4MDAA

Structure of mos1 transposase catalytic domain and raltegravir with mn
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
225
structure length
200
Chain Sequence
PHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFVKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mariner Mos1 transposase
publication title Structural Basis of Mos1 Transposase Inhibition by the Anti-retroviral Drug Raltegravir.
pubmed doi rcsb
source organism Drosophila mauritiana
molecule tags Hydrolase/hydrolase inhibitor
total genus 75
structure length 200
sequence length 225
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01359 Transposase_1 Transposase (partial DDE domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4mdaA00
3F2KA 4R79A 5HOOA 3HOTA 4MDAA 5CR4A 3K9KA 4MDBA 3K9JA 4U7BA 2F7TA 3HOSA
chains in the Genus database with same CATH superfamily
5GADP 4CBWA 4WFAL 3P83D 3QBWA 1S1XA 3TWHA 4JK9A 2HNYA 2O8EA 1NK5A 4NXNK 4M3ZA 5I42A 1WLJA 1NMNA 2HBLA 1D8YA 4BE2A 2D0AA 1I39A 2WBNA 1NGEA 3AAPA 5JVGL 2QTDA 3VQCA 3IUCA 4CF1A 4FK2A 1QHAA 2UXDK 1YIJN 4JKBA 1X1PA 5T7BA 5FPDA 4O55A 1BGXT 3O3HA 1L3VA 5AQTA 3C6AA 3I55N 1QQMA 1F21A 1RTDA 1ATNA 4FLZA 2BANA 3SMPA 1XC9A 4LFAK 3ULEA 1B9FA 4LFBK 1CXQA 4J2DA 3QFPA 4B1ZA 3TTFA 5ADXA 3HL8A 1WBDA 4CK2A 1HYSA 4CJKA 3CPEA 1KC8O 3A5MC 4DTRA 2FBXA 3LP0A 1FK9A 3AO5A 5LMUK 1KAYA 3WUHA 4ID5A 1NK6A 2IVNA 2D0OA 3PSIA 3C6HA 4NCAA 3L8BA 3D2EA 3T7ZA 2P9IA 1KLMA 1K8AO 1RFQA 5AFUH 3ENOA 4FLYA 3T3FA 2Y1JA 2VWKA 4XEIA 4QCLA 1YJNN 4BC5A 2HBMA 3UKUA 4AHTA 4CK1A 3THWB 3OBWA 2E6LA 1KVAA 3SYZA 4J2AA 3RMBA 3CCUN 4IG3A 3EL2A 3OYJA 1WAJA 1YF5L 3D2FB 4BC3A 3AVGA 4JKGA 1CXUA 4XH1A 4CJLA 4DS4A 2NLXA 2W41A 4Y1DA 1WBBA 5BRFA 1K6YA 3MXJA 3CCEN 3ZT0A 2P9UA 4B3RK 1J54A 2O4GA 3EN9A 3QEWA 2P9KB 2OPSA 4JNEA 3JSMA 1RDDA 2ASOA 3RTVA 1NKCA 1A5XA 4J2BA 5AQHA 4BRNA 3OJSA 1P8ZA 2D5RA 3BEXA 4JD2A 3ZX0A 4RTFD 3SI6A 5BRHA 4X64K 1WSHA 3WXJA 3NF7A 4MO4A 4C1NK 3F9KA 1VQLN 4LF4K 2BUPA 1ATRA 3AVJA 3JS6A 3HOSA 1XHZA 2E4LA 5BPNA 4YDUC 3CIPA 2Y1IA 3WXIA 4F2SA 1J53A 5AQRA 4FM0A 3J7YP 4AHCA 4YNQA 3AA4A 1ASUA 3VQDA 3CM6A 1OH5A 4N41A 4R5PA 3W0LA 4Z4CA 4DUZK 1S5JA 2VG6A 3H3OB 2XY5A 3KK1A 4DR3K 5CZ2A 3VQQA 2NRZA 5EOYA 5HRSA 5F0XA 3I0SA 1E4FT 5FPEA 4K42A 2RN2A 4L3QA 4BR2A 4OPAA 3U8XA 3KLHA 3DRRA 4BGAA 2WTUA 1X9WA 4ISGA 5C2DA 5ELZA 4JI1K 3ZSVA 2UUAK 3DJCA 3M8SA 3K58A 2Z1HA 4CJEA 2F7TA 3A5LC 2CH5A 2HF3A 1D9FA 4FZXC 2G8HA 4E1NA 3THXA 3ID6A 4CZGA 1LW0A 4HTUA 4BDYA 1L5UA 1JCEA 3AVKA 4FJNA 4V19S 4IDKA 1U48A 4DU3A 1N32K 2XY6A 3HM8A 4H8KA 3ZSRA 1VQON 3DLBA 3PX0A 4CIGA 5AQYA 2OZSA 1U4BA 3RMAA 2YHBA 4FXDA 4LF9K 3OYIA 2A40A 4FWLA 3U6FA 2OCEA 3VENA 3C95A 1ZBSA 2G8UA 3DLEA 3LPTA 1YUWA 1U45A 2VQFK 4IO8A 3OJUA 3VQ6A 3C0BA 1C0FA 5A2QO 1WSFA 3M8RA 4B8CA 5F1XA 2O4IA 1TK8A 1NGFA 3HVTA 4IEEA 4BRGA 4FJIA 4DTOA 4OKKA 1JLGA 2XHBA 2ZD1A 2P1JA 1TK0A 3L0QA 2F4VK 3LP2A 1BA0A 3ATVA 3O1BA 4O5FA 3UKRA 3K9JA 1BDGA 4YFUA 3VEVA 4GW6A 4Z94A 4H4OA 5KI6A 1EX4A 1BI4B 2VQEK 1TL1A 1VSHA 1XI1A 3K9KA 2IOCA 4ZTFA 4J8FA 4M42A 2OTLN 4JK7A 2YHXA 4FLVA 3K57A 4E7JA 4CZKA 2GX9A 4E1JA 3G6EN 4H0YB 3NGIA 2ZJQL 1HNXK 2GELA 1YVUA 3A2FA 4BDZA 4KTQA 2P9SA 3ZETA 3HM9A 3ZLJA 3TSPA 2KZMA 4DLGA 5IT9O 3SUOA 1RT2A 2HNZA 3LDSA 1GLAG 3TSUA 1TYQB 3GDQA 2FBTA 4K8XA 3VEZA 2O8FA 3CJCA 4B3MK 5C2FA 4GY2B 4GVMA 3NGZA 3QEPA 4JI3K 4E0DA 4DG1A 3K0SA 3AVFA 4E19A 4W5RA 1WSJA 5AQIA 4FWKA 3NH2A 3MAQA 5AZJA 4CJTA 5AQQA 3OS0A 1L3TA 3NBPA 3U9DA 2V7ZA 4JHDA 3VF2A 2FBYA 3SK3A 2FLOA 2XY8A 3VGKA 1RTJA 3AVAA 4DFJA 3KD5E 2P9PA 4KI4A 3E9PA 3FZHA 1Q81O 2PBDA 4JKAA 1UOCA 3K5NA 2GWJA 3VN5A 3ZT1A 3OYKA 3D0PA 1W2BM 4QS7A 4KB1A 4DF4A 2ZE2A 4F2RA 4CJFA 4B1YB 3BF1A 3VGMA 4CJRA 1C0TA 1RBVA 3DM2A 3MCAB 1VK0A 4IOCL 2GUPA 3CXCM 4FLTA 1W0HA 2IDOA 3TAMA 3EYZA 4DV7K 4RWTA 3EY1A 1VSEA 3SPZA 4MO5A 1JCFA 3A8YA 2A1RA 5FPMA 3DLHA 2NUBA 5HOOA 5AQMA 4FJMA 2KLAA 4CHNA 2HNDA 4FPBA 2HMPA 3VERA 3B6OA 2EHGA 4B9SA 3RSEA 3SQ2A 4W5QA 2F8SA 1HLUA 3WT0A 3LDNA 2GEMA 4K41A 1S1UA 2FSNA 2V52B 5F2RA 3FZKA 4IG0A 4JI6K 3GE1A 4XH5A 3WNFA 1D5AA 3HJFA 1NGGA 3A0IX 3AA5X 1SL1A 3SV3A 4CIEA 2E88A 1W7AA 1B9DA 4QS8A 3V9UA 1BISA 5JVHL 1U49A 1NGAA 4OPHA 4MLEA 1BU6O 1VRUA 3QNNA 1YITN 4CHQA 3CCMN 1REVA 4B9LA 3TAPA 1SL2A 2VGMA 3IKMA 3CJBA 4DF8A 5GIOA 1EKEA 4IFVA 4LSNA 3PUFA 1NJWA 2WC9A 4KV8A 3SAFA 4WCEL 4NYFA 2OA8A 5SWMA 1JJ2M 5AQSA 3NH0A 1J6ZA 3WEEB 2WOMA 5M1FA 4CGHA 1X9JA 3FE1A 1C1AA 2G8IA 2VG7A 3E01A 1HMVA 4H4MA 4FVMA 3E1YA 1XNRK 1YXQA 2YNIA 2F9TA 4CFCA 3CETA 3DYAA 3RWUA 1K8KB 3J7ZO 3M8PA 2UXCK 4KREA 1RT3A 1LAWA 3O6WA 3H3NO 5AZIA 1JCGA 4CZJA 4XIUA 2I7NA 3AA2A 4DV0K 3AGRA 1C1CA 5LY3A 4DTUA 5FDLA 1BHLA 4W5TA 1UA0A 1ILYA 4DR7K 3CCSN 3QEVA 4C23A 2UUBK 2D0BA 1QVGM 2V7YA 4IZ9A 1BQMA 1S1TA 4U67L 1HYVA 1DEJA 4O0IA 4YDUA 4M3YA 4E89A 3N4QA 3H1VX 4BVPA 2OZMA 4DQ8A 1DLOA 4Q5VA 5LJWA 4EP5A 2VGNA 1HX1A 4FJJA 4YOVA 2PYLA 2DFHA 5B8HA 4JS4A 3EE9A 4CZMA 4FJ7A 3Q7CA 4YHHK 3IG1A 3IMXA 3G71N 2QKBA 1RT1A 3CCJN 3QEIA 4DV3K 3DLLL 4C8OA 4I6MB 3DI6A 4YORA 1A5WA 1JXBA 2QXFA 2HW3A 1SS6A 4M3XA 2IC3A 4F3OA 2BDPA 3KTQA 4HCBA 2P9LB 1U2VA 1OH7A 4WFNL 1NWKA 4CEBA 4DSEA 3QINA 1NJXA 1HPMA 4XH4A 2W40A 4BRHA 1NU0A 1OVYA 3VQBA 1JLQA 1GLDG 1T6CA 3NAEA 2KFZA 4R79A 1Q9XA 5ADXH 4FL9A 5AQOA 1TL3A 5FLXO 2RKIA 3MX5A 2VCPA 1XC3A 3MX2A 4MDBA 1GOAA 2A5XA 1HKCA 3ASMA 1KD1O 3NMUA 3B8AX 4KKOA 5BN8A 2QWMA 3CFRA 1EXQA 3MECA 1UA1A 1O13A 2F96A 5AQLA 1WAFA 4EAHD 2YHYA 4DSKA 4YOUA 2HMIA 3M6GA 4H5TA 3HI0A 1J9AA 5CYQA 1IKYA 4WE1A 4NLCA 2W6LA 3M3ZA 4DB3A 3HP9A 2HHVA 3CC7N 1XMQK 3AO3A 1RDBA 4A2BA 2X6SA 3NGYA 4G1QA 5BPMA 2GV9A 2RF2A 4JI7K 1Q82O 2HHHK 2KHOA 4H0OA 2HBJA 3VA3A 5SZTA 4M3TA 1OH8A 1RCHA 3CF5L 2UXBK 3LAKA 5HRRA 4N47A 4DKWA 2HOEA 3M8QA 4BQZA 1NJZA 3O4QA 2JWLA 5EY4A 3SQ4A 1V4SA 5KGWA 5CZ1A 2HSTA 1S9GA 5C12A 4AF1A 4B1VA 3U4LA 5C0YA 4AM6A 5AQNA 3L2UA 3HK2A 1YT3A 3PX4A 4Q0BA 3P5JA 4OGCA 3DXMB 5M1KA 4JKEA 3CCRN 4ICLA 2EWSA 3I8DA 4AHSA 1NMDA 3ZT3A 3V4IA 3THWA 3O8MA 4NXMK 1GLCG 4DFPA 1SKRA 4KH4A 2O8EB 3D2FA 3ZYYX 2ZM6K 2D0PA 1EETA 1RGIA 5AQKA 4BY9C 3VEXA 2IGIA 4FWSA 1HNWK 4PA1A 4JKCA 3WNEA 4GV3A 3LP3A 3ALYA 4DV4K 2P9KA 3BF3A 3WXMB 1RTIA 4DV1K 1VQPN 4CEZA 2NZTA 4DWIA 5DM6L 4FLXA 4LSLA 1VSMA 1TUUA 1VRTA 4H5VA 5J2PA 3EZ5A 4CJSA 4DQIA 4I9LA 2P5GA 3ULEB 3C65A 3HRGA 5KRTA 4L8RB 3FLCO 4ILGB 4BE0A 1IBKK 4KHNA 4Y1CA 3F9MA 4CJWA 2CGKA 1N33K 1RT5A 4E7IA 4B9MA 3RR8A 1TKZA 3O9UA 1NK4A 3MEGA 5E84A 5LJVA 3VOVA 3ZT4A 1OVQA 1VQKN 1UWBA 1UAXA 4LF5K 3R6MA 3CERA 4DTNA 4KRFA 3EZWA 2O8CA 3A5NC 4FWRA 4EHUA 3OYMA 5BR9A 4HUEA 1BO5O 4JKGB 3O9QA 3LL3A 3SAHA 4A5AA 4JI8K 3ZSQA 1JLCA 4HCCA 3F5TA 3LWLA 2JWKA 2P9UB 1Z6RA 3T1HK 3JXUA 3KWGA 3H1QA 3UE5A 4RW8A 4JI5K 4CEDA 3FZMA 5LMNK 4JKFA 1BCOA 3ZX3A 4CI6A 4GMJB 3LDLA 1T7PA 1IH7A 3I0RA 3DAWA 1LOTB 4MQ3A 3F2KA 5BRDA 2YKMA 1H1VA 3DWLA 3QMLA 2ZJPL 1RBSA 3MN6A 3NE6A 3ZSWA 3GOIA 3MWPA 3CG7A 1HKGA 1NNEA 2O8DA 4KPYA 4BC4A 1L3UA 2Q31A 4FZYA 3RMDA 4KTWA 2QWRA 4FJ8A 3AVNA 3PV8A 4CJPA 1BQNA 1TVRA 1Y64A 3HBTA 3JYTA 4CZLA 3K2PA 3T19A 2DPNA 3HSTB 3ZSOA 1IJJA 4DTPA 4GV9A 2CGLA 1RTHA 4EP4A 3L2QA 4O8UA 4IBNA 4JKHA 4HUGA 4WQ4C 2FSJA 3QBXA 3AV9A 3O5BA 3O08A 4ILHA 1CZAN 3CJ1A 3D7EO 1CZ9A 2V51B 2DFFA 2P51A 1BI4A 3OYDA 1NBWA 2D1KA 3ISNC 3THXB 3OHRA 2E5LK 3LDOA 4A2AA 2WFBA 4FZZA 4OLAA 3N4PA 1NGCA 3SZ2A 4I2QA 1KVCA 3KKRA 3P38A 4FSVA 3MWTA 2GUIA 4X65K 3QNOA 3SUNA 1X9SA 1WOQA 5KRSA 3KLEA 3C6UA 5C25A 4U7BA 4HVJA 3SMSA 5GIPA 1VSJA 3HXMA 1GLFO 1U6ZA 2PAVA 4LD0A 1YTAA 4BG8A 2ZWHA 5AQJA 4IOAL 3L2RA 3TAGA 4FCYA 3CD6N 3QETA 2YJFA 3O4NA 1MU2A 2GTDA 1IO2A 1YAGA 3O4WA 2PZSA 4FK0A 3WNHA 4JN4A 3SJHA 3O80A 3CFPA 3CYMA 1FW6A 3S9HA 4HTLA 3TAFA 1KLNA 3NVMA 3KIOA 2QWOA 1KFSA 4MDAA 3EE8A 1S6PA 2VG5A 3VQ5A 3VQ4A 5KPZA 4FK4A 2VYPA 4OGEA 4DR1K 2YHWA 3I33A 4B1UB 4IO9L 4CVNE 4NYNA 3WNGA 4E3SA 1VSLA 3C6TA 3E66A 4OPJA 1XQSC 2Z1JA 3O9TA 3WXLA 3QFUA 4FWQA 2A3ZA 1IKWA 1BWFO 4DR4K 4FWMA 1RNHA 3BP8A 4Y0WA 4JI4K 4QAGA 3HO1A 3K5OA 3SNNA 2Q3SA 2A42A 2NRTA 3LALA 5JLFA 1KTQA 1DKGD 4AM7A 2Q1NA 4M63C 1OKJA 1HJRA 4FM2A 4CECA 1WNSA 3DXKB 3K5MA 3OW2M 3ULDA 4ELUA 2IVPA 1T6DA 4CIFA 1ZYQA 2P9NA 4PKGA 4K0KK 1D4XA 4KHPK 2Z1GA 1VQMN 2KQ2A 2FF6A 1HNZK 3MN7A 5MLCQ 1I94K 4AHVA 3OA9A 3NVKA 2O8FB 4DSJA 4GKKK 3MMVA 4CZFA 1BIZA 3QB0A 3AO4A 4G9ZA 4WF9L 4WFBL 1VQ5N 4BVOA 3KJVA 3MDQA 1BIUA 2E20A 4A62A 1SKSA 4FJGA 3CJAA 1Q8IA 1X3NA 4A5BA 3FR0A 4WQ5C 4BRLA 4JHDB 4B1WB 1GLEG 2OTJN 1O1WA 4K8ZA 1QSYA 1YVNA 1ZXOA 1TKTA 5DMRA 3MXMA 1R0AA 4H5NA 2WUSA 1XNQK 4BRIA 5KQ8A 2G8FA 3VF4A 3QICA 4PY5A 4GV6A 2PY5A 3LDQA 2O8BA 4LH5A 4E7KA 4BWJA 2YNGA 4FJ5A 4ISEA 1HR0K 4FVUA 4TSXA 1ZBUA 4BRPA 4BR4A 3WEEA 2QI2A 3LP1A 4O0JA 4PKIA 3FGUA 3AO1A 3PLAA 1QSLA 4BRDA 2DY4A 3TAQA 3BDPA 1K9MO 4B9VA 2AP1A 4M3UA 2YNHA 1GLJO 1C6VA 1T44A 1K8KA 1FXXA 4CZEA 3RSEB 1S3XA 4H0XB 4KFBA 5JICA 1VSDA 4NLBA 4FO0A 4DLEA 4BR0A 1Z26A 4OVLA 1V4TA 2HVHA 1NGJA 2NNWA 3TANA 4DTSA 3W3DA 4KHQA 2OPQA 4CHZA 1LW2A 3LWMA 4FJ9A 1W97L 4IXCA 5HP1A 3G0ZA 2UU9K 3SAGA 3Q7BA 4JEPA 3KLFA 4BC2A 4KAZA 4BACA 2FC0A 4CGDA 2AA4A 4DV6K 1DTTA 1RBRA 4W5NA 3VQ8A 2Z1IA 4DUYK 5M1PA 1RDWX 1NOYA 2H3GX 2QKKA 1KVBA 4DTMA 3OS1A 5CYMA 1Y97A 4YOTA 5BPLA 2BGGA 2F8TA 4I6MA 4H0PA 2JLEA 4IFYA 1X9MA 3B6PA 3ZEUA 1S6QA 3VTHA 2XY7A 2HHXA 2IVOA 1FKOA 1VQNN 5EU7A 4FYDA 3LZJA 2PFUA 3V81A 1NGDA 2P9LA 3ATUA 3RRHA 3C7NB 3VQEA 4CEFA 4ILJA 3LZIA 3IS9A 4CF0A 1SUQA 4H5WA 1N8RO 1ZBHA 2YHAA 3U3GA 1J5OA 4RW9A 1DTQA 3L2WA 4BRMA 4CD1A 4DV5K 1VQ4N 4CJ5A 3KD1E 5AQVA 2Q97A 2DFEA 4FPAA 3HVRA 3VQ7A 1C1BA 5AZIB 1Z25A 2RPIA 5C24A 4BR7A 1HNIA 3VF6A 4F4KA 1E3MA 4JK8A 1VQ6N 4CJVA 4DU1A 3DOKA 5KPTA 2YKNA 3VGLA 3VESA 4JV5K 2Q2RA 4CJ3A 2NRHA 3AVMA 3G25A 3CM5A 3QIOA 1XMOK 2XRIA 1NKBA 3O1WA 4FOEA 3CFOA 5M1NA 3E9LA 4GVEA 1TGOA 3L3VA 4YOWA 4CCHA 1JXEA 3OYCA 3SV4A 1CZBA 1M1KO 4CGJA 2NRRA 4B1XB 3J80O 4B3TK 1N6QA 4DR5K 3BZCA 3KLGA 4WQ4A 1RT4A 4UY8O 4JYAK 1NOZA 4M7XA 3QERA 4EZ9A 1ATSA 4FW1A 4IEIA 3NH1A 5EVZA 3D45A 4NB4A 3OBYA 4C8LA 4CERA 3R9PA 4JRQA 4RW6A 1NJIO 5DK5A 1QQCA 2ITGA 3FZFA 1HRHA 3VQ9A 1WSEA 3AARA 5AQXA 3VMFB 3AAQA 2CGJA 2F9WA 3THVA 3R3LA 3NF8A 3T1AA 4ZHRA 3V9ZA 3VEOA 4C1NI 1KSPA 4Z0UA 4Z4HA 4H03B 3H6EA 5JMVA 3U9ZA 2ATQA 3QESA 1SAZA 2E6MA 2B5JA 3THYB 3ENHA 1MWMA 1Q86O 2X78A 1QTMA 3SBTA 4CEQA 4BRAA 2FXUA 2JGUA 4CZHA 3CQYA 1JLFA 3UB5A 4C8NA 4O5BA 5J2QA 1QVFM 5CR4A 4NO7A 3OVNA 2OANA 2YX6A 4B9UA 5FPNA 3LM2A 4DCHA 3VEWA 3ENBA 1R59O 1RT7A 1ESVA 1TKXA 4LFCK 2DTUA 3L4QA 3CJ9A 4E1MA 3L6QA 4JI0K 4LF6K 3BZKA 5CY4A 1EWRA 2ASMA 4QS9A 5HL7L 3TSQA 3S3OA 3FZLA 2CH6A 1YJWN 4LF8K 2YI1A 4O44A 3SJJA 4CW7B 2E2QA 4JLHA 1QE1A 3MEDA 3K59A 1MDUB 2W6KA 3GBTA 1YJ9N 1YTUA 2QWNA 2ZQBA 3OYLA 2I7PA 4IDHA 1LWCA 1TV6A 4FM1A 1LAVA 4LY7A 1NM1A 1N34K 1L3SA 2WONA 4Z4GA 3P31A 1GOBA 4CEOA 3DRSA 1MA9B 1Q9YA 3TPQA 3BGRA 3OYGA 1SZ2A 3GG4A 4IKFA 1QQNA 2BE2A 3KK2A 3KLIA 5EX5A 1S72N 3DOLA 3SQ1A 5LL6Z 2YNFA 2BTFA 4BWMA 4OPKA 1GOCA 4J2EA 3D2EB 3O3FA 2P9IB 4CJ4A 1T05A 2KKZA 4CD3A 5KGXA 4UQGA 2X6NA 4ZTJA 4DSIA 4CFAA 2YJEA 3VEYA 3HYFA 3UKUB 2QXLA 4AH9A 3NDKA 1Q7YO 1JLAA 1LCUA 1ASWA 4DS5A 1JL2A 2HHUA 1DT9A 1HKBA 4CGGA 3ZSYA 5EXWA 4JS5A 4FLUA 4M7YA 3DLKA 3TTDA 5M1OA 3ID8A 3MXIA 1LWEA 4FJHA 4JKDA 4BRCA 4DR2K 2HVIA 4KI6A 4IJNA 4IOXA 4WQ5A 4BDPA 4CE9A 1S22A 2Q36A 5H1SQ 1VHXA 5AQFA 3AVCA 5AQUA 3MCPA 3TU5A 1IBLK 4JD2B 3HZ6A 3MN9A 1BCMA 1XUPO 2YV0X 1K73O 2GWKA 2HBKA 1WN7A 2Q0UA 4AHUA 3U3YA 4QOZB 3EO3A 4A61A 1NGBA 5AFUA 2IS3A 4N5SA 2O8CB 4CHOA 1LWFA 1NK7A 2A1SA 3L2VA 4EFHA 1FJGK 4KHYA 3M1FA 4FWOA 4HWIA 1NG9A 1G99A 2HF4A 4OJRA 2B6AA 5AJ3K 4CHPA 3IFRA 3IRXA 4IWVA 3SBGA 1KCFA 1ZC6A 4CBUA 3V9WA 1DGKN 3V9XA 2X74A 4PL8A 1A5VA 4DFMA 3AVIA 3ZX2A 5FRMA 4C8MA 1KRPA 4ISFA 4A59A 3VETA 1W9HA 3UIQA 4CEEA 3AVHA 4H0VB 3DLRA 3OTOK 5CHIA 4PWDA 3KKSA 1U04A 5D3GA 4OX9K 1G15A 3NHGA 4CJ7A 4BROA 1TK5A 1QZ6A 1EWQA 2O8DB 5IWAK 5KPRA 1IKXA 3CQXA 3E9OA 3C94A 2AJQA 1VSKA 4AHRA 4DQRA 3SUPA 5TKYA 2HB5A 4KTZA 1XWLA 3RR7A 3D6RA 4IJAA 2D0CA 1ZBIA 1BG3A 1LV5A 4BQLA 4B08A 4DHYA 5KTQA 3CCLN 4JRPA 4CBXA 3S3NA 3CC2N 2XO7A 5E26A 3P39A 4OLBA 3HT3A 3CQ8A 3PO4A 1KAXA 4MFBA 4KHSA 3S3MA 5FROA 4CFDA 1HYZA 5AQGA 1HNVA 3LAMA 4DMNA 3FFKB 3BY5A 1TUYA 4NCGA 4OO1J 5JLHA 4W5OA 2E8AA 2OPPA 1TYQA 5JS2A 4O8KA 4CF9A 4YY3K 4GKJK 5BR8K 1P90A 4CJUA 3MEEA 1BUPA 1X3MA 3T1YK 2KFNA 3EKUA 1KXPA 4M3RA 2ASPA 1Z05A 3L3UA 5GAHP 1N5YA 3ZSXA 2KW4A 4OKEA 3HP6A 3UKRB 4H5RA 2E2PA 2A6AA 1EO1A 1IG8A 5J2NA 4DTJA 3SQ0A 3I56N 2QWLA 3EKSA 1JL1A 4JI2K 4B8AB 4E7HA 1HUXA 3DXKA 4M45A 2ZGYA 4CF2A 4DFKA 1VSIA 3NF6A 4KH5A 3AY9A 2FBVA 1RDCA 4CJQA 1RILA 1EQYA 3RMCA 4KO0A 5E41A 1VAZA 4FLWA 1NK9A 4Z4IA 3ZT2A 4ELTA 3FFIA 4MLHA 1IKVA 2FSKA 4HUFA 4BR9A 5BREA 3LDPA 1KQSM 3AGKA 3CMEN 4GNIA 4CGIA 4X66K 2P9SB 1HQUA 3ZETB 4LC9B 2LSNA 2ETJA 4DQQA 3QIPA 1RBUA 4K43A 3OYFA 4DSLA 5C10A 3HPHA 4WYBA 3GL1A 5HLFA 1BL3A 4JAXA 3OYHA 1ASVA 3ITHA 2ZJRL 1SKWA 4I7FA 5J2MA 1WSGA 5BN9A 3AO2A 4B9NA 3M5RA 2IAJA 4K25A 4CGFA 3CC4N 2QA4N 4DV2K 2RE2A 3NCIA 5FRNA 5AZJB 2E2NA 4O4GA 3VQAA 3VPZA 2HHSA 1BOTO 3R8EA 1XHXA 1NK8A 3DRPA 4N56A 3WQTA 3CPWM 5C15A 3HTVA 4BRQA 2P9PB 5HRNA 4ID1A 4RCHA 3HPGA 4BG9A 3ZSZA 4N76A 3VTIA 2P9NB 3A5OC 2G8VA 5C42A 3V9SA 3OYEA 1T3VA 3TABA 2EX3A 3PIOL 2KZZA 1SV5A 1S9EA 4CF8A 3PSFA 5AQPA 1HQEA 4KHUA 5TKWA 3OS2A 3H45C 4DU4A 1VQ7N 2RHKA 3HSCA 1NJYA 1E4GT 5I9EB 3MK6A 4M41A 3QDKA 4ELVA 2HHQA 1RBTA 1IG9A 3V6DA 4CHYA 4CK3A 5K14A 3I8BA 4I9QA 1NLVA 3O9RA 3OY9A 3DMJA 1Q18A 3IDHA 1M90O 4B9TA 4EZ6A 3QO9A 3NF9A 1TAQA 4PL7A 1BA1A 3J81O 3HOTA 1T03A 4AILC 3P4IA 1RT6A 3LPUA 3OYBA 4BE1A 3J8AA 3BUZB 2O8BB 4AQYK 3H08A 3KVGA 2A41A 2QEXN 1KFDA 2J4RA 2UUCK 1QHTA 3CHWA 1CLQA 3DLGA 3RVCA 5KQDA 3L4IA 4KB0A 2B4JA 3KK3A 2VWJA 4DR6K 1VQ9N 4CFBA 3OYAA 2E2OA 2YCHA 4F9OA 3NFAA 4FJXA 4DSFA 1QQOA 1YI2N 1IV0A 1TAUA 1D9DA 4A57A 3O9SA 3RRGA 3SLCA 1KAZA 3EEQA 2R7YA 3C7NA 1ZBFA 2NRWA 4H0TB 1FKPA 1TKDA 4FWPA 4CESA 4BREA 3T69A 3G10A 1YHQN 4EHTA 1VQ8N 4C8KA 1NKEA 2I5JA 1S1WA 5I3UA 3PY8A 3KK7A 3WXKA 3CJ7A 2IIRA 2P5OA 4RG8A 4BR5A 3IAYA 4FOIA 1I3AA 2HHTA 2HHWA 2VWBA 5AR0A 2BH1A 1RDUA 3HPOA 3OYNA 5GINA 3SCXA 2QWPA 3CCVN 2QK9A 3LM9A 3V1OA 5CE3A 4NCBA 3SPYA 1JKHA 3CMAN 5AQZA 3R1XA 5HRPA 3KWIA 3PO5A 1IBMK 4F3TA 2UYTA 1ITGA 1SL0A 1GLBG 3KZBA 4IFEA 2QM1A 3CCQN 1EP4A 5AQWA 2ZF5O 1QS4A 4CEAA 2Q0RA 4LH4A 4RW7A 1J5EK 1QSSA 3CI5A 1QZ5A 3TR8A 4B3OA 1WSIA 4DTXA 5GAGP 1C0MA 3QEXA 1MWKA 4FJKA 1JLBA 2PYJA 3S41A 4B9QA 4YOXA 4PQUA 2E1ZA 1N36K 4PHTX 1ZBLA 4YOYA 2QW9A 3ZEUB 4DQPA 3G4SN 4KHWA 2KTQA 4PKHA 2NRVA 4FJLA 5HROA 4PUOA 1VSFA 4F8RA 4BGBA 2G8KA 2FF3B 5JS1A 1C0UA 2NRXA 2ITMA 3J7AP 3PX6A 3PIPL 1RDAA 2E1YA 4RW4A 5DM7L 1T8EA 3TI0A 3MN5A 1HJOA 4B3SK 5J1EA 3ZCMA 2GBZA 4E7LA 1JLEA 4DQSA 3F73A 3QLHA 5HBMA 4I2PA 4OKJA 3KHYA 1NGIA 3LANA 3TTCA 1WUAA 5M1QA 2W42A 4BRFA 3WQUA 2G8WA 1NGHA 1C0GA 4CZIA 3AVLA 2D4WA 1SQKA 3O3GA 3VQPA 1U2VB 2ZGZA 4X62K 3V1RA 4FWNA 1GLLO 4KBOA 3THYA 3TAEA 1S1VA 2OPRA 4BRKA 4LF7K 3H46O 1U47A 3SUQA 4EIAA 3TARA 1NK0A 3K5LA 2QWQA 3DXMA 1WB9A 1HPZA 1OH6A 1B92A 4Z4EA 2OYQA 5GAEP 4KH6A 4HHTA 3AA3A 3VA0A 3JAMO 4Z4FA 4FW2A 4M3WA 3P1GA 3V1QA 3AVBA
chains in the Genus database with same CATH topology
3O9TA 5GADP 3WXLA 4CBWA 4WFAL 1XUPO 3QFUA 3E1YA 3QBWA 1K73O 4FWQA 4JK9A 1YXQA 2A3ZA 1BWFO 2GWKA 4FWMA 2HBKA 2Q0UA 2F9TA 3BP8A 4Y0WA 3CETA 1K8KB 3EO3A 4A61A 3J7ZO 1NGBA 5AFUA 2A42A 2NRTA 2HBLA 3O6WA 5JLFA 3H3NO 1DKGD 5AZIA 4AM7A 1JCGA 2WBNA 4CZJA 1NGEA 2Q1NA 3AAPA 4M63C 5JVGL 2QTDA 1OKJA 3IUCA 1QHAA 2I7NA 4EFHA 3DXKB 1YIJN 3AGRA 4JKBA 3M1FA 4FWOA 4HWIA 5LY3A 1G99A 2HF4A 5FPDA 3OW2M 1ILYA 3IFRA 4IWVA 3SBGA 3CCSN 2IVPA 5AQTA 3C6AA 1T6DA 1ZC6A 4C23A 1QQMA 4CBUA 1DGKN 3I55N 4PL8A 1QVGM 2V7YA 4IZ9A 2P9NA 4PKGA 1ATNA 3SMPA 4U67L 1DEJA 3ZX2A 4YDUA 3ULEA 1D4XA 3N4QA 3QFPA 3H1VX 4B1ZA 1VQMN 3TTFA 2FF6A 4ISFA 4BVPA 5ADXA 3MN7A 5MLCQ 3OA9A 4A59A 3VETA 3CPEA 4DQ8A 3NVKA 1KC8O 3A5MC 5LJWA 4H0VB 2VGNA 3MMVA 4CZFA 3QB0A 5CHIA 1HX1A 1KAYA 3WUHA 4G9ZA 4WF9L 2IVNA 4WFBL 2D0OA 4YOVA 5B8HA 3C6HA 3EE9A 1VQ5N 3D2EA 4BVOA 4CZMA 3MDQA 2E20A 3Q7CA 2P9IA 3T7ZA 4A62A 1QZ6A 4BROA 4CJ7A 3IMXA 3G71N 5KPRA 1K8AO 3CCJN 1RFQA 5AFUH 3ENOA 3CJAA 3DLLL 1X3NA 3CQXA 4I6MB 3E9OA 4YORA 3FR0A 4XEIA 4A5BA 1SS6A 4WQ5C 1YJNN 4BRLA 4JHDB 4BC5A 4B1WB 1GLEG 2HBMA 5TKYA 2OTJN 1YVNA 1ZXOA 3D6RA 4IJAA 3UKUA 4H5NA 2WUSA 3OBWA 1BG3A 4BRIA 5KQ8A 2P9LB 4BQLA 4DHYA 1U2VA 3CCLN 3CCUN 3EL2A 3VF4A 1NWKA 3QICA 4CBXA 1YF5L 4WFNL 5E26A 3CC2N 3P39A 4GV6A 3D2FB 4BC3A 3LDQA 1HPMA 4JKGA 4XH4A 2W40A 4XH1A 4BRHA 1KAXA 1OVYA 2NLXA 2W41A 5BRFA 1GLDG 1T6CA 3CCEN 4ISEA 4R79A 2P9UA 4FVUA 5ADXH 4BRPA 4FL9A 3EN9A 5AQGA 3WEEA 4BR4A 2P9KB 2QI2A 3FFKB 4PKIA 5AQOA 4JNEA 1TUYA 4OO1J 3MX5A 2VCPA 1XC3A 2ASOA 3MX2A 4MDBA 5JLHA 2E8AA 3FGUA 1TYQA 4O8KA 3PLAA 2A5XA 4BRDA 5AQHA 1HKCA 4BRNA 1P8ZA 3BEXA 1P90A 4JD2A 3ZX0A 1KD1O 3NMUA 4RTFD 3B8AX 1BUPA 1X3MA 5BN8A 5BRHA 1K9MO 2AP1A 2QWMA 3EKUA 1KXPA 2ASPA 3WXJA 4C1NK 4MO4A 1GLJO 1Z05A 1T44A 5GAHP 1VQLN 2BUPA 1ATRA 3JS6A 1K8KA 3HOSA 1O13A 5AQLA 4YDUC 3CIPA 4EAHD 3WXIA 2YHYA 3UKRB 4CZEA 5BPNA 4H5RA 4YOUA 2E2PA 3RSEB 2A6AA 5AQRA 1EO1A 1IG8A 3M6GA 4H5TA 1S3XA 3HI0A 4H0XB 5JICA 4NLBA 4NLCA 4FO0A 3I56N 2QWLA 3EKSA 4BR0A 3M3ZA 1V4TA 4DB3A 1NGJA 2NNWA 3W0LA 1HUXA 3DXKA 2ZGYA 3W3DA 3CC7N 3H3OB 1W97L 4KH5A 4IXCA 4A2BA 3AY9A 5BPMA 3SAGA 2NRZA 3Q7BA 1EQYA 5EOYA 4JEPA 5F0XA 2KHOA 4H0OA 1Q82O 1VAZA 1E4FT 5FPEA 2HBJA 4BC2A 4K42A 4L3QA 4BR2A 4OPAA 3CF5L 2AA4A 4MLHA 3U8XA 2FSKA 4DKWA 2HOEA 4BGAA 4BR9A 5BREA 3LDPA 4BQZA 3AGKA 1KQSM 3CMEN 4ISGA 2JWLA 5EY4A 1V4SA 5ELZA 4GNIA 5C2DA 2HSTA 3DJCA 5C12A 4AF1A 4B1VA 3U4LA 2P9SB 1RDWX 5M1PA 3ZETB 2F7TA 3A5LC 4LC9B 4AM6A 5C0YA 2CH5A 2H3GX 2HF3A 5AQNA 3ID6A 4CZGA 4K43A 1JCEA 4YOTA 5C10A 5BPLA 4WYBA 3DXMB 4I6MA 3GL1A 4H0PA 5M1KA 4JKEA 3ZEUA 3CCRN 4JAXA 3VTHA 2ZJRL 2EWSA 2IVOA 3HM8A 1VQON 1VQNN 5BN9A 5AQYA 1NMDA 3O8MA 2PFUA 1NGDA 2P9LA 3M5RA 3ATUA 4K25A 3C7NB 1GLCG 4ILJA 4KH4A 3D2FA 2A40A 3CC4N 4FWLA 3ZYYX 2QA4N 4H5WA 1N8RO 2D0PA 2RE2A 3VENA 1ZBSA 1RGIA 5AQKA 4BRMA 4CD1A 4BY9C 1VQ4N 5AZJB 2E2NA 1YUWA 3VEXA 3VPZA 5AQVA 4FWSA 2Q97A 4FPAA 1BOTO 4JKCA 5AZIB 4GV3A 3R8EA 4IO8A 4BR7A 2P9KA 3BF3A 3WQTA 3WXMB 3VF6A 1VQPN 3C0BA 1C0FA 3CPWM 5C15A 4JK8A 2NZTA 1VQ6N 3HTVA 5F1XA 4BRQA 5DM6L 2P9PB 5KPTA 3VGLA 3VESA 4RCHA 1NGFA 2Q2RA 2NRHA 4BG9A 4IEEA 4BRGA 1TUUA 4H5VA 3G25A 3VTIA 2P9NB 3A5OC 3ULEB 3C65A 3HRGA 3L0QA 3O1WA 1BA0A 3ATVA 3O1BA 4FOEA 4O5FA 3K9JA 3UKRA 3FLCO 5M1NA 1T3VA 1BDGA 4ILGB 3PIOL 3E9LA 3VEVA 4GVEA 4Z94A 4YOWA 3F9MA 5AQPA 5TKWA 3H45C 2CGKA 1VQ7N 2RHKA 3HSCA 1E4GT 5I9EB 3MK6A 3K9KA 1M1KO 2NRRA 3QDKA 4B1XB 3O9UA 4J8FA 2OTLN 3I8BA 5E84A 5LJVA 3VOVA 1NLVA 4WQ4A 4JK7A 4UY8O 1VQKN 2YHXA 3O9RA 4M7XA 3R6MA 3CERA 4CZKA 1Q18A 2GX9A 3IDHA 1ATSA 4IEIA 1M90O 4E1JA 3EZWA 5EVZA 3A5NC 3G6EN 4H0YB 4NB4A 4PL7A 1BA1A 4FWRA 3HOTA 4EHUA 3OBYA 3P4IA 5BR9A 2ZJQL 3R9PA 3J8AA 2GELA 1BO5O 3BUZB 1NJIO 3FZFA 4JKGB 2P9SA 3O9QA 3ZETA 3LL3A 3KVGA 2A41A 2QEXN 2J4RA 3CHWA 3AARA 3SAHA 3TSPA 3RVCA 4A5AA 5KQDA 5AQXA 3VMFB 3L4IA 3AAQA 2CGJA 3F5TA 2JWKA 2F9WA 2P9UB 1Z6RA 3R3LA 3JXUA 1VQ9N 3VEOA 3KWGA 2E2OA 3H1QA 2YCHA 3UE5A 4C1NI 4F9OA 1GLAG 3FZMA 4JKFA 1QQOA 4H03B 3H6EA 3ZX3A 4CI6A 5JMVA 3TSUA 3LDLA 3U9ZA 1YI2N 1TYQB 3GDQA 1SAZA 4A57A 3O9SA 3VEZA 3CJCA 3DAWA 3SLCA 1KAZA 1LOTB 3F2KA 3ENHA 3C7NA 4GY2B 1MWMA 5BRDA 2NRWA 4H0TB 1H1VA 3DWLA 3QMLA 2ZJPL 3SBTA 1Q86O 4BRAA 2FXUA 3MN6A 4FWPA 3GOIA 3MWPA 4CZHA 1HKGA 3CQYA 4BREA 5AQIA 4FWKA 3T69A 3UB5A 1YHQN 3MN9A 4BC4A 4EHTA 1VQ8N 5AZJA 5AQQA 1QVFM 2Q31A 5CR4A 3U9DA 4NO7A 3KK7A 3WXKA 3CJ7A 2IIRA 2OANA 2V7ZA 2YX6A 4JHDA 4FOIA 3VF2A 4BR5A 5FPNA 3LM2A 3SK3A 2QWRA 2VWBA 5AR0A 2BH1A 1RDUA 2FLOA 4DCHA 3VEWA 3ENBA 3VGKA 1Y64A 3HBTA 1R59O 1ESVA 4CZLA 5GINA 2DPNA 3L4QA 2QWPA 3CCVN 2P9PA 3CJ9A 3LM9A 3E9PA 3FZHA 1Q81O 1IJJA 5CE3A 4GV9A 2CGLA 2PBDA 3L6QA 3CMAN 4JKAA 5AQZA 2GWJA 3R1XA 2ASMA 4QS9A 5HL7L 4O8UA 3TSQA 4JKHA 3FZLA 3KWIA 1W2BM 4QS7A 4WQ4C 2UYTA 1GLBG 2CH6A 3KZBA 4IFEA 1YJWN 2QM1A 2FSJA 2YI1A 3BF1A 5AQWA 2ZF5O 3QBXA 3VGMA 4B1YB 3CCQN 3O5BA 3O08A 4ILHA 2E2QA 2Q0RA 1CZAN 1MDUB 3CJ1A 3MCAB 3GBTA 3CI5A 4IOCL 1QZ5A 1YJ9N 2GUPA 2QWNA 3CXCM 5GAGP 3D7EO 2I7PA 4IDHA 2V51B 1MWKA 1NBWA 1NM1A 4RWTA 2D1KA 3S41A 4B9QA 4YOXA 4MO5A 1JCFA 3A8YA 3OHRA 3LDOA 3P31A 5FPMA 4A2AA 2WFBA 5HOOA 2E1ZA 1MA9B 3TPQA 5C2FA 5AQMA 4PHTX 3N4PA 4YOYA 2QW9A 1NGCA 2KLAA 3ZEUB 1SZ2A 3G4SN 3GG4A 3P38A 4FPBA 1QQNA 3MWTA 4FSVA 4PKHA 2HMPA 2NRVA 3VERA 1WOQA 3RSEA 4BGBA 1HLUA 5EX5A 1S72N 3WT0A 2FF3B 4U7BA 3LDNA 2GEMA 4K41A 2NRXA 2FSNA 2V52B 3SMSA 5GIPA 2ITMA 2BTFA 3FZKA 5F2RA 1GLFO 3PIPL 1U6ZA 2PAVA 2E1YA 3D2EB 3GE1A 4XH5A 5DM7L 2P9IB 1HJOA 3MN5A 1NGGA 3A0IX 4BG8A 2KKZA 2ZWHA 5AQJA 4CD3A 4IOAL 2E88A 3KHYA 4QS8A 1NGIA 3TTCA 2YJEA 1WUAA 5M1QA 3VEYA 3CD6N 5JVHL 4BRFA 3WQUA 2YJFA 1NGAA 4OPHA 1NGHA 1C0GA 3UKUB 2GTDA 4CZIA 2QXLA 1BU6O 1YAGA 4MLEA 1Q7YO 3O4WA 1YITN 2D4WA 1SQKA 1U2VB 2ZGZA 4JN4A 1LCUA 3O80A 3SJHA 3CCMN 1DT9A 1HKBA 4FWNA 1GLLO 2VGMA 4HTLA 4KBOA 5EXWA 3IKMA 4M7YA 3CJBA 3TTDA 4BRKA 5M1OA 3ID8A 3NVMA 5GIOA 2QWOA 4MDAA 3EE8A 2WC9A 3H46O 4JKDA 4BRCA 3SAFA 4EIAA 4WCEL 5KPZA 1JJ2M 2QWQA 4IJNA 4IOXA 1J6ZA 3DXMA 4WQ5A 5AQSA 2VYPA 3WEEB 5M1FA 2YHWA 3I33A 1X9JA 3FE1A 4B1UB 5GAEP 1S22A 2Q36A 5H1SQ 4KH6A 4IO9L 5AQFA 5AQUA 3E66A 3MCPA 1XQSC 3TU5A 4JD2B 3HZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F2K A;  4R79 A;  5HOO A;  3HOT A;  4MDA A;  5CR4 A;  3K9K A;  4MDB A;  3K9J A;  4U7B A;  2F7T A;  3HOS A; 
#chains in the Genus database with same CATH topology
 5GAD P;  4CBW A;  4WFA L;  3P83 D;  3QBW A;  1S1X A;  3TWH A;  4JK9 A;  2HNY A;  2O8E A;  1NK5 A;  4NXN K;  4M3Z A;  5I42 A;  1WLJ A;  1NMN A;  2HBL A;  1D8Y A;  4BE2 A;  2D0A A;  1I39 A;  2WBN A;  1NGE A;  3AAP A;  5JVG L;  2QTD A;  3VQC A;  3IUC A;  4CF1 A;  4FK2 A;  1QHA A;  2UXD K;  1YIJ N;  4JKB A;  1X1P A;  5T7B A;  5FPD A;  4O55 A;  1BGX T;  3O3H A;  1L3V A;  5AQT A;  3C6A A;  3I55 N;  1QQM A;  1F21 A;  1RTD A;  1ATN A;  4FLZ A;  2BAN A;  3SMP A;  1XC9 A;  4LFA K;  3ULE A;  1B9F A;  4LFB K;  1CXQ A;  4J2D A;  3QFP A;  4B1Z A;  3TTF A;  5ADX A;  3HL8 A;  1WBD A;  4CK2 A;  1HYS A;  4CJK A;  3CPE A;  1KC8 O;  3A5M C;  4DTR A;  2FBX A;  3LP0 A;  1FK9 A;  3AO5 A;  5LMU K;  1KAY A;  3WUH A;  4ID5 A;  1NK6 A;  2IVN A;  2D0O A;  3PSI A;  3C6H A;  4NCA A;  3L8B A;  3D2E A;  3T7Z A;  2P9I A;  1KLM A;  1K8A O;  1RFQ A;  5AFU H;  3ENO A;  4FLY A;  3T3F A;  2Y1J A;  2VWK A;  4XEI A;  4QCL A;  1YJN N;  4BC5 A;  2HBM A;  3UKU A;  4AHT A;  4CK1 A;  3THW B;  3OBW A;  2E6L A;  1KVA A;  3SYZ A;  4J2A A;  3RMB A;  3CCU N;  4IG3 A;  3EL2 A;  3OYJ A;  1WAJ A;  1YF5 L;  3D2F B;  4BC3 A;  3AVG A;  4JKG A;  1CXU A;  4XH1 A;  4CJL A;  4DS4 A;  2NLX A;  2W41 A;  4Y1D A;  1WBB A;  5BRF A;  1K6Y A;  3MXJ A;  3CCE N;  3ZT0 A;  2P9U A;  4B3R K;  1J54 A;  2O4G A;  3EN9 A;  3QEW A;  2P9K B;  2OPS A;  4JNE A;  3JSM A;  1RDD A;  2ASO A;  3RTV A;  1NKC A;  1A5X A;  4J2B A;  5AQH A;  4BRN A;  3OJS A;  1P8Z A;  2D5R A;  3BEX A;  4JD2 A;  3ZX0 A;  4RTF D;  3SI6 A;  5BRH A;  4X64 K;  1WSH A;  3WXJ A;  3NF7 A;  4MO4 A;  4C1N K;  3F9K A;  1VQL N;  4LF4 K;  2BUP A;  1ATR A;  3AVJ A;  3JS6 A;  3HOS A;  1XHZ A;  2E4L A;  5BPN A;  4YDU C;  3CIP A;  2Y1I A;  3WXI A;  4F2S A;  1J53 A;  5AQR A;  4FM0 A;  3J7Y P;  4AHC A;  4YNQ A;  3AA4 A;  1ASU A;  3VQD A;  3CM6 A;  1OH5 A;  4N41 A;  4R5P A;  3W0L A;  4Z4C A;  4DUZ K;  1S5J A;  2VG6 A;  3H3O B;  2XY5 A;  3KK1 A;  4DR3 K;  5CZ2 A;  3VQQ A;  2NRZ A;  5EOY A;  5HRS A;  5F0X A;  3I0S A;  1E4F T;  5FPE A;  4K42 A;  2RN2 A;  4L3Q A;  4BR2 A;  4OPA A;  3U8X A;  3KLH A;  3DRR A;  4BGA A;  2WTU A;  1X9W A;  4ISG A;  5C2D A;  5ELZ A;  4JI1 K;  3ZSV A;  2UUA K;  3DJC A;  3M8S A;  3K58 A;  2Z1H A;  4CJE A;  2F7T A;  3A5L C;  2CH5 A;  2HF3 A;  1D9F A;  4FZX C;  2G8H A;  4E1N A;  3THX A;  3ID6 A;  4CZG A;  1LW0 A;  4HTU A;  4BDY A;  1L5U A;  1JCE A;  3AVK A;  4FJN A;  4V19 S;  4IDK A;  1U48 A;  4DU3 A;  1N32 K;  2XY6 A;  3HM8 A;  4H8K A;  3ZSR A;  1VQO N;  3DLB A;  3PX0 A;  4CIG A;  5AQY A;  2OZS A;  1U4B A;  3RMA A;  2YHB A;  4FXD A;  4LF9 K;  3OYI A;  2A40 A;  4FWL A;  3U6F A;  2OCE A;  3VEN A;  3C95 A;  1ZBS A;  2G8U A;  3DLE A;  3LPT A;  1YUW A;  1U45 A;  2VQF K;  4IO8 A;  3OJU A;  3VQ6 A;  3C0B A;  1C0F A;  5A2Q O;  1WSF A;  3M8R A;  4B8C A;  5F1X A;  2O4I A;  1TK8 A;  1NGF A;  3HVT A;  4IEE A;  4BRG A;  4FJI A;  4DTO A;  4OKK A;  1JLG A;  2XHB A;  2ZD1 A;  2P1J A;  1TK0 A;  3L0Q A;  2F4V K;  3LP2 A;  1BA0 A;  3ATV A;  3O1B A;  4O5F A;  3UKR A;  3K9J A;  1BDG A;  4YFU A;  3VEV A;  4GW6 A;  4Z94 A;  4H4O A;  5KI6 A;  1EX4 A;  1BI4 B;  2VQE K;  1TL1 A;  1VSH A;  1XI1 A;  3K9K A;  2IOC A;  4ZTF A;  4J8F A;  4M42 A;  2OTL N;  4JK7 A;  2YHX A;  4FLV A;  3K57 A;  4E7J A;  4CZK A;  2GX9 A;  4E1J A;  3G6E N;  4H0Y B;  3NGI A;  2ZJQ L;  1HNX K;  2GEL A;  1YVU A;  3A2F A;  4BDZ A;  4KTQ A;  2P9S A;  3ZET A;  3HM9 A;  3ZLJ A;  3TSP A;  2KZM A;  4DLG A;  5IT9 O;  3SUO A;  1RT2 A;  2HNZ A;  3LDS A;  1GLA G;  3TSU A;  1TYQ B;  3GDQ A;  2FBT A;  4K8X A;  3VEZ A;  2O8F A;  3CJC A;  4B3M K;  5C2F A;  4GY2 B;  4GVM A;  3NGZ A;  3QEP A;  4JI3 K;  4E0D A;  4DG1 A;  3K0S A;  3AVF A;  4E19 A;  4W5R A;  1WSJ A;  5AQI A;  4FWK A;  3NH2 A;  3MAQ A;  5AZJ A;  4CJT A;  5AQQ A;  3OS0 A;  1L3T A;  3NBP A;  3U9D A;  2V7Z A;  4JHD A;  3VF2 A;  2FBY A;  3SK3 A;  2FLO A;  2XY8 A;  3VGK A;  1RTJ A;  3AVA A;  4DFJ A;  3KD5 E;  2P9P A;  4KI4 A;  3E9P A;  3FZH A;  1Q81 O;  2PBD A;  4JKA A;  1UOC A;  3K5N A;  2GWJ A;  3VN5 A;  3ZT1 A;  3OYK A;  3D0P A;  1W2B M;  4QS7 A;  4KB1 A;  4DF4 A;  2ZE2 A;  4F2R A;  4CJF A;  4B1Y B;  3BF1 A;  3VGM A;  4CJR A;  1C0T A;  1RBV A;  3DM2 A;  3MCA B;  1VK0 A;  4IOC L;  2GUP A;  3CXC M;  4FLT A;  1W0H A;  2IDO A;  3TAM A;  3EYZ A;  4DV7 K;  4RWT A;  3EY1 A;  1VSE A;  3SPZ A;  4MO5 A;  1JCF A;  3A8Y A;  2A1R A;  5FPM A;  3DLH A;  2NUB A;  5HOO A;  5AQM A;  4FJM A;  2KLA A;  4CHN A;  2HND A;  4FPB A;  2HMP A;  3VER A;  3B6O A;  2EHG A;  4B9S A;  3RSE A;  3SQ2 A;  4W5Q A;  2F8S A;  1HLU A;  3WT0 A;  3LDN A;  2GEM A;  4K41 A;  1S1U A;  2FSN A;  2V52 B;  5F2R A;  3FZK A;  4IG0 A;  4JI6 K;  3GE1 A;  4XH5 A;  3WNF A;  1D5A A;  3HJF A;  1NGG A;  3A0I X;  3AA5 X;  1SL1 A;  3SV3 A;  4CIE A;  2E88 A;  1W7A A;  1B9D A;  4QS8 A;  3V9U A;  1BIS A;  5JVH L;  1U49 A;  1NGA A;  4OPH A;  4MLE A;  1BU6 O;  1VRU A;  3QNN A;  1YIT N;  4CHQ A;  3CCM N;  1REV A;  4B9L A;  3TAP A;  1SL2 A;  2VGM A;  3IKM A;  3CJB A;  4DF8 A;  5GIO A;  1EKE A;  4IFV A;  4LSN A;  3PUF A;  1NJW A;  2WC9 A;  4KV8 A;  3SAF A;  4WCE L;  4NYF A;  2OA8 A;  5SWM A;  1JJ2 M;  5AQS A;  3NH0 A;  1J6Z A;  3WEE B;  2WOM A;  5M1F A;  4CGH A;  1X9J A;  3FE1 A;  1C1A A;  2G8I A;  2VG7 A;  3E01 A;  1HMV A;  4H4M A;  4FVM A;  3E1Y A;  1XNR K;  1YXQ A;  2YNI A;  2F9T A;  4CFC A;  3CET A;  3DYA A;  3RWU A;  1K8K B;  3J7Z O;  3M8P A;  2UXC K;  4KRE A;  1RT3 A;  1LAW A;  3O6W A;  3H3N O;  5AZI A;  1JCG A;  4CZJ A;  4XIU A;  2I7N A;  3AA2 A;  4DV0 K;  3AGR A;  1C1C A;  5LY3 A;  4DTU A;  5FDL A;  1BHL A;  4W5T A;  1UA0 A;  1ILY A;  4DR7 K;  3CCS N;  3QEV A;  4C23 A;  2UUB K;  2D0B A;  1QVG M;  2V7Y A;  4IZ9 A;  1BQM A;  1S1T A;  4U67 L;  1HYV A;  1DEJ A;  4O0I A;  4YDU A;  4M3Y A;  4E89 A;  3N4Q A;  3H1V X;  4BVP A;  2OZM A;  4DQ8 A;  1DLO A;  4Q5V A;  5LJW A;  4EP5 A;  2VGN A;  1HX1 A;  4FJJ A;  4YOV A;  2PYL A;  2DFH A;  5B8H A;  4JS4 A;  3EE9 A;  4CZM A;  4FJ7 A;  3Q7C A;  4YHH K;  3IG1 A;  3IMX A;  3G71 N;  2QKB A;  1RT1 A;  3CCJ N;  3QEI A;  4DV3 K;  3DLL L;  4C8O A;  4I6M B;  3DI6 A;  4YOR A;  1A5W A;  1JXB A;  2QXF A;  2HW3 A;  1SS6 A;  4M3X A;  2IC3 A;  4F3O A;  2BDP A;  3KTQ A;  4HCB A;  2P9L B;  1U2V A;  1OH7 A;  4WFN L;  1NWK A;  4CEB A;  4DSE A;  3QIN A;  1NJX A;  1HPM A;  4XH4 A;  2W40 A;  4BRH A;  1NU0 A;  1OVY A;  3VQB A;  1JLQ A;  1GLD G;  1T6C A;  3NAE A;  2KFZ A;  4R79 A;  1Q9X A;  5ADX H;  4FL9 A;  5AQO A;  1TL3 A;  5FLX O;  2RKI A;  3MX5 A;  2VCP A;  1XC3 A;  3MX2 A;  4MDB A;  1GOA A;  2A5X A;  1HKC A;  3ASM A;  1KD1 O;  3NMU A;  3B8A X;  4KKO A;  5BN8 A;  2QWM A;  3CFR A;  1EXQ A;  3MEC A;  1UA1 A;  1O13 A;  2F96 A;  5AQL A;  1WAF A;  4EAH D;  2YHY A;  4DSK A;  4YOU A;  2HMI A;  3M6G A;  4H5T A;  3HI0 A;  1J9A A;  5CYQ A;  1IKY A;  4WE1 A;  4NLC A;  2W6L A;  3M3Z A;  4DB3 A;  3HP9 A;  2HHV A;  3CC7 N;  1XMQ K;  3AO3 A;  1RDB A;  4A2B A;  2X6S A;  3NGY A;  4G1Q A;  5BPM A;  2GV9 A;  2RF2 A;  4JI7 K;  1Q82 O;  2HHH K;  2KHO A;  4H0O A;  2HBJ A;  3VA3 A;  5SZT A;  4M3T A;  1OH8 A;  1RCH A;  3CF5 L;  2UXB K;  3LAK A;  5HRR A;  4N47 A;  4DKW A;  2HOE A;  3M8Q A;  4BQZ A;  1NJZ A;  3O4Q A;  2JWL A;  5EY4 A;  3SQ4 A;  1V4S A;  5KGW A;  5CZ1 A;  2HST A;  1S9G A;  5C12 A;  4AF1 A;  4B1V A;  3U4L A;  5C0Y A;  4AM6 A;  5AQN A;  3L2U A;  3HK2 A;  1YT3 A;  3PX4 A;  4Q0B A;  3P5J A;  4OGC A;  3DXM B;  5M1K A;  4JKE A;  3CCR N;  4ICL A;  2EWS A;  3I8D A;  4AHS A;  1NMD A;  3ZT3 A;  3V4I A;  3THW A;  3O8M A;  4NXM K;  1GLC G;  4DFP A;  1SKR A;  4KH4 A;  2O8E B;  3D2F A;  3ZYY X;  2ZM6 K;  2D0P A;  1EET A;  1RGI A;  5AQK A;  4BY9 C;  3VEX A;  2IGI A;  4FWS A;  1HNW K;  4PA1 A;  4JKC A;  3WNE A;  4GV3 A;  3LP3 A;  3ALY A;  4DV4 K;  2P9K A;  3BF3 A;  3WXM B;  1RTI A;  4DV1 K;  1VQP N;  4CEZ A;  2NZT A;  4DWI A;  5DM6 L;  4FLX A;  4LSL A;  1VSM A;  1TUU A;  1VRT A;  4H5V A;  5J2P A;  3EZ5 A;  4CJS A;  4DQI A;  4I9L A;  2P5G A;  3ULE B;  3C65 A;  3HRG A;  5KRT A;  4L8R B;  3FLC O;  4ILG B;  4BE0 A;  1IBK K;  4KHN A;  4Y1C A;  3F9M A;  4CJW A;  2CGK A;  1N33 K;  1RT5 A;  4E7I A;  4B9M A;  3RR8 A;  1TKZ A;  3O9U A;  1NK4 A;  3MEG A;  5E84 A;  5LJV A;  3VOV A;  3ZT4 A;  1OVQ A;  1VQK N;  1UWB A;  1UAX A;  4LF5 K;  3R6M A;  3CER A;  4DTN A;  4KRF A;  3EZW A;  2O8C A;  3A5N C;  4FWR A;  4EHU A;  3OYM A;  5BR9 A;  4HUE A;  1BO5 O;  4JKG B;  3O9Q A;  3LL3 A;  3SAH A;  4A5A A;  4JI8 K;  3ZSQ A;  1JLC A;  4HCC A;  3F5T A;  3LWL A;  2JWK A;  2P9U B;  1Z6R A;  3T1H K;  3JXU A;  3KWG A;  3H1Q A;  3UE5 A;  4RW8 A;  4JI5 K;  4CED A;  3FZM A;  5LMN K;  4JKF A;  1BCO A;  3ZX3 A;  4CI6 A;  4GMJ B;  3LDL A;  1T7P A;  1IH7 A;  3I0R A;  3DAW A;  1LOT B;  4MQ3 A;  3F2K A;  5BRD A;  2YKM A;  1H1V A;  3DWL A;  3QML A;  2ZJP L;  1RBS A;  3MN6 A;  3NE6 A;  3ZSW A;  3GOI A;  3MWP A;  3CG7 A;  1HKG A;  1NNE A;  2O8D A;  4KPY A;  4BC4 A;  1L3U A;  2Q31 A;  4FZY A;  3RMD A;  4KTW A;  2QWR A;  4FJ8 A;  3AVN A;  3PV8 A;  4CJP A;  1BQN A;  1TVR A;  1Y64 A;  3HBT A;  3JYT A;  4CZL A;  3K2P A;  3T19 A;  2DPN A;  3HST B;  3ZSO A;  1IJJ A;  4DTP A;  4GV9 A;  2CGL A;  1RTH A;  4EP4 A;  3L2Q A;  4O8U A;  4IBN A;  4JKH A;  4HUG A;  4WQ4 C;  2FSJ A;  3QBX A;  3AV9 A;  3O5B A;  3O08 A;  4ILH A;  1CZA N;  3CJ1 A;  3D7E O;  1CZ9 A;  2V51 B;  2DFF A;  2P51 A;  1BI4 A;  3OYD A;  1NBW A;  2D1K A;  3ISN C;  3THX B;  3OHR A;  2E5L K;  3LDO A;  4A2A A;  2WFB A;  4FZZ A;  4OLA A;  3N4P A;  1NGC A;  3SZ2 A;  4I2Q A;  1KVC A;  3KKR A;  3P38 A;  4FSV A;  3MWT A;  2GUI A;  4X65 K;  3QNO A;  3SUN A;  1X9S A;  1WOQ A;  5KRS A;  3KLE A;  3C6U A;  5C25 A;  4U7B A;  4HVJ A;  3SMS A;  5GIP A;  1VSJ A;  3HXM A;  1GLF O;  1U6Z A;  2PAV A;  4LD0 A;  1YTA A;  4BG8 A;  2ZWH A;  5AQJ A;  4IOA L;  3L2R A;  3TAG A;  4FCY A;  3CD6 N;  3QET A;  2YJF A;  3O4N A;  1MU2 A;  2GTD A;  1IO2 A;  1YAG A;  3O4W A;  2PZS A;  4FK0 A;  3WNH A;  4JN4 A;  3SJH A;  3O80 A;  3CFP A;  3CYM A;  1FW6 A;  3S9H A;  4HTL A;  3TAF A;  1KLN A;  3NVM A;  3KIO A;  2QWO A;  1KFS A;  4MDA A;  3EE8 A;  1S6P A;  2VG5 A;  3VQ5 A;  3VQ4 A;  5KPZ A;  4FK4 A;  2VYP A;  4OGE A;  4DR1 K;  2YHW A;  3I33 A;  4B1U B;  4IO9 L;  4CVN E;  4NYN A;  3WNG A;  4E3S A;  1VSL A;  3C6T A;  3E66 A;  4OPJ A;  1XQS C;  2Z1J A;  3O9T A;  3WXL A;  3QFU A;  4FWQ A;  2A3Z A;  1IKW A;  1BWF O;  4DR4 K;  4FWM A;  1RNH A;  3BP8 A;  4Y0W A;  4JI4 K;  4QAG A;  3HO1 A;  3K5O A;  3SNN A;  2Q3S A;  2A42 A;  2NRT A;  3LAL A;  5JLF A;  1KTQ A;  1DKG D;  4AM7 A;  2Q1N A;  4M63 C;  1OKJ A;  1HJR A;  4FM2 A;  4CEC A;  1WNS A;  3DXK B;  3K5M A;  3OW2 M;  3ULD A;  4ELU A;  2IVP A;  1T6D A;  4CIF A;  1ZYQ A;  2P9N A;  4PKG A;  4K0K K;  1D4X A;  4KHP K;  2Z1G A;  1VQM N;  2KQ2 A;  2FF6 A;  1HNZ K;  3MN7 A;  5MLC Q;  1I94 K;  4AHV A;  3OA9 A;  3NVK A;  2O8F B;  4DSJ A;  4GKK K;  3MMV A;  4CZF A;  1BIZ A;  3QB0 A;  3AO4 A;  4G9Z A;  4WF9 L;  4WFB L;  1VQ5 N;  4BVO A;  3KJV A;  3MDQ A;  1BIU A;  2E20 A;  4A62 A;  1SKS A;  4FJG A;  3CJA A;  1Q8I A;  1X3N A;  4A5B A;  3FR0 A;  4WQ5 C;  4BRL A;  4JHD B;  4B1W B;  1GLE G;  2OTJ N;  1O1W A;  4K8Z A;  1QSY A;  1YVN A;  1ZXO A;  1TKT A;  5DMR A;  3MXM A;  1R0A A;  4H5N A;  2WUS A;  1XNQ K;  4BRI A;  5KQ8 A;  2G8F A;  3VF4 A;  3QIC A;  4PY5 A;  4GV6 A;  2PY5 A;  3LDQ A;  2O8B A;  4LH5 A;  4E7K A;  4BWJ A;  2YNG A;  4FJ5 A;  4ISE A;  1HR0 K;  4FVU A;  4TSX A;  1ZBU A;  4BRP A;  4BR4 A;  3WEE A;  2QI2 A;  3LP1 A;  4O0J A;  4PKI A;  3FGU A;  3AO1 A;  3PLA A;  1QSL A;  4BRD A;  2DY4 A;  3TAQ A;  3BDP A;  1K9M O;  4B9V A;  2AP1 A;  4M3U A;  2YNH A;  1GLJ O;  1C6V A;  1T44 A;  1K8K A;  1FXX A;  4CZE A;  3RSE B;  1S3X A;  4H0X B;  4KFB A;  5JIC A;  1VSD A;  4NLB A;  4FO0 A;  4DLE A;  4BR0 A;  1Z26 A;  4OVL A;  1V4T A;  2HVH A;  1NGJ A;  2NNW A;  3TAN A;  4DTS A;  3W3D A;  4KHQ A;  2OPQ A;  4CHZ A;  1LW2 A;  3LWM A;  4FJ9 A;  1W97 L;  4IXC A;  5HP1 A;  3G0Z A;  2UU9 K;  3SAG A;  3Q7B A;  4JEP A;  3KLF A;  4BC2 A;  4KAZ A;  4BAC A;  2FC0 A;  4CGD A;  2AA4 A;  4DV6 K;  1DTT A;  1RBR A;  4W5N A;  3VQ8 A;  2Z1I A;  4DUY K;  5M1P A;  1RDW X;  1NOY A;  2H3G X;  2QKK A;  1KVB A;  4DTM A;  3OS1 A;  5CYM A;  1Y97 A;  4YOT A;  5BPL A;  2BGG A;  2F8T A;  4I6M A;  4H0P A;  2JLE A;  4IFY A;  1X9M A;  3B6P A;  3ZEU A;  1S6Q A;  3VTH A;  2XY7 A;  2HHX A;  2IVO A;  1FKO A;  1VQN N;  5EU7 A;  4FYD A;  3LZJ A;  2PFU A;  3V81 A;  1NGD A;  2P9L A;  3ATU A;  3RRH A;  3C7N B;  3VQE A;  4CEF A;  4ILJ A;  3LZI A;  3IS9 A;  4CF0 A;  1SUQ A;  4H5W A;  1N8R O;  1ZBH A;  2YHA A;  3U3G A;  1J5O A;  4RW9 A;  1DTQ A;  3L2W A;  4BRM A;  4CD1 A;  4DV5 K;  1VQ4 N;  4CJ5 A;  3KD1 E;  5AQV A;  2Q97 A;  2DFE A;  4FPA A;  3HVR A;  3VQ7 A;  1C1B A;  5AZI B;  1Z25 A;  2RPI A;  5C24 A;  4BR7 A;  1HNI A;  3VF6 A;  4F4K A;  1E3M A;  4JK8 A;  1VQ6 N;  4CJV A;  4DU1 A;  3DOK A;  5KPT A;  2YKN A;  3VGL A;  3VES A;  4JV5 K;  2Q2R A;  4CJ3 A;  2NRH A;  3AVM A;  3G25 A;  3CM5 A;  3QIO A;  1XMO K;  2XRI A;  1NKB A;  3O1W A;  4FOE A;  3CFO A;  5M1N A;  3E9L A;  4GVE A;  1TGO A;  3L3V A;  4YOW A;  4CCH A;  1JXE A;  3OYC A;  3SV4 A;  1CZB A;  1M1K O;  4CGJ A;  2NRR A;  4B1X B;  3J80 O;  4B3T K;  1N6Q A;  4DR5 K;  3BZC A;  3KLG A;  4WQ4 A;  1RT4 A;  4UY8 O;  4JYA K;  1NOZ A;  4M7X A;  3QER A;  4EZ9 A;  1ATS A;  4FW1 A;  4IEI A;  3NH1 A;  5EVZ A;  3D45 A;  4NB4 A;  3OBY A;  4C8L A;  4CER A;  3R9P A;  4JRQ A;  4RW6 A;  1NJI O;  5DK5 A;  1QQC A;  2ITG A;  3FZF A;  1HRH A;  3VQ9 A;  1WSE A;  3AAR A;  5AQX A;  3VMF B;  3AAQ A;  2CGJ A;  2F9W A;  3THV A;  3R3L A;  3NF8 A;  3T1A A;  4ZHR A;  3V9Z A;  3VEO A;  4C1N I;  1KSP A;  4Z0U A;  4Z4H A;  4H03 B;  3H6E A;  5JMV A;  3U9Z A;  2ATQ A;  3QES A;  1SAZ A;  2E6M A;  2B5J A;  3THY B;  3ENH A;  1MWM A;  1Q86 O;  2X78 A;  1QTM A;  3SBT A;  4CEQ A;  4BRA A;  2FXU A;  2JGU A;  4CZH A;  3CQY A;  1JLF A;  3UB5 A;  4C8N A;  4O5B A;  5J2Q A;  1QVF M;  5CR4 A;  4NO7 A;  3OVN A;  2OAN A;  2YX6 A;  4B9U A;  5FPN A;  3LM2 A;  4DCH A;  3VEW A;  3ENB A;  1R59 O;  1RT7 A;  1ESV A;  1TKX A;  4LFC K;  2DTU A;  3L4Q A;  3CJ9 A;  4E1M A;  3L6Q A;  4JI0 K;  4LF6 K;  3BZK A;  5CY4 A;  1EWR A;  2ASM A;  4QS9 A;  5HL7 L;  3TSQ A;  3S3O A;  3FZL A;  2CH6 A;  1YJW N;  4LF8 K;  2YI1 A;  4O44 A;  3SJJ A;  4CW7 B;  2E2Q A;  4JLH A;  1QE1 A;  3MED A;  3K59 A;  1MDU B;  2W6K A;  3GBT A;  1YJ9 N;  1YTU A;  2QWN A;  2ZQB A;  3OYL A;  2I7P A;  4IDH A;  1LWC A;  1TV6 A;  4FM1 A;  1LAV A;  4LY7 A;  1NM1 A;  1N34 K;  1L3S A;  2WON A;  4Z4G A;  3P31 A;  1GOB A;  4CEO A;  3DRS A;  1MA9 B;  1Q9Y A;  3TPQ A;  3BGR A;  3OYG A;  1SZ2 A;  3GG4 A;  4IKF A;  1QQN A;  2BE2 A;  3KK2 A;  3KLI A;  5EX5 A;  1S72 N;  3DOL A;  3SQ1 A;  5LL6 Z;  2YNF A;  2BTF A;  4BWM A;  4OPK A;  1GOC A;  4J2E A;  3D2E B;  3O3F A;  2P9I B;  4CJ4 A;  1T05 A;  2KKZ A;  4CD3 A;  5KGX A;  4UQG A;  2X6N A;  4ZTJ A;  4DSI A;  4CFA A;  2YJE A;  3VEY A;  3HYF A;  3UKU B;  2QXL A;  4AH9 A;  3NDK A;  1Q7Y O;  1JLA A;  1LCU A;  1ASW A;  4DS5 A;  1JL2 A;  2HHU A;  1DT9 A;  1HKB A;  4CGG A;  3ZSY A;  5EXW A;  4JS5 A;  4FLU A;  4M7Y A;  3DLK A;  3TTD A;  5M1O A;  3ID8 A;  3MXI A;  1LWE A;  4FJH A;  4JKD A;  4BRC A;  4DR2 K;  2HVI A;  4KI6 A;  4IJN A;  4IOX A;  4WQ5 A;  4BDP A;  4CE9 A;  1S22 A;  2Q36 A;  5H1S Q;  1VHX A;  5AQF A;  3AVC A;  5AQU A;  3MCP A;  3TU5 A;  1IBL K;  4JD2 B;  3HZ6 A;  3MN9 A;  1BCM A;  1XUP O;  2YV0 X;  1K73 O;  2GWK A;  2HBK A;  1WN7 A;  2Q0U A;  4AHU A;  3U3Y A;  4QOZ B;  3EO3 A;  4A61 A;  1NGB A;  5AFU A;  2IS3 A;  4N5S A;  2O8C B;  4CHO A;  1LWF A;  1NK7 A;  2A1S A;  3L2V A;  4EFH A;  1FJG K;  4KHY A;  3M1F A;  4FWO A;  4HWI A;  1NG9 A;  1G99 A;  2HF4 A;  4OJR A;  2B6A A;  5AJ3 K;  4CHP A;  3IFR A;  3IRX A;  4IWV A;  3SBG A;  1KCF A;  1ZC6 A;  4CBU A;  3V9W A;  1DGK N;  3V9X A;  2X74 A;  4PL8 A;  1A5V A;  4DFM A;  3AVI A;  3ZX2 A;  5FRM A;  4C8M A;  1KRP A;  4ISF A;  4A59 A;  3VET A;  1W9H A;  3UIQ A;  4CEE A;  3AVH A;  4H0V B;  3DLR A;  3OTO K;  5CHI A;  4PWD A;  3KKS A;  1U04 A;  5D3G A;  4OX9 K;  1G15 A;  3NHG A;  4CJ7 A;  4BRO A;  1TK5 A;  1QZ6 A;  1EWQ A;  2O8D B;  5IWA K;  5KPR A;  1IKX A;  3CQX A;  3E9O A;  3C94 A;  2AJQ A;  1VSK A;  4AHR A;  4DQR A;  3SUP A;  5TKY A;  2HB5 A;  4KTZ A;  1XWL A;  3RR7 A;  3D6R A;  4IJA A;  2D0C A;  1ZBI A;  1BG3 A;  1LV5 A;  4BQL A;  4B08 A;  4DHY A;  5KTQ A;  3CCL N;  4JRP A;  4CBX A;  3S3N A;  3CC2 N;  2XO7 A;  5E26 A;  3P39 A;  4OLB A;  3HT3 A;  3CQ8 A;  3PO4 A;  1KAX A;  4MFB A;  4KHS A;  3S3M A;  5FRO A;  4CFD A;  1HYZ A;  5AQG A;  1HNV A;  3LAM A;  4DMN A;  3FFK B;  3BY5 A;  1TUY A;  4NCG A;  4OO1 J;  5JLH A;  4W5O A;  2E8A A;  2OPP A;  1TYQ A;  5JS2 A;  4O8K A;  4CF9 A;  4YY3 K;  4GKJ K;  5BR8 K;  1P90 A;  4CJU A;  3MEE A;  1BUP A;  1X3M A;  3T1Y K;  2KFN A;  3EKU A;  1KXP A;  4M3R A;  2ASP A;  1Z05 A;  3L3U A;  5GAH P;  1N5Y A;  3ZSX A;  2KW4 A;  4OKE A;  3HP6 A;  3UKR B;  4H5R A;  2E2P A;  2A6A A;  1EO1 A;  1IG8 A;  5J2N A;  4DTJ A;  3SQ0 A;  3I56 N;  2QWL A;  3EKS A;  1JL1 A;  4JI2 K;  4B8A B;  4E7H A;  1HUX A;  3DXK A;  4M45 A;  2ZGY A;  4CF2 A;  4DFK A;  1VSI A;  3NF6 A;  4KH5 A;  3AY9 A;  2FBV A;  1RDC A;  4CJQ A;  1RIL A;  1EQY A;  3RMC A;  4KO0 A;  5E41 A;  1VAZ A;  4FLW A;  1NK9 A;  4Z4I A;  3ZT2 A;  4ELT A;  3FFI A;  4MLH A;  1IKV A;  2FSK A;  4HUF A;  4BR9 A;  5BRE A;  3LDP A;  1KQS M;  3AGK A;  3CME N;  4GNI A;  4CGI A;  4X66 K;  2P9S B;  1HQU A;  3ZET B;  4LC9 B;  2LSN A;  2ETJ A;  4DQQ A;  3QIP A;  1RBU A;  4K43 A;  3OYF A;  4DSL A;  5C10 A;  3HPH A;  4WYB A;  3GL1 A;  5HLF A;  1BL3 A;  4JAX A;  3OYH A;  1ASV A;  3ITH A;  2ZJR L;  1SKW A;  4I7F A;  5J2M A;  1WSG A;  5BN9 A;  3AO2 A;  4B9N A;  3M5R A;  2IAJ A;  4K25 A;  4CGF A;  3CC4 N;  2QA4 N;  4DV2 K;  2RE2 A;  3NCI A;  5FRN A;  5AZJ B;  2E2N A;  4O4G A;  3VQA A;  3VPZ A;  2HHS A;  1BOT O;  3R8E A;  1XHX A;  1NK8 A;  3DRP A;  4N56 A;  3WQT A;  3CPW M;  5C15 A;  3HTV A;  4BRQ A;  2P9P B;  5HRN A;  4ID1 A;  4RCH A;  3HPG A;  4BG9 A;  3ZSZ A;  4N76 A;  3VTI A;  2P9N B;  3A5O C;  2G8V A;  5C42 A;  3V9S A;  3OYE A;  1T3V A;  3TAB A;  2EX3 A;  3PIO L;  2KZZ A;  1SV5 A;  1S9E A;  4CF8 A;  3PSF A;  5AQP A;  1HQE A;  4KHU A;  5TKW A;  3OS2 A;  3H45 C;  4DU4 A;  1VQ7 N;  2RHK A;  3HSC A;  1NJY A;  1E4G T;  5I9E B;  3MK6 A;  4M41 A;  3QDK A;  4ELV A;  2HHQ A;  1RBT A;  1IG9 A;  3V6D A;  4CHY A;  4CK3 A;  5K14 A;  3I8B A;  4I9Q A;  1NLV A;  3O9R A;  3OY9 A;  3DMJ A;  1Q18 A;  3IDH A;  1M90 O;  4B9T A;  4EZ6 A;  3QO9 A;  3NF9 A;  1TAQ A;  4PL7 A;  1BA1 A;  3J81 O;  3HOT A;  1T03 A;  4AIL C;  3P4I A;  1RT6 A;  3LPU A;  3OYB A;  4BE1 A;  3J8A A;  3BUZ B;  2O8B B;  4AQY K;  3H08 A;  3KVG A;  2A41 A;  2QEX N;  1KFD A;  2J4R A;  2UUC K;  1QHT A;  3CHW A;  1CLQ A;  3DLG A;  3RVC A;  5KQD A;  3L4I A;  4KB0 A;  2B4J A;  3KK3 A;  2VWJ A;  4DR6 K;  1VQ9 N;  4CFB A;  3OYA A;  2E2O A;  2YCH A;  4F9O A;  3NFA A;  4FJX A;  4DSF A;  1QQO A;  1YI2 N;  1IV0 A;  1TAU A;  1D9D A;  4A57 A;  3O9S A;  3RRG A;  3SLC A;  1KAZ A;  3EEQ A;  2R7Y A;  3C7N A;  1ZBF A;  2NRW A;  4H0T B;  1FKP A;  1TKD A;  4FWP A;  4CES A;  4BRE A;  3T69 A;  3G10 A;  1YHQ N;  4EHT A;  1VQ8 N;  4C8K A;  1NKE A;  2I5J A;  1S1W A;  5I3U A;  3PY8 A;  3KK7 A;  3WXK A;  3CJ7 A;  2IIR A;  2P5O A;  4RG8 A;  4BR5 A;  3IAY A;  4FOI A;  1I3A A;  2HHT A;  2HHW A;  2VWB A;  5AR0 A;  2BH1 A;  1RDU A;  3HPO A;  3OYN A;  5GIN A;  3SCX A;  2QWP A;  3CCV N;  2QK9 A;  3LM9 A;  3V1O A;  5CE3 A;  4NCB A;  3SPY A;  1JKH A;  3CMA N;  5AQZ A;  3R1X A;  5HRP A;  3KWI A;  3PO5 A;  1IBM K;  4F3T A;  2UYT A;  1ITG A;  1SL0 A;  1GLB G;  3KZB A;  4IFE A;  2QM1 A;  3CCQ N;  1EP4 A;  5AQW A;  2ZF5 O;  1QS4 A;  4CEA A;  2Q0R A;  4LH4 A;  4RW7 A;  1J5E K;  1QSS A;  3CI5 A;  1QZ5 A;  3TR8 A;  4B3O A;  1WSI A;  4DTX A;  5GAG P;  1C0M A;  3QEX A;  1MWK A;  4FJK A;  1JLB A;  2PYJ A;  3S41 A;  4B9Q A;  4YOX A;  4PQU A;  2E1Z A;  1N36 K;  4PHT X;  1ZBL A;  4YOY A;  2QW9 A;  3ZEU B;  4DQP A;  3G4S N;  4KHW A;  2KTQ A;  4PKH A;  2NRV A;  4FJL A;  5HRO A;  4PUO A;  1VSF A;  4F8R A;  4BGB A;  2G8K A;  2FF3 B;  5JS1 A;  1C0U A;  2NRX A;  2ITM A;  3J7A P;  3PX6 A;  3PIP L;  1RDA A;  2E1Y A;  4RW4 A;  5DM7 L;  1T8E A;  3TI0 A;  3MN5 A;  1HJO A;  4B3S K;  5J1E A;  3ZCM A;  2GBZ A;  4E7L A;  1JLE A;  4DQS A;  3F73 A;  3QLH A;  5HBM A;  4I2P A;  4OKJ A;  3KHY A;  1NGI A;  3LAN A;  3TTC A;  1WUA A;  5M1Q A;  2W42 A;  4BRF A;  3WQU A;  2G8W A;  1NGH A;  1C0G A;  4CZI A;  3AVL A;  2D4W A;  1SQK A;  3O3G A;  3VQP A;  1U2V B;  2ZGZ A;  4X62 K;  3V1R A;  4FWN A;  1GLL O;  4KBO A;  3THY A;  3TAE A;  1S1V A;  2OPR A;  4BRK A;  4LF7 K;  3H46 O;  1U47 A;  3SUQ A;  4EIA A;  3TAR A;  1NK0 A;  3K5L A;  2QWQ A;  3DXM A;  1WB9 A;  1HPZ A;  1OH6 A;  1B92 A;  4Z4E A;  2OYQ A;  5GAE P;  4KH6 A;  4HHT A;  3AA3 A;  3VA0 A;  3JAM O;  4Z4F A;  4FW2 A;  4M3W A;  3P1G A;  3V1Q A;  3AVB A; 
#chains in the Genus database with same CATH homology
 3O9T A;  5GAD P;  3WXL A;  4CBW A;  4WFA L;  1XUP O;  3QFU A;  3E1Y A;  3QBW A;  1K73 O;  4FWQ A;  4JK9 A;  1YXQ A;  2A3Z A;  1BWF O;  2GWK A;  4FWM A;  2HBK A;  2Q0U A;  2F9T A;  3BP8 A;  4Y0W A;  3CET A;  1K8K B;  3EO3 A;  4A61 A;  3J7Z O;  1NGB A;  5AFU A;  2A42 A;  2NRT A;  2HBL A;  3O6W A;  5JLF A;  3H3N O;  1DKG D;  5AZI A;  4AM7 A;  1JCG A;  2WBN A;  4CZJ A;  1NGE A;  2Q1N A;  3AAP A;  4M63 C;  5JVG L;  2QTD A;  1OKJ A;  3IUC A;  1QHA A;  2I7N A;  4EFH A;  3DXK B;  1YIJ N;  3AGR A;  4JKB A;  3M1F A;  4FWO A;  4HWI A;  5LY3 A;  1G99 A;  2HF4 A;  5FPD A;  3OW2 M;  1ILY A;  3IFR A;  4IWV A;  3SBG A;  3CCS N;  2IVP A;  5AQT A;  3C6A A;  1T6D A;  1ZC6 A;  4C23 A;  1QQM A;  4CBU A;  1DGK N;  3I55 N;  4PL8 A;  1QVG M;  2V7Y A;  4IZ9 A;  2P9N A;  4PKG A;  1ATN A;  3SMP A;  4U67 L;  1DEJ A;  3ZX2 A;  4YDU A;  3ULE A;  1D4X A;  3N4Q A;  3QFP A;  3H1V X;  4B1Z A;  1VQM N;  3TTF A;  2FF6 A;  4ISF A;  4BVP A;  5ADX A;  3MN7 A;  5MLC Q;  3OA9 A;  4A59 A;  3VET A;  3CPE A;  4DQ8 A;  3NVK A;  1KC8 O;  3A5M C;  5LJW A;  4H0V B;  2VGN A;  3MMV A;  4CZF A;  3QB0 A;  5CHI A;  1HX1 A;  1KAY A;  3WUH A;  4G9Z A;  4WF9 L;  2IVN A;  4WFB L;  2D0O A;  4YOV A;  5B8H A;  3C6H A;  3EE9 A;  1VQ5 N;  3D2E A;  4BVO A;  4CZM A;  3MDQ A;  2E20 A;  3Q7C A;  2P9I A;  3T7Z A;  4A62 A;  1QZ6 A;  4BRO A;  4CJ7 A;  3IMX A;  3G71 N;  5KPR A;  1K8A O;  3CCJ N;  1RFQ A;  5AFU H;  3ENO A;  3CJA A;  3DLL L;  1X3N A;  3CQX A;  4I6M B;  3E9O A;  4YOR A;  3FR0 A;  4XEI A;  4A5B A;  1SS6 A;  4WQ5 C;  1YJN N;  4BRL A;  4JHD B;  4BC5 A;  4B1W B;  1GLE G;  2HBM A;  5TKY A;  2OTJ N;  1YVN A;  1ZXO A;  3D6R A;  4IJA A;  3UKU A;  4H5N A;  2WUS A;  3OBW A;  1BG3 A;  4BRI A;  5KQ8 A;  2P9L B;  4BQL A;  4DHY A;  1U2V A;  3CCL N;  3CCU N;  3EL2 A;  3VF4 A;  1NWK A;  3QIC A;  4CBX A;  1YF5 L;  4WFN L;  5E26 A;  3CC2 N;  3P39 A;  4GV6 A;  3D2F B;  4BC3 A;  3LDQ A;  1HPM A;  4JKG A;  4XH4 A;  2W40 A;  4XH1 A;  4BRH A;  1KAX A;  1OVY A;  2NLX A;  2W41 A;  5BRF A;  1GLD G;  1T6C A;  3CCE N;  4ISE A;  4R79 A;  2P9U A;  4FVU A;  5ADX H;  4BRP A;  4FL9 A;  3EN9 A;  5AQG A;  3WEE A;  4BR4 A;  2P9K B;  2QI2 A;  3FFK B;  4PKI A;  5AQO A;  4JNE A;  1TUY A;  4OO1 J;  3MX5 A;  2VCP A;  1XC3 A;  2ASO A;  3MX2 A;  4MDB A;  5JLH A;  2E8A A;  3FGU A;  1TYQ A;  4O8K A;  3PLA A;  2A5X A;  4BRD A;  5AQH A;  1HKC A;  4BRN A;  1P8Z A;  3BEX A;  1P90 A;  4JD2 A;  3ZX0 A;  1KD1 O;  3NMU A;  4RTF D;  3B8A X;  1BUP A;  1X3M A;  5BN8 A;  5BRH A;  1K9M O;  2AP1 A;  2QWM A;  3EKU A;  1KXP A;  2ASP A;  3WXJ A;  4C1N K;  4MO4 A;  1GLJ O;  1Z05 A;  1T44 A;  5GAH P;  1VQL N;  2BUP A;  1ATR A;  3JS6 A;  1K8K A;  3HOS A;  1O13 A;  5AQL A;  4YDU C;  3CIP A;  4EAH D;  3WXI A;  2YHY A;  3UKR B;  4CZE A;  5BPN A;  4H5R A;  4YOU A;  2E2P A;  3RSE B;  2A6A A;  5AQR A;  1EO1 A;  1IG8 A;  3M6G A;  4H5T A;  1S3X A;  3HI0 A;  4H0X B;  5JIC A;  4NLB A;  4NLC A;  4FO0 A;  3I56 N;  2QWL A;  3EKS A;  4BR0 A;  3M3Z A;  1V4T A;  4DB3 A;  1NGJ A;  2NNW A;  3W0L A;  1HUX A;  3DXK A;  2ZGY A;  3W3D A;  3CC7 N;  3H3O B;  1W97 L;  4KH5 A;  4IXC A;  4A2B A;  3AY9 A;  5BPM A;  3SAG A;  2NRZ A;  3Q7B A;  1EQY A;  5EOY A;  4JEP A;  5F0X A;  2KHO A;  4H0O A;  1Q82 O;  1VAZ A;  1E4F T;  5FPE A;  2HBJ A;  4BC2 A;  4K42 A;  4L3Q A;  4BR2 A;  4OPA A;  3CF5 L;  2AA4 A;  4MLH A;  3U8X A;  2FSK A;  4DKW A;  2HOE A;  4BGA A;  4BR9 A;  5BRE A;  3LDP A;  4BQZ A;  3AGK A;  1KQS M;  3CME N;  4ISG A;  2JWL A;  5EY4 A;  1V4S A;  5ELZ A;  4GNI A;  5C2D A;  2HST A;  3DJC A;  5C12 A;  4AF1 A;  4B1V A;  3U4L A;  2P9S B;  1RDW X;  5M1P A;  3ZET B;  2F7T A;  3A5L C;  4LC9 B;  4AM6 A;  5C0Y A;  2CH5 A;  2H3G X;  2HF3 A;  5AQN A;  3ID6 A;  4CZG A;  4K43 A;  1JCE A;  4YOT A;  5C10 A;  5BPL A;  4WYB A;  3DXM B;  4I6M A;  3GL1 A;  4H0P A;  5M1K A;  4JKE A;  3ZEU A;  3CCR N;  4JAX A;  3VTH A;  2ZJR L;  2EWS A;  2IVO A;  3HM8 A;  1VQO N;  1VQN N;  5BN9 A;  5AQY A;  1NMD A;  3O8M A;  2PFU A;  1NGD A;  2P9L A;  3M5R A;  3ATU A;  4K25 A;  3C7N B;  1GLC G;  4ILJ A;  4KH4 A;  3D2F A;  2A40 A;  3CC4 N;  4FWL A;  3ZYY X;  2QA4 N;  4H5W A;  1N8R O;  2D0P A;  2RE2 A;  3VEN A;  1ZBS A;  1RGI A;  5AQK A;  4BRM A;  4CD1 A;  4BY9 C;  1VQ4 N;  5AZJ B;  2E2N A;  1YUW A;  3VEX A;  3VPZ A;  5AQV A;  4FWS A;  2Q97 A;  4FPA A;  1BOT O;  4JKC A;  5AZI B;  4GV3 A;  3R8E A;  4IO8 A;  4BR7 A;  2P9K A;  3BF3 A;  3WQT A;  3WXM B;  3VF6 A;  1VQP N;  3C0B A;  1C0F A;  3CPW M;  5C15 A;  4JK8 A;  2NZT A;  1VQ6 N;  3HTV A;  5F1X A;  4BRQ A;  5DM6 L;  2P9P B;  5KPT A;  3VGL A;  3VES A;  4RCH A;  1NGF A;  2Q2R A;  2NRH A;  4BG9 A;  4IEE A;  4BRG A;  1TUU A;  4H5V A;  3G25 A;  3VTI A;  2P9N B;  3A5O C;  3ULE B;  3C65 A;  3HRG A;  3L0Q A;  3O1W A;  1BA0 A;  3ATV A;  3O1B A;  4FOE A;  4O5F A;  3K9J A;  3UKR A;  3FLC O;  5M1N A;  1T3V A;  1BDG A;  4ILG B;  3PIO L;  3E9L A;  3VEV A;  4GVE A;  4Z94 A;  4YOW A;  3F9M A;  5AQP A;  5TKW A;  3H45 C;  2CGK A;  1VQ7 N;  2RHK A;  3HSC A;  1E4G T;  5I9E B;  3MK6 A;  3K9K A;  1M1K O;  2NRR A;  3QDK A;  4B1X B;  3O9U A;  4J8F A;  2OTL N;  3I8B A;  5E84 A;  5LJV A;  3VOV A;  1NLV A;  4WQ4 A;  4JK7 A;  4UY8 O;  1VQK N;  2YHX A;  3O9R A;  4M7X A;  3R6M A;  3CER A;  4CZK A;  1Q18 A;  2GX9 A;  3IDH A;  1ATS A;  4IEI A;  1M90 O;  4E1J A;  3EZW A;  5EVZ A;  3A5N C;  3G6E N;  4H0Y B;  4NB4 A;  4PL7 A;  1BA1 A;  4FWR A;  3HOT A;  4EHU A;  3OBY A;  3P4I A;  5BR9 A;  2ZJQ L;  3R9P A;  3J8A A;  2GEL A;  1BO5 O;  3BUZ B;  1NJI O;  3FZF A;  4JKG B;  2P9S A;  3O9Q A;  3ZET A;  3LL3 A;  3KVG A;  2A41 A;  2QEX N;  2J4R A;  3CHW A;  3AAR A;  3SAH A;  3TSP A;  3RVC A;  4A5A A;  5KQD A;  5AQX A;  3VMF B;  3L4I A;  3AAQ A;  2CGJ A;  3F5T A;  2JWK A;  2F9W A;  2P9U B;  1Z6R A;  3R3L A;  3JXU A;  1VQ9 N;  3VEO A;  3KWG A;  2E2O A;  3H1Q A;  2YCH A;  3UE5 A;  4C1N I;  4F9O A;  1GLA G;  3FZM A;  4JKF A;  1QQO A;  4H03 B;  3H6E A;  3ZX3 A;  4CI6 A;  5JMV A;  3TSU A;  3LDL A;  3U9Z A;  1YI2 N;  1TYQ B;  3GDQ A;  1SAZ A;  4A57 A;  3O9S A;  3VEZ A;  3CJC A;  3DAW A;  3SLC A;  1KAZ A;  1LOT B;  3F2K A;  3ENH A;  3C7N A;  4GY2 B;  1MWM A;  5BRD A;  2NRW A;  4H0T B;  1H1V A;  3DWL A;  3QML A;  2ZJP L;  3SBT A;  1Q86 O;  4BRA A;  2FXU A;  3MN6 A;  4FWP A;  3GOI A;  3MWP A;  4CZH A;  1HKG A;  3CQY A;  4BRE A;  5AQI A;  4FWK A;  3T69 A;  3UB5 A;  1YHQ N;  3MN9 A;  4BC4 A;  4EHT A;  1VQ8 N;  5AZJ A;  5AQQ A;  1QVF M;  2Q31 A;  5CR4 A;  3U9D A;  4NO7 A;  3KK7 A;  3WXK A;  3CJ7 A;  2IIR A;  2OAN A;  2V7Z A;  2YX6 A;  4JHD A;  4FOI A;  3VF2 A;  4BR5 A;  5FPN A;  3LM2 A;  3SK3 A;  2QWR A;  2VWB A;  5AR0 A;  2BH1 A;  1RDU A;  2FLO A;  4DCH A;  3VEW A;  3ENB A;  3VGK A;  1Y64 A;  3HBT A;  1R59 O;  1ESV A;  4CZL A;  5GIN A;  2DPN A;  3L4Q A;  2QWP A;  3CCV N;  2P9P A;  3CJ9 A;  3LM9 A;  3E9P A;  3FZH A;  1Q81 O;  1IJJ A;  5CE3 A;  4GV9 A;  2CGL A;  2PBD A;  3L6Q A;  3CMA N;  4JKA A;  5AQZ A;  2GWJ A;  3R1X A;  2ASM A;  4QS9 A;  5HL7 L;  4O8U A;  3TSQ A;  4JKH A;  3FZL A;  3KWI A;  1W2B M;  4QS7 A;  4WQ4 C;  2UYT A;  1GLB G;  2CH6 A;  3KZB A;  4IFE A;  1YJW N;  2QM1 A;  2FSJ A;  2YI1 A;  3BF1 A;  5AQW A;  2ZF5 O;  3QBX A;  3VGM A;  4B1Y B;  3CCQ N;  3O5B A;  3O08 A;  4ILH A;  2E2Q A;  2Q0R A;  1CZA N;  1MDU B;  3CJ1 A;  3MCA B;  3GBT A;  3CI5 A;  4IOC L;  1QZ5 A;  1YJ9 N;  2GUP A;  2QWN A;  3CXC M;  5GAG P;  3D7E O;  2I7P A;  4IDH A;  2V51 B;  1MWK A;  1NBW A;  1NM1 A;  4RWT A;  2D1K A;  3S41 A;  4B9Q A;  4YOX A;  4MO5 A;  1JCF A;  3A8Y A;  3OHR A;  3LDO A;  3P31 A;  5FPM A;  4A2A A;  2WFB A;  5HOO A;  2E1Z A;  1MA9 B;  3TPQ A;  5C2F A;  5AQM A;  4PHT X;  3N4P A;  4YOY A;  2QW9 A;  1NGC A;  2KLA A;  3ZEU B;  1SZ2 A;  3G4S N;  3GG4 A;  3P38 A;  4FPB A;  1QQN A;  3MWT A;  4FSV A;  4PKH A;  2HMP A;  2NRV A;  3VER A;  1WOQ A;  3RSE A;  4BGB A;  1HLU A;  5EX5 A;  1S72 N;  3WT0 A;  2FF3 B;  4U7B A;  3LDN A;  2GEM A;  4K41 A;  2NRX A;  2FSN A;  2V52 B;  3SMS A;  5GIP A;  2ITM A;  2BTF A;  3FZK A;  5F2R A;  1GLF O;  3PIP L;  1U6Z A;  2PAV A;  2E1Y A;  3D2E B;  3GE1 A;  4XH5 A;  5DM7 L;  2P9I B;  1HJO A;  3MN5 A;  1NGG A;  3A0I X;  4BG8 A;  2KKZ A;  2ZWH A;  5AQJ A;  4CD3 A;  4IOA L;  2E88 A;  3KHY A;  4QS8 A;  1NGI A;  3TTC A;  2YJE A;  1WUA A;  5M1Q A;  3VEY A;  3CD6 N;  5JVH L;  4BRF A;  3WQU A;  2YJF A;  1NGA A;  4OPH A;  1NGH A;  1C0G A;  3UKU B;  2GTD A;  4CZI A;  2QXL A;  1BU6 O;  1YAG A;  4MLE A;  1Q7Y O;  3O4W A;  1YIT N;  2D4W A;  1SQK A;  1U2V B;  2ZGZ A;  4JN4 A;  1LCU A;  3O80 A;  3SJH A;  3CCM N;  1DT9 A;  1HKB A;  4FWN A;  1GLL O;  2VGM A;  4HTL A;  4KBO A;  5EXW A;  3IKM A;  4M7Y A;  3CJB A;  3TTD A;  4BRK A;  5M1O A;  3ID8 A;  3NVM A;  5GIO A;  2QWO A;  4MDA A;  3EE8 A;  2WC9 A;  3H46 O;  4JKD A;  4BRC A;  3SAF A;  4EIA A;  4WCE L;  5KPZ A;  1JJ2 M;  2QWQ A;  4IJN A;  4IOX A;  1J6Z A;  3DXM A;  4WQ5 A;  5AQS A;  2VYP A;  3WEE B;  5M1F A;  2YHW A;  3I33 A;  1X9J A;  3FE1 A;  4B1U B;  5GAE P;  1S22 A;  2Q36 A;  5H1S Q;  4KH6 A;  4IO9 L;  5AQF A;  5AQU A;  3E66 A;  3MCP A;  1XQS C;  3TU5 A;  4JD2 B;  3HZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...