4MDAA

Structure of mos1 transposase catalytic domain and raltegravir with mn
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
225
structure length
200
Chain Sequence
b'PHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFVKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mariner Mos1 transposase
publication title Structural Basis of Mos1 Transposase Inhibition by the Anti-retroviral Drug Raltegravir.
pubmed doi rcsb
source organism Drosophila mauritiana
molecule tags Hydrolase/hydrolase inhibitor
total genus 75
structure length 200
sequence length 225
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01359 Transposase_1 Transposase (partial DDE domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4mdaA00
3F2KA 2F7TA 5CR4A 4MDBA 4MDAA 5HOOA 3K9JA 3HOSA 3HOTA 4U7BA 3K9KA 4R79A
chains in the Genus database with same CATH superfamily
3PSIA 5AQZA 2WUSA 4FYDA 1D9FA 5AZIA 3WXLA 2HHWA 2O8DA 1RGIA 3SZ2A 2YHYA 3G6EN 5MLCQ 2ZGZA 3FZMA 1VQON 3RRGA 5KI6A 5J1EA 1QQNA 3KK2A 4DTSA 4F4KA 4IEIA 4DR2K 4DQPA 3MDQA 1RT3A 4W5QA 5AQPA 3AVNA 4BRQA 2OPPA 5AQJA 1VQKN 4H0OA 3QNOA 4O8UA 5I42A 2D4WA 4NCGA 4BRMA 5JMVA 2OZSA 2QWLA 3KHYA 4H5TA 5KPRA 1BWFO 1RT6A 2ASMA 2I5JA 1JCEA 4CJ5A 3CPWM 2J4RA 1KAYA 2QW9A 1V4TA 2RHKA 2XRIA 4N47A 3SJJA 3PO4A 5BRFA 3ID8A 4BY9C 1GLJO 1T6CA 3LWMA 4LFAK 1BHLA 2E4LA 2XY7A 1LAVA 3DI6A 3CF5L 1QSYA 1J5OA 3BGRA 4CJRA 1ZYQA 1CXUA 1JLGA 1QQCA 1KVBA 4CECA 3OBYA 4I2PA 4AHTA 3TANA 4DV7K 3L6QA 3E66A 4FJLA 2YHAA 4EHTA 1HR0K 4CIEA 3FZKA 3OYMA 2VYPA 1WSFA 1HPZA 1VHXA 4WFAL 1SL2A 3PO5A 1BI4A 4HUEA 2RPIA 2D5RA 4FLUA 4JI1K 1YF5L 3A5LC 3THYA 1YVUA 4ILJA 4JI2K 3DM2A 1S6QA 2YNGA 2HHXA 2DFEA 3PX6A 2FBXA 3NDKA 3TTDA 3AO1A 1BISA 2O8CB 4HVJA 3LDSA 5HP1A 4LF8K 2XO7A 4WE1A 1LWEA 4CFCA 5BPNA 4DR7K 3M8PA 1GOCA 1HNXK 2NZTA 1MA9B 4NYNA 3M6GA 4BVOA 3MWTA 3SI6A 3OVNA 1W9HA 3UKRA 4DV0K 4H0XB 3CMEN 3HP9A 3ZSYA 3VA3A 1QZ6A 2UUAK 2WONA 5SZTA 4FWNA 2YNIA 3AVCA 5F2RA 1NWKA 4Y1DA 5J2NA 1Q86O 4IJAA 4M3RA 2HHUA 1L3TA 4FM1A 3F73A 4CFAA 4CZJA 3M8SA 1UWBA 4DTOA 5LMUK 4C8KA 3CIPA 4DTRA 4WQ4A 3QEPA 2E5LK 1RDAA 3F5TA 5J2PA 1NGIA 1VSMA 3C0BA 3HRGA 1QHTA 2P9IB 4YORA 3KLEA 1KFDA 3WXJA 4YOVA 1GLAG 4M7YA 1SAZA 3VPZA 3LDLA 3EKSA 5AQXA 3DRRA 1NGJA 4GV9A 2O8BB 2PAVA 1FKPA 5CZ1A 5HRRA 2QA4N 3SV4A 1GLDG 1BIZA 2UXBK 1Z26A 1ATSA 4X66K 4JKDA 3QINA 5M1PA 1VQPN 3AGKA 4B1UB 4DUYK 1YVNA 4DSKA 3AO2A 3WNEA 2HF3A 3EY1A 3VQEA 1JKHA 3ZSRA 1NGGA 5AQHA 3VF6A 4Z4EA 4DR4K 1VQ6N 3D2FB 4LFCK 4CJPA 4B3SK 1KRPA 2V7YA 4CHPA 3KK3A 1WOQA 4JI7K 3O3HA 4CK2A 3VESA 1WLJA 3QERA 1U45A 2NRHA 1WSIA 2RN2A 3MN5A 1JJ2M 4B3MK 3R9PA 3UKUB 4HWIA 3O08A 2V7ZA 4IEEA 2AP1A 5AQOA 4E1NA 3M8QA 4BDZA 4FJ5A 4DSLA 4CZIA 1IBMK 5HROA 4J2BA 1ZBFA 4CEZA 5BRHA 1RDUA 4ISEA 4KV8A 3LPUA 3KK1A 1NBWA 4ICLA 1WN7A 4CBUA 3OYGA 2F96A 3P31A 3BZKA 1DLOA 4BR4A 1TKXA 1VSDA 1L3VA 4JD2B 5DK5A 5T7BA 5FPNA 2CH5A 2QI2A 4CJWA 1EWQA 2Z1JA 4JKBA 3CI5A 1J6ZA 3H3NO 3WUHA 1TAQA 1NJZA 2P1JA 4AHUA 3KLIA 3MK6A 4E0DA 4GW6A 3JYTA 4OKKA 3LP3A 4JN4A 5GAHP 3ENOA 1RDCA 4DS4A 2O8EB 2QM1A 1O1WA 4PKGA 4H5WA 4BC3A 2D0BA 1ZBUA 3DJCA 5KRTA 3MXMA 3HK2A 4TSXA 4QS8A 1HNIA 2O8FB 5AQYA 3AGRA 1IH7A 4DSIA 2A5XA 1GLCG 3NFAA 5GAEP 5H1SQ 3CD6N 5M1NA 2LSNA 4IKFA 1SZ2A 4MDAA 3V9WA 1W0HA 3O3GA 1Q9XA 1NGCA 1B92A 3ENHA 4FLVA 3DOKA 3HI0A 3GL1A 1YT3A 2P9SB 2QXLA 3SBGA 4CD1A 3BUZB 1S5JA 4DQSA 5AQNA 1SUQA 3RVCA 3THXA 4FW2A 3G4SN 1XC3A 4NO7A 4O5FA 3MXJA 1U49A 3VETA 4BREA 2OPQA 3C95A 3CXCM 4DV1K 2O4IA 1A5VA 4CF8A 1S3XA 2W42A 1QVFM 4RW8A 3L0QA 1GLBG 5HRPA 2X74A 5A2QO 2XY8A 4PQUA 3VEOA 4ISFA 4K42A 2UUCK 1L3UA 5KGWA 3ZT2A 4ID5A 1QQMA 4CFBA 1NK9A 3V9XA 1JL2A 1TGOA 3C6HA 3SQ0A 3VQCA 2W6LA 1NGBA 4OPKA 1XHZA 4KHQA 4KH5A 3FZHA 3M8RA 4JI0K 4CEOA 5CE3A 1BO5O 2EWSA 4ISGA 4XH5A 3VQQA 2X6NA 2D1KA 4DTXA 4OX9K 3HJFA 1N5YA 3RR7A 3QFUA 2YV0X 3EE9A 4B3RK 1VAZA 3LM2A 5AQKA 3SAGA 3TAMA 3P39A 4JK9A 3OW2M 1U47A 2GBZA 3C6TA 4OVLA 1UAXA 4QAGA 3OYBA 5BR9A 4JNEA 1NGHA 4WCEL 1RBSA 1BA0A 2HBLA 3HBTA 5AQWA 1XWLA 3KLGA 4YY3K 4C23A 1S1UA 2GX9A 2ITMA 1N32K 4EHUA 1SL0A 3LM9A 4DG1A 3CJBA 3ZT3A 4EP5A 4H5VA 1C1CA 5ELZA 4OPHA 3JS6A 2GWJA 2NRXA 3A5OC 2XY5A 4BR2A 3F9KA 3NGIA 3ASMA 4FWOA 4Z4IA 4RW7A 3AARA 3DLEA 4WFNL 2BTFA 3FFKB 3TARA 3L2RA 1K8AO 3VEXA 1HNWK 3DLKA 1VSFA 2QWNA 3HOTA 4FCYA 5AQIA 5FRMA 3WEEA 4Q0BA 5GIPA 1X9SA 4GV6A 3UE5A 4BRHA 2Q36A 5BPLA 4JK8A 4BRPA 4PA1A 2ZM6K 1OH6A 3QEIA 4PWDA 3CERA 4A59A 3FLCO 3UKUA 4QOZB 3SNNA 5F1XA 4JK7A 1GOBA 4KI4A 4DKWA 3O9SA 1CZAN 3PUFA 2QWPA 1TK8A 3L2VA 1NMDA 3VQ6A 1NJIO 5LJWA 1NK5A 2HBJA 2G8FA 1VSHA 3KK7A 5FROA 3AO3A 1RBVA 1CXQA 3L2UA 2VGNA 3FE1A 3NVMA 5C0YA 4DFKA 1LWFA 2IDOA 3V81A 3H1VX 3MN7A 2E6MA 3L3UA 4EAHD 3O6WA 4BRIA 2G8UA 4CVNE 1HNVA 3AY9A 1S1WA 2A40A 2P5GA 3VTHA 4CBXA 4AILC 3S3OA 4A2BA 5FPEA 4ILHA 1CZBA 2RF2A 1EETA 3IKMA 4M63C 4E3SA 2GTDA 4DTPA 4DCHA 5TKYA 4JKGB 3PY8A 4M45A 4BG8A 1UOCA 1YI2N 4BC2A 2FSNA 4FJKA 1QZ5A 1VK0A 2YJEA 3FZFA 3SMPA 3TSQA 2IIRA 2X78A 4Q5VA 1E3MA 3QEVA 3VF4A 4FOEA 4AHVA 2E2NA 2ZJPL 1ITGA 5FPMA 1IKYA 1YJ9N 2E6LA 3W0LA 3RRHA 1BA1A 4BWJA 4B1YB 4CIFA 3TAPA 2RKIA 4GY2B 3SUQA 1R0AA 4YDUC 3OYKA 3A5MC 4O8KA 4ZTJA 1A5WA 1B9FA 1K73O 3VENA 3MXIA 4PHTX 1VSLA 3HPGA 3OY9A 3GOIA 3ZT4A 2GEMA 3KD5E 1NJYA 1TKZA 4RW6A 1LV5A 4HTLA 3LWLA 4H5RA 5FLXO 4JV5K 3B8AX 3DLBA 3J7AP 2P9PB 4JI6K 4YOTA 2VCPA 1VQNN 4F8RA 3EN9A 4EP4A 4ZHRA 5ADXH 4HUFA 4LH5A 1U04A 4CJ7A 3U6FA 1T8EA 2W40A 1YTAA 4E7KA 3QFPA 4M42A 1HJRA 3LP1A 2P9KB 3F2KA 1ZBLA 3IAYA 3DLRA 3CCEN 3K5NA 4PKIA 1KLMA 4DB3A 1ZBHA 4CW7B 4HCCA 3G25A 2VQEK 4KREA 3VGMA 2OCEA 1GLLO 3CCMN 1T6DA 1RTDA 3C94A 1C0FA 4CI6A 4E19A 3OJUA 4KBOA 4BGAA 3JAMO 4AHCA 1WUAA 4F9OA 3HM9A 3NH0A 1MWMA 1WSHA 3LDOA 3OA9A 4FWKA 3FZLA 4A5BA 3T1HK 3VERA 1NM1A 5AR0A 4IOXA 2P9UB 3TPQA 1VSEA 3LAKA 4H4MA 4FJJA 3IFRA 2XY6A 4W5OA 2B4JA 1EX4A 3EYZA 2DFFA 1G99A 3JSMA 1JLQA 5FPDA 4YOXA 4AHSA 4WQ5C 2IVPA 1VQ4N 2IGIA 2WC9A 4FLYA 1VQ8N 3L2QA 1J54A 5HLFA 2OA8A 4FWPA 2UXCK 3WXIA 4CJSA 3VA0A 3MEDA 4FJ9A 4IOCL 1UA1A 1RT1A 3CJ9A 1SV5A 4IZ9A 4DFPA 4KHUA 1HYSA 5BREA 4MQ3A 4M3YA 3CCLN 4H0TB 3O9UA 3O9TA 1SQKA 2E1ZA 1IKWA 1JLEA 4G1QA 3CJAA 4CGHA 4Z94A 4B1XB 3OHRA 3SBTA 2E1YA 1KQSM 1U2VB 3C7NA 3ULEB 2FC0A 4HCBA 3EZ5A 5B8HA 4FK4A 1KTQA 1JL1A 4RWTA 4DV5K 4JI5K 4OJRA 3MN9A 4CZLA 4LSNA 3G10A 1KCFA 5JLHA 4GV3A 1C0UA 3OYIA 3J7YP 3O4NA 5BR8K 1U4BA 4IO8A 4KKOA 3GBTA 1ATNA 3MN6A 1DKGD 2UU9K 4E7JA 2HW3A 1NJXA 3PV8A 4LC9B 4YOWA 1Q82O 2E2OA 4UQGA 4AQYK 4B9LA 3U8XA 2IAJA 4B3OA 5LY3A 2QK9A 4JKGA 1GOAA 4YOUA 3SAFA 3O4WA 2G8VA 3L2WA 2UUBK 3S41A 1HYVA 3OJSA 2BE2A 3FR0A 1XNQK 2QTDA 1NGDA 1HRHA 4BDYA 1OVQA 3ISNC 3PIOL 3ZT1A 2Q0UA 3DMJA 4JAXA 3V1RA 3J80O 1YITN 5JS1A 3HZ6A 4LF5K 3K58A 3QESA 1QHAA 3A0IX 3NE6A 4OLAA 2HNZA 1XUPO 3ALYA 4DMNA 4L3QA 1ASVA 3QETA 3V4IA 4C1NK 3TAGA 4FW1A 2F9TA 1JCFA 3I56N 4DF8A 3U9ZA 4DFMA 4JHDA 2PFUA 4YFUA 3E9LA 5EOYA 4MO5A 1QE1A 3A2FA 1Y64A 1WAJA 4FVUA 4K0KK 4LY7A 3O80A 1YHQN 4BWMA 3HVTA 3D7EO 4U7BA 4FPAA 4LD0A 4F3OA 3HM8A 2HBKA 3LP0A 2QXFA 5C42A 1NK6A 1HNZK 3EKUA 3QBXA 1OVYA 3ZSVA 1BGXT 1VSIA 2P51A 2P9NA 3AA4A 5M1QA 4DTNA 4O55A 1S72N 2JLEA 3DXKB 4OGCA 1HX1A 4ELTA 3THWB 1KVCA 4JRPA 5J2QA 3SUNA 4BRNA 2Q0RA 1Z6RA 2O4GA 3QDKA 3SQ2A 2NLXA 2Q2RA 3CC7N 1TUYA 5J2MA 3CFRA 4BC4A 4CE9A 2ETJA 4CHQA 4N5SA 3D2EB 4RCHA 3CCUN 1NOZA 3AVHA 2BH1A 3LP2A 3KD1E 4EZ6A 3KKRA 5BN8A 4FLWA 5BPMA 4MFBA 3IUCA 3ZEUB 1GLEG 2HHHK 1FW6A 3V1OA 3ZLJA 3D0PA 3HSCA 3ZYYX 1YAGA 2HHQA 2GUPA 1RDBA 3RR8A 4W5TA 1E4FT 4IDKA 2E2QA 3T7ZA 4PKHA 1LAWA 3AA5X 3AVIA 1HJOA 4IFVA 4BDPA 2GELA 5M1FA 3V6DA 2P5OA 3CG7A 3ZSQA 1W97L 4FLZA 2YCHA 1HQUA 3L4IA 1LWCA 2Y1IA 2YJFA 2Q31A 3TAQA 2WOMA 5HL7L 1J9AA 1MWKA 4B1WB 5HBMA 2GV9A 3O3FA 4B08A 3K5MA 3ITHA 1OH5A 4JI3K 3E1YA 3NF7A 3MAQA 4WFBL 1EKEA 3SQ4A 3H6EA 4Z4CA 2ZWHA 3H45C 3HPOA 4YDUA 4B9UA 4M3UA 5KQDA 4AHRA 2ZQBA 1TL1A 3ULEA 4PUOA 2XHBA 1GLFO 2FXUA 1IV0A 3E9OA 4CF9A 3VOVA 1TAUA 4DSJA 4FL9A 4R79A 4ELVA 1R59O 3TTFA 4B1ZA 3CETA 5AQLA 5GAGP 3MX5A 3LZIA 1XC9A 4CZMA 5KPZA 3HOSA 1XMOK 4ZTFA 4YHHK 3FFIA 3K9KA 1X9WA 1VQLN 3DLLL 1Y97A 4DLGA 1DGKN 4LF9K 2O8CA 3FGUA 4O5BA 1REVA 4WF9L 3WNGA 1DTTA 1LOTB 4YOYA 1Q7YO 4CJ4A 4F2SA 4OPAA 4NXNK 5C25A 4O0IA 2JWKA 4I9LA 4BQLA 3O8MA 3WT0A 3DYAA 4B8AB 4U67L 2KZMA 4A2AA 3U3YA 2VQFK 4H03B 3E9PA 4H0VB 3IRXA 4CJFA 1TYQB 1IKXA 4CHNA 1EXQA 4K41A 4IG0A 1K9MO 4H0PA 2DY4A 2KW4A 2PYJA 4DFJA 1FJGK 3KLHA 3PIPL 4X62K 4CZGA 3EL2A 2A3ZA 4N56A 3NVKA 5CYQA 3S3NA 1SKWA 3TR8A 4Z4HA 2X6SA 4CFDA 4I6MB 4CCHA 4MLEA 2P9IA 3HVRA 2HMPA 2QKBA 5EX5A 3VQ8A 1CLQA 4PY5A 1DEJA 3AVMA 1X9MA 4CERA 4GNIA 1ZXOA 4WQ5A 3CM5A 5KQ8A 1N36K 2EX3A 2OTJN 2WBNA 2ZJRL 2F8TA 3CCVN 2O8BA 1SL1A 2E2PA 4AF1A 4FZXC 3RSEB 3WXKA 3ZSOA 3I33A 4M3WA 2KZZA 3ZETB 3KKSA 3RMAA 4J8FA 5CHIA 4DLEA 5K14A 4BRAA 4BRCA 3RWUA 3OTOK 1S9EA 2ZJQL 3OYJA 1RBUA 2YHWA 2CGKA 1NMNA 3CYMA 4WQ4C 3HL8A 2NRZA 4CZFA 1C1BA 4DF4A 3U4LA 3D2FA 4JS5A 4O44A 3DOLA 1RDDA 4BR9A 4EZ9A 4DQ8A 1OH8A 2FF6A 4CK3A 1FK9A 3W3DA 3TU5A 3D6RA 3K59A 2IS3A 5JVHL 4DSEA 1SKSA 3VQBA 1NK4A 4BGBA 3AV9A 2YNFA 5IWAK 2KFNA 1H1VA 4WYBA 3KZBA 4CEFA 3OBWA 4FWLA 4CJ3A 3IDHA 4DS5A 1RFQA 1M90O 3PX4A 4DU4A 1YTUA 1S22A 4AM6A 1KC8O 3VEVA 2VWBA 4BRLA 3T19A 1S6PA 4CHYA 4DV3K 1WAFA 1IG9A 4JD2A 4A62A 3CC2N 4Z4FA 4NB4A 1ZBSA 3HYFA 3CHWA 2A1RA 5FDLA 3SUOA 4JI4K 1EO1A 1BIUA 2HB5A 4GMJB 5HRSA 4GKKK 3CFOA 4KO0A 4JS4A 1NNEA 3P1GA 4V19S 3ZX0A 5AJ3K 4M3XA 2VG6A 1N8RO 5AQMA 3VQPA 2O8EA 2D0CA 1RT5A 4QS9A 3THYB 4M41A 3K2PA 3GDQA 2O8FA 1BG3A 4B9TA 2HMIA 2NUBA 1TKTA 3CQ8A 4KH6A 3AVBA 2OZMA 2G8KA 4JKAA 2JGUA 1RNHA 3ZX2A 1XQSC 2P9SA 1L3SA 1HLUA 3I0RA 1KAZA 3NH1A 2FSKA 1BDGA 5AQSA 3UKRB 2CGJA 3NHGA 1LCUA 1V4SA 4Z0UA 1X3NA 4IO9L 1JXEA 2B5JA 3C65A 1S9GA 4FJXA 1KLNA 3VEZA 4HUGA 1HPMA 1W7AA 1WSGA 1QVGM 2QWRA 2ASPA 2IOCA 4MO4A 5FRNA 3O9RA 1TYQA 3ZSZA 4DR3K 4KTWA 2KTQA 4NYFA 4FLXA 4XH4A 3QIOA 3M1FA 5AQFA 4QS7A 2G8WA 3HTVA 4E7HA 2NRRA 3TSPA 3ID6A 3DXMB 3VQ7A 3LALA 3QO9A 1VRUA 1ZC6A 3WNFA 3HO1A 1HMVA 1XMQK 5KPTA 4KB1A 4OLBA 2QWOA 4NXMK 1P90A 4JRQA 2CGLA 2HNYA 4H4OA 1DT9A 1HKCA 3NH2A 3DAWA 1S1TA 3H1QA 4RW9A 3CJ7A 4ILGB 3CCRN 3AO5A 2E20A 3KLFA 4E1JA 3O1WA 4J2DA 2G8IA 5M1KA 4BR5A 3VF2A 3VQ4A 1S1XA 5JS2A 2PBDA 1BUPA 2HNDA 3VGLA 3ZSXA 3UIQA 4F3TA 3SCXA 3AVFA 4KAZA 2Z1HA 5JVGL 2A1SA 3CCSN 4DV6K 4CGJA 3OYFA 3GG4A 5AQGA 3NCIA 3C6UA 5DM7L 2P9LB 3J7ZO 1YIJN 2PZSA 3WXMB 1MDUB 1NKBA 3NMUA 3VEWA 2HOEA 3S3MA 1YJWN 3HSTB 1LW2A 3BY5A 4HTUA 2F9WA 2EHGA 2D0PA 2HSTA 2HF4A 2ITGA 4C8OA 4KB0A 3CFPA 1JXBA 1X1PA 1Q9YA 4KHSA 2KQ2A 3CMAN 3K5LA 2Z1IA 1NG9A 4IG3A 5GIOA 3F9MA 3MEGA 4J2AA 3MCAB 4FZZA 3TSUA 4IXCA 3H46O 1YJNN 1BU6O 3CC4N 4I9QA 3CCQN 3AO4A 5CR4A 4BR7A 1X3MA 1IBKK 4FWMA 2HHTA 3OS1A 1G15A 2D0OA 4CEEA 1KXPA 3RMDA 4DR5K 3O9QA 1JLFA 1K8KB 1XHXA 1UA0A 1ILYA 1HUXA 1IO2A 2OPRA 1NK7A 2ZF5O 1JLBA 3VGKA 3G0ZA 1TV6A 3OS0A 4CZHA 2B6AA 4DQQA 1IKVA 2UYTA 1Q18A 3TAFA 4LF6K 4DTJA 1TVRA 4BACA 1I39A 4CJQA 1RBTA 1N34K 4CGDA 3I8DA 2W41A 1D8YA 2R7YA 2FSJA 2H3GX 4B3TK 2AJQA 5C2FA 2HBMA 1TL3A 2YX6A 1NGFA 4CJTA 1IG8A 3AAPA 3EO3A 5E41A 3HXMA 4A61A 1NGEA 5DMRA 4FOIA 5EU7A 3THXB 5AQQA 3MX2A 3J81O 3LPTA 4CEQA 4CZKA 1Z25A 3N4QA 3OYHA 2DFHA 2NRVA 3A8YA 3MEEA 1D5AA 5KRSA 4FK0A 1KSPA 3D45A 3A5NC 2FF3B 3DRPA 3RTVA 4CJLA 5LL6Z 4B8CA 3GE1A 3TWHA 4FJMA 4DV4K 1NLVA 1X9JA 1WSEA 3OYNA 4DQIA 1XNRK 4FJ8A 4FWQA 4C8NA 3QICA 4KH4A 1NJWA 5EVZA 4L8RB 3Q7CA 3LDPA 2A6AA 2VGMA 2VWKA 3KWGA 4BQZA 3ZCMA 3ENBA 1VQ5N 2FLOA 4DSFA 3VTIA 4OGEA 3KJVA 2HVIA 3KIOA 1S1VA 3NF9A 3CJCA 2GUIA 4BVPA 2Q97A 1C0GA 2P9PA 3VEYA 3VQAA 3G71N 1RTHA 3K5OA 4N41A 3H3OB 1KD1O 2F4VK 4NLBA 3WNHA 3R6MA 4I7FA 2FBTA 1T3VA 1I94K 3AVKA 3RMCA 3V9SA 2P9KA 2G8HA 2OPSA 1BQMA 5KGXA 3V9ZA 1U48A 5AQVA 3IG1A 1L5UA 2FBYA 3OYAA 3DXMA 3TTCA 1D4XA 4JKCA 3N4PA 1CZ9A 1BQNA 3EE8A 3I8BA 4OPJA 2D0AA 4CD3A 2HHSA 2V52B 5JLFA 4FPBA 5AFUA 1VRTA 2I7PA 4KHPK 2E88A 4IBNA 4N76A 3B6PA 3L3VA 3Q7BA 3RMBA 4K25A 4B1VA 5HRNA 3MECA 1Q8IA 1C0MA 3BDPA 1J5EK 4M3ZA 3HP6A 3LANA 1M1KO 4K43A 1JCGA 4FJGA 3V1QA 2P9UA 3HT3A 4UY8O 4CGIA 1QS4A 4MDBA 1T05A 4NLCA 4AM7A 4X65K 3WEEB 3TI0A 3SV3A 1T7PA 1YXQA 3U9DA 2P9LA 4KTQA 3CQXA 3QEXA 4LSLA 2OTLN 2ATQA 3H08A 1BL3A 1QSLA 2PY5A 1KVAA 1T03A 4CJVA 4H0YB 4GVMA 2V51B 3TABA 3OS2A 4BRKA 2UXDK 3CPEA 5I9EB 4FLTA 3SMSA 1I3AA 3KTQA 1EWRA 1C6VA 2AA4A 4C8MA 4DUZK 4CBWA 1T44A 4Y0WA 4K8ZA 4J2EA 2BANA 4JKHA 3LZJA 4QCLA 2KLAA 4IFEA 3ZT0A 4BC5A 1QSSA 4H5NA 1QTMA 3PX0A 3DRSA 3O5BA 4CK1A 2BDPA 3M5RA 2YI1A 1K8KA 2QWQA 4FK2A 4FJHA 1W2BM 4CHZA 1RT4A 1ASUA 2QKKA 3C6AA 1U2VA 3P38A 4PL7A 4BE1A 4KI6A 5AFUH 4NCAA 3WQTA 4O0JA 3KVGA 5C10A 3SPYA 4KPYA 3LDNA 5LJVA 3LAMA 1LW0A 4CGFA 3CM6A 5EY4A 3VQDA 4KHWA 3KWIA 2ZGYA 3IS9A 4JYAK 1ATRA 2W6KA 3AVJA 4OKJA 4FO0A 5C12A 3VQ5A 4BG9A 5HOOA 2DPNA 3WQUA 1VQ9N 4B9NA 3QNNA 1TUUA 2Z1GA 2DTUA 1HQEA 4DR6K 3O1BA 4FSVA 2F8SA 4OO1J 2VG7A 4LH4A 5CZ2A 1ESVA 3T1AA 5M1OA 4B9SA 1N33K 3NGZA 3P4IA 3AVGA 5AZJB 4BE2A 3PLAA 4DV2K 2KFZA 4H8KA 3HPHA 3THVA 1TK5A 4C8LA 3J8AA 4EIAA 4JLHA 4O4GA 4B9QA 4CIGA 2VG5A 4JKFA 3P83D 4E7IA 1O13A 4FZYA 3LL3A 4JI8K 1J53A 4AH9A 3QEWA 3NAEA 1WB9A 3SLCA 3SQ1A 3QLHA 4A57A 1RT7A 4KRFA 3SK3A 3QBWA 3OYCA 5GINA 4RG8A 1SS6A 1WBBA 2OYQA 1ASWA 3BZCA 3R8EA 4FXDA 2NRTA 4BR0A 5I3UA 4FJNA 1P8ZA 4RTFD 4KTZA 4KHYA 3S9HA 3EZWA 2Y1JA 3NF8A 3ATVA 4BRFA 4E1MA 5C2DA 4DR1K 1F21A 3NGYA 4C1NI 1HKBA 4PL8A 5AQUA 3JXUA 1IJJA 1N6QA 1VQMN 1VSJA 2YKMA 1WBDA 3SPZA 5AZIB 4IWVA 4CZEA 2O8DB 3R3LA 3K9JA 4GKJK 1BOTO 1HYZA 3AA2A 5SWMA 4XIUA 3DXKA 2YHXA 2ASOA 3E01A 3SJHA 1VSKA 3AVLA 3B6OA 4RW4A 2WFBA 1FXXA 3I0SA 3LDQA 3THWA 3AVAA 1RT2A 4B9MA 3L4QA 2Q3SA 3L8BA 3U3GA 3D2EA 2ZE2A 2QWMA 4DQRA 1EQYA 1QQOA 1NKCA 3OYEA 3NBPA 4KFBA 3M3ZA 1NU0A 5CY4A 2HHVA 4DTMA 4I2QA 1DTQA 2HVHA 3ZEUA 4F2RA 2VWJA 2YKNA 1RBRA 1RTJA 3BEXA 3ULDA 1RILA 3ATUA 1HKGA 3K57A 1WSJA 4CJEA 4YNQA 3TAEA 2E8AA 4FWSA 4CEBA 3DLGA 4FM0A 2GWKA 5AQTA 2CH6A 3T69A 4JEPA 4DU3A 4FJIA 1KFSA 4E89A 5LMNK 2IVOA 3MCPA 1Q81O 2YHBA 4CGGA 4EFHA 1NGAA 4CJUA 2JWLA 1RDWX 3T3FA 5BRDA 5KTQA 3C7NB 4CESA 4G9ZA 1BCOA 4FWRA 3BP8A 2BGGA 2IVNA 3O4QA 1NK0A 1K6YA 4CF1A 1BI4B 3AA3A 3V9UA 1NOYA 4CF0A 4IJNA 1C0TA 3MMVA 4ELUA 4E7LA 1TKDA 3CJ1A 5ADXA 2WTUA 1RTIA 4BRGA 3QB0A 3NF6A 5E26A 4M7XA 3SAHA 3OYDA 1C1AA 1BCMA 4ID1A 4IOAL 1XI1A 4X64K 4KHNA 4Z4GA 2I7NA 3ZX3A 1RCHA 4DHYA 4OKEA 5AQRA 3AAQA 3R1XA 4CF2A 4FJ7A 3CQYA 4BE0A 3UB5A 4M3TA 4W5NA 1OH7A 1KAXA 3CCJN 2IC3A 2QEXN 3BF3A 3K0SA 5CYMA 3DWLA 1U6ZA 3VMFB 5EXWA 4FVMA 1JLAA 5BN9A 3T1YK 3QIPA 2RE2A 4DU1A 4CEAA 2A41A 4DTUA 4FM2A 2F7TA 3PSFA 3QMLA 3ZSWA 2KHOA 2OANA 5AZJA 5GADP 5E84A 5F0XA 4XEIA 1YUWA 1NKEA 1SKRA 4JHDB 4MLHA 5IT9O 4W5RA 2A42A 2KKZA 4IDHA 1D9DA 4R5PA 1JLCA 1MU2A 2FBVA 5C24A 1E4GT 4CEDA 4K8XA 3IMXA 5C15A 1WNSA 4GVEA 3DLHA 2BUPA 5DM6L 3BF1A 1EP4A 2YNHA 1VQ7N 1OKJA 4I6MA 3SUPA 1NK8A 4LFBK 3VQ9A 4CJKA 3SYZA 1B9DA 4Y1CA 3MWPA 3EEQA 1ZBIA 4NCBA 1Z05A 3OYLA 4A5AA 4LF4K 2P9NB 4IFYA 5D3GA 2PYLA 3P5JA 4CHOA 3I55N 1FKOA 5JICA 4LF7K 4BRDA 1TK0A 3VN5A 4DWIA 5TKWA 3RSEA 2Q1NA 1A5XA 4HHTA 4B9VA 4BROA 4JKEA 2ZD1A 3ZETA 4XH1A 2NRWA 2NNWA 1IBLK
chains in the Genus database with same CATH topology
5AQZA 2WUSA 2HBJA 3CJCA 3KK7A 5AZIA 3WXLA 3K9KA 4BVPA 2Q97A 1RGIA 1VQLN 1C0GA 2P9PA 3DLLL 2YHYA 1DGKN 3VEYA 3G71N 3G6EN 5MLCQ 2ZGZA 3H3OB 1KD1O 2VGNA 3FZMA 3FE1A 3FGUA 3NVMA 1VQON 4NLBA 4WF9L 3R6MA 5C0YA 1LOTB 4YOYA 1Q7YO 1T3VA 4OPAA 1QQNA 3H1VX 3MN7A 4IEIA 2JWKA 4BQLA 4EAHD 3MDQA 3O6WA 3O8MA 3WT0A 4U67L 2P9KA 4A2AA 4BRIA 3AY9A 5AQPA 2A40A 4BRQA 4H03B 5AQVA 3VTHA 3E9PA 4H0VB 5AQJA 4CBXA 3DXMA 1VQKN 3TTCA 1TYQB 1D4XA 4A2BA 4H0OA 4JKCA 4O8UA 2D4WA 3N4PA 5FPEA 4ILHA 4K41A 3EE8A 3I8BA 4BRMA 5JMVA 4H0PA 1K9MO 2QWLA 3KHYA 4H5TA 3IKMA 1BWFO 5KPRA 4M63C 2GTDA 2ASMA 1JCEA 4CD3A 4DCHA 2V52B 2J4RA 4JKGB 5TKYA 1KAYA 4FPBA 2QW9A 4BG8A 5AFUA 1V4TA 2RHKA 2I7PA 1YI2N 4BC2A 3PIPL 2E88A 2FSNA 3ID8A 4CZGA 5BRFA 1QZ5A 4BY9C 3EL2A 1GLJO 1T6CA 2A3ZA 2YJEA 3FZFA 3SMPA 3Q7BA 3TSQA 3NVKA 4K25A 4B1VA 2IIRA 3CF5L 4I6MB 1M1KO 4MLEA 3VF4A 4K43A 4FOEA 1JCGA 2P9IA 3OBYA 2P9UA 2HMPA 4UY8O 2E2NA 4MDBA 2ZJPL 5EX5A 5FPMA 3L6QA 3E66A 4NLCA 1YJ9N 1DEJA 3W0LA 4AM7A 4EHTA 3WEEB 4GNIA 1BA1A 1ZXOA 3FZKA 4B1YB 1YXQA 4WQ5A 3U9DA 4GY2B 2P9LA 5KQ8A 2VYPA 2OTJN 2WBNA 4YDUC 2ZJRL 3CCVN 3A5MC 4O8KA 4WFAL 3CQXA 2OTLN 2E2PA 1K73O 3VENA 4AF1A 3RSEB 3WXKA 4PHTX 1YF5L 3A5LC 3GOIA 2GEMA 3I33A 4ILJA 4H0YB 3ZETB 2V51B 4J8FA 5CHIA 4HTLA 4BRAA 4BRKA 3CPEA 5I9EB 4H5RA 3SMSA 4BRCA 2AA4A 3B8AX 4CBWA 3TTDA 1T44A 4Y0WA 2ZJQL 2P9PB 4JKHA 4YOTA 2VCPA 2YHWA 1VQNN 2CGKA 2KLAA 3EN9A 4IFEA 4WQ4C 5ADXH 2NRZA 4CZFA 4BC5A 5BPNA 4H5NA 3U4LA 4CJ7A 3O5BA 3D2FA 2W40A 3M5RA 2YI1A 1K8KA 2NZTA 2QWQA 3QFPA 4BR9A 1MA9B 4DQ8A 1W2BM 2FF6A 3M6GA 2P9KB 3F2KA 3MWTA 4BVOA 3W3DA 3TU5A 3UKRA 3C6AA 1U2VA 3D6RA 3P38A 5JVHL 4PL7A 4H0XB 3CCEN 3CMEN 4PKIA 4BGBA 5AFUH 4DB3A 1QZ6A 1H1VA 4WYBA 3G25A 4FWNA 3KZBA 3WQTA 3OBWA 3VGMA 3KVGA 5C10A 1GLLO 4FWLA 5F2RA 1T6DA 3CCMN 1NWKA 3LDNA 3IDHA 1Q86O 1RFQA 1C0FA 4CI6A 4IJAA 1M90O 5LJVA 4KBOA 4BGAA 5EY4A 1S22A 1WUAA 5JLFA 4AM6A 4F9OA 4CZJA 3KWIA 2ZGYA 1KC8O 3VEVA 1MWMA 2VWBA 3LDOA 3OA9A 4BRLA 3CIPA 1ATRA 4WQ4A 4FWKA 3FZLA 4A5BA 5C12A 4FO0A 3VERA 4BG9A 1NM1A 5HOOA 3F5TA 2DPNA 4JD2A 1NGIA 3C0BA 4A62A 3HRGA 3WQUA 3CC2N 4NB4A 1ZBSA 3CHWA 1VQ9N 2P9IB 5AR0A 4IOXA 1TUUA 2P9UB 4YORA 3TPQA 3O1BA 4FSVA 3WXJA 3IFRA 4OO1J 4YOVA 1GLAG 4M7YA 1ESVA 1EO1A 1SAZA 3VPZA 1G99A 3LDLA 3EKSA 5AQXA 5M1OA 3P4IA 5AZJB 1NGJA 5FPDA 3ZX0A 2PAVA 4GV9A 3PLAA 4YOXA 2QA4N 1GLDG 4WQ5C 2IVPA 1VQ4N 1N8RO 5AQMA 3J8AA 1ATSA 4EIAA 2WC9A 1VQ8N 4JKDA 4QS9A 4B9QA 5M1PA 1VQPN 4FWPA 3AGKA 3WXIA 4B1UB 1YVNA 4JKFA 1O13A 3LL3A 3GDQA 2HF3A 4IOCL 1BG3A 3CJ9A 4IZ9A 5BREA 4KH6A 3SLCA 3CCLN 4A57A 1NGGA 4JKAA 3SK3A 4H0TB 3O9UA 5AQHA 3ZX2A 3QBWA 3O9TA 1SQKA 2E1ZA 5GINA 1SS6A 3VF6A 1VQ6N 3D2FB 3CJAA 1XQSC 3R8EA 4Z94A 4B1XB 2V7YA 3CPWM 3OHRA 2P9SA 2NRTA 3SBTA 1HLUA 1WOQA 1KAZA 2E1YA 2FSKA 4BR0A 1P8ZA 1BDGA 3VESA 5AQSA 3UKRB 4RTFD 1KQSM 1U2VB 2CGJA 3C7NA 3ULEB 2NRHA 1JJ2M 3MN5A 5B8HA 1LCUA 1V4SA 3EZWA 3R9PA 3UKUB 4HWIA 4RWTA 3O08A 2V7ZA 3ATVA 2AP1A 4IEEA 5AQOA 4BRFA 5C2DA 3MN9A 4CZLA 1X3NA 4IO9L 5JLHA 4CZIA 4C1NI 1HKBA 4GV3A 3C65A 4PL8A 5BRHA 3VEZA 5AQUA 1HPMA 1RDUA 3JXUA 4IO8A 4ISEA 1IJJA 3GBTA 1VQMN 1ATNA 3MN6A 1NBWA 1DKGD 1QVGM 2QWRA 5AZIB 4IWVA 2ASPA 4CZEA 4CBUA 3R3LA 3K9JA 1BOTO 3P31A 4MO4A 3O9RA 4BR4A 4LC9B 4YOWA 1TYQA 1Q82O 4JD2B 2E2OA 3DXKA 2YHXA 2ASOA 3SJHA 3U8XA 5FPNA 4XH4A 5LY3A 2CH5A 3M1FA 2QI2A 2WFBA 3LDQA 5AQFA 4QS7A 3HTVA 4JKGA 2NRRA 4JKBA 4YOUA 3CI5A 1J6ZA 3L4QA 3H3NO 3TSPA 3SAFA 3WUHA 3O4WA 3MK6A 3D2EA 3ID6A 3DXMB 2QWMA 1EQYA 1ZC6A 3S41A 1QQOA 4JN4A 5GAHP 3ENOA 5KPTA 2QM1A 2QWOA 3M3ZA 4PKGA 4H5WA 3FR0A 4BC3A 1P90A 3DJCA 2CGLA 2QTDA 1NGDA 1DT9A 1HKCA 3ZEUA 4QS8A 3DAWA 3PIOL 5AQYA 3AGRA 2Q0UA 4JAXA 3H1QA 1YITN 2A5XA 3BEXA 3CJ7A 3HZ6A 4ILGB 3CCRN 1GLCG 2E20A 1QHAA 3A0IX 1HKGA 3ATUA 3O1WA 4E1JA 1XUPO 4BR5A 3VF2A 5GAEP 5M1KA 5H1SQ 4L3QA 4C1NK 2E8AA 4FWSA 5M1NA 3CD6N 1SZ2A 2F9TA 4MDAA 1JCFA 2GWKA 2PBDA 1BUPA 3VGLA 3I56N 5AQTA 2CH6A 3T69A 4JEPA 3U9ZA 1NGCA 3ENHA 3HI0A 4JHDA 2IVOA 3MCPA 3GL1A 1Q81O 5JVGL 2P9SB 2PFUA 3E9LA 5EOYA 4EFHA 1NGAA 3CCSN 2JWLA 1RDWX 4MO5A 2QXLA 3SBGA 3GG4A 5AQGA 4CD1A 3BUZB 5BRDA 3C7NB 5DM7L 2P9LB 5AQNA 3J7ZO 1YIJN 4G9ZA 3RVCA 4FWRA 3BP8A 3G4SN 1Y64A 1MDUB 3WXMB 3NMUA 1XC3A 2IVNA 2HOEA 4NO7A 3O80A 4O5FA 3VEWA 1YJWN 1YHQN 4FVUA 2F9WA 2HSTA 2D0PA 2HF4A 3VETA 3D7EO 4BREA 4U7BA 4FPAA 3CXCM 4IJNA 3HM8A 2HBKA 3CMAN 1S3XA 3MMVA 1QVFM 3L0QA 3CJ1A 1GLBG 3EKUA 3QBXA 5ADXA 1OVYA 5GIOA 3F9MA 4BRGA 3MCAB 3VEOA 3TSUA 4ISFA 3H46O 3QB0A 4IXCA 2P9NA 4K42A 1YJNN 1BU6O 5M1QA 3CC4N 5E26A 4M7XA 3SAHA 5CR4A 3CCQN 1S72N 1QQMA 4BR7A 1X3MA 3DXKB 4FWMA 4IOAL 1HX1A 2D0OA 3C6HA 2I7NA 1KXPA 3ZX3A 4DHYA 5AQRA 1NGBA 3AAQA 3O9QA 3R1XA 1K8KB 2Q0RA 1Z6RA 3QDKA 4KH5A 4BRNA 3FZHA 2NLXA 1HUXA 2Q2RA 5CE3A 3CC7N 1ILYA 1TUYA 3CQYA 2ZF5O 3VGKA 1BO5O 4BC4A 2EWSA 4ISGA 4XH5A 3UB5A 4CZHA 3D2EB 4RCHA 2D1KA 1KAXA 3CCJN 3CCUN 2UYTA 2BH1A 1Q18A 2QEXN 3BF3A 3QFUA 3DWLA 3EE9A 1U6ZA 3VMFB 5BN8A 5EXWA 1VAZA 3LM2A 5AQKA 3SAGA 5BN9A 2RE2A 3P39A 5BPMA 4JK9A 3OW2M 3IUCA 3ZEUB 1GLEG 2A41A 3HSCA 3ZYYX 1YAGA 2F7TA 2GUPA 3QMLA 2KHOA 2OANA 1E4FT 2W41A 5BR9A 4JNEA 2E2QA 1NGHA 3T7ZA 2FSJA 4WCEL 2H3GX 5AZJA 5GADP 1BA0A 2HBLA 2HBMA 3HBTA 4PKHA 5E84A 5C2FA 5F0XA 1HJOA 1NGFA 2YX6A 5AQWA 4C23A 4XEIA 1YUWA 2GELA 5M1FA 2GX9A 1IG8A 2ITMA 3AAPA 3EO3A 4EHUA 4JHDB 4MLHA 4A61A 1NGEA 3LM9A 1W97L 2A42A 3CJBA 2KKZA 4IDHA 4FOIA 2YCHA 4H5VA 5ELZA 4OPHA 3L4IA 1E4GT 3JS6A 3MX2A 2GWJA 2YJFA 2Q31A 3IMXA 5AQQA 5C15A 2NRXA 5HL7L 4GVEA 1MWKA 4B1WB 2BUPA 5DM6L 3A5OC 3BF1A 1VQ7N 4BR2A 1OKJA 4CZKA 4I6MA 4FWOA 3AARA 4WFNL 3N4QA 3E1YA 2BTFA 2NRVA 3A8YA 3FFKB 4WFBL 3MWPA 1K8AO 3H6EA 3VEXA 1Z05A 2FF3B 3A5NC 2ZWHA 3H45C 3HOTA 2QWNA 4YDUA 5AQIA 3WEEA 4A5AA 5KQDA 5GIPA 4GV6A 3UE5A 4BRHA 2Q36A 3GE1A 4JK8A 4BRPA 2P9NB 5BPLA 3ULEA 1NLVA 1X9JA 3CERA 1GLFO 4A59A 3FLCO 2FXUA 4FWQA 3UKUA 3I55N 3E9OA 3VOVA 3QICA 4JK7A 4KH4A 5F1XA 4FL9A 5EVZA 5JICA 4BRDA 3Q7CA 4DKWA 3LDPA 5TKWA 3O9SA 3RSEA 2Q1NA 2A6AA 2VGMA 1R59O 3TTFA 4R79A 1CZAN 3KWGA 3CETA 5AQLA 4B1ZA 2QWPA 3MX5A 3ENBA 4BROA 4BQZA 5GAGP 4JKEA 1NMDA 4CZMA 1VQ5N 2FLOA 4XH1A 3ZETA 5KPZA 3HOSA 1NJIO 5LJWA 2NRWA 3VTIA 2NNWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F2K A;  2F7T A;  5CR4 A;  4MDB A;  4MDA A;  5HOO A;  3K9J A;  3HOS A;  3HOT A;  4U7B A;  3K9K A;  4R79 A; 
#chains in the Genus database with same CATH topology
 3PSI A;  5AQZ A;  2WUS A;  4FYD A;  1D9F A;  5AZI A;  3WXL A;  2HHW A;  2O8D A;  1RGI A;  3SZ2 A;  2YHY A;  3G6E N;  5MLC Q;  2ZGZ A;  3FZM A;  1VQO N;  3RRG A;  5KI6 A;  5J1E A;  1QQN A;  3KK2 A;  4DTS A;  4F4K A;  4IEI A;  4DR2 K;  4DQP A;  3MDQ A;  1RT3 A;  4W5Q A;  5AQP A;  3AVN A;  4BRQ A;  2OPP A;  5AQJ A;  1VQK N;  4H0O A;  3QNO A;  4O8U A;  5I42 A;  2D4W A;  4NCG A;  4BRM A;  5JMV A;  2OZS A;  2QWL A;  3KHY A;  4H5T A;  5KPR A;  1BWF O;  1RT6 A;  2ASM A;  2I5J A;  1JCE A;  4CJ5 A;  3CPW M;  2J4R A;  1KAY A;  2QW9 A;  1V4T A;  2RHK A;  2XRI A;  4N47 A;  3SJJ A;  3PO4 A;  5BRF A;  3ID8 A;  4BY9 C;  1GLJ O;  1T6C A;  3LWM A;  4LFA K;  1BHL A;  2E4L A;  2XY7 A;  1LAV A;  3DI6 A;  3CF5 L;  1QSY A;  1J5O A;  3BGR A;  4CJR A;  1ZYQ A;  1CXU A;  1JLG A;  1QQC A;  1KVB A;  4CEC A;  3OBY A;  4I2P A;  4AHT A;  3TAN A;  4DV7 K;  3L6Q A;  3E66 A;  4FJL A;  2YHA A;  4EHT A;  1HR0 K;  4CIE A;  3FZK A;  3OYM A;  2VYP A;  1WSF A;  1HPZ A;  1VHX A;  4WFA L;  1SL2 A;  3PO5 A;  1BI4 A;  4HUE A;  2RPI A;  2D5R A;  4FLU A;  4JI1 K;  1YF5 L;  3A5L C;  3THY A;  1YVU A;  4ILJ A;  4JI2 K;  3DM2 A;  1S6Q A;  2YNG A;  2HHX A;  2DFE A;  3PX6 A;  2FBX A;  3NDK A;  3TTD A;  3AO1 A;  1BIS A;  2O8C B;  4HVJ A;  3LDS A;  5HP1 A;  4LF8 K;  2XO7 A;  4WE1 A;  1LWE A;  4CFC A;  5BPN A;  4DR7 K;  3M8P A;  1GOC A;  1HNX K;  2NZT A;  1MA9 B;  4NYN A;  3M6G A;  4BVO A;  3MWT A;  3SI6 A;  3OVN A;  1W9H A;  3UKR A;  4DV0 K;  4H0X B;  3CME N;  3HP9 A;  3ZSY A;  3VA3 A;  1QZ6 A;  2UUA K;  2WON A;  5SZT A;  4FWN A;  2YNI A;  3AVC A;  5F2R A;  1NWK A;  4Y1D A;  5J2N A;  1Q86 O;  4IJA A;  4M3R A;  2HHU A;  1L3T A;  4FM1 A;  3F73 A;  4CFA A;  4CZJ A;  3M8S A;  1UWB A;  4DTO A;  5LMU K;  4C8K A;  3CIP A;  4DTR A;  4WQ4 A;  3QEP A;  2E5L K;  1RDA A;  3F5T A;  5J2P A;  1NGI A;  1VSM A;  3C0B A;  3HRG A;  1QHT A;  2P9I B;  4YOR A;  3KLE A;  1KFD A;  3WXJ A;  4YOV A;  1GLA G;  4M7Y A;  1SAZ A;  3VPZ A;  3LDL A;  3EKS A;  5AQX A;  3DRR A;  1NGJ A;  4GV9 A;  2O8B B;  2PAV A;  1FKP A;  5CZ1 A;  5HRR A;  2QA4 N;  3SV4 A;  1GLD G;  1BIZ A;  2UXB K;  1Z26 A;  1ATS A;  4X66 K;  4JKD A;  3QIN A;  5M1P A;  1VQP N;  3AGK A;  4B1U B;  4DUY K;  1YVN A;  4DSK A;  3AO2 A;  3WNE A;  2HF3 A;  3EY1 A;  3VQE A;  1JKH A;  3ZSR A;  1NGG A;  5AQH A;  3VF6 A;  4Z4E A;  4DR4 K;  1VQ6 N;  3D2F B;  4LFC K;  4CJP A;  4B3S K;  1KRP A;  2V7Y A;  4CHP A;  3KK3 A;  1WOQ A;  4JI7 K;  3O3H A;  4CK2 A;  3VES A;  1WLJ A;  3QER A;  1U45 A;  2NRH A;  1WSI A;  2RN2 A;  3MN5 A;  1JJ2 M;  4B3M K;  3R9P A;  3UKU B;  4HWI A;  3O08 A;  2V7Z A;  4IEE A;  2AP1 A;  5AQO A;  4E1N A;  3M8Q A;  4BDZ A;  4FJ5 A;  4DSL A;  4CZI A;  1IBM K;  5HRO A;  4J2B A;  1ZBF A;  4CEZ A;  5BRH A;  1RDU A;  4ISE A;  4KV8 A;  3LPU A;  3KK1 A;  1NBW A;  4ICL A;  1WN7 A;  4CBU A;  3OYG A;  2F96 A;  3P31 A;  3BZK A;  1DLO A;  4BR4 A;  1TKX A;  1VSD A;  1L3V A;  4JD2 B;  5DK5 A;  5T7B A;  5FPN A;  2CH5 A;  2QI2 A;  4CJW A;  1EWQ A;  2Z1J A;  4JKB A;  3CI5 A;  1J6Z A;  3H3N O;  3WUH A;  1TAQ A;  1NJZ A;  2P1J A;  4AHU A;  3KLI A;  3MK6 A;  4E0D A;  4GW6 A;  3JYT A;  4OKK A;  3LP3 A;  4JN4 A;  5GAH P;  3ENO A;  1RDC A;  4DS4 A;  2O8E B;  2QM1 A;  1O1W A;  4PKG A;  4H5W A;  4BC3 A;  2D0B A;  1ZBU A;  3DJC A;  5KRT A;  3MXM A;  3HK2 A;  4TSX A;  4QS8 A;  1HNI A;  2O8F B;  5AQY A;  3AGR A;  1IH7 A;  4DSI A;  2A5X A;  1GLC G;  3NFA A;  5GAE P;  5H1S Q;  3CD6 N;  5M1N A;  2LSN A;  4IKF A;  1SZ2 A;  4MDA A;  3V9W A;  1W0H A;  3O3G A;  1Q9X A;  1NGC A;  1B92 A;  3ENH A;  4FLV A;  3DOK A;  3HI0 A;  3GL1 A;  1YT3 A;  2P9S B;  2QXL A;  3SBG A;  4CD1 A;  3BUZ B;  1S5J A;  4DQS A;  5AQN A;  1SUQ A;  3RVC A;  3THX A;  4FW2 A;  3G4S N;  1XC3 A;  4NO7 A;  4O5F A;  3MXJ A;  1U49 A;  3VET A;  4BRE A;  2OPQ A;  3C95 A;  3CXC M;  4DV1 K;  2O4I A;  1A5V A;  4CF8 A;  1S3X A;  2W42 A;  1QVF M;  4RW8 A;  3L0Q A;  1GLB G;  5HRP A;  2X74 A;  5A2Q O;  2XY8 A;  4PQU A;  3VEO A;  4ISF A;  4K42 A;  2UUC K;  1L3U A;  5KGW A;  3ZT2 A;  4ID5 A;  1QQM A;  4CFB A;  1NK9 A;  3V9X A;  1JL2 A;  1TGO A;  3C6H A;  3SQ0 A;  3VQC A;  2W6L A;  1NGB A;  4OPK A;  1XHZ A;  4KHQ A;  4KH5 A;  3FZH A;  3M8R A;  4JI0 K;  4CEO A;  5CE3 A;  1BO5 O;  2EWS A;  4ISG A;  4XH5 A;  3VQQ A;  2X6N A;  2D1K A;  4DTX A;  4OX9 K;  3HJF A;  1N5Y A;  3RR7 A;  3QFU A;  2YV0 X;  3EE9 A;  4B3R K;  1VAZ A;  3LM2 A;  5AQK A;  3SAG A;  3TAM A;  3P39 A;  4JK9 A;  3OW2 M;  1U47 A;  2GBZ A;  3C6T A;  4OVL A;  1UAX A;  4QAG A;  3OYB A;  5BR9 A;  4JNE A;  1NGH A;  4WCE L;  1RBS A;  1BA0 A;  2HBL A;  3HBT A;  5AQW A;  1XWL A;  3KLG A;  4YY3 K;  4C23 A;  1S1U A;  2GX9 A;  2ITM A;  1N32 K;  4EHU A;  1SL0 A;  3LM9 A;  4DG1 A;  3CJB A;  3ZT3 A;  4EP5 A;  4H5V A;  1C1C A;  5ELZ A;  4OPH A;  3JS6 A;  2GWJ A;  2NRX A;  3A5O C;  2XY5 A;  4BR2 A;  3F9K A;  3NGI A;  3ASM A;  4FWO A;  4Z4I A;  4RW7 A;  3AAR A;  3DLE A;  4WFN L;  2BTF A;  3FFK B;  3TAR A;  3L2R A;  1K8A O;  3VEX A;  1HNW K;  3DLK A;  1VSF A;  2QWN A;  3HOT A;  4FCY A;  5AQI A;  5FRM A;  3WEE A;  4Q0B A;  5GIP A;  1X9S A;  4GV6 A;  3UE5 A;  4BRH A;  2Q36 A;  5BPL A;  4JK8 A;  4BRP A;  4PA1 A;  2ZM6 K;  1OH6 A;  3QEI A;  4PWD A;  3CER A;  4A59 A;  3FLC O;  3UKU A;  4QOZ B;  3SNN A;  5F1X A;  4JK7 A;  1GOB A;  4KI4 A;  4DKW A;  3O9S A;  1CZA N;  3PUF A;  2QWP A;  1TK8 A;  3L2V A;  1NMD A;  3VQ6 A;  1NJI O;  5LJW A;  1NK5 A;  2HBJ A;  2G8F A;  1VSH A;  3KK7 A;  5FRO A;  3AO3 A;  1RBV A;  1CXQ A;  3L2U A;  2VGN A;  3FE1 A;  3NVM A;  5C0Y A;  4DFK A;  1LWF A;  2IDO A;  3V81 A;  3H1V X;  3MN7 A;  2E6M A;  3L3U A;  4EAH D;  3O6W A;  4BRI A;  2G8U A;  4CVN E;  1HNV A;  3AY9 A;  1S1W A;  2A40 A;  2P5G A;  3VTH A;  4CBX A;  4AIL C;  3S3O A;  4A2B A;  5FPE A;  4ILH A;  1CZB A;  2RF2 A;  1EET A;  3IKM A;  4M63 C;  4E3S A;  2GTD A;  4DTP A;  4DCH A;  5TKY A;  4JKG B;  3PY8 A;  4M45 A;  4BG8 A;  1UOC A;  1YI2 N;  4BC2 A;  2FSN A;  4FJK A;  1QZ5 A;  1VK0 A;  2YJE A;  3FZF A;  3SMP A;  3TSQ A;  2IIR A;  2X78 A;  4Q5V A;  1E3M A;  3QEV A;  3VF4 A;  4FOE A;  4AHV A;  2E2N A;  2ZJP L;  1ITG A;  5FPM A;  1IKY A;  1YJ9 N;  2E6L A;  3W0L A;  3RRH A;  1BA1 A;  4BWJ A;  4B1Y B;  4CIF A;  3TAP A;  2RKI A;  4GY2 B;  3SUQ A;  1R0A A;  4YDU C;  3OYK A;  3A5M C;  4O8K A;  4ZTJ A;  1A5W A;  1B9F A;  1K73 O;  3VEN A;  3MXI A;  4PHT X;  1VSL A;  3HPG A;  3OY9 A;  3GOI A;  3ZT4 A;  2GEM A;  3KD5 E;  1NJY A;  1TKZ A;  4RW6 A;  1LV5 A;  4HTL A;  3LWL A;  4H5R A;  5FLX O;  4JV5 K;  3B8A X;  3DLB A;  3J7A P;  2P9P B;  4JI6 K;  4YOT A;  2VCP A;  1VQN N;  4F8R A;  3EN9 A;  4EP4 A;  4ZHR A;  5ADX H;  4HUF A;  4LH5 A;  1U04 A;  4CJ7 A;  3U6F A;  1T8E A;  2W40 A;  1YTA A;  4E7K A;  3QFP A;  4M42 A;  1HJR A;  3LP1 A;  2P9K B;  3F2K A;  1ZBL A;  3IAY A;  3DLR A;  3CCE N;  3K5N A;  4PKI A;  1KLM A;  4DB3 A;  1ZBH A;  4CW7 B;  4HCC A;  3G25 A;  2VQE K;  4KRE A;  3VGM A;  2OCE A;  1GLL O;  3CCM N;  1T6D A;  1RTD A;  3C94 A;  1C0F A;  4CI6 A;  4E19 A;  3OJU A;  4KBO A;  4BGA A;  3JAM O;  4AHC A;  1WUA A;  4F9O A;  3HM9 A;  3NH0 A;  1MWM A;  1WSH A;  3LDO A;  3OA9 A;  4FWK A;  3FZL A;  4A5B A;  3T1H K;  3VER A;  1NM1 A;  5AR0 A;  4IOX A;  2P9U B;  3TPQ A;  1VSE A;  3LAK A;  4H4M A;  4FJJ A;  3IFR A;  2XY6 A;  4W5O A;  2B4J A;  1EX4 A;  3EYZ A;  2DFF A;  1G99 A;  3JSM A;  1JLQ A;  5FPD A;  4YOX A;  4AHS A;  4WQ5 C;  2IVP A;  1VQ4 N;  2IGI A;  2WC9 A;  4FLY A;  1VQ8 N;  3L2Q A;  1J54 A;  5HLF A;  2OA8 A;  4FWP A;  2UXC K;  3WXI A;  4CJS A;  3VA0 A;  3MED A;  4FJ9 A;  4IOC L;  1UA1 A;  1RT1 A;  3CJ9 A;  1SV5 A;  4IZ9 A;  4DFP A;  4KHU A;  1HYS A;  5BRE A;  4MQ3 A;  4M3Y A;  3CCL N;  4H0T B;  3O9U A;  3O9T A;  1SQK A;  2E1Z A;  1IKW A;  1JLE A;  4G1Q A;  3CJA A;  4CGH A;  4Z94 A;  4B1X B;  3OHR A;  3SBT A;  2E1Y A;  1KQS M;  1U2V B;  3C7N A;  3ULE B;  2FC0 A;  4HCB A;  3EZ5 A;  5B8H A;  4FK4 A;  1KTQ A;  1JL1 A;  4RWT A;  4DV5 K;  4JI5 K;  4OJR A;  3MN9 A;  4CZL A;  4LSN A;  3G10 A;  1KCF A;  5JLH A;  4GV3 A;  1C0U A;  3OYI A;  3J7Y P;  3O4N A;  5BR8 K;  1U4B A;  4IO8 A;  4KKO A;  3GBT A;  1ATN A;  3MN6 A;  1DKG D;  2UU9 K;  4E7J A;  2HW3 A;  1NJX A;  3PV8 A;  4LC9 B;  4YOW A;  1Q82 O;  2E2O A;  4UQG A;  4AQY K;  4B9L A;  3U8X A;  2IAJ A;  4B3O A;  5LY3 A;  2QK9 A;  4JKG A;  1GOA A;  4YOU A;  3SAF A;  3O4W A;  2G8V A;  3L2W A;  2UUB K;  3S41 A;  1HYV A;  3OJS A;  2BE2 A;  3FR0 A;  1XNQ K;  2QTD A;  1NGD A;  1HRH A;  4BDY A;  1OVQ A;  3ISN C;  3PIO L;  3ZT1 A;  2Q0U A;  3DMJ A;  4JAX A;  3V1R A;  3J80 O;  1YIT N;  5JS1 A;  3HZ6 A;  4LF5 K;  3K58 A;  3QES A;  1QHA A;  3A0I X;  3NE6 A;  4OLA A;  2HNZ A;  1XUP O;  3ALY A;  4DMN A;  4L3Q A;  1ASV A;  3QET A;  3V4I A;  4C1N K;  3TAG A;  4FW1 A;  2F9T A;  1JCF A;  3I56 N;  4DF8 A;  3U9Z A;  4DFM A;  4JHD A;  2PFU A;  4YFU A;  3E9L A;  5EOY A;  4MO5 A;  1QE1 A;  3A2F A;  1Y64 A;  1WAJ A;  4FVU A;  4K0K K;  4LY7 A;  3O80 A;  1YHQ N;  4BWM A;  3HVT A;  3D7E O;  4U7B A;  4FPA A;  4LD0 A;  4F3O A;  3HM8 A;  2HBK A;  3LP0 A;  2QXF A;  5C42 A;  1NK6 A;  1HNZ K;  3EKU A;  3QBX A;  1OVY A;  3ZSV A;  1BGX T;  1VSI A;  2P51 A;  2P9N A;  3AA4 A;  5M1Q A;  4DTN A;  4O55 A;  1S72 N;  2JLE A;  3DXK B;  4OGC A;  1HX1 A;  4ELT A;  3THW B;  1KVC A;  4JRP A;  5J2Q A;  3SUN A;  4BRN A;  2Q0R A;  1Z6R A;  2O4G A;  3QDK A;  3SQ2 A;  2NLX A;  2Q2R A;  3CC7 N;  1TUY A;  5J2M A;  3CFR A;  4BC4 A;  4CE9 A;  2ETJ A;  4CHQ A;  4N5S A;  3D2E B;  4RCH A;  3CCU N;  1NOZ A;  3AVH A;  2BH1 A;  3LP2 A;  3KD1 E;  4EZ6 A;  3KKR A;  5BN8 A;  4FLW A;  5BPM A;  4MFB A;  3IUC A;  3ZEU B;  1GLE G;  2HHH K;  1FW6 A;  3V1O A;  3ZLJ A;  3D0P A;  3HSC A;  3ZYY X;  1YAG A;  2HHQ A;  2GUP A;  1RDB A;  3RR8 A;  4W5T A;  1E4F T;  4IDK A;  2E2Q A;  3T7Z A;  4PKH A;  1LAW A;  3AA5 X;  3AVI A;  1HJO A;  4IFV A;  4BDP A;  2GEL A;  5M1F A;  3V6D A;  2P5O A;  3CG7 A;  3ZSQ A;  1W97 L;  4FLZ A;  2YCH A;  1HQU A;  3L4I A;  1LWC A;  2Y1I A;  2YJF A;  2Q31 A;  3TAQ A;  2WOM A;  5HL7 L;  1J9A A;  1MWK A;  4B1W B;  5HBM A;  2GV9 A;  3O3F A;  4B08 A;  3K5M A;  3ITH A;  1OH5 A;  4JI3 K;  3E1Y A;  3NF7 A;  3MAQ A;  4WFB L;  1EKE A;  3SQ4 A;  3H6E A;  4Z4C A;  2ZWH A;  3H45 C;  3HPO A;  4YDU A;  4B9U A;  4M3U A;  5KQD A;  4AHR A;  2ZQB A;  1TL1 A;  3ULE A;  4PUO A;  2XHB A;  1GLF O;  2FXU A;  1IV0 A;  3E9O A;  4CF9 A;  3VOV A;  1TAU A;  4DSJ A;  4FL9 A;  4R79 A;  4ELV A;  1R59 O;  3TTF A;  4B1Z A;  3CET A;  5AQL A;  5GAG P;  3MX5 A;  3LZI A;  1XC9 A;  4CZM A;  5KPZ A;  3HOS A;  1XMO K;  4ZTF A;  4YHH K;  3FFI A;  3K9K A;  1X9W A;  1VQL N;  3DLL L;  1Y97 A;  4DLG A;  1DGK N;  4LF9 K;  2O8C A;  3FGU A;  4O5B A;  1REV A;  4WF9 L;  3WNG A;  1DTT A;  1LOT B;  4YOY A;  1Q7Y O;  4CJ4 A;  4F2S A;  4OPA A;  4NXN K;  5C25 A;  4O0I A;  2JWK A;  4I9L A;  4BQL A;  3O8M A;  3WT0 A;  3DYA A;  4B8A B;  4U67 L;  2KZM A;  4A2A A;  3U3Y A;  2VQF K;  4H03 B;  3E9P A;  4H0V B;  3IRX A;  4CJF A;  1TYQ B;  1IKX A;  4CHN A;  1EXQ A;  4K41 A;  4IG0 A;  1K9M O;  4H0P A;  2DY4 A;  2KW4 A;  2PYJ A;  4DFJ A;  1FJG K;  3KLH A;  3PIP L;  4X62 K;  4CZG A;  3EL2 A;  2A3Z A;  4N56 A;  3NVK A;  5CYQ A;  3S3N A;  1SKW A;  3TR8 A;  4Z4H A;  2X6S A;  4CFD A;  4I6M B;  4CCH A;  4MLE A;  2P9I A;  3HVR A;  2HMP A;  2QKB A;  5EX5 A;  3VQ8 A;  1CLQ A;  4PY5 A;  1DEJ A;  3AVM A;  1X9M A;  4CER A;  4GNI A;  1ZXO A;  4WQ5 A;  3CM5 A;  5KQ8 A;  1N36 K;  2EX3 A;  2OTJ N;  2WBN A;  2ZJR L;  2F8T A;  3CCV N;  2O8B A;  1SL1 A;  2E2P A;  4AF1 A;  4FZX C;  3RSE B;  3WXK A;  3ZSO A;  3I33 A;  4M3W A;  2KZZ A;  3ZET B;  3KKS A;  3RMA A;  4J8F A;  5CHI A;  4DLE A;  5K14 A;  4BRA A;  4BRC A;  3RWU A;  3OTO K;  1S9E A;  2ZJQ L;  3OYJ A;  1RBU A;  2YHW A;  2CGK A;  1NMN A;  3CYM A;  4WQ4 C;  3HL8 A;  2NRZ A;  4CZF A;  1C1B A;  4DF4 A;  3U4L A;  3D2F A;  4JS5 A;  4O44 A;  3DOL A;  1RDD A;  4BR9 A;  4EZ9 A;  4DQ8 A;  1OH8 A;  2FF6 A;  4CK3 A;  1FK9 A;  3W3D A;  3TU5 A;  3D6R A;  3K59 A;  2IS3 A;  5JVH L;  4DSE A;  1SKS A;  3VQB A;  1NK4 A;  4BGB A;  3AV9 A;  2YNF A;  5IWA K;  2KFN A;  1H1V A;  4WYB A;  3KZB A;  4CEF A;  3OBW A;  4FWL A;  4CJ3 A;  3IDH A;  4DS5 A;  1RFQ A;  1M90 O;  3PX4 A;  4DU4 A;  1YTU A;  1S22 A;  4AM6 A;  1KC8 O;  3VEV A;  2VWB A;  4BRL A;  3T19 A;  1S6P A;  4CHY A;  4DV3 K;  1WAF A;  1IG9 A;  4JD2 A;  4A62 A;  3CC2 N;  4Z4F A;  4NB4 A;  1ZBS A;  3HYF A;  3CHW A;  2A1R A;  5FDL A;  3SUO A;  4JI4 K;  1EO1 A;  1BIU A;  2HB5 A;  4GMJ B;  5HRS A;  4GKK K;  3CFO A;  4KO0 A;  4JS4 A;  1NNE A;  3P1G A;  4V19 S;  3ZX0 A;  5AJ3 K;  4M3X A;  2VG6 A;  1N8R O;  5AQM A;  3VQP A;  2O8E A;  2D0C A;  1RT5 A;  4QS9 A;  3THY B;  4M41 A;  3K2P A;  3GDQ A;  2O8F A;  1BG3 A;  4B9T A;  2HMI A;  2NUB A;  1TKT A;  3CQ8 A;  4KH6 A;  3AVB A;  2OZM A;  2G8K A;  4JKA A;  2JGU A;  1RNH A;  3ZX2 A;  1XQS C;  2P9S A;  1L3S A;  1HLU A;  3I0R A;  1KAZ A;  3NH1 A;  2FSK A;  1BDG A;  5AQS A;  3UKR B;  2CGJ A;  3NHG A;  1LCU A;  1V4S A;  4Z0U A;  1X3N A;  4IO9 L;  1JXE A;  2B5J A;  3C65 A;  1S9G A;  4FJX A;  1KLN A;  3VEZ A;  4HUG A;  1HPM A;  1W7A A;  1WSG A;  1QVG M;  2QWR A;  2ASP A;  2IOC A;  4MO4 A;  5FRN A;  3O9R A;  1TYQ A;  3ZSZ A;  4DR3 K;  4KTW A;  2KTQ A;  4NYF A;  4FLX A;  4XH4 A;  3QIO A;  3M1F A;  5AQF A;  4QS7 A;  2G8W A;  3HTV A;  4E7H A;  2NRR A;  3TSP A;  3ID6 A;  3DXM B;  3VQ7 A;  3LAL A;  3QO9 A;  1VRU A;  1ZC6 A;  3WNF A;  3HO1 A;  1HMV A;  1XMQ K;  5KPT A;  4KB1 A;  4OLB A;  2QWO A;  4NXM K;  1P90 A;  4JRQ A;  2CGL A;  2HNY A;  4H4O A;  1DT9 A;  1HKC A;  3NH2 A;  3DAW A;  1S1T A;  3H1Q A;  4RW9 A;  3CJ7 A;  4ILG B;  3CCR N;  3AO5 A;  2E20 A;  3KLF A;  4E1J A;  3O1W A;  4J2D A;  2G8I A;  5M1K A;  4BR5 A;  3VF2 A;  3VQ4 A;  1S1X A;  5JS2 A;  2PBD A;  1BUP A;  2HND A;  3VGL A;  3ZSX A;  3UIQ A;  4F3T A;  3SCX A;  3AVF A;  4KAZ A;  2Z1H A;  5JVG L;  2A1S A;  3CCS N;  4DV6 K;  4CGJ A;  3OYF A;  3GG4 A;  5AQG A;  3NCI A;  3C6U A;  5DM7 L;  2P9L B;  3J7Z O;  1YIJ N;  2PZS A;  3WXM B;  1MDU B;  1NKB A;  3NMU A;  3VEW A;  2HOE A;  3S3M A;  1YJW N;  3HST B;  1LW2 A;  3BY5 A;  4HTU A;  2F9W A;  2EHG A;  2D0P A;  2HST A;  2HF4 A;  2ITG A;  4C8O A;  4KB0 A;  3CFP A;  1JXB A;  1X1P A;  1Q9Y A;  4KHS A;  2KQ2 A;  3CMA N;  3K5L A;  2Z1I A;  1NG9 A;  4IG3 A;  5GIO A;  3F9M A;  3MEG A;  4J2A A;  3MCA B;  4FZZ A;  3TSU A;  4IXC A;  3H46 O;  1YJN N;  1BU6 O;  3CC4 N;  4I9Q A;  3CCQ N;  3AO4 A;  5CR4 A;  4BR7 A;  1X3M A;  1IBK K;  4FWM A;  2HHT A;  3OS1 A;  1G15 A;  2D0O A;  4CEE A;  1KXP A;  3RMD A;  4DR5 K;  3O9Q A;  1JLF A;  1K8K B;  1XHX A;  1UA0 A;  1ILY A;  1HUX A;  1IO2 A;  2OPR A;  1NK7 A;  2ZF5 O;  1JLB A;  3VGK A;  3G0Z A;  1TV6 A;  3OS0 A;  4CZH A;  2B6A A;  4DQQ A;  1IKV A;  2UYT A;  1Q18 A;  3TAF A;  4LF6 K;  4DTJ A;  1TVR A;  4BAC A;  1I39 A;  4CJQ A;  1RBT A;  1N34 K;  4CGD A;  3I8D A;  2W41 A;  1D8Y A;  2R7Y A;  2FSJ A;  2H3G X;  4B3T K;  2AJQ A;  5C2F A;  2HBM A;  1TL3 A;  2YX6 A;  1NGF A;  4CJT A;  1IG8 A;  3AAP A;  3EO3 A;  5E41 A;  3HXM A;  4A61 A;  1NGE A;  5DMR A;  4FOI A;  5EU7 A;  3THX B;  5AQQ A;  3MX2 A;  3J81 O;  3LPT A;  4CEQ A;  4CZK A;  1Z25 A;  3N4Q A;  3OYH A;  2DFH A;  2NRV A;  3A8Y A;  3MEE A;  1D5A A;  5KRS A;  4FK0 A;  1KSP A;  3D45 A;  3A5N C;  2FF3 B;  3DRP A;  3RTV A;  4CJL A;  5LL6 Z;  4B8C A;  3GE1 A;  3TWH A;  4FJM A;  4DV4 K;  1NLV A;  1X9J A;  1WSE A;  3OYN A;  4DQI A;  1XNR K;  4FJ8 A;  4FWQ A;  4C8N A;  3QIC A;  4KH4 A;  1NJW A;  5EVZ A;  4L8R B;  3Q7C A;  3LDP A;  2A6A A;  2VGM A;  2VWK A;  3KWG A;  4BQZ A;  3ZCM A;  3ENB A;  1VQ5 N;  2FLO A;  4DSF A;  3VTI A;  4OGE A;  3KJV A;  2HVI A;  3KIO A;  1S1V A;  3NF9 A;  3CJC A;  2GUI A;  4BVP A;  2Q97 A;  1C0G A;  2P9P A;  3VEY A;  3VQA A;  3G71 N;  1RTH A;  3K5O A;  4N41 A;  3H3O B;  1KD1 O;  2F4V K;  4NLB A;  3WNH A;  3R6M A;  4I7F A;  2FBT A;  1T3V A;  1I94 K;  3AVK A;  3RMC A;  3V9S A;  2P9K A;  2G8H A;  2OPS A;  1BQM A;  5KGX A;  3V9Z A;  1U48 A;  5AQV A;  3IG1 A;  1L5U A;  2FBY A;  3OYA A;  3DXM A;  3TTC A;  1D4X A;  4JKC A;  3N4P A;  1CZ9 A;  1BQN A;  3EE8 A;  3I8B A;  4OPJ A;  2D0A A;  4CD3 A;  2HHS A;  2V52 B;  5JLF A;  4FPB A;  5AFU A;  1VRT A;  2I7P A;  4KHP K;  2E88 A;  4IBN A;  4N76 A;  3B6P A;  3L3V A;  3Q7B A;  3RMB A;  4K25 A;  4B1V A;  5HRN A;  3MEC A;  1Q8I A;  1C0M A;  3BDP A;  1J5E K;  4M3Z A;  3HP6 A;  3LAN A;  1M1K O;  4K43 A;  1JCG A;  4FJG A;  3V1Q A;  2P9U A;  3HT3 A;  4UY8 O;  4CGI A;  1QS4 A;  4MDB A;  1T05 A;  4NLC A;  4AM7 A;  4X65 K;  3WEE B;  3TI0 A;  3SV3 A;  1T7P A;  1YXQ A;  3U9D A;  2P9L A;  4KTQ A;  3CQX A;  3QEX A;  4LSL A;  2OTL N;  2ATQ A;  3H08 A;  1BL3 A;  1QSL A;  2PY5 A;  1KVA A;  1T03 A;  4CJV A;  4H0Y B;  4GVM A;  2V51 B;  3TAB A;  3OS2 A;  4BRK A;  2UXD K;  3CPE A;  5I9E B;  4FLT A;  3SMS A;  1I3A A;  3KTQ A;  1EWR A;  1C6V A;  2AA4 A;  4C8M A;  4DUZ K;  4CBW A;  1T44 A;  4Y0W A;  4K8Z A;  4J2E A;  2BAN A;  4JKH A;  3LZJ A;  4QCL A;  2KLA A;  4IFE A;  3ZT0 A;  4BC5 A;  1QSS A;  4H5N A;  1QTM A;  3PX0 A;  3DRS A;  3O5B A;  4CK1 A;  2BDP A;  3M5R A;  2YI1 A;  1K8K A;  2QWQ A;  4FK2 A;  4FJH A;  1W2B M;  4CHZ A;  1RT4 A;  1ASU A;  2QKK A;  3C6A A;  1U2V A;  3P38 A;  4PL7 A;  4BE1 A;  4KI6 A;  5AFU H;  4NCA A;  3WQT A;  4O0J A;  3KVG A;  5C10 A;  3SPY A;  4KPY A;  3LDN A;  5LJV A;  3LAM A;  1LW0 A;  4CGF A;  3CM6 A;  5EY4 A;  3VQD A;  4KHW A;  3KWI A;  2ZGY A;  3IS9 A;  4JYA K;  1ATR A;  2W6K A;  3AVJ A;  4OKJ A;  4FO0 A;  5C12 A;  3VQ5 A;  4BG9 A;  5HOO A;  2DPN A;  3WQU A;  1VQ9 N;  4B9N A;  3QNN A;  1TUU A;  2Z1G A;  2DTU A;  1HQE A;  4DR6 K;  3O1B A;  4FSV A;  2F8S A;  4OO1 J;  2VG7 A;  4LH4 A;  5CZ2 A;  1ESV A;  3T1A A;  5M1O A;  4B9S A;  1N33 K;  3NGZ A;  3P4I A;  3AVG A;  5AZJ B;  4BE2 A;  3PLA A;  4DV2 K;  2KFZ A;  4H8K A;  3HPH A;  3THV A;  1TK5 A;  4C8L A;  3J8A A;  4EIA A;  4JLH A;  4O4G A;  4B9Q A;  4CIG A;  2VG5 A;  4JKF A;  3P83 D;  4E7I A;  1O13 A;  4FZY A;  3LL3 A;  4JI8 K;  1J53 A;  4AH9 A;  3QEW A;  3NAE A;  1WB9 A;  3SLC A;  3SQ1 A;  3QLH A;  4A57 A;  1RT7 A;  4KRF A;  3SK3 A;  3QBW A;  3OYC A;  5GIN A;  4RG8 A;  1SS6 A;  1WBB A;  2OYQ A;  1ASW A;  3BZC A;  3R8E A;  4FXD A;  2NRT A;  4BR0 A;  5I3U A;  4FJN A;  1P8Z A;  4RTF D;  4KTZ A;  4KHY A;  3S9H A;  3EZW A;  2Y1J A;  3NF8 A;  3ATV A;  4BRF A;  4E1M A;  5C2D A;  4DR1 K;  1F21 A;  3NGY A;  4C1N I;  1HKB A;  4PL8 A;  5AQU A;  3JXU A;  1IJJ A;  1N6Q A;  1VQM N;  1VSJ A;  2YKM A;  1WBD A;  3SPZ A;  5AZI B;  4IWV A;  4CZE A;  2O8D B;  3R3L A;  3K9J A;  4GKJ K;  1BOT O;  1HYZ A;  3AA2 A;  5SWM A;  4XIU A;  3DXK A;  2YHX A;  2ASO A;  3E01 A;  3SJH A;  1VSK A;  3AVL A;  3B6O A;  4RW4 A;  2WFB A;  1FXX A;  3I0S A;  3LDQ A;  3THW A;  3AVA A;  1RT2 A;  4B9M A;  3L4Q A;  2Q3S A;  3L8B A;  3U3G A;  3D2E A;  2ZE2 A;  2QWM A;  4DQR A;  1EQY A;  1QQO A;  1NKC A;  3OYE A;  3NBP A;  4KFB A;  3M3Z A;  1NU0 A;  5CY4 A;  2HHV A;  4DTM A;  4I2Q A;  1DTQ A;  2HVH A;  3ZEU A;  4F2R A;  2VWJ A;  2YKN A;  1RBR A;  1RTJ A;  3BEX A;  3ULD A;  1RIL A;  3ATU A;  1HKG A;  3K57 A;  1WSJ A;  4CJE A;  4YNQ A;  3TAE A;  2E8A A;  4FWS A;  4CEB A;  3DLG A;  4FM0 A;  2GWK A;  5AQT A;  2CH6 A;  3T69 A;  4JEP A;  4DU3 A;  4FJI A;  1KFS A;  4E89 A;  5LMN K;  2IVO A;  3MCP A;  1Q81 O;  2YHB A;  4CGG A;  4EFH A;  1NGA A;  4CJU A;  2JWL A;  1RDW X;  3T3F A;  5BRD A;  5KTQ A;  3C7N B;  4CES A;  4G9Z A;  1BCO A;  4FWR A;  3BP8 A;  2BGG A;  2IVN A;  3O4Q A;  1NK0 A;  1K6Y A;  4CF1 A;  1BI4 B;  3AA3 A;  3V9U A;  1NOY A;  4CF0 A;  4IJN A;  1C0T A;  3MMV A;  4ELU A;  4E7L A;  1TKD A;  3CJ1 A;  5ADX A;  2WTU A;  1RTI A;  4BRG A;  3QB0 A;  3NF6 A;  5E26 A;  4M7X A;  3SAH A;  3OYD A;  1C1A A;  1BCM A;  4ID1 A;  4IOA L;  1XI1 A;  4X64 K;  4KHN A;  4Z4G A;  2I7N A;  3ZX3 A;  1RCH A;  4DHY A;  4OKE A;  5AQR A;  3AAQ A;  3R1X A;  4CF2 A;  4FJ7 A;  3CQY A;  4BE0 A;  3UB5 A;  4M3T A;  4W5N A;  1OH7 A;  1KAX A;  3CCJ N;  2IC3 A;  2QEX N;  3BF3 A;  3K0S A;  5CYM A;  3DWL A;  1U6Z A;  3VMF B;  5EXW A;  4FVM A;  1JLA A;  5BN9 A;  3T1Y K;  3QIP A;  2RE2 A;  4DU1 A;  4CEA A;  2A41 A;  4DTU A;  4FM2 A;  2F7T A;  3PSF A;  3QML A;  3ZSW A;  2KHO A;  2OAN A;  5AZJ A;  5GAD P;  5E84 A;  5F0X A;  4XEI A;  1YUW A;  1NKE A;  1SKR A;  4JHD B;  4MLH A;  5IT9 O;  4W5R A;  2A42 A;  2KKZ A;  4IDH A;  1D9D A;  4R5P A;  1JLC A;  1MU2 A;  2FBV A;  5C24 A;  1E4G T;  4CED A;  4K8X A;  3IMX A;  5C15 A;  1WNS A;  4GVE A;  3DLH A;  2BUP A;  5DM6 L;  3BF1 A;  1EP4 A;  2YNH A;  1VQ7 N;  1OKJ A;  4I6M A;  3SUP A;  1NK8 A;  4LFB K;  3VQ9 A;  4CJK A;  3SYZ A;  1B9D A;  4Y1C A;  3MWP A;  3EEQ A;  1ZBI A;  4NCB A;  1Z05 A;  3OYL A;  4A5A A;  4LF4 K;  2P9N B;  4IFY A;  5D3G A;  2PYL A;  3P5J A;  4CHO A;  3I55 N;  1FKO A;  5JIC A;  4LF7 K;  4BRD A;  1TK0 A;  3VN5 A;  4DWI A;  5TKW A;  3RSE A;  2Q1N A;  1A5X A;  4HHT A;  4B9V A;  4BRO A;  4JKE A;  2ZD1 A;  3ZET A;  4XH1 A;  2NRW A;  2NNW A;  1IBL K; 
#chains in the Genus database with same CATH homology
 5AQZ A;  2WUS A;  2HBJ A;  3CJC A;  3KK7 A;  5AZI A;  3WXL A;  3K9K A;  4BVP A;  2Q97 A;  1RGI A;  1VQL N;  1C0G A;  2P9P A;  3DLL L;  2YHY A;  1DGK N;  3VEY A;  3G71 N;  3G6E N;  5MLC Q;  2ZGZ A;  3H3O B;  1KD1 O;  2VGN A;  3FZM A;  3FE1 A;  3FGU A;  3NVM A;  1VQO N;  4NLB A;  4WF9 L;  3R6M A;  5C0Y A;  1LOT B;  4YOY A;  1Q7Y O;  1T3V A;  4OPA A;  1QQN A;  3H1V X;  3MN7 A;  4IEI A;  2JWK A;  4BQL A;  4EAH D;  3MDQ A;  3O6W A;  3O8M A;  3WT0 A;  4U67 L;  2P9K A;  4A2A A;  4BRI A;  3AY9 A;  5AQP A;  2A40 A;  4BRQ A;  4H03 B;  5AQV A;  3VTH A;  3E9P A;  4H0V B;  5AQJ A;  4CBX A;  3DXM A;  1VQK N;  3TTC A;  1TYQ B;  1D4X A;  4A2B A;  4H0O A;  4JKC A;  4O8U A;  2D4W A;  3N4P A;  5FPE A;  4ILH A;  4K41 A;  3EE8 A;  3I8B A;  4BRM A;  5JMV A;  4H0P A;  1K9M O;  2QWL A;  3KHY A;  4H5T A;  3IKM A;  1BWF O;  5KPR A;  4M63 C;  2GTD A;  2ASM A;  1JCE A;  4CD3 A;  4DCH A;  2V52 B;  2J4R A;  4JKG B;  5TKY A;  1KAY A;  4FPB A;  2QW9 A;  4BG8 A;  5AFU A;  1V4T A;  2RHK A;  2I7P A;  1YI2 N;  4BC2 A;  3PIP L;  2E88 A;  2FSN A;  3ID8 A;  4CZG A;  5BRF A;  1QZ5 A;  4BY9 C;  3EL2 A;  1GLJ O;  1T6C A;  2A3Z A;  2YJE A;  3FZF A;  3SMP A;  3Q7B A;  3TSQ A;  3NVK A;  4K25 A;  4B1V A;  2IIR A;  3CF5 L;  4I6M B;  1M1K O;  4MLE A;  3VF4 A;  4K43 A;  4FOE A;  1JCG A;  2P9I A;  3OBY A;  2P9U A;  2HMP A;  4UY8 O;  2E2N A;  4MDB A;  2ZJP L;  5EX5 A;  5FPM A;  3L6Q A;  3E66 A;  4NLC A;  1YJ9 N;  1DEJ A;  3W0L A;  4AM7 A;  4EHT A;  3WEE B;  4GNI A;  1BA1 A;  1ZXO A;  3FZK A;  4B1Y B;  1YXQ A;  4WQ5 A;  3U9D A;  4GY2 B;  2P9L A;  5KQ8 A;  2VYP A;  2OTJ N;  2WBN A;  4YDU C;  2ZJR L;  3CCV N;  3A5M C;  4O8K A;  4WFA L;  3CQX A;  2OTL N;  2E2P A;  1K73 O;  3VEN A;  4AF1 A;  3RSE B;  3WXK A;  4PHT X;  1YF5 L;  3A5L C;  3GOI A;  2GEM A;  3I33 A;  4ILJ A;  4H0Y B;  3ZET B;  2V51 B;  4J8F A;  5CHI A;  4HTL A;  4BRA A;  4BRK A;  3CPE A;  5I9E B;  4H5R A;  3SMS A;  4BRC A;  2AA4 A;  3B8A X;  4CBW A;  3TTD A;  1T44 A;  4Y0W A;  2ZJQ L;  2P9P B;  4JKH A;  4YOT A;  2VCP A;  2YHW A;  1VQN N;  2CGK A;  2KLA A;  3EN9 A;  4IFE A;  4WQ4 C;  5ADX H;  2NRZ A;  4CZF A;  4BC5 A;  5BPN A;  4H5N A;  3U4L A;  4CJ7 A;  3O5B A;  3D2F A;  2W40 A;  3M5R A;  2YI1 A;  1K8K A;  2NZT A;  2QWQ A;  3QFP A;  4BR9 A;  1MA9 B;  4DQ8 A;  1W2B M;  2FF6 A;  3M6G A;  2P9K B;  3F2K A;  3MWT A;  4BVO A;  3W3D A;  3TU5 A;  3UKR A;  3C6A A;  1U2V A;  3D6R A;  3P38 A;  5JVH L;  4PL7 A;  4H0X B;  3CCE N;  3CME N;  4PKI A;  4BGB A;  5AFU H;  4DB3 A;  1QZ6 A;  1H1V A;  4WYB A;  3G25 A;  4FWN A;  3KZB A;  3WQT A;  3OBW A;  3VGM A;  3KVG A;  5C10 A;  1GLL O;  4FWL A;  5F2R A;  1T6D A;  3CCM N;  1NWK A;  3LDN A;  3IDH A;  1Q86 O;  1RFQ A;  1C0F A;  4CI6 A;  4IJA A;  1M90 O;  5LJV A;  4KBO A;  4BGA A;  5EY4 A;  1S22 A;  1WUA A;  5JLF A;  4AM6 A;  4F9O A;  4CZJ A;  3KWI A;  2ZGY A;  1KC8 O;  3VEV A;  1MWM A;  2VWB A;  3LDO A;  3OA9 A;  4BRL A;  3CIP A;  1ATR A;  4WQ4 A;  4FWK A;  3FZL A;  4A5B A;  5C12 A;  4FO0 A;  3VER A;  4BG9 A;  1NM1 A;  5HOO A;  3F5T A;  2DPN A;  4JD2 A;  1NGI A;  3C0B A;  4A62 A;  3HRG A;  3WQU A;  3CC2 N;  4NB4 A;  1ZBS A;  3CHW A;  1VQ9 N;  2P9I B;  5AR0 A;  4IOX A;  1TUU A;  2P9U B;  4YOR A;  3TPQ A;  3O1B A;  4FSV A;  3WXJ A;  3IFR A;  4OO1 J;  4YOV A;  1GLA G;  4M7Y A;  1ESV A;  1EO1 A;  1SAZ A;  3VPZ A;  1G99 A;  3LDL A;  3EKS A;  5AQX A;  5M1O A;  3P4I A;  5AZJ B;  1NGJ A;  5FPD A;  3ZX0 A;  2PAV A;  4GV9 A;  3PLA A;  4YOX A;  2QA4 N;  1GLD G;  4WQ5 C;  2IVP A;  1VQ4 N;  1N8R O;  5AQM A;  3J8A A;  1ATS A;  4EIA A;  2WC9 A;  1VQ8 N;  4JKD A;  4QS9 A;  4B9Q A;  5M1P A;  1VQP N;  4FWP A;  3AGK A;  3WXI A;  4B1U B;  1YVN A;  4JKF A;  1O13 A;  3LL3 A;  3GDQ A;  2HF3 A;  4IOC L;  1BG3 A;  3CJ9 A;  4IZ9 A;  5BRE A;  4KH6 A;  3SLC A;  3CCL N;  4A57 A;  1NGG A;  4JKA A;  3SK3 A;  4H0T B;  3O9U A;  5AQH A;  3ZX2 A;  3QBW A;  3O9T A;  1SQK A;  2E1Z A;  5GIN A;  1SS6 A;  3VF6 A;  1VQ6 N;  3D2F B;  3CJA A;  1XQS C;  3R8E A;  4Z94 A;  4B1X B;  2V7Y A;  3CPW M;  3OHR A;  2P9S A;  2NRT A;  3SBT A;  1HLU A;  1WOQ A;  1KAZ A;  2E1Y A;  2FSK A;  4BR0 A;  1P8Z A;  1BDG A;  3VES A;  5AQS A;  3UKR B;  4RTF D;  1KQS M;  1U2V B;  2CGJ A;  3C7N A;  3ULE B;  2NRH A;  1JJ2 M;  3MN5 A;  5B8H A;  1LCU A;  1V4S A;  3EZW A;  3R9P A;  3UKU B;  4HWI A;  4RWT A;  3O08 A;  2V7Z A;  3ATV A;  2AP1 A;  4IEE A;  5AQO A;  4BRF A;  5C2D A;  3MN9 A;  4CZL A;  1X3N A;  4IO9 L;  5JLH A;  4CZI A;  4C1N I;  1HKB A;  4GV3 A;  3C65 A;  4PL8 A;  5BRH A;  3VEZ A;  5AQU A;  1HPM A;  1RDU A;  3JXU A;  4IO8 A;  4ISE A;  1IJJ A;  3GBT A;  1VQM N;  1ATN A;  3MN6 A;  1NBW A;  1DKG D;  1QVG M;  2QWR A;  5AZI B;  4IWV A;  2ASP A;  4CZE A;  4CBU A;  3R3L A;  3K9J A;  1BOT O;  3P31 A;  4MO4 A;  3O9R A;  4BR4 A;  4LC9 B;  4YOW A;  1TYQ A;  1Q82 O;  4JD2 B;  2E2O A;  3DXK A;  2YHX A;  2ASO A;  3SJH A;  3U8X A;  5FPN A;  4XH4 A;  5LY3 A;  2CH5 A;  3M1F A;  2QI2 A;  2WFB A;  3LDQ A;  5AQF A;  4QS7 A;  3HTV A;  4JKG A;  2NRR A;  4JKB A;  4YOU A;  3CI5 A;  1J6Z A;  3L4Q A;  3H3N O;  3TSP A;  3SAF A;  3WUH A;  3O4W A;  3MK6 A;  3D2E A;  3ID6 A;  3DXM B;  2QWM A;  1EQY A;  1ZC6 A;  3S41 A;  1QQO A;  4JN4 A;  5GAH P;  3ENO A;  5KPT A;  2QM1 A;  2QWO A;  3M3Z A;  4PKG A;  4H5W A;  3FR0 A;  4BC3 A;  1P90 A;  3DJC A;  2CGL A;  2QTD A;  1NGD A;  1DT9 A;  1HKC A;  3ZEU A;  4QS8 A;  3DAW A;  3PIO L;  5AQY A;  3AGR A;  2Q0U A;  4JAX A;  3H1Q A;  1YIT N;  2A5X A;  3BEX A;  3CJ7 A;  3HZ6 A;  4ILG B;  3CCR N;  1GLC G;  2E20 A;  1QHA A;  3A0I X;  1HKG A;  3ATU A;  3O1W A;  4E1J A;  1XUP O;  4BR5 A;  3VF2 A;  5GAE P;  5M1K A;  5H1S Q;  4L3Q A;  4C1N K;  2E8A A;  4FWS A;  5M1N A;  3CD6 N;  1SZ2 A;  2F9T A;  4MDA A;  1JCF A;  2GWK A;  2PBD A;  1BUP A;  3VGL A;  3I56 N;  5AQT A;  2CH6 A;  3T69 A;  4JEP A;  3U9Z A;  1NGC A;  3ENH A;  3HI0 A;  4JHD A;  2IVO A;  3MCP A;  3GL1 A;  1Q81 O;  5JVG L;  2P9S B;  2PFU A;  3E9L A;  5EOY A;  4EFH A;  1NGA A;  3CCS N;  2JWL A;  1RDW X;  4MO5 A;  2QXL A;  3SBG A;  3GG4 A;  5AQG A;  4CD1 A;  3BUZ B;  5BRD A;  3C7N B;  5DM7 L;  2P9L B;  5AQN A;  3J7Z O;  1YIJ N;  4G9Z A;  3RVC A;  4FWR A;  3BP8 A;  3G4S N;  1Y64 A;  1MDU B;  3WXM B;  3NMU A;  1XC3 A;  2IVN A;  2HOE A;  4NO7 A;  3O80 A;  4O5F A;  3VEW A;  1YJW N;  1YHQ N;  4FVU A;  2F9W A;  2HST A;  2D0P A;  2HF4 A;  3VET A;  3D7E O;  4BRE A;  4U7B A;  4FPA A;  3CXC M;  4IJN A;  3HM8 A;  2HBK A;  3CMA N;  1S3X A;  3MMV A;  1QVF M;  3L0Q A;  3CJ1 A;  1GLB G;  3EKU A;  3QBX A;  5ADX A;  1OVY A;  5GIO A;  3F9M A;  4BRG A;  3MCA B;  3VEO A;  3TSU A;  4ISF A;  3H46 O;  3QB0 A;  4IXC A;  2P9N A;  4K42 A;  1YJN N;  1BU6 O;  5M1Q A;  3CC4 N;  5E26 A;  4M7X A;  3SAH A;  5CR4 A;  3CCQ N;  1S72 N;  1QQM A;  4BR7 A;  1X3M A;  3DXK B;  4FWM A;  4IOA L;  1HX1 A;  2D0O A;  3C6H A;  2I7N A;  1KXP A;  3ZX3 A;  4DHY A;  5AQR A;  1NGB A;  3AAQ A;  3O9Q A;  3R1X A;  1K8K B;  2Q0R A;  1Z6R A;  3QDK A;  4KH5 A;  4BRN A;  3FZH A;  2NLX A;  1HUX A;  2Q2R A;  5CE3 A;  3CC7 N;  1ILY A;  1TUY A;  3CQY A;  2ZF5 O;  3VGK A;  1BO5 O;  4BC4 A;  2EWS A;  4ISG A;  4XH5 A;  3UB5 A;  4CZH A;  3D2E B;  4RCH A;  2D1K A;  1KAX A;  3CCJ N;  3CCU N;  2UYT A;  2BH1 A;  1Q18 A;  2QEX N;  3BF3 A;  3QFU A;  3DWL A;  3EE9 A;  1U6Z A;  3VMF B;  5BN8 A;  5EXW A;  1VAZ A;  3LM2 A;  5AQK A;  3SAG A;  5BN9 A;  2RE2 A;  3P39 A;  5BPM A;  4JK9 A;  3OW2 M;  3IUC A;  3ZEU B;  1GLE G;  2A41 A;  3HSC A;  3ZYY X;  1YAG A;  2F7T A;  2GUP A;  3QML A;  2KHO A;  2OAN A;  1E4F T;  2W41 A;  5BR9 A;  4JNE A;  2E2Q A;  1NGH A;  3T7Z A;  2FSJ A;  4WCE L;  2H3G X;  5AZJ A;  5GAD P;  1BA0 A;  2HBL A;  2HBM A;  3HBT A;  4PKH A;  5E84 A;  5C2F A;  5F0X A;  1HJO A;  1NGF A;  2YX6 A;  5AQW A;  4C23 A;  4XEI A;  1YUW A;  2GEL A;  5M1F A;  2GX9 A;  1IG8 A;  2ITM A;  3AAP A;  3EO3 A;  4EHU A;  4JHD B;  4MLH A;  4A61 A;  1NGE A;  3LM9 A;  1W97 L;  2A42 A;  3CJB A;  2KKZ A;  4IDH A;  4FOI A;  2YCH A;  4H5V A;  5ELZ A;  4OPH A;  3L4I A;  1E4G T;  3JS6 A;  3MX2 A;  2GWJ A;  2YJF A;  2Q31 A;  3IMX A;  5AQQ A;  5C15 A;  2NRX A;  5HL7 L;  4GVE A;  1MWK A;  4B1W B;  2BUP A;  5DM6 L;  3A5O C;  3BF1 A;  1VQ7 N;  4BR2 A;  1OKJ A;  4CZK A;  4I6M A;  4FWO A;  3AAR A;  4WFN L;  3N4Q A;  3E1Y A;  2BTF A;  2NRV A;  3A8Y A;  3FFK B;  4WFB L;  3MWP A;  1K8A O;  3H6E A;  3VEX A;  1Z05 A;  2FF3 B;  3A5N C;  2ZWH A;  3H45 C;  3HOT A;  2QWN A;  4YDU A;  5AQI A;  3WEE A;  4A5A A;  5KQD A;  5GIP A;  4GV6 A;  3UE5 A;  4BRH A;  2Q36 A;  3GE1 A;  4JK8 A;  4BRP A;  2P9N B;  5BPL A;  3ULE A;  1NLV A;  1X9J A;  3CER A;  1GLF O;  4A59 A;  3FLC O;  2FXU A;  4FWQ A;  3UKU A;  3I55 N;  3E9O A;  3VOV A;  3QIC A;  4JK7 A;  4KH4 A;  5F1X A;  4FL9 A;  5EVZ A;  5JIC A;  4BRD A;  3Q7C A;  4DKW A;  3LDP A;  5TKW A;  3O9S A;  3RSE A;  2Q1N A;  2A6A A;  2VGM A;  1R59 O;  3TTF A;  4R79 A;  1CZA N;  3KWG A;  3CET A;  5AQL A;  4B1Z A;  2QWP A;  3MX5 A;  3ENB A;  4BRO A;  4BQZ A;  5GAG P;  4JKE A;  1NMD A;  4CZM A;  1VQ5 N;  2FLO A;  4XH1 A;  3ZET A;  5KPZ A;  3HOS A;  1NJI O;  5LJW A;  2NRW A;  3VTI A;  2NNW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...