 3IS9A 4EP4A 1RDWX 4F3OA 3G10A 4DLGA 1NGAA 4AQYK 1ZBLA 3A5MC 3AAPA 3KKSA 3MWPA 1JXEA 1KXPA 4B1WB 5KI6A 1OVQA 4PUOA 1W97L 1BU6O 1S22A 2WBNA 1KLNA 1N33K 4DQ8A 1WSHA 4M3ZA 4R5PA 3O4WA 1VQ7N 2VG6A 3LWLA 2QTDA 5AQNA 4DTMA 1CXUA 3DLHA 3VF6A 2O8EA 1T05A 1LWFA 4BR4A 2QWOA 4KAZA 1J5OA 3LM9A 1VSEA 1EXQA 3CJ1A 3HZ6A 2O8FA 2P9UB 4CZLA 2HBLA 1VQLN 5AQUA 4XIUA 4H0YB 5LL6Z 3SQ1A 1HUXA 4RWTA 3AVKA 4JS5A 1IG8A 2GELA 2B5JA 1RBUA 4DV7K 2XY5A 1FW6A 4OKJA 1U2VA 5C12A 2YNHA 3AVAA 2HBJA 4FWSA 4I6MA 2P9NA 3L3UA 3TSQA 3KLIA 1TKZA 2QI2A 3ISNC 1ESVA 5JLHA 4BGBA 3QETA 4FWPA 4WFBL 4BROA 3J7YP 3J80O 3A5NC 1TYQA 5BN8A 3PUFA 4CJTA 5LMNK 1WOQA 2GUPA 1C0FA 1I3AA 5CHIA 2VG5A 1NKEA 4JI5K 2LSNA 4JK7A 2GBZA 3V81A 4GVMA 4B1VA 4HWIA 1U48A 4KH5A 4AHCA 4CJ4A 3CD6N 4CJLA 5BREA 4CHYA 4FLXA 3VA3A 5KRSA 4FK0A 1L3TA 2Z1IA 3T1HK 1TVRA 4F3TA 3SYZA 2ZJRL 4CHOA 3KLHA 5LMUK 4ZTJA 4OPJA 3CJ9A 4WCEL 3MK6A 4AHTA 4M3TA 5HOOA 3DOLA 3CFRA 4JKGA 4DMNA 2HBKA 4CK3A 1VK0A 1S5JA 4OVLA 4O0IA 3L8BA 4E7LA 5E41A 4FWNA 4O5BA 3VGKA 3U6FA 2WONA 4BRMA 5J1EA 3WEEB 1RDAA 3KLGA 3HRGA 3O8MA 5GAHP 4KHPK 4WQ5A 4TSXA 4C8LA 2OA8A 3WNEA 1L3UA 5EVZA 3LPTA 4WQ4A 1NGCA 1JKHA 2FBYA 3D45A 1IG9A 4PKHA 2A40A 4AHUA 2Q36A 1U4BA 1OKJA 4B9MA 1QSLA 4WYBA 1JL1A 3I8BA 5M1OA 5AR0A 3CG7A 5A2QO 2E2NA 4EZ6A 3E9OA 5HLFA 2KHOA 5AFUA 3CCUN 4HUFA 2KZZA 3CQ8A 1FKOA 1D9DA 1MWMA 3HOSA 4QS7A 1YJ9N 3ZSZA 3VGLA 5C2DA 3CFOA 1HNIA 4IO8A 4BG9A 1GOAA 5HL7L 3VF4A 4FOIA 3NVKA 3THXB 2EHGA 3ENOA 4U7BA 3SQ0A 1DLOA 1BL3A 1BGXT 3CHWA 3MAQA 1TUUA 5BPLA 3VQ9A 5CY4A 3ZEUB 3M5RA 2RN2A 2HOEA 3KK2A 4EZ9A 1HYVA 3SJJA 4H0OA 2KTQA 3SMPA 3FE1A 4X64K 4JS4A 4JKGB 1RTDA 1YJNN 5KRTA 4IBNA 5J2NA 1JLCA 3I33A 4N41A 1V4SA 2Q0UA 4DV6K 4NYNA 4FK2A 2QW9A 1CZBA 3N4QA 4RCHA 3AVFA 5FLXO 4E7IA 4NLCA 4ID5A 1WAFA 1Q7YO 4CGJA 3DI6A 2XO7A 1X9WA 3LDNA 1U47A 1HMVA 4FJ7A 3QIPA 4DR2K 3MCPA 3QMLA 1JCFA 2NNWA 5J2MA 3THYB 3AA2A 1N6QA 3ZT2A 4CEQA 1I94K 3QERA 3K5OA 2VQEK 5LJWA 4CEBA 1TAUA 4M42A 1RT6A 3TAEA 1HQEA 4JI2K 2O8BB 4X62K 4E0DA 3O3HA 3ZETA 3VN5A 4U67L 1IO2A 1ZBSA 4CJVA 3OW2M 4BDZA 1TYQB 1ZBIA 5KPTA 2GTDA 1RBTA 3TTFA 4CHPA 2YHYA 4BQLA 1NMDA 3K0SA 3K9KA 4FLZA 1NJIO 4BRLA 2HHVA 4Z0UA 2ASPA 3AO4A 2YNFA 3P83D 1A5WA 2A5XA 3I0SA 1ZBHA 4FLTA 3OYNA 3ZYYX 4FWRA 2PYLA 4NCGA 3GE1A 3OTOK 1BUPA 5HRNA 3H46O 2KKZA 3TAMA 2A41A 4BRCA 3HXMA 1RT7A 3TI0A 4F8RA 1A5XA 3QINA 3T1YK 1SKRA 5DM6L 1Z05A 4DU4A 2AJQA 1YF5L 3V9ZA 1BIZA 3NAEA 4OX9K 3LZIA 4JD2B 4JI3K 4EIAA 1QS4A 4Z4EA 3G25A 4CGHA 3F73A 4CJPA 4JYAK 1ASUA 3TTCA 2R7YA 2HHUA 5JVGL 4LC9B 3VEXA 2P9IA 4BRQA 4YOTA 4PL8A 4FOEA 1RFQA 3VA0A 4OPHA 1HYZA 2FLOA 3Q7CA 2NRXA 3LZJA 2QWNA 3O5BA 5DM7L 3K5LA 1NGBA 4M41A 1KAXA 4DB3A 4JN4A 1IV0A 2O8BA 3I55N 2ZQBA 2Z1HA 5BPMA 5GADP 1DT9A 4CJFA 3S41A 1NOYA 3DMJA 1TK5A 3CJBA 3SMSA 3EO3A 2KQ2A 5AQIA 1GLEG 2PYJA 2YJFA 2CH5A 4KHQA 5EX5A 3UIQA 4FW2A 3LANA 2BH1A 4RTFD 3HP6A 4JI4K 1TK8A 3VQBA 3MN7A 1M1KO 4A2AA 2G8IA 1TKDA 3RMCA 3WUHA 3H3OB 3UKUA 1T3VA 4RW9A 4Z4HA 2FSJA 4DSFA 4CD1A 3VMFB 2ETJA 1CLQA 3ASMA 1ATRA 3VQDA 1OH8A 2P9NB 4DQQA 1HRHA 4IDHA 5M1QA 3CC2N 2XY6A 1N32K 3BEXA 5IWAK 4IG3A 1SKSA 4OKKA 5HRSA 5CZ2A 1D5AA 1LAWA 4YOXA 2HNDA 3K57A 3QFPA 4ELTA 4L3QA 4M3UA 1K6YA 4IOCL 3U3YA 1ASVA 4H4MA 1NLVA 1X9JA 1RILA 4WFNL 1IH7A 2VGMA 4DG1A 2A3ZA 2D4WA 3RVCA 5BRDA 1HNZK 3K2PA 2QXLA 3CPEA 4KFBA 4WE1A 4Z4GA 1VAZA 5HBMA 2ZE2A 5CE3A 1NWKA 4JV5K 4OO1J 1BO5O 4JI6K 2EX3A 2ZGYA 4LF7K 3SJHA 2JGUA 2UUCK 1EKEA 3M1FA 3MWTA 2CGJA 2P9LA 3OA9A 3JYTA 3THXA 2EWSA 4G1QA 2WUSA 5E26A 4CF2A 1KVBA 1GLDG 2B6AA 3NF8A 3SQ2A 4Z4FA 2D0AA 1ZBFA 4FWOA 4NO7A 3MN5A 4IWVA 4B3OA 4A2BA 2V7YA 1ZC6A 1WNSA 4JK9A 4F9OA 3QBXA 1TV6A 4JI1K 4DR3K 1JJ2M 4LD0A 3O4NA 2KW4A 3GG4A 4WF9L 2P9PB 3LALA 2A42A 2YNGA 3EYZA 1EP4A 4KO0A 1D4XA 4CD3A 1DGKN 3BP8A 2UU9K 4N47A 5BRFA 4FJJA 1J54A 4H0VB 4DSJA 2ITGA 4KHUA 1IJJA 4JKAA 4BWMA 3G71N 3KD5E 3CCQN 4DF8A 1ITGA 4CJSA 3PX4A 3ZSVA 3QICA 4NLBA 2BE2A 4IKFA 4OKEA 4DU3A 4BC3A 4HVJA 4YY3K 3O3GA 4DV0K 3M8PA 1NK8A 5ADXA 1RBRA 4H0TB 4AM7A 2E8AA 3DAWA 3VEWA 1BISA 2W6KA 2CH6A 3M8RA 2G8VA 1O13A 1UA1A 3ULEB 1NGIA 4O0JA 3DLGA 5T7BA 2HMIA 2RE2A 3SLCA 3M3ZA 4BRFA 3THWB 1REVA 4IFEA 2QA4N 3PY8A 1BG3A 2GX9A 1SL2A 1VSIA 5DK5A 1NNEA 2QKKA 4H03B 1NOZA 4DSLA 4EFHA 4IOXA 1KVCA 3KHYA 4AM6A 2F8SA 1EWRA 5HROA 4GV3A 4DUZK 4DR1K 4GKJK 4CZFA 4RG8A 1JLBA 4CCHA 3ULEA 1VQPN 3SNNA 2YKMA 1XMOK 2FSKA 3LP0A 4BC5A 4K41A 1HKBA 1NG9A 4AILC 4YFUA 3V9WA 4BG8A 1QQCA 3SUPA 2PY5A 3AVMA 3C6TA 1HX1A 2OPSA 3JAMO 1Q9YA 4KTWA 4O44A 2OPRA 4CZMA 3FFKB 3DLRA 4JHDA 3L4QA 4FZYA 2WC9A 1TAQA 4DLEA 2XY7A 4DV3K 2P9IB 1SL0A 3OS2A 1XWLA 3C6AA 1ATNA 2HHSA 4FSVA 3M6GA 3MX2A 3LAMA 3OYGA 2CGLA 3P4IA 3C7NB 3C65A 4ILGB 3H08A 2VWJA 3FZKA 2PAVA 4DSKA 5M1PA 3ATUA 4C8NA 2HSTA 4CGIA 4FXDA 3EEQA 4JI7K 2ATQA 2YHXA 4JKBA 4CEDA 2QK9A 2HBMA 1LW0A 1YVUA 3FZLA 4CF0A 1SAZA 3GDQA 2JWLA 4IXCA 3SPZA 2QWRA 3NVMA 2NRVA 3OYKA 2DTUA 4JKFA 4NXNK 4DFKA 5AJ3K 3HP9A 1N34K 4Y1CA 1V4TA 3U3GA 3QEPA 3AVLA 4H0XB 1RTHA 1MDUB 3T19A 4BVPA 2YHBA 1NJYA 3EY1A 4A57A 2AP1A 2IAJA 3HT3A 3E66A 2O8DB 5AQOA 3V9SA 2P1JA 3O9RA 4KHNA 3OYIA 2FBXA 3IRXA 1RNHA 4CVNE 2BGGA 4X66K 3TANA 3FZHA 5BPNA 3GOIA 1W0HA 3NBPA 4FL9A 3ZSQA 1VQ9N 1VSJA 5KQDA 4CE9A 3O80A 3V1OA 2KFNA 2D1KA 1LW2A 4DQRA 3CCMN 1GLBG 4G9ZA 3R3LA 4CHNA 2E2PA 1RBSA 4LFBK 1JL2A 5JS1A 3ZETB 1Q82O 4BDPA 2RKIA 1VRUA 4FWMA 4DS5A 4OPAA 4FJIA 3VQ6A 2HVIA 3RR8A 1SQKA 3SI6A 3M8SA 1S1TA 2I7NA 5KGXA 4DV4K 5TKWA 4DUYK 4KI6A 3B6OA 3RSEB 1X1PA 3DXKB 4ISGA 1WBBA 1K73O 4MLHA 3NCIA 3TTDA 3OBYA 4CJ5A 4KB0A 3AA3A 3KVGA 3CJ7A 4E19A 2HF3A 3F5TA 2FBTA 4E1JA 3CC7N 3EE9A 5EOYA 3ZEUA 4CEOA 3QNOA 4JI8K 2W41A 5BR9A 4CJ7A 4J2BA 1K8KB 1EWQA 1U6ZA 3AVNA 4Y0WA 4FO0A 1B92A 1E3MA 3RMDA 1Q18A 1J6ZA 4FVMA 3M8QA 4V19S 3T1AA 3H1VX 1LWCA 3NF7A 3OYDA 4GKKK 2ASMA 3NGIA 4N56A 4IO9L 3SZ2A 3TAGA 4CGGA 3OS1A 1NGEA 3KWGA 4CIGA 1W7AA 3HSCA 1GOBA 1HYSA 4OJRA 3T7ZA 3D2FA 4W5OA 4PKGA 2WOMA 2DY4A 2I5JA 3J8AA 3QDKA 1ASWA 1FXXA 3OYAA 3OVNA 2F4VK 4MQ3A 4DKWA 4FJMA 4LF5K 3NE6A 1BI4B 3LL3A 2F8TA 4O8UA 4ZHRA 4LY7A 3DWLA 2HHTA 5BN9A 1KTQA 3PSIA 2QEXN 3CETA 2IVNA 4FYDA 4B8CA 2CGKA 2G8FA 3OYMA 3PX6A 3TAQA 1LWEA 1NGFA 4DU1A 1XNQK 4O4GA 3NH1A 2V52B 2G8UA 3TU5A 3TAPA 2QWQA 2QKBA 4GVEA 3EKUA 3F2KA 1P90A 4H5TA 2NRHA 5AFUH 4GV9A 1RDDA 3VQ8A 3LDSA 3VQEA 3QNNA 3MEDA 4I9LA 1JLAA 1J53A 4F2SA 3VGMA 4EHTA 3OYEA 3ZT4A 1I39A 5AQFA 4BRHA 1OH6A 4CZGA 1WSEA 2IGIA 2YV0X 3VETA 5CR4A 2UXBK 1TKXA 4CF1A 3WXJA 4MFBA 3DRRA 4GW6A 2E5LK 1XNRK 2X74A 1Q8IA 4XH4A 3DXMB 4B3TK 3SBGA 1NJWA 2YI1A 4JRPA 3V6DA 3V9XA 3B6PA 4FM0A 2J4RA 3CI5A 1CZAN 4BC4A 4FLUA 2YHWA 1EO1A 5SZTA 1D8YA 3NGYA 1VQNN 1HPMA 4DTOA 5HP1A 2D0CA 2G8HA 3BZCA 2Z1GA 2E6MA 4CZIA 3G0ZA 1QVFM 2W6LA 4DTJA 1NK7A 2ZD1A 3SBTA 4CEEA 4M63C 2XHBA 3SAFA 3KWIA 4CESA 4B1XB 5AQSA 2O8EB 1M90O 4YDUA 2O4IA 1Z25A 3VQ5A 2O4GA 3K9JA 2VGNA 2A6AA 2OZMA 2YCHA 4NCAA 4A5AA 3J7ZO 3H1QA 1JCEA 3SAHA 2Q31A 1NK5A 4M3WA 1C0UA 1EETA 1N8RO 2KZMA 3ZSOA 4PL7A 5AQWA 4H5VA 5JS2A 1YI2N 4CJQA 4DTXA 4O5FA 1UA0A 4JEPA 4BR5A 3MEEA 1X9MA 4GMJB 5F1XA 3W3DA 1YUWA 4BQZA 4QOZB 1HPZA 4LSNA 1YVNA 3EKSA 3ID6A 3ZSXA 3RTVA 1C0TA 1KVAA 1NGGA 4C8MA 1QVGM 3B8AX 3JS6A 1U49A 4BR2A 3ZSWA 4CK2A 3SUNA 2AA4A 4JKDA 4CJUA 4OLAA 3P38A 4KBOA 1RDUA 4Q5VA 4CF8A 4QCLA 4B8AB 2HHXA 1GOCA 4ZTFA 3C6HA 1T8EA 3PX0A 4BC2A 3HSTB 4KTZA 2UYTA 3O9UA 4FLWA 2FSNA 1NMNA 3O1BA 2OTJN 5I42A 1SL1A 4MDBA 4AH9A 3S3MA 2NUBA 3OJSA 3VEYA 4W5TA 1NK0A
chains in the Genus database with same CATH topology
2RE2A 4FWQA 3M3ZA 3P39A 3SLCA 3D2FB 4CZLA 2HBLA 2P9SB 2V51B 1VQLN 3Q7BA 4BRFA 3CMAN 3E9LA 4IFEA 5AQUA 1DKGD 4H0YB 2QA4N 3IUCA 1BG3A 2GX9A 3H6EA 5AQTA 1HUXA 4H03B 4RWTA 2D0OA 4EFHA 4H0PA 3FZMA 3UB5A 4IOXA 5AQJA 3HI0A 1IG8A 5AZIB 4DCHA 4ILHA 3KHYA 4AM6A 2GELA 3H45C 5E84A 4GV3A 3H3NO 1U2VA 5C12A 5AQHA 1BWFO 2HBJA 4I6MB 4FWSA 5C15A 4I6MA 2P9NA 1T6CA 3VF2A 4CZFA 5TKYA 3CJCA 2DPNA 3TSPA 3TSQA 2QI2A 2NRWA 1ESVA 3ULEA 4FWLA 3WXIA 4B1UB 4BGBA 5JLHA 4FWPA 4WFBL 4BROA 1VQPN 1HKCA 4YOUA 3A5NC 4BRAA 3BF1A 1TYQA 5BN8A 2FSKA 3GL1A 4BC5A 3TPQA 4A61A 1WOQA 4K41A 1K8AO 1HKBA 2GUPA 1C0FA 2PFUA 5F0XA 4B9QA 5FPEA 5CHIA 2Q2RA 3A5LC 4JKEA 4BG8A 4JK7A 3VERA 4GV6A 1BDGA 2Q0RA 4A5BA 1HX1A 4HWIA 4B1VA 3A0IX 4KH5A 4EHUA 2BUPA 1YIJN 2ZWHA 2QWMA 4FPBA 3CD6N 3DXKA 1DEJA 5BREA 3AY9A 1YAGA 2NZTA 4CZMA 3FFKB 4JD2A 4JHDA 3WXKA 1QQNA 3L4QA 2WC9A 3MMVA 3VPZA 3WEEA 4BREA 4XH5A 4B1YB 2P9IB 2ZJRL 4YORA 3VESA 2H3GX 3P31A 3C6AA 1ATNA 3CJ9A 4WCEL 4FSVA 3M6GA 3JXUA 3MX2A 3MK6A 1NGJA 4GY2B 2FF3B 5HOOA 4UY8O 2CGLA 3P4IA 2IIRA 3C7NB 4JKGA 3C65A 4PKIA 5AQMA 4ILGB 2HBKA 4DHYA 1VQ5N 1QZ5A 3ENHA 3FZKA 1Y64A 4IJNA 2PAVA 4A62A 3E9PA 5M1PA 4IZ9A 4FWNA 3ATUA 4A59A 3VGKA 4JNEA 1U2VB 1BA0A 2HSTA 4BRMA 3D2EA 1LCUA 2Q97A 3WEEB 5FPMA 2YHXA 5C2FA 3IKMA 4JKBA 3HRGA 3O8MA 4ISFA 4J8FA 3E1YA 1Q86O 5GAHP 2HBMA 5BRHA 4WQ5A 3FZLA 1SAZA 3GDQA 4WQ5C 3UE5A 2JWLA 3MDQA 4ISEA 4QS9A 3PLAA 4IXCA 5EVZA 4WQ4A 1NGCA 4YOWA 2QWRA 3CERA 3D7EO 3NVMA 4PKHA 1E4GT 2NRVA 5AZJB 2A40A 4JKFA 3ZX0A 2P9UA 3LDOA 2GWJA 3VENA 2Q36A 3VOVA 2RHKA 5GAEP 3UKRB 1OKJA 1V4TA 2QM1A 4CBUA 4WYBA 2I7PA 1ATSA 4CZJA 3I8BA 5M1OA 5AR0A 2E2NA 3PIPL 3O6WA 3E9OA 4H0XB 1MDUB 1VQON 2KHOA 4BVPA 5AFUA 1HJOA 1H1VA 3CCUN 4BRIA 5GINA 1MWMA 3HOSA 4QS7A 4A57A 2AP1A 2W40A 1YJ9N 4EAHD 1YXQA 3E66A 3VGLA 5C2DA 2GEMA 1NGHA 3VEVA 4BG9A 4IO8A 5AQOA 5HL7L 3VF4A 3O9RA 1HLUA 1R59O 3O9QA 4FOIA 3QB0A 5AQVA 3DLLL 3NVKA 1QQMA 3ENOA 4U7BA 3CHWA 2FF6A 1TUUA 3EZWA 1GLAG 1GLLO 1P8ZA 2ZF5O 4C1NI 1XUPO 5BPLA 2OTLN 1NBWA 3ZEUB 1C0GA 2BTFA 3M5RA 3ZX2A 2HOEA 4CZHA 4H0OA 3FZHA 5BPNA 5GIOA 3CF5L 3SMPA 3FE1A 3GOIA 3C7NA 4JKGB 1YJNN 3LDPA 3SAGA 4FL9A 4MDAA 1VQ9N 3I33A 1V4SA 5AQRA 1K8KA 2HMPA 2Q0UA 3AAQA 5KQDA 3L0QA 5AQPA 5M1FA 3O80A 1VQ4N 2D1KA 3U4LA 3RSEA 2V7ZA 3CCMN 1GLBG 3N4PA 2QW9A 3BUZB 3N4QA 3VTHA 4RCHA 4G9ZA 4JKHA 1BA1A 3R3LA 3C0BA 4NLCA 5JICA 2E2PA 1Q7YO 3HM8A 3ZETB 4YOYA 1Q82O 2NLXA 1YITN 4FWMA 4XEIA 4OPAA 5EY4A 4GNIA 5GAGP 3NMUA 3LDNA 3LDLA 2HF4A 3U9ZA 2F7TA 3WQTA 4H5WA 4B1ZA 1SQKA 4KH6A 2YX6A 3CCRN 4BR7A 3MX5A 2I7NA 3MCPA 4QS8A 1Z6RA 4M7YA 3QMLA 5TKWA 1JCFA 2NNWA 3CC4N 5M1KA 1KQSM 3F9MA 3IDHA 3WQUA 4JHDB 3RSEB 5LJWA 3CXCM 3DXKB 4ISGA 5AQXA 3FR0A 1K73O 4MLHA 1GLFO 1VQMN 3TTDA 1QZ6A 3OBYA 4BRDA 3CIPA 4C1NK 3ZETA 1GLCG 3CMEN 3L6QA 4MLEA 3LM2A 3KVGA 4MO5A 3CJ7A 5JMVA 2HF3A 3F5TA 1SZ2A 4FWKA 4U67L 4E1JA 2NRZA 1LOTB 1ZBSA 1JCGA 4KH4A 3EE9A 3CCVN 5MLCQ 5EOYA 3OW2M 3CC7N 3ZEUA 1OVYA 1TYQB 3MN6A 1MA9B 5AQLA 1XC3A 1X3NA 2W41A 5BR9A 5KPTA 2GTDA 4CJ7A 3TTFA 1K8KB 4R79A 1U6ZA 2YHYA 4BQLA 1NMDA 4Y0WA 5LY3A 4FO0A 3K9KA 1J6ZA 1Q18A 1NJIO 1BOTO 4BRLA 3T69A 5FPDA 2ASPA 4BRNA 5KQ8A 2E88A 3H1VX 3R9PA 2A5XA 2F9WA 2Q1NA 3HTVA 3EN9A 2ASMA 1K9MO 3WXLA 3ZYYX 3IMXA 4FWRA 1G99A 4IO9L 3GE1A 1BUPA 5AQQA 3H46O 2IVOA 5F2RA 2YJEA 2KKZA 3QFUA 1NGEA 3KWGA 3HSCA 2A41A 4BRCA 5I9EB 3T7ZA 3D2FA 2E2QA 4PKGA 1YJWN 1KAZA 3EE8A 5AQYA 4C23A 5ADXH 1S72N 3J8AA 3QDKA 5DM6L 1Z05A 4YOVA 2PBDA 1YF5L 4JD2B 4IEIA 1KAYA 4DKWA 4EIAA 3LL3A 4BVOA 3G25A 4BRGA 4O8UA 4BY9C 3CQXA 3DWLA 5BN9A 4JK8A 1QQOA 2FXUA 1YHQN 3TTCA 3MCAB 5JVGL 4LC9B 5AQGA 3VEXA 3AGKA 3FGUA 2P9IA 3CETA 2QEXN 2IVNA 4BRQA 4YOTA 5H1SQ 4PL8A 4FOEA 1RFQA 2CGKA 4OPHA 1NGFA 3FZFA 2V52B 2FLOA 1WUAA 1S3XA 3TU5A 4H5RA 3Q7CA 1T44A 3GBTA 2NRXA 2QWQA 2OANA 4GVEA 2P9KB 3EKUA 2QWNA 3F2KA 3O5BA 1P90A 3R6MA 1X3MA 4H5TA 2NRHA 3KZBA 4K25A 3G4SN 5AFUH 5DM7L 2QWLA 1XQSC 4CI6A 1NGBA 3IFRA 4GV9A 1NM1A 1KAXA 4DB3A 4JN4A 2E20A 2ITMA 1E4FT 2ASOA 2P9PA 3CCLN 3I55N 4NB4A 3O9SA 5BPMA 1KD1O 5GADP 3VGMA 1DT9A 5JVHL 2P9LB 4EHTA 3HOTA 3S41A 4K42A 3CJBA 5AQFA 4BRHA 2E1ZA 3EO3A 5AQIA 2P9SA 3SMSA 4CZGA 1GLEG 1NGDA 3VETA 5CR4A 2IVPA 2YJFA 2CH5A 2P9KA 5EX5A 1RGIA 3CCEN 3D6RA 1VQKN 2BH1A 4RTFD 2GWKA 3WXJA 2ZJPL 2QWPA 4XH4A 1Q81O 3DXMB 4O8KA 3PIOL 4FPAA 3MN7A 5AZIA 4A2AA 3SBGA 1M1KO 2D0PA 2YI1A 4JAXA 4XH1A 3H3OB 3UKUA 3WUHA 1ILYA 1T3VA 5KPRA 5C10A 2FSJA 4CD1A 2J4RA 3VMFB 3CI5A 1CZAN 3EL2A 3CJAA 1ATRA 3MN9A 4BC4A 3R8EA 4Z94A 3O1WA 1VQ8N 2P9NB 2YHWA 2NRRA 4IDHA 5M1QA 1EO1A 3OHRA 3CC2N 5AQKA 5AQZA 1VQNN 1HPMA 1VQ6N 3VTIA 4BRKA 3BEXA 5EXWA 4IOAL 3BF3A 1QHAA 4CZIA 2JWKA 4FVUA 2VYPA 5AZJA 4HTLA 4YOXA 3QFPA 1QVFM 4L3QA 5C0YA 4IOCL 3SBTA 4IEEA 3FLCO 3ID8A 3O08A 5FPNA 4BGAA 5B8HA 1NLVA 4M63C 1X9JA 4ILJA 3SAFA 4WFNL 1HKGA 2VGMA 3KWIA 2VWBA 3DXMA 2A3ZA 2VCPA 2D4WA 3RVCA 5BRDA 4B1XB 3KK7A 2QXLA 3QBWA 3CPWM 3R1XA 3CPEA 3HBTA 3D2EB 3A8YA 5AQSA 5ELZA 1VAZA 5CE3A 1M90O 1NWKA 4YDUA 2ZGZA 4AF1A 4OO1J 1BO5O 2ZGYA 4WQ4C 3U8XA 5GIPA 3K9JA 2VGNA 3SJHA 1SS6A 5KPZA 2A6AA 2YCHA 3M1FA 3MWTA 3A5OC 3ATVA 2CGJA 2P9LA 3CCJN 4BRPA 4JKCA 4A5AA 3OA9A 3AGRA 1GLJO 3J7ZO 3H1QA 1JCEA 3VEOA 3SAHA 3G6EN 2WFBA 2Q31A 1T6DA 2EWSA 4M7XA 2E2OA 2WUSA 5E26A 3O9TA 4CZKA 1KC8O 3UKRA 1N8RO 1GLDG 4YDUC 3ZX3A 3CCSN 2NRTA 4PL7A 2E1YA 5AQWA 4H5VA 5JLFA 4CBXA 1YI2N 1W2BM 4O5FA 4H5NA 4JEPA 4MO4A 4BR5A 4FWOA 4NO7A 3MN5A 4IWVA 1YUWA 3W3DA 4A2BA 4BQZA 1TUYA 2V7YA 3U9DA 5F1XA 4WFAL 1ZC6A 3TSUA 4JK9A 4F9OA 3QBXA 3UKUB 1JJ2M 1YVNA 3EKSA 3ENBA 3ID6A 3I56N 3SK3A 3GG4A 4WF9L 1MWKA 2P9PB 1NGGA 2A42A 3WT0A 1QVGM 3B8AX 3JS6A 4BR2A 1D4XA 1ZXOA 4CD3A 1DGKN 5LJVA 1RDWX 3BP8A 3W0LA 2AA4A 5BRFA 3VEZA 1NGAA 4K43A 3DJCA 4BR9A 3A5MC 3AAPA 4H0VB 3MWPA 1IJJA 4JKAA 4JKDA 3G71N 3WXMB 1KXPA 3CCQN 3P38A 4KBOA 1RDUA 4CBWA 4PHTX 3QICA 4NLBA 4B1WB 3OBWA 2F9TA 1W97L 3C6HA 3LDQA 1BU6O 4BC3A 1S22A 2WBNA 4BR0A 4DQ8A 4BC2A 5ADXA 4H0TB 4AM7A 2E8AA 3O4WA 3DAWA 5M1NA 1EQYA 1VQ7N 4IJAA 3VEWA 2UYTA 3O9UA 2FSNA 2QTDA 3O1BA 5AQNA 2CH6A 2ZJQL 3VF6A 3L4IA 2OTJN 2KLAA 3AARA 4BR4A 4MDBA 1O13A 2QWOA 3VEYA 3LM9A 3CQYA 3ULEB 1NGIA 3CJ1A 3HZ6A 4CZEA 2P9UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOS A;  3HOT A;  4R79 A;  5CR4 A;  5HOO A;  4U7B A;  4MDA A;  3K9K A;  3F2K A;  3K9J A;  4MDB A;  2F7T A; 
#chains in the Genus database with same CATH topology
 4FWQ A;  3P39 A;  2HW3 A;  4CGD A;  3TAR A;  3Q7B A;  3ALY A;  4C8O A;  4OGE A;  4CJK A;  4W5R A;  4HCB A;  3HPG A;  4KKO A;  4H0P A;  1HNX K;  3HI0 A;  3LP1 A;  4DCH A;  4B3R K;  1ZYQ A;  3H45 C;  5E84 A;  1TL1 A;  2D5R A;  4YNQ A;  3H3N O;  1RT5 A;  4B9V A;  1IKX A;  1BWF O;  4I6M B;  5C15 A;  4CER A;  3CJC A;  5TKY A;  1VHX A;  2A1R A;  1S1U A;  1S9G A;  2NRW A;  4B1U B;  4FWL A;  1C0M A;  3WXI A;  3L2Q A;  3V1R A;  1HKC A;  1MU2 A;  1S1W A;  4BRA A;  4E7J A;  1U45 A;  5KTQ A;  3GL1 A;  4A61 A;  2W42 A;  1K8A O;  4FZX C;  4B9Q A;  2YKN A;  2Q2R A;  3A5L C;  4JKE A;  1UOC A;  2X6S A;  3NH0 A;  2Q0R A;  4EHU A;  3A0I X;  3OYF A;  1FK9 A;  1YIJ N;  3QEI A;  2ZWH A;  4FPB A;  4DV5 K;  4DQP A;  3DXK A;  1DEJ A;  4FJX A;  2OPQ A;  5CYM A;  4JD2 A;  3T3F A;  3WXK A;  1JLG A;  4FJ5 A;  3VPZ A;  3WEE A;  4BRE A;  4E3S A;  3VQ7 A;  3VES A;  2H3G X;  3P31 A;  2RPI A;  5FRM A;  2Z1J A;  3AVC A;  1S1X A;  3MXM A;  1BQM A;  4UY8 O;  4KV8 A;  5K14 A;  4DHY A;  4RW6 A;  1QZ5 A;  1VQ5 N;  3L2W A;  3E9P A;  4IZ9 A;  4F2R A;  1BA0 A;  4Q0B A;  1LCU A;  2HHW A;  1C1A A;  2P5G A;  4DTS A;  3DLB A;  4ISF A;  1Q86 O;  3E1Y A;  5BRH A;  3PO5 A;  4PWD A;  1JLF A;  4WQ5 C;  4UQG A;  4ISE A;  2YHA A;  3PLA A;  4DFJ A;  2QXF A;  4YOW A;  3CER A;  3D7E O;  4LH4 A;  1XC9 A;  4DV1 K;  1RTJ A;  3VOV A;  3VEN A;  3SUQ A;  2RHK A;  3UKR B;  2Y1I A;  5BR8 K;  3AV9 A;  4CBU A;  3E01 A;  1ATS A;  4B3M K;  3PIP L;  4F4K A;  2UXC K;  3HVT A;  1HJO A;  4B9S A;  4BRI A;  5GIN A;  4KPY A;  3KJV A;  1YXQ A;  4H8K A;  4K0K K;  2GEM A;  3VEV A;  1IBK K;  1HLU A;  1B9F A;  2A1S A;  5AQV A;  3DLL L;  2X6N A;  3EZW A;  2OZS A;  1GLA G;  1GLL O;  2ZF5 O;  4C1N I;  1Z26 A;  1XUP O;  1C0G A;  4CZH A;  4BE1 A;  1YT3 A;  2UUB K;  1IBL K;  1B9D A;  3OYL A;  3LDP A;  3SAG A;  3K59 A;  1RT1 A;  3AAQ A;  4CW7 B;  3L0Q A;  5M1F A;  4J2A A;  3QO9 A;  1OH5 A;  3U4L A;  2V7Z A;  3KKR A;  2D0B A;  3N4P A;  5C24 A;  3BUZ B;  4JKH A;  3C0B A;  1RDC A;  3TR8 A;  1J9A A;  3HK2 A;  2NLX A;  1YIT N;  4XEI A;  5EY4 A;  4GNI A;  1O1W A;  3LDL A;  2HF4 A;  1U04 A;  3WQT A;  3U9Z A;  3SCX A;  4KH6 A;  2YX6 A;  4X65 K;  4BR7 A;  3S9H A;  3CC4 N;  4LF9 K;  3AO3 A;  4IG0 A;  5M1K A;  1RT3 A;  4JI0 K;  2P51 A;  3IDH A;  3WQU A;  5FDL A;  1LV5 A;  5AQX A;  1WSI A;  1VQM N;  3V1Q A;  1VSM A;  1QZ6 A;  4BRD A;  3CIP A;  3MXI A;  1GLC G;  2OPP A;  1JLE A;  1Q9X A;  4DR6 K;  1W9H A;  3LM2 A;  3WNG A;  1NJZ A;  4FWK A;  1DTT A;  2NRZ A;  4KH4 A;  1WN7 A;  1JCG A;  3CCV N;  5MLC Q;  4BE2 A;  1NKC A;  3MN6 A;  5AQL A;  1MA9 B;  1XC3 A;  3AVG A;  1UAX A;  4FJG A;  1EX4 A;  5I3U A;  5CZ1 A;  2O8C B;  1S1V A;  2G8W A;  4BRN A;  5KQ8 A;  4JLH A;  2Q1N A;  1BIU A;  3ZCM A;  1FJG K;  1K9M O;  3VQC A;  2IOC A;  1UWB A;  4NYF A;  3IMX A;  1G99 A;  3AVJ A;  5AQQ A;  1KRP A;  5I9E B;  4DQI A;  4DTP A;  2E6L A;  4BE0 A;  1NU0 A;  3LP2 A;  3SV3 A;  4PY5 A;  1DTQ A;  3EE8 A;  4C23 A;  2OCE A;  4YOV A;  1KLM A;  2PBD A;  4B9T A;  2XRI A;  3DRP A;  2VG7 A;  4BVO A;  4BRG A;  3V9U A;  4BY9 C;  3CQX A;  4DF4 A;  3THY A;  1RTI A;  4JK8 A;  2FXU A;  3P1G A;  5AQG A;  5H1S Q;  4CFA A;  3AO5 A;  3LPU A;  3MEG A;  1KFS A;  1QSS A;  1XHX A;  2WTU A;  4DWI A;  1IKY A;  4I2Q A;  4PQU A;  1WLJ A;  3A2F A;  1NK4 A;  2OAN A;  3S3N A;  3L2V A;  2P9K B;  3R6M A;  3THW A;  4K25 A;  2P5O A;  1X3M A;  4N5S A;  2QWL A;  1XQS C;  4CI6 A;  3IFR A;  2DFF A;  3MEC A;  4KB1 A;  1E4F T;  3WNH A;  2ASO A;  2P9P A;  3O3F A;  3CCL N;  1S6Q A;  3MXJ A;  1SV5 A;  3LP3 A;  3O9S A;  1KD1 O;  1S6P A;  2P9L B;  4CJW A;  4FCY A;  4FJL A;  4KRF A;  1T7P A;  4BDY A;  2E1Z A;  2F96 A;  1NGD A;  5D3G A;  2IVP A;  1RGI A;  3CCE N;  3D6R A;  1VQK N;  2QWP A;  4ELU A;  1Q81 O;  1KSP A;  4O8K A;  4FPA A;  1VSK A;  1L3S A;  2D0P A;  4JAX A;  4CEA A;  1J5E K;  4DSI A;  1ILY A;  3NF9 A;  5KPR A;  3EL2 A;  3ITH A;  3HVR A;  3PO4 A;  3CJA A;  4K8X A;  3MN9 A;  4Z94 A;  4YHH K;  1XMQ K;  1VQ8 N;  1SUQ A;  1WSF A;  2NRR A;  1BCO A;  4FM2 A;  3OHR A;  2G8K A;  1C6V A;  5AQK A;  5AQZ A;  4BRK A;  5EXW A;  1VSL A;  3KK3 A;  3BF3 A;  1QHA A;  4FJH A;  4IOA L;  3J7A P;  2VYP A;  5AZJ A;  4FM1 A;  4E7K A;  5C0Y A;  4FJK A;  1HR0 K;  3FLC O;  1TL3 A;  5J2P A;  4PA1 A;  5B8H A;  4ILJ A;  2RF2 A;  3K58 A;  3BGR A;  2VWB A;  3DXM A;  3J81 O;  3AO1 A;  3CPW M;  3KK7 A;  3QBW A;  4CJE A;  1WBD A;  3C6U A;  4RW7 A;  5ELZ A;  2UXD K;  4NCB A;  4CFB A;  4DQS A;  4WQ4 C;  5GIP A;  3VQ4 A;  1SS6 A;  5KPZ A;  3CM6 A;  3TAF A;  3CCJ N;  4BRP A;  3CFP A;  3VEO A;  2WFB A;  4IFY A;  3ZSR A;  4M7X A;  2E2O A;  3O9T A;  4CZK A;  4YDU C;  3CCS N;  4DR5 K;  2E1Y A;  5JLF A;  4CBX A;  4IFV A;  3L2U A;  4E7H A;  4J2E A;  3NHG A;  4H5N A;  4MO4 A;  1BCM A;  3RMA A;  3THV A;  3TSU A;  3UKU B;  3ENB A;  2YNI A;  3SK3 A;  3HM9 A;  3LWM A;  3WT0 A;  1YTA A;  1C1B A;  1ZXO A;  2DFH A;  5LJV A;  3ULD A;  3W0L A;  4QAG A;  3VEZ A;  1IKW A;  1RDB A;  3DJC A;  3DOK A;  3AVH A;  4K43 A;  4BR9 A;  4AHV A;  5C25 A;  1HQU A;  3NF6 A;  3WXM B;  3P5J A;  3KK1 A;  4CBW A;  4PHT X;  4CF9 A;  3OBW A;  4ICL A;  2HHH K;  2F9T A;  4LFC K;  3LDQ A;  5HRP A;  3RWU A;  1CXQ A;  4BR0 A;  1WB9 A;  5FRO A;  1X9S A;  5M1N A;  1EQY A;  4IJA A;  1RCH A;  2X78 A;  1RBV A;  1Y97 A;  2ZJQ L;  3L4I A;  2KLA A;  3AAR A;  3BDP A;  4RW8 A;  3FFI A;  3CQY A;  4W5Q A;  4M45 A;  2BAN A;  4CZE A;  4FJ9 A;  4K8Z A;  1QTM A;  1YTU A;  3D2F B;  2V51 B;  2P9S B;  3IAY A;  2O8F B;  3CMA N;  3E9L A;  4DTR A;  1DKG D;  4M3R A;  3IUC A;  4B08 A;  3H6E A;  5AQT A;  2ZM6 K;  2D0O A;  3UB5 A;  3FZM A;  5AQJ A;  3F9K A;  5AZI B;  3VQA A;  4ILH A;  4AHS A;  4HHT A;  3K5M A;  4N76 A;  2FC0 A;  5AQH A;  1L3V A;  1T6C A;  3VF2 A;  2DPN A;  3TSP A;  1NKB A;  4Z4C A;  1R0A A;  3VQP A;  3AO2 A;  3HPH A;  4ELV A;  4YOU A;  1NK6 A;  3BF1 A;  3IG1 A;  1BQN A;  3TPQ A;  2PFU A;  5DMR A;  5F0X A;  3DYA A;  5FPE A;  4O55 A;  1WAJ A;  4CHZ A;  3VER A;  3L2R A;  4GV6 A;  1BDG A;  4A5B A;  2BUP A;  2QWM A;  3AY9 A;  1YAG A;  2NZT A;  1QQN A;  3MMV A;  4I2P A;  4B9U A;  4E1M A;  4XH5 A;  4OLB A;  4B1Y B;  2HB5 A;  4DTU A;  3V4I A;  4YOR A;  4DTN A;  3QES A;  3JXU A;  3BZK A;  1NGJ A;  4GY2 B;  5FRN A;  2FF3 B;  3TWH A;  4FK4 A;  2HVH A;  2IIR A;  4PKI A;  5AQM A;  4CEC A;  1VSH A;  3ENH A;  5J2Q A;  1Y64 A;  4IJN A;  3DLE A;  4A62 A;  4KHS A;  3KIO A;  3OYB A;  1QHT A;  4A59 A;  4JNE A;  1U2V B;  3D2E A;  3S3O A;  2Q97 A;  4H4O A;  5FPM A;  1VSF A;  2BDP A;  5C2F A;  3IKM A;  4EP5 A;  4J8F A;  3EZ5 A;  4LFA K;  3UE5 A;  3MDQ A;  4QS9 A;  4FJ8 A;  4DR7 K;  4Z4I A;  1E4G T;  5AZJ B;  3ZX0 A;  2P9U A;  3LDO A;  2GWJ A;  5GAE P;  2O8C A;  1JXB A;  3ZSY A;  2QM1 A;  2I7P A;  4CZJ A;  2VQF K;  2GUI A;  3O6W A;  3KLF A;  4KHY A;  4DFM A;  5SWM A;  1S9E A;  1VQO N;  1XI1 A;  1H1V A;  3L3V A;  4BAC A;  2W40 A;  1N5Y A;  4OPK A;  4EAH D;  4I9Q A;  3RR7 A;  1NGH A;  3ZT3 A;  1R59 O;  3O9Q A;  3QB0 A;  1QQM A;  3KD1 E;  1L5U A;  2FF6 A;  2OTL N;  2XY8 A;  1P8Z A;  2Y1J A;  1NBW A;  2BTF A;  4DV2 K;  3ZX2 A;  1RT4 A;  4CFC A;  4JRQ A;  5GIO A;  3CF5 L;  3RMB A;  3C7N A;  4MDA A;  2JLE A;  3ZT1 A;  4L8R B;  3O4Q A;  5AQR A;  1K8K A;  2HMP A;  1D9F A;  5AQP A;  2GV9 A;  4FZZ A;  1VQ4 N;  3RSE A;  4CIE A;  4FJN A;  3DLK A;  4CIF A;  1C1C A;  3VTH A;  4J2D A;  1BA1 A;  5KGW A;  5JIC A;  4HUE A;  3K5N A;  3SPY A;  1WSG A;  1ZBU A;  3HM8 A;  4CJ3 A;  4YOY A;  3NGZ A;  3I8D A;  1CZ9 A;  4M3X A;  2IC3 A;  5GAG P;  3NMU A;  3AA5 X;  4NXM K;  2F7T A;  4B1Z A;  4H5W A;  3SV4 A;  3CCR N;  3MX5 A;  3HJF A;  4QS8 A;  1Z6R A;  3CYM A;  4M7Y A;  2OYQ A;  5CYQ A;  1KQS M;  3F9M A;  3NDK A;  4JHD B;  3CXC M;  4CEF A;  3C94 A;  3FR0 A;  1GLF O;  2UUA K;  4C1N K;  3CME N;  4C8K A;  3L6Q A;  4MLE A;  3HL8 A;  4MO5 A;  3OY9 A;  5JMV A;  1SZ2 A;  1WSJ A;  3SQ4 A;  4CJR A;  1LOT B;  1OVY A;  1QE1 A;  4CK1 A;  1IBM K;  1JLQ A;  1X3N A;  3OYH A;  3KTQ A;  4R79 A;  1KCF A;  5LY3 A;  2KFZ A;  1BHL A;  4LF8 K;  4FLY A;  1BOT O;  3T69 A;  5FPD A;  3HYF A;  1VSD A;  4Y1D A;  1A5V A;  3NH2 A;  2E88 A;  3R9P A;  1G15 A;  2F9W A;  3HTV A;  4OGC A;  3OS0 A;  1IKV A;  3EN9 A;  3OYJ A;  1T03 A;  3WXL A;  1OH7 A;  4IDK A;  1RT2 A;  2IVO A;  5F2R A;  2YJE A;  3KLE A;  4KTQ A;  3QFU A;  4FW1 A;  2IDO A;  3BY5 A;  2E2Q A;  1YJW N;  1HNV A;  1KAZ A;  5AQY A;  5ADX H;  4ID1 A;  1S72 N;  4IEI A;  1BI4 A;  1KAY A;  2IS3 A;  4B9N A;  3QEW A;  4HUG A;  4I7F A;  3DM2 A;  1QQO A;  1YHQ N;  3MCA B;  3TAB A;  1VRT A;  3AGK A;  3FGU A;  3SUO A;  2PZS A;  3FZF A;  4LH5 A;  1WUA A;  1S3X A;  3LAK A;  4H5R A;  1T44 A;  3GBT A;  4LF4 K;  3OJU A;  4DR4 K;  4W5N A;  3G4S N;  3KZB A;  3I0R A;  4CGF A;  1NM1 A;  2E4L A;  1N36 K;  2E20 A;  1TGO A;  2ITM A;  3QIO A;  3CM5 A;  4NB4 A;  2FBV A;  5JVH L;  4AHR A;  4HTU A;  3HOT A;  1TK0 A;  4K42 A;  3ZLJ A;  2Q3S A;  1LAV A;  2P9S A;  4LF6 K;  3AA4 A;  3OYC A;  4LSL A;  3WNF A;  2P9K A;  1F21 A;  3ZT0 A;  3QEV A;  2ZJP L;  3HPO A;  2GWK A;  4CEZ A;  3D0P A;  3PIO L;  5AZI A;  1TKT A;  4XH1 A;  2B4J A;  5C10 A;  1HJR A;  5C42 A;  4FLV A;  3AVB A;  1XHZ A;  3R8E A;  3PV8 A;  3RRG A;  3O1W A;  2DFE A;  3HO1 A;  1NK9 A;  3C95 A;  3AVI A;  4BWJ A;  3RRH A;  1VQ6 N;  3VTI A;  4CHQ A;  3DRS A;  4B3S K;  2O8D A;  2JWK A;  4FVU A;  4HTL A;  3VQQ A;  4DFP A;  3PSF A;  1QSY A;  5HRR A;  4M3Y A;  4B9L A;  4IEE A;  3ID8 A;  3O08 A;  5FPN A;  4BGA A;  3JSM A;  4DSE A;  4KHW A;  1HKG A;  2HNY A;  1KFD A;  2VCP A;  3R1X A;  3HBT A;  3D2E B;  3A8Y A;  2HNZ A;  1HNW K;  2ZGZ A;  4AF1 A;  4RW4 A;  1FKP A;  3U8X A;  4CFD A;  1NJX A;  3A5O C;  3ATV A;  3NFA A;  4JKC A;  3AGR A;  1GLJ O;  3G6E N;  1T6D A;  1KC8 O;  3UKR A;  3ZX3 A;  2NRT A;  1SKW A;  5EU7 A;  4E89 A;  3QEX A;  1W2B M;  4HCC A;  3QLH A;  4KRE A;  4DS4 A;  1TUY A;  3U9D A;  4WFA L;  3I56 N;  5IT9 O;  2HHQ A;  4E1N A;  1MWK A;  4KI4 A;  2VWK A;  3IS9 A;  4EP4 A;  1RDW X;  4F3O A;  3G10 A;  4DLG A;  1NGA A;  4AQY K;  1ZBL A;  3A5M C;  3AAP A;  3KKS A;  3MWP A;  1JXE A;  1KXP A;  4B1W B;  5KI6 A;  1OVQ A;  4PUO A;  1W97 L;  1BU6 O;  1S22 A;  2WBN A;  1KLN A;  1N33 K;  4DQ8 A;  1WSH A;  4M3Z A;  4R5P A;  3O4W A;  1VQ7 N;  2VG6 A;  3LWL A;  2QTD A;  5AQN A;  4DTM A;  1CXU A;  3DLH A;  3VF6 A;  2O8E A;  1T05 A;  1LWF A;  4BR4 A;  2QWO A;  4KAZ A;  1J5O A;  3LM9 A;  1VSE A;  1EXQ A;  3CJ1 A;  3HZ6 A;  2O8F A;  2P9U B;  4CZL A;  2HBL A;  1VQL N;  5AQU A;  4XIU A;  4H0Y B;  5LL6 Z;  3SQ1 A;  1HUX A;  4RWT A;  3AVK A;  4JS5 A;  1IG8 A;  2GEL A;  2B5J A;  1RBU A;  4DV7 K;  2XY5 A;  1FW6 A;  4OKJ A;  1U2V A;  5C12 A;  2YNH A;  3AVA A;  2HBJ A;  4FWS A;  4I6M A;  2P9N A;  3L3U A;  3TSQ A;  3KLI A;  1TKZ A;  2QI2 A;  3ISN C;  1ESV A;  5JLH A;  4BGB A;  3QET A;  4FWP A;  4WFB L;  4BRO A;  3J7Y P;  3J80 O;  3A5N C;  1TYQ A;  5BN8 A;  3PUF A;  4CJT A;  5LMN K;  1WOQ A;  2GUP A;  1C0F A;  1I3A A;  5CHI A;  2VG5 A;  1NKE A;  4JI5 K;  2LSN A;  4JK7 A;  2GBZ A;  3V81 A;  4GVM A;  4B1V A;  4HWI A;  1U48 A;  4KH5 A;  4AHC A;  4CJ4 A;  3CD6 N;  4CJL A;  5BRE A;  4CHY A;  4FLX A;  3VA3 A;  5KRS A;  4FK0 A;  1L3T A;  2Z1I A;  3T1H K;  1TVR A;  4F3T A;  3SYZ A;  2ZJR L;  4CHO A;  3KLH A;  5LMU K;  4ZTJ A;  4OPJ A;  3CJ9 A;  4WCE L;  3MK6 A;  4AHT A;  4M3T A;  5HOO A;  3DOL A;  3CFR A;  4JKG A;  4DMN A;  2HBK A;  4CK3 A;  1VK0 A;  1S5J A;  4OVL A;  4O0I A;  3L8B A;  4E7L A;  5E41 A;  4FWN A;  4O5B A;  3VGK A;  3U6F A;  2WON A;  4BRM A;  5J1E A;  3WEE B;  1RDA A;  3KLG A;  3HRG A;  3O8M A;  5GAH P;  4KHP K;  4WQ5 A;  4TSX A;  4C8L A;  2OA8 A;  3WNE A;  1L3U A;  5EVZ A;  3LPT A;  4WQ4 A;  1NGC A;  1JKH A;  2FBY A;  3D45 A;  1IG9 A;  4PKH A;  2A40 A;  4AHU A;  2Q36 A;  1U4B A;  1OKJ A;  4B9M A;  1QSL A;  4WYB A;  1JL1 A;  3I8B A;  5M1O A;  5AR0 A;  3CG7 A;  5A2Q O;  2E2N A;  4EZ6 A;  3E9O A;  5HLF A;  2KHO A;  5AFU A;  3CCU N;  4HUF A;  2KZZ A;  3CQ8 A;  1FKO A;  1D9D A;  1MWM A;  3HOS A;  4QS7 A;  1YJ9 N;  3ZSZ A;  3VGL A;  5C2D A;  3CFO A;  1HNI A;  4IO8 A;  4BG9 A;  1GOA A;  5HL7 L;  3VF4 A;  4FOI A;  3NVK A;  3THX B;  2EHG A;  3ENO A;  4U7B A;  3SQ0 A;  1DLO A;  1BL3 A;  1BGX T;  3CHW A;  3MAQ A;  1TUU A;  5BPL A;  3VQ9 A;  5CY4 A;  3ZEU B;  3M5R A;  2RN2 A;  2HOE A;  3KK2 A;  4EZ9 A;  1HYV A;  3SJJ A;  4H0O A;  2KTQ A;  3SMP A;  3FE1 A;  4X64 K;  4JS4 A;  4JKG B;  1RTD A;  1YJN N;  5KRT A;  4IBN A;  5J2N A;  1JLC A;  3I33 A;  4N41 A;  1V4S A;  2Q0U A;  4DV6 K;  4NYN A;  4FK2 A;  2QW9 A;  1CZB A;  3N4Q A;  4RCH A;  3AVF A;  5FLX O;  4E7I A;  4NLC A;  4ID5 A;  1WAF A;  1Q7Y O;  4CGJ A;  3DI6 A;  2XO7 A;  1X9W A;  3LDN A;  1U47 A;  1HMV A;  4FJ7 A;  3QIP A;  4DR2 K;  3MCP A;  3QML A;  1JCF A;  2NNW A;  5J2M A;  3THY B;  3AA2 A;  1N6Q A;  3ZT2 A;  4CEQ A;  1I94 K;  3QER A;  3K5O A;  2VQE K;  5LJW A;  4CEB A;  1TAU A;  4M42 A;  1RT6 A;  3TAE A;  1HQE A;  4JI2 K;  2O8B B;  4X62 K;  4E0D A;  3O3H A;  3ZET A;  3VN5 A;  4U67 L;  1IO2 A;  1ZBS A;  4CJV A;  3OW2 M;  4BDZ A;  1TYQ B;  1ZBI A;  5KPT A;  2GTD A;  1RBT A;  3TTF A;  4CHP A;  2YHY A;  4BQL A;  1NMD A;  3K0S A;  3K9K A;  4FLZ A;  1NJI O;  4BRL A;  2HHV A;  4Z0U A;  2ASP A;  3AO4 A;  2YNF A;  3P83 D;  1A5W A;  2A5X A;  3I0S A;  1ZBH A;  4FLT A;  3OYN A;  3ZYY X;  4FWR A;  2PYL A;  4NCG A;  3GE1 A;  3OTO K;  1BUP A;  5HRN A;  3H46 O;  2KKZ A;  3TAM A;  2A41 A;  4BRC A;  3HXM A;  1RT7 A;  3TI0 A;  4F8R A;  1A5X A;  3QIN A;  3T1Y K;  1SKR A;  5DM6 L;  1Z05 A;  4DU4 A;  2AJQ A;  1YF5 L;  3V9Z A;  1BIZ A;  3NAE A;  4OX9 K;  3LZI A;  4JD2 B;  4JI3 K;  4EIA A;  1QS4 A;  4Z4E A;  3G25 A;  4CGH A;  3F73 A;  4CJP A;  4JYA K;  1ASU A;  3TTC A;  2R7Y A;  2HHU A;  5JVG L;  4LC9 B;  3VEX A;  2P9I A;  4BRQ A;  4YOT A;  4PL8 A;  4FOE A;  1RFQ A;  3VA0 A;  4OPH A;  1HYZ A;  2FLO A;  3Q7C A;  2NRX A;  3LZJ A;  2QWN A;  3O5B A;  5DM7 L;  3K5L A;  1NGB A;  4M41 A;  1KAX A;  4DB3 A;  4JN4 A;  1IV0 A;  2O8B A;  3I55 N;  2ZQB A;  2Z1H A;  5BPM A;  5GAD P;  1DT9 A;  4CJF A;  3S41 A;  1NOY A;  3DMJ A;  1TK5 A;  3CJB A;  3SMS A;  3EO3 A;  2KQ2 A;  5AQI A;  1GLE G;  2PYJ A;  2YJF A;  2CH5 A;  4KHQ A;  5EX5 A;  3UIQ A;  4FW2 A;  3LAN A;  2BH1 A;  4RTF D;  3HP6 A;  4JI4 K;  1TK8 A;  3VQB A;  3MN7 A;  1M1K O;  4A2A A;  2G8I A;  1TKD A;  3RMC A;  3WUH A;  3H3O B;  3UKU A;  1T3V A;  4RW9 A;  4Z4H A;  2FSJ A;  4DSF A;  4CD1 A;  3VMF B;  2ETJ A;  1CLQ A;  3ASM A;  1ATR A;  3VQD A;  1OH8 A;  2P9N B;  4DQQ A;  1HRH A;  4IDH A;  5M1Q A;  3CC2 N;  2XY6 A;  1N32 K;  3BEX A;  5IWA K;  4IG3 A;  1SKS A;  4OKK A;  5HRS A;  5CZ2 A;  1D5A A;  1LAW A;  4YOX A;  2HND A;  3K57 A;  3QFP A;  4ELT A;  4L3Q A;  4M3U A;  1K6Y A;  4IOC L;  3U3Y A;  1ASV A;  4H4M A;  1NLV A;  1X9J A;  1RIL A;  4WFN L;  1IH7 A;  2VGM A;  4DG1 A;  2A3Z A;  2D4W A;  3RVC A;  5BRD A;  1HNZ K;  3K2P A;  2QXL A;  3CPE A;  4KFB A;  4WE1 A;  4Z4G A;  1VAZ A;  5HBM A;  2ZE2 A;  5CE3 A;  1NWK A;  4JV5 K;  4OO1 J;  1BO5 O;  4JI6 K;  2EX3 A;  2ZGY A;  4LF7 K;  3SJH A;  2JGU A;  2UUC K;  1EKE A;  3M1F A;  3MWT A;  2CGJ A;  2P9L A;  3OA9 A;  3JYT A;  3THX A;  2EWS A;  4G1Q A;  2WUS A;  5E26 A;  4CF2 A;  1KVB A;  1GLD G;  2B6A A;  3NF8 A;  3SQ2 A;  4Z4F A;  2D0A A;  1ZBF A;  4FWO A;  4NO7 A;  3MN5 A;  4IWV A;  4B3O A;  4A2B A;  2V7Y A;  1ZC6 A;  1WNS A;  4JK9 A;  4F9O A;  3QBX A;  1TV6 A;  4JI1 K;  4DR3 K;  1JJ2 M;  4LD0 A;  3O4N A;  2KW4 A;  3GG4 A;  4WF9 L;  2P9P B;  3LAL A;  2A42 A;  2YNG A;  3EYZ A;  1EP4 A;  4KO0 A;  1D4X A;  4CD3 A;  1DGK N;  3BP8 A;  2UU9 K;  4N47 A;  5BRF A;  4FJJ A;  1J54 A;  4H0V B;  4DSJ A;  2ITG A;  4KHU A;  1IJJ A;  4JKA A;  4BWM A;  3G71 N;  3KD5 E;  3CCQ N;  4DF8 A;  1ITG A;  4CJS A;  3PX4 A;  3ZSV A;  3QIC A;  4NLB A;  2BE2 A;  4IKF A;  4OKE A;  4DU3 A;  4BC3 A;  4HVJ A;  4YY3 K;  3O3G A;  4DV0 K;  3M8P A;  1NK8 A;  5ADX A;  1RBR A;  4H0T B;  4AM7 A;  2E8A A;  3DAW A;  3VEW A;  1BIS A;  2W6K A;  2CH6 A;  3M8R A;  2G8V A;  1O13 A;  1UA1 A;  3ULE B;  1NGI A;  4O0J A;  3DLG A;  5T7B A;  2HMI A;  2RE2 A;  3SLC A;  3M3Z A;  4BRF A;  3THW B;  1REV A;  4IFE A;  2QA4 N;  3PY8 A;  1BG3 A;  2GX9 A;  1SL2 A;  1VSI A;  5DK5 A;  1NNE A;  2QKK A;  4H03 B;  1NOZ A;  4DSL A;  4EFH A;  4IOX A;  1KVC A;  3KHY A;  4AM6 A;  2F8S A;  1EWR A;  5HRO A;  4GV3 A;  4DUZ K;  4DR1 K;  4GKJ K;  4CZF A;  4RG8 A;  1JLB A;  4CCH A;  3ULE A;  1VQP N;  3SNN A;  2YKM A;  1XMO K;  2FSK A;  3LP0 A;  4BC5 A;  4K41 A;  1HKB A;  1NG9 A;  4AIL C;  4YFU A;  3V9W A;  4BG8 A;  1QQC A;  3SUP A;  2PY5 A;  3AVM A;  3C6T A;  1HX1 A;  2OPS A;  3JAM O;  1Q9Y A;  4KTW A;  4O44 A;  2OPR A;  4CZM A;  3FFK B;  3DLR A;  4JHD A;  3L4Q A;  4FZY A;  2WC9 A;  1TAQ A;  4DLE A;  2XY7 A;  4DV3 K;  2P9I B;  1SL0 A;  3OS2 A;  1XWL A;  3C6A A;  1ATN A;  2HHS A;  4FSV A;  3M6G A;  3MX2 A;  3LAM A;  3OYG A;  2CGL A;  3P4I A;  3C7N B;  3C65 A;  4ILG B;  3H08 A;  2VWJ A;  3FZK A;  2PAV A;  4DSK A;  5M1P A;  3ATU A;  4C8N A;  2HST A;  4CGI A;  4FXD A;  3EEQ A;  4JI7 K;  2ATQ A;  2YHX A;  4JKB A;  4CED A;  2QK9 A;  2HBM A;  1LW0 A;  1YVU A;  3FZL A;  4CF0 A;  1SAZ A;  3GDQ A;  2JWL A;  4IXC A;  3SPZ A;  2QWR A;  3NVM A;  2NRV A;  3OYK A;  2DTU A;  4JKF A;  4NXN K;  4DFK A;  5AJ3 K;  3HP9 A;  1N34 K;  4Y1C A;  1V4T A;  3U3G A;  3QEP A;  3AVL A;  4H0X B;  1RTH A;  1MDU B;  3T19 A;  4BVP A;  2YHB A;  1NJY A;  3EY1 A;  4A57 A;  2AP1 A;  2IAJ A;  3HT3 A;  3E66 A;  2O8D B;  5AQO A;  3V9S A;  2P1J A;  3O9R A;  4KHN A;  3OYI A;  2FBX A;  3IRX A;  1RNH A;  4CVN E;  2BGG A;  4X66 K;  3TAN A;  3FZH A;  5BPN A;  3GOI A;  1W0H A;  3NBP A;  4FL9 A;  3ZSQ A;  1VQ9 N;  1VSJ A;  5KQD A;  4CE9 A;  3O80 A;  3V1O A;  2KFN A;  2D1K A;  1LW2 A;  4DQR A;  3CCM N;  1GLB G;  4G9Z A;  3R3L A;  4CHN A;  2E2P A;  1RBS A;  4LFB K;  1JL2 A;  5JS1 A;  3ZET B;  1Q82 O;  4BDP A;  2RKI A;  1VRU A;  4FWM A;  4DS5 A;  4OPA A;  4FJI A;  3VQ6 A;  2HVI A;  3RR8 A;  1SQK A;  3SI6 A;  3M8S A;  1S1T A;  2I7N A;  5KGX A;  4DV4 K;  5TKW A;  4DUY K;  4KI6 A;  3B6O A;  3RSE B;  1X1P A;  3DXK B;  4ISG A;  1WBB A;  1K73 O;  4MLH A;  3NCI A;  3TTD A;  3OBY A;  4CJ5 A;  4KB0 A;  3AA3 A;  3KVG A;  3CJ7 A;  4E19 A;  2HF3 A;  3F5T A;  2FBT A;  4E1J A;  3CC7 N;  3EE9 A;  5EOY A;  3ZEU A;  4CEO A;  3QNO A;  4JI8 K;  2W41 A;  5BR9 A;  4CJ7 A;  4J2B A;  1K8K B;  1EWQ A;  1U6Z A;  3AVN A;  4Y0W A;  4FO0 A;  1B92 A;  1E3M A;  3RMD A;  1Q18 A;  1J6Z A;  4FVM A;  3M8Q A;  4V19 S;  3T1A A;  3H1V X;  1LWC A;  3NF7 A;  3OYD A;  4GKK K;  2ASM A;  3NGI A;  4N56 A;  4IO9 L;  3SZ2 A;  3TAG A;  4CGG A;  3OS1 A;  1NGE A;  3KWG A;  4CIG A;  1W7A A;  3HSC A;  1GOB A;  1HYS A;  4OJR A;  3T7Z A;  3D2F A;  4W5O A;  4PKG A;  2WOM A;  2DY4 A;  2I5J A;  3J8A A;  3QDK A;  1ASW A;  1FXX A;  3OYA A;  3OVN A;  2F4V K;  4MQ3 A;  4DKW A;  4FJM A;  4LF5 K;  3NE6 A;  1BI4 B;  3LL3 A;  2F8T A;  4O8U A;  4ZHR A;  4LY7 A;  3DWL A;  2HHT A;  5BN9 A;  1KTQ A;  3PSI A;  2QEX N;  3CET A;  2IVN A;  4FYD A;  4B8C A;  2CGK A;  2G8F A;  3OYM A;  3PX6 A;  3TAQ A;  1LWE A;  1NGF A;  4DU1 A;  1XNQ K;  4O4G A;  3NH1 A;  2V52 B;  2G8U A;  3TU5 A;  3TAP A;  2QWQ A;  2QKB A;  4GVE A;  3EKU A;  3F2K A;  1P90 A;  4H5T A;  2NRH A;  5AFU H;  4GV9 A;  1RDD A;  3VQ8 A;  3LDS A;  3VQE A;  3QNN A;  3MED A;  4I9L A;  1JLA A;  1J53 A;  4F2S A;  3VGM A;  4EHT A;  3OYE A;  3ZT4 A;  1I39 A;  5AQF A;  4BRH A;  1OH6 A;  4CZG A;  1WSE A;  2IGI A;  2YV0 X;  3VET A;  5CR4 A;  2UXB K;  1TKX A;  4CF1 A;  3WXJ A;  4MFB A;  3DRR A;  4GW6 A;  2E5L K;  1XNR K;  2X74 A;  1Q8I A;  4XH4 A;  3DXM B;  4B3T K;  3SBG A;  1NJW A;  2YI1 A;  4JRP A;  3V6D A;  3V9X A;  3B6P A;  4FM0 A;  2J4R A;  3CI5 A;  1CZA N;  4BC4 A;  4FLU A;  2YHW A;  1EO1 A;  5SZT A;  1D8Y A;  3NGY A;  1VQN N;  1HPM A;  4DTO A;  5HP1 A;  2D0C A;  2G8H A;  3BZC A;  2Z1G A;  2E6M A;  4CZI A;  3G0Z A;  1QVF M;  2W6L A;  4DTJ A;  1NK7 A;  2ZD1 A;  3SBT A;  4CEE A;  4M63 C;  2XHB A;  3SAF A;  3KWI A;  4CES A;  4B1X B;  5AQS A;  2O8E B;  1M90 O;  4YDU A;  2O4I A;  1Z25 A;  3VQ5 A;  2O4G A;  3K9J A;  2VGN A;  2A6A A;  2OZM A;  2YCH A;  4NCA A;  4A5A A;  3J7Z O;  3H1Q A;  1JCE A;  3SAH A;  2Q31 A;  1NK5 A;  4M3W A;  1C0U A;  1EET A;  1N8R O;  2KZM A;  3ZSO A;  4PL7 A;  5AQW A;  4H5V A;  5JS2 A;  1YI2 N;  4CJQ A;  4DTX A;  4O5F A;  1UA0 A;  4JEP A;  4BR5 A;  3MEE A;  1X9M A;  4GMJ B;  5F1X A;  3W3D A;  1YUW A;  4BQZ A;  4QOZ B;  1HPZ A;  4LSN A;  1YVN A;  3EKS A;  3ID6 A;  3ZSX A;  3RTV A;  1C0T A;  1KVA A;  1NGG A;  4C8M A;  1QVG M;  3B8A X;  3JS6 A;  1U49 A;  4BR2 A;  3ZSW A;  4CK2 A;  3SUN A;  2AA4 A;  4JKD A;  4CJU A;  4OLA A;  3P38 A;  4KBO A;  1RDU A;  4Q5V A;  4CF8 A;  4QCL A;  4B8A B;  2HHX A;  1GOC A;  4ZTF A;  3C6H A;  1T8E A;  3PX0 A;  4BC2 A;  3HST B;  4KTZ A;  2UYT A;  3O9U A;  4FLW A;  2FSN A;  1NMN A;  3O1B A;  2OTJ N;  5I42 A;  1SL1 A;  4MDB A;  4AH9 A;  3S3M A;  2NUB A;  3OJS A;  3VEY A;  4W5T A;  1NK0 A; 
#chains in the Genus database with same CATH homology
 2RE2 A;  4FWQ A;  3M3Z A;  3P39 A;  3SLC A;  3D2F B;  4CZL A;  2HBL A;  2P9S B;  2V51 B;  1VQL N;  3Q7B A;  4BRF A;  3CMA N;  3E9L A;  4IFE A;  5AQU A;  1DKG D;  4H0Y B;  2QA4 N;  3IUC A;  1BG3 A;  2GX9 A;  3H6E A;  5AQT A;  1HUX A;  4H03 B;  4RWT A;  2D0O A;  4EFH A;  4H0P A;  3FZM A;  3UB5 A;  4IOX A;  5AQJ A;  3HI0 A;  1IG8 A;  5AZI B;  4DCH A;  4ILH A;  3KHY A;  4AM6 A;  2GEL A;  3H45 C;  5E84 A;  4GV3 A;  3H3N O;  1U2V A;  5C12 A;  5AQH A;  1BWF O;  2HBJ A;  4I6M B;  4FWS A;  5C15 A;  4I6M A;  2P9N A;  1T6C A;  3VF2 A;  4CZF A;  5TKY A;  3CJC A;  2DPN A;  3TSP A;  3TSQ A;  2QI2 A;  2NRW A;  1ESV A;  3ULE A;  4FWL A;  3WXI A;  4B1U B;  4BGB A;  5JLH A;  4FWP A;  4WFB L;  4BRO A;  1VQP N;  1HKC A;  4YOU A;  3A5N C;  4BRA A;  3BF1 A;  1TYQ A;  5BN8 A;  2FSK A;  3GL1 A;  4BC5 A;  3TPQ A;  4A61 A;  1WOQ A;  4K41 A;  1K8A O;  1HKB A;  2GUP A;  1C0F A;  2PFU A;  5F0X A;  4B9Q A;  5FPE A;  5CHI A;  2Q2R A;  3A5L C;  4JKE A;  4BG8 A;  4JK7 A;  3VER A;  4GV6 A;  1BDG A;  2Q0R A;  4A5B A;  1HX1 A;  4HWI A;  4B1V A;  3A0I X;  4KH5 A;  4EHU A;  2BUP A;  1YIJ N;  2ZWH A;  2QWM A;  4FPB A;  3CD6 N;  3DXK A;  1DEJ A;  5BRE A;  3AY9 A;  1YAG A;  2NZT A;  4CZM A;  3FFK B;  4JD2 A;  4JHD A;  3WXK A;  1QQN A;  3L4Q A;  2WC9 A;  3MMV A;  3VPZ A;  3WEE A;  4BRE A;  4XH5 A;  4B1Y B;  2P9I B;  2ZJR L;  4YOR A;  3VES A;  2H3G X;  3P31 A;  3C6A A;  1ATN A;  3CJ9 A;  4WCE L;  4FSV A;  3M6G A;  3JXU A;  3MX2 A;  3MK6 A;  1NGJ A;  4GY2 B;  2FF3 B;  5HOO A;  4UY8 O;  2CGL A;  3P4I A;  2IIR A;  3C7N B;  4JKG A;  3C65 A;  4PKI A;  5AQM A;  4ILG B;  2HBK A;  4DHY A;  1VQ5 N;  1QZ5 A;  3ENH A;  3FZK A;  1Y64 A;  4IJN A;  2PAV A;  4A62 A;  3E9P A;  5M1P A;  4IZ9 A;  4FWN A;  3ATU A;  4A59 A;  3VGK A;  4JNE A;  1U2V B;  1BA0 A;  2HST A;  4BRM A;  3D2E A;  1LCU A;  2Q97 A;  3WEE B;  5FPM A;  2YHX A;  5C2F A;  3IKM A;  4JKB A;  3HRG A;  3O8M A;  4ISF A;  4J8F A;  3E1Y A;  1Q86 O;  5GAH P;  2HBM A;  5BRH A;  4WQ5 A;  3FZL A;  1SAZ A;  3GDQ A;  4WQ5 C;  3UE5 A;  2JWL A;  3MDQ A;  4ISE A;  4QS9 A;  3PLA A;  4IXC A;  5EVZ A;  4WQ4 A;  1NGC A;  4YOW A;  2QWR A;  3CER A;  3D7E O;  3NVM A;  4PKH A;  1E4G T;  2NRV A;  5AZJ B;  2A40 A;  4JKF A;  3ZX0 A;  2P9U A;  3LDO A;  2GWJ A;  3VEN A;  2Q36 A;  3VOV A;  2RHK A;  5GAE P;  3UKR B;  1OKJ A;  1V4T A;  2QM1 A;  4CBU A;  4WYB A;  2I7P A;  1ATS A;  4CZJ A;  3I8B A;  5M1O A;  5AR0 A;  2E2N A;  3PIP L;  3O6W A;  3E9O A;  4H0X B;  1MDU B;  1VQO N;  2KHO A;  4BVP A;  5AFU A;  1HJO A;  1H1V A;  3CCU N;  4BRI A;  5GIN A;  1MWM A;  3HOS A;  4QS7 A;  4A57 A;  2AP1 A;  2W40 A;  1YJ9 N;  4EAH D;  1YXQ A;  3E66 A;  3VGL A;  5C2D A;  2GEM A;  1NGH A;  3VEV A;  4BG9 A;  4IO8 A;  5AQO A;  5HL7 L;  3VF4 A;  3O9R A;  1HLU A;  1R59 O;  3O9Q A;  4FOI A;  3QB0 A;  5AQV A;  3DLL L;  3NVK A;  1QQM A;  3ENO A;  4U7B A;  3CHW A;  2FF6 A;  1TUU A;  3EZW A;  1GLA G;  1GLL O;  1P8Z A;  2ZF5 O;  4C1N I;  1XUP O;  5BPL A;  2OTL N;  1NBW A;  3ZEU B;  1C0G A;  2BTF A;  3M5R A;  3ZX2 A;  2HOE A;  4CZH A;  4H0O A;  3FZH A;  5BPN A;  5GIO A;  3CF5 L;  3SMP A;  3FE1 A;  3GOI A;  3C7N A;  4JKG B;  1YJN N;  3LDP A;  3SAG A;  4FL9 A;  4MDA A;  1VQ9 N;  3I33 A;  1V4S A;  5AQR A;  1K8K A;  2HMP A;  2Q0U A;  3AAQ A;  5KQD A;  3L0Q A;  5AQP A;  5M1F A;  3O80 A;  1VQ4 N;  2D1K A;  3U4L A;  3RSE A;  2V7Z A;  3CCM N;  1GLB G;  3N4P A;  2QW9 A;  3BUZ B;  3N4Q A;  3VTH A;  4RCH A;  4G9Z A;  4JKH A;  1BA1 A;  3R3L A;  3C0B A;  4NLC A;  5JIC A;  2E2P A;  1Q7Y O;  3HM8 A;  3ZET B;  4YOY A;  1Q82 O;  2NLX A;  1YIT N;  4FWM A;  4XEI A;  4OPA A;  5EY4 A;  4GNI A;  5GAG P;  3NMU A;  3LDN A;  3LDL A;  2HF4 A;  3U9Z A;  2F7T A;  3WQT A;  4H5W A;  4B1Z A;  1SQK A;  4KH6 A;  2YX6 A;  3CCR N;  4BR7 A;  3MX5 A;  2I7N A;  3MCP A;  4QS8 A;  1Z6R A;  4M7Y A;  3QML A;  5TKW A;  1JCF A;  2NNW A;  3CC4 N;  5M1K A;  1KQS M;  3F9M A;  3IDH A;  3WQU A;  4JHD B;  3RSE B;  5LJW A;  3CXC M;  3DXK B;  4ISG A;  5AQX A;  3FR0 A;  1K73 O;  4MLH A;  1GLF O;  1VQM N;  3TTD A;  1QZ6 A;  3OBY A;  4BRD A;  3CIP A;  4C1N K;  3ZET A;  1GLC G;  3CME N;  3L6Q A;  4MLE A;  3LM2 A;  3KVG A;  4MO5 A;  3CJ7 A;  5JMV A;  2HF3 A;  3F5T A;  1SZ2 A;  4FWK A;  4U67 L;  4E1J A;  2NRZ A;  1LOT B;  1ZBS A;  1JCG A;  4KH4 A;  3EE9 A;  3CCV N;  5MLC Q;  5EOY A;  3OW2 M;  3CC7 N;  3ZEU A;  1OVY A;  1TYQ B;  3MN6 A;  1MA9 B;  5AQL A;  1XC3 A;  1X3N A;  2W41 A;  5BR9 A;  5KPT A;  2GTD A;  4CJ7 A;  3TTF A;  1K8K B;  4R79 A;  1U6Z A;  2YHY A;  4BQL A;  1NMD A;  4Y0W A;  5LY3 A;  4FO0 A;  3K9K A;  1J6Z A;  1Q18 A;  1NJI O;  1BOT O;  4BRL A;  3T69 A;  5FPD A;  2ASP A;  4BRN A;  5KQ8 A;  2E88 A;  3H1V X;  3R9P A;  2A5X A;  2F9W A;  2Q1N A;  3HTV A;  3EN9 A;  2ASM A;  1K9M O;  3WXL A;  3ZYY X;  3IMX A;  4FWR A;  1G99 A;  4IO9 L;  3GE1 A;  1BUP A;  5AQQ A;  3H46 O;  2IVO A;  5F2R A;  2YJE A;  2KKZ A;  3QFU A;  1NGE A;  3KWG A;  3HSC A;  2A41 A;  4BRC A;  5I9E B;  3T7Z A;  3D2F A;  2E2Q A;  4PKG A;  1YJW N;  1KAZ A;  3EE8 A;  5AQY A;  4C23 A;  5ADX H;  1S72 N;  3J8A A;  3QDK A;  5DM6 L;  1Z05 A;  4YOV A;  2PBD A;  1YF5 L;  4JD2 B;  4IEI A;  1KAY A;  4DKW A;  4EIA A;  3LL3 A;  4BVO A;  3G25 A;  4BRG A;  4O8U A;  4BY9 C;  3CQX A;  3DWL A;  5BN9 A;  4JK8 A;  1QQO A;  2FXU A;  1YHQ N;  3TTC A;  3MCA B;  5JVG L;  4LC9 B;  5AQG A;  3VEX A;  3AGK A;  3FGU A;  2P9I A;  3CET A;  2QEX N;  2IVN A;  4BRQ A;  4YOT A;  5H1S Q;  4PL8 A;  4FOE A;  1RFQ A;  2CGK A;  4OPH A;  1NGF A;  3FZF A;  2V52 B;  2FLO A;  1WUA A;  1S3X A;  3TU5 A;  4H5R A;  3Q7C A;  1T44 A;  3GBT A;  2NRX A;  2QWQ A;  2OAN A;  4GVE A;  2P9K B;  3EKU A;  2QWN A;  3F2K A;  3O5B A;  1P90 A;  3R6M A;  1X3M A;  4H5T A;  2NRH A;  3KZB A;  4K25 A;  3G4S N;  5AFU H;  5DM7 L;  2QWL A;  1XQS C;  4CI6 A;  1NGB A;  3IFR A;  4GV9 A;  1NM1 A;  1KAX A;  4DB3 A;  4JN4 A;  2E20 A;  2ITM A;  1E4F T;  2ASO A;  2P9P A;  3CCL N;  3I55 N;  4NB4 A;  3O9S A;  5BPM A;  1KD1 O;  5GAD P;  3VGM A;  1DT9 A;  5JVH L;  2P9L B;  4EHT A;  3HOT A;  3S41 A;  4K42 A;  3CJB A;  5AQF A;  4BRH A;  2E1Z A;  3EO3 A;  5AQI A;  2P9S A;  3SMS A;  4CZG A;  1GLE G;  1NGD A;  3VET A;  5CR4 A;  2IVP A;  2YJF A;  2CH5 A;  2P9K A;  5EX5 A;  1RGI A;  3CCE N;  3D6R A;  1VQK N;  2BH1 A;  4RTF D;  2GWK A;  3WXJ A;  2ZJP L;  2QWP A;  4XH4 A;  1Q81 O;  3DXM B;  4O8K A;  3PIO L;  4FPA A;  3MN7 A;  5AZI A;  4A2A A;  3SBG A;  1M1K O;  2D0P A;  2YI1 A;  4JAX A;  4XH1 A;  3H3O B;  3UKU A;  3WUH A;  1ILY A;  1T3V A;  5KPR A;  5C10 A;  2FSJ A;  4CD1 A;  2J4R A;  3VMF B;  3CI5 A;  1CZA N;  3EL2 A;  3CJA A;  1ATR A;  3MN9 A;  4BC4 A;  3R8E A;  4Z94 A;  3O1W A;  1VQ8 N;  2P9N B;  2YHW A;  2NRR A;  4IDH A;  5M1Q A;  1EO1 A;  3OHR A;  3CC2 N;  5AQK A;  5AQZ A;  1VQN N;  1HPM A;  1VQ6 N;  3VTI A;  4BRK A;  3BEX A;  5EXW A;  4IOA L;  3BF3 A;  1QHA A;  4CZI A;  2JWK A;  4FVU A;  2VYP A;  5AZJ A;  4HTL A;  4YOX A;  3QFP A;  1QVF M;  4L3Q A;  5C0Y A;  4IOC L;  3SBT A;  4IEE A;  3FLC O;  3ID8 A;  3O08 A;  5FPN A;  4BGA A;  5B8H A;  1NLV A;  4M63 C;  1X9J A;  4ILJ A;  3SAF A;  4WFN L;  1HKG A;  2VGM A;  3KWI A;  2VWB A;  3DXM A;  2A3Z A;  2VCP A;  2D4W A;  3RVC A;  5BRD A;  4B1X B;  3KK7 A;  2QXL A;  3QBW A;  3CPW M;  3R1X A;  3CPE A;  3HBT A;  3D2E B;  3A8Y A;  5AQS A;  5ELZ A;  1VAZ A;  5CE3 A;  1M90 O;  1NWK A;  4YDU A;  2ZGZ A;  4AF1 A;  4OO1 J;  1BO5 O;  2ZGY A;  4WQ4 C;  3U8X A;  5GIP A;  3K9J A;  2VGN A;  3SJH A;  1SS6 A;  5KPZ A;  2A6A A;  2YCH A;  3M1F A;  3MWT A;  3A5O C;  3ATV A;  2CGJ A;  2P9L A;  3CCJ N;  4BRP A;  4JKC A;  4A5A A;  3OA9 A;  3AGR A;  1GLJ O;  3J7Z O;  3H1Q A;  1JCE A;  3VEO A;  3SAH A;  3G6E N;  2WFB A;  2Q31 A;  1T6D A;  2EWS A;  4M7X A;  2E2O A;  2WUS A;  5E26 A;  3O9T A;  4CZK A;  1KC8 O;  3UKR A;  1N8R O;  1GLD G;  4YDU C;  3ZX3 A;  3CCS N;  2NRT A;  4PL7 A;  2E1Y A;  5AQW A;  4H5V A;  5JLF A;  4CBX A;  1YI2 N;  1W2B M;  4O5F A;  4H5N A;  4JEP A;  4MO4 A;  4BR5 A;  4FWO A;  4NO7 A;  3MN5 A;  4IWV A;  1YUW A;  3W3D A;  4A2B A;  4BQZ A;  1TUY A;  2V7Y A;  3U9D A;  5F1X A;  4WFA L;  1ZC6 A;  3TSU A;  4JK9 A;  4F9O A;  3QBX A;  3UKU B;  1JJ2 M;  1YVN A;  3EKS A;  3ENB A;  3ID6 A;  3I56 N;  3SK3 A;  3GG4 A;  4WF9 L;  1MWK A;  2P9P B;  1NGG A;  2A42 A;  3WT0 A;  1QVG M;  3B8A X;  3JS6 A;  4BR2 A;  1D4X A;  1ZXO A;  4CD3 A;  1DGK N;  5LJV A;  1RDW X;  3BP8 A;  3W0L A;  2AA4 A;  5BRF A;  3VEZ A;  1NGA A;  4K43 A;  3DJC A;  4BR9 A;  3A5M C;  3AAP A;  4H0V B;  3MWP A;  1IJJ A;  4JKA A;  4JKD A;  3G71 N;  3WXM B;  1KXP A;  3CCQ N;  3P38 A;  4KBO A;  1RDU A;  4CBW A;  4PHT X;  3QIC A;  4NLB A;  4B1W B;  3OBW A;  2F9T A;  1W97 L;  3C6H A;  3LDQ A;  1BU6 O;  4BC3 A;  1S22 A;  2WBN A;  4BR0 A;  4DQ8 A;  4BC2 A;  5ADX A;  4H0T B;  4AM7 A;  2E8A A;  3O4W A;  3DAW A;  5M1N A;  1EQY A;  1VQ7 N;  4IJA A;  3VEW A;  2UYT A;  3O9U A;  2FSN A;  2QTD A;  3O1B A;  5AQN A;  2CH6 A;  2ZJQ L;  3VF6 A;  3L4I A;  2OTJ N;  2KLA A;  3AAR A;  4BR4 A;  4MDB A;  1O13 A;  2QWO A;  3VEY A;  3LM9 A;  3CQY A;  3ULE B;  1NGI A;  3CJ1 A;  3HZ6 A;  4CZE A;  2P9U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...