4MDBA

Structure of mos1 transposase catalytic domain and raltegravir with mg
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
224
structure length
201
Chain Sequence
HELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFVNGKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mariner Mos1 transposase
publication title Structural Basis of Mos1 Transposase Inhibition by the Anti-retroviral Drug Raltegravir.
pubmed doi rcsb
source organism Drosophila mauritiana
molecule tags Hydrolase/hydrolase inhibitor
total genus 72
structure length 201
sequence length 224
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01359 Transposase_1 Transposase (partial DDE domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4mdbA00
5HOOA 3K9KA 2F7TA 3F2KA 3K9JA 3HOSA 4R79A 3HOTA 4MDAA 4U7BA 4MDBA 5CR4A
chains in the Genus database with same CATH superfamily
1K8KA 3ZETA 1NJYA 4CJVA 1HKBA 1ZXOA 3I0RA 4NLBA 1BA1A 4F2SA 4DV5K 1EO1A 4NO7A 1IKWA 1JXEA 2F9TA 4BG9A 2WOMA 1G99A 4RW4A 3QIOA 1X9WA 2QWRA 3H3NO 4ICLA 1JCFA 1UAXA 3EKUA 2Q3SA 4E7HA 5FROA 4W5OA 4EIAA 4CERA 1RFQA 3VQ7A 2A42A 1KAYA 2ZGYA 3UIQA 4JD2B 3PX6A 3ZSZA 2YX6A 4DV2K 3KK7A 4PUOA 4BRAA 3RMDA 5AQVA 1NGIA 1IBMK 3SPZA 3AVNA 3VF6A 4OVLA 4M3UA 1H1VA 1D9DA 1S1WA 4E7IA 1VQ9N 2KHOA 5AZJB 3S3MA 4RW7A 4JN4A 1YJ9N 4ID1A 1HJOA 3WXKA 4CEZA 4E1MA 1IBLK 3SAGA 2HVIA 3KVGA 5GAGP 2NRVA 1D8YA 4CHQA 5C25A 5BRFA 4FSVA 4NYFA 1UWBA 4A2AA 3VMFB 3JXUA 2VWJA 1BOTO 3ZT1A 4CGGA 2V7ZA 5BREA 1N32K 3O5BA 4DFJA 3CMEN 4A61A 3AVLA 1VSFA 4MQ3A 1RBUA 3DOLA 1TK5A 4KO0A 3PV8A 2HBJA 2I5JA 2V51B 1BWFO 1FKOA 2FBVA 1G15A 4I6MA 3J7AP 1WBBA 5BRDA 3NFAA 3TTDA 4CGDA 2NLXA 3E9LA 3C7NA 2E4LA 2I7NA 1K8KB 4L8RB 5AQRA 3NVKA 3NF9A 2Q0RA 4N76A 4CHPA 2FC0A 4O5BA 3TTFA 3VTHA 2Y1JA 4DSLA 3CHWA 5JVHL 3CCVN 4DV4K 4GKKK 1C0UA 3IKMA 3CCJN 5CZ2A 3V1RA 2HHQA 3VA3A 1L5UA 1IG9A 4DFKA 5C12A 4WF9L 1ATRA 3TAMA 4FK0A 2EWSA 3FR0A 3L2VA 4IOXA 1KD1O 1RT1A 4O8KA 2QKKA 5MLCQ 1QQNA 4F3OA 3SQ0A 3KKRA 5M1FA 3PX4A 4WQ5A 4KB1A 2A6AA 3DMJA 4KI4A 3OY9A 1SL2A 1TYQB 2X78A 3RSEA 1O1WA 4BC4A 3THWA 3O9TA 4BR2A 2HF3A 4RG8A 2UXCK 1IKVA 4CD1A 4BRKA 1SV5A 5ADXH 4DG1A 4OPKA 4WE1A 3IDHA 3WUHA 3QEIA 1VSKA 3A2FA 4IEIA 4DFPA 3J7ZO 1RTDA 1U49A 3ENOA 2DFEA 3A5MC 2E2PA 4DR4K 1OH5A 4DU1A 4PQUA 3LDSA 2FSKA 5AQUA 1LAVA 5FDLA 4OGCA 4FWRA 4F2RA 1W2BM 4IJNA 2CH6A 3SPYA 2NRWA 3NE6A 3CG7A 1HJRA 4KH4A 1NU0A 4B3SK 1LWFA 3OYDA 3NGIA 5FRMA 4CJLA 3AO2A 2HW3A 2RKIA 4LF4K 4YORA 3PIOL 4Z4GA 1VQ7N 4I6MB 2LSNA 3WNHA 1SL0A 1YJNN 4DU3A 3H3OB 1YUWA 1SZ2A 5EXWA 4CI6A 1NK0A 4PKIA 2Q0UA 4IFEA 1N8RO 5AQQA 4CESA 2D0PA 4K25A 4O5FA 1UA0A 3RR8A 4FK4A 1HX1A 3TTCA 4LF8K 5GIPA 4DUYK 4M7XA 4J2BA 4IO8A 4BR5A 4FJXA 2IC3A 4H0XB 4FW2A 1RGIA 5BN9A 3DYAA 1NG9A 1NGCA 3OYLA 4KHYA 2V52B 1HLUA 4H0VB 2OZMA 3CCQN 2IGIA 4DV1K 4JKGB 4B9TA 4CZEA 4B9VA 5JLHA 1HNIA 4B3RK 1BIUA 5GIOA 3KLEA 1RTIA 1IO2A 3ZSVA 1WSIA 1K73O 3HZ6A 1VRTA 5AQLA 1R59O 4BRLA 1JKHA 3HK2A 4HCCA 1ATSA 1BQNA 3AA5X 2NUBA 4A59A 3THVA 2NNWA 4DQ8A 4FOEA 4JV5K 5GADP 3VA0A 1RT6A 2ZQBA 4KBOA 2H3GX 1BCOA 4YOVA 2GEMA 1KXPA 5CE3A 4JI6K 1RT5A 4C8KA 1A5XA 3CJ1A 4DCHA 4FWPA 1HYVA 2KKZA 3F9MA 4KTZA 3VQCA 3DAWA 3EL2A 3SMPA 3OJUA 2P5OA 1SKRA 3U8XA 4HUGA 2A1SA 5JLFA 3IMXA 3KD1E 4IOAL 1BHLA 2Z1HA 1T03A 3O6WA 1D5AA 4KREA 2ZM6K 3VQ9A 1BI4A 3OA9A 3CFPA 4FCYA 4BY9C 2X6SA 3DRPA 1EXQA 3SJHA 1RT3A 1WAJA 3AAQA 1VSMA 3G0ZA 4FWOA 3CCUN 4O55A 4BDPA 1T6DA 3LP3A 4E1NA 3L3UA 1NNEA 3CPWM 4BWJA 2Z1JA 2A5XA 3L2UA 2Z1IA 4BC2A 2WC9A 3O80A 5DMRA 3WNFA 1U47A 1KFDA 3F5TA 4U7BA 2E6MA 3LWLA 3LP1A 3D2EA 3MWTA 4FLTA 2JGUA 1WSEA 3N4QA 2P9KA 3B8AX 4HVJA 3M8SA 2HBKA 4PL7A 1KSPA 3H6EA 3HL8A 4CJKA 1ASWA 5JS1A 3RMAA 3IUCA 1XI1A 3E9OA 3QDKA 3ID8A 1LW2A 4YDUC 2D1KA 1CZBA 3AVCA 4KPYA 3I8BA 2W40A 4CEFA 4AM6A 4JS5A 3RMBA 2ZWHA 3C94A 1NK9A 3T1AA 1OH6A 1FXXA 4B3MK 4GNIA 1TKZA 4DV6K 2FF3B 3M6GA 1NGJA 3KK3A 2AA4A 3KZBA 4FLWA 1E4GT 2CH5A 2E88A 1V4TA 4Y0WA 3S3OA 4DTPA 1OKJA 4JKDA 1KLNA 4QCLA 1DKGD 5AQYA 4RW8A 4LSLA 3CCEN 3T7ZA 5CY4A 5AQPA 3VENA 1C0GA 2ATQA 3CJ7A 2IS3A 5TKWA 4CD3A 2YJFA 4JI5K 1J5OA 5AQHA 3H08A 4KHUA 2B5JA 1S22A 3WQTA 4CJ4A 3O1WA 2QTDA 1YT3A 1D4XA 1KC8O 4F4KA 3BGRA 4BRDA 3M5RA 3NF8A 1KTQA 1C6VA 1Q18A 5TKYA 5BPLA 3IS9A 3NVMA 2ASMA 3AVIA 2HHSA 1KAXA 1QSYA 2AJQA 4J2DA 4ILHA 4LD0A 3AO3A 5KQ8A 1NKBA 3F9KA 2VG5A 3QERA 3C6TA 2ASPA 2YKNA 5EY4A 3CYMA 2P9IB 5KGXA 5M1NA 1HNXK 2KZMA 1A5VA 1BGXT 2CGJA 2KW4A 1EKEA 1S5JA 3OYHA 2D0CA 4DQSA 4YY3K 3HT3A 4ZHRA 3OYKA 1ZBFA 3G6EN 1KQSM 1QTMA 1V4SA 1MA9B 3S9HA 4CZHA 3LM9A 3SYZA 3FZFA 1J6ZA 3O9UA 3VERA 1TV6A 5FRNA 2Q2RA 2PYJA 3UKUB 3Q7CA 4ISFA 1Q9XA 3LDQA 3QLHA 4DR3K 4IG0A 3MCAB 4AF1A 3UB5A 4GVMA 4DSEA 1NK8A 3RRGA 4KHNA 4JKHA 3P5JA 4BQLA 2QWNA 4PHTX 3OS2A 4IFVA 2OTJN 3CQXA 4ILJA 3HRGA 3SV3A 2A40A 4LF7K 5SWMA 3VOVA 2JLEA 3C95A 1NGGA 3RVCA 3GL1A 3HOTA 5AZIA 1XMQK 4JHDB 3O9SA 4LH4A 4CF0A 4H4OA 5EU7A 4N41A 4AQYK 4GW6A 4LF6K 3FZHA 1BQMA 3VGKA 2YHAA 3AVHA 4ISEA 5CYQA 1NK7A 4DQIA 1KRPA 4WCEL 1XMOK 1Q81O 3FGUA 3D2FB 5F2RA 4DR1K 2YNHA 3UE5A 1TAUA 3E66A 2YKMA 3SK3A 4E3SA 2UUCK 1VQKN 4WQ4C 2ZJPL 2UYTA 4GVEA 4QAGA 4W5NA 4BRPA 4C23A 4CVNE 4EAHD 5J2NA 4EZ6A 4JD2A 3A5OC 4O0JA 4RWTA 3LANA 3MAQA 2B4JA 3LDLA 5KRSA 4DF8A 2FBYA 3TWHA 2KZZA 3O4QA 5KRTA 4OLAA 4K8XA 5AZJA 3TPQA 3O8MA 5A2QO 1KVAA 3IAYA 1EQYA 5FLXO 4K8ZA 4BRFA 3GG4A 2HMPA 5M1KA 4AM7A 3ZEUA 3LPUA 3ISNC 5M1PA 4X66K 1S1XA 2OA8A 2FSNA 5AQTA 4MO4A 3W0LA 3OS0A 4JI1K 3EE9A 4CIFA 4B08A 3PLAA 1BCMA 3SUPA 3MN6A 1X9SA 4FL9A 2F9WA 4CJRA 4IWVA 2O8FA 4GV3A 1ITGA 3O9QA 4LFCK 3EN9A 2ZJRL 2P1JA 3AVAA 1EP4A 1RT2A 2P5GA 4YFUA 3VN5A 2WFBA 1BIZA 3MXJA 2HHXA 3VGMA 2QI2A 2GWJA 3OBYA 4CIGA 3L3VA 2RF2A 3FZLA 4AHVA 4KRFA 3OBWA 4CJQA 4FJNA 3AVBA 3AVKA 4BE0A 4BRHA 3WXIA 3MDQA 4ELVA 1FKPA 5D3GA 5FPEA 2YHWA 1L3SA 3O3HA 3CCMN 2GX9A 4EP5A 4H5RA 3T19A 4B1UB 4PKHA 2X6NA 3K2PA 1C1AA 2P51A 1ASUA 1KAZA 4O44A 1W7AA 1TYQA 4K42A 2V7YA 5BPNA 4IZ9A 2XHBA 1WSJA 3V9XA 2G8KA 4ZTFA 1VQPN 3F73A 4B9SA 4CW7B 3CIPA 1JJ2M 3FFIA 1TUUA 4QS9A 4WYBA 3MN9A 4DS4A 4B1WB 4LFAK 4B1ZA 3D0PA 1J54A 5EX5A 4J2AA 3ZEUB 4CJPA 5AQGA 3H1QA 3ZX2A 4CK3A 4FLXA 4LY7A 3ENBA 3K9KA 4WQ5C 1NJXA 1NMNA 2G8VA 4M3WA 5GAEP 3HYFA 4DR2K 3SUNA 4CJ5A 3L0QA 1TL3A 2ZJQL 2HHHK 2F7TA 2WUSA 2O8FB 1W9HA 3SZ2A 3CJAA 3HVTA 3G71N 4BGAA 5C2DA 2QXFA 4GV6A 3DLBA 1D9FA 1NLVA 1LAWA 1HR0K 1GLLO 5HRSA 2PBDA 2BGGA 4OPJA 2ITMA 3A0IX 1NGFA 3QNOA 4BRQA 1JL2A 4LF9K 1NK5A 1BDGA 3HPOA 5KPTA 1EX4A 1K9MO 4YOUA 4O4GA 3I55N 4BC5A 3KKSA 2HHVA 3EO3A 1JLCA 3DRRA 3VF2A 1BU6O 3O08A 4HUEA 5AQMA 1Y97A 3LALA 3ZT0A 3E01A 2A41A 1N6QA 3KTQA 3OYJA 4JKGA 1RBTA 3KLIA 3LAMA 4BREA 4B9NA 3OYNA 2A1RA 2P9SB 3SJJA 4FM2A 1GLCG 3HPHA 4KHPK 1QQOA 2G8UA 4DSIA 2KFZA 5KGWA 1WB9A 1VQMN 4FYDA 3OYFA 4JI8K 3DM2A 3WNGA 3NDKA 4IO9L 4Z0UA 1LCUA 2KLAA 3WEEA 4KB0A 2IOCA 3TU5A 4CHOA 1WSFA 4E1JA 3BY5A 5KTQA 3M8RA 1A5WA 1VAZA 4OKKA 3V9ZA 1VSDA 1HKCA 3AGRA 1VQNN 3QO9A 3V1QA 4CFAA 3I8DA 1LV5A 3DLRA 1BO5O 4J8FA 4DTJA 5C2FA 3MCPA 3LZIA 2NZTA 1S1VA 1JLFA 3VGLA 1RBSA 5FPMA 4FJIA 1VSIA 4BQZA 3HSCA 3SQ2A 3PO4A 1TKXA 4OO1J 1JLGA 1BL3A 1HPZA 4G1QA 1Z6RA 2HMIA 4FPAA 1LWEA 4RW9A 4CZMA 4BC3A 5AQJA 4FZZA 4LFBK 1NGAA 4JK9A 4E89A 4FJKA 4IEEA 2QWPA 2QWOA 3L4QA 3U3YA 1VSLA 2ZGZA 4AH9A 1CXQA 4FLYA 2HF4A 5AQZA 4M41A 3MEGA 4R79A 4CEAA 3OVNA 3HBTA 4HUFA 3JS6A 4GKJK 3MWPA 3GOIA 4IFYA 1NWKA 3QBWA 2NRRA 3VEVA 4WFBL 2OPPA 3MN5A 3NH2A 4JK8A 3R3LA 4A57A 3JYTA 2GUPA 4NXMK 1RILA 3QINA 3CXCM 4M3ZA 1EETA 4IKFA 1C0TA 4KAZA 4I9LA 4DSJA 3WXLA 1T8EA 4FJHA 3MECA 3WXJA 4CJ7A 4H5TA 2VCPA 1NOYA 4FJ9A 4FVUA 1YXQA 2KTQA 3WEEB 1X9MA 1M1KO 3MMVA 1TKDA 4YOXA 4FLUA 1UOCA 1X9JA 4I7FA 1P8ZA 3A5NC 4CHZA 4X62K 3EYZA 3GE1A 3LDNA 3DLGA 3FZKA 1L3VA 2VG6A 4JLHA 1XC9A 1HYZA 5AR0A 1VRUA 2OPRA 4CCHA 1KCFA 5JVGL 1T7PA 2PY5A 4ISGA 4OPAA 5LL6Z 1GLJO 3OYAA 3SBTA 2P9LB 4DTNA 4KTWA 2RE2A 3SBGA 4GY2B 4O0IA 5BPMA 1S3XA 1UA1A 2NRXA 3THYB 2PZSA 2Z1GA 3I33A 1YHQN 4FJ7A 3ZSOA 1TK0A 3AVFA 3ZSQA 1NOZA 3H46O 2NRTA 3ITHA 5HOOA 5LJVA 3KD5E 4PA1A 3CC2N 4OKEA 4KKOA 3VPZA 1MWKA 3L2RA 1YTUA 3SLCA 4W5QA 4DU4A 2IVPA 2YCHA 4EHTA 5AQWA 1NKCA 3VETA 3AAPA 3ID6A 5ADXA 4DV0K 3P38A 2DFFA 2FSJA 2P9IA 4Z4IA 4J2EA 1U04A 3L2QA 3F2KA 2PAVA 3ZYYX 3K57A 1N34K 1K6YA 1E4FT 4FWNA 5CYMA 3BUZB 3OHRA 3RMCA 4EHUA 4B1VA 1RDCA 4YOYA 3K5OA 4FO0A 4BRMA 1OH8A 4ELTA 4GV9A 4AHRA 2BH1A 2GWKA 5K14A 3ZLJA 4CF9A 4BGBA 1RBVA 4I2QA 3CERA 2VYPA 1Z25A 5CZ1A 4CHNA 3UKUA 2P9NA 2E1ZA 3KHYA 3H1VX 4NCAA 3V6DA 4MLHA 4M63C 4MDAA 3LM2A 5T7BA 2YJEA 4JYAK 1I94K 4HTLA 3PO5A 3B6PA 1ZBIA 4LH5A 1JXBA 1NMDA 4CEQA 4M3TA 5I9EB 3OS1A 3NGYA 1DT9A 1BA0A 2UUAK 3AO4A 3VF4A 3DWLA 5EVZA 1E3MA 3AA2A 4FWSA 4E7JA 2XY5A 2DFHA 3TARA 4JHDA 4HWIA 3BEXA 2YI1A 3VQEA 4CK2A 3JSMA 1L3TA 1I39A 1RDUA 3HSTB 3P83D 4DMNA 1W0HA 1TGOA 1VK0A 3KLGA 3VQ5A 2RN2A 4XIUA 4MDBA 1SUQA 3KWGA 1GOCA 4H03B 4YOWA 3AVMA 4E7KA 3TAEA 5GAHP 5AJ3K 3D2FA 4PWDA 1IKYA 3HP9A 3TAGA 2F96A 2HHTA 1S1UA 2CGKA 2HHWA 1R0AA 3VQBA 3AVGA 2E20A 1NGEA 1X3MA 2A3ZA 1XWLA 4YDUA 2WBNA 4FM1A 3ZT4A 3ALYA 2E5LK 3D45A 3VQPA 4U67L 1WOQA 2FLOA 4MLEA 3J80O 1WBDA 1ATNA 2O4GA 3CMAN 3MXMA 3OYMA 3QEVA 4H0OA 3UKRB 3C6UA 3V9SA 2YHBA 4LC9B 1K8AO 4M42A 3IG1A 2WTUA 4FW1A 4DHYA 1S9EA 4UY8O 4TSXA 2P9PB 2HNZA 4CZFA 4IDHA 5BRHA 4HTUA 4DTXA 1MWMA 1HQEA 1T3VA 3WXMB 4DTOA 4H4MA 4JRQA 3LAKA 2D0OA 1U4BA 2DTUA 3N4PA 3NF6A 3EY1A 2P9NB 1YJWN 4DR6K 3BF1A 5C10A 4MO5A 4BRCA 4KFBA 3EZ5A 2BE2A 5JICA 4IOCL 3OYEA 4DTMA 4OGEA 1P90A 3CF5L 3NGZA 2OPSA 4JI0K 4C8OA 3HXMA 3FZMA 1EWRA 3T1HK 4FLZA 5C15A 5HL7L 3EZWA 3QB0A 3DXMB 4JI3K 1VSEA 4BDZA 2OZSA 3NF7A 4BVPA 2ZE2A 3OYBA 1N5YA 1REVA 4JKBA 4K43A 1XHXA 3O1BA 1F21A 2QWMA 2DY4A 2KQ2A 3U9ZA 2YNGA 4N47A 4JRPA 1VSJA 4PKGA 5CHIA 1ILYA 4Z4EA 5J2PA 3J7YP 3ATUA 5BR9A 1IBKK 2BDPA 3CCRN 4AHUA 2UXBK 3VQQA 4C8MA 3CCSN 3J81O 4FJ8A 1YTAA 4B9UA 4BROA 4R5PA 2VQEK 3PIPL 2QWLA 3HTVA 3ZCMA 4C8LA 4B8AB 4CK1A 3MN7A 4JI4K 4IXCA 1SAZA 4X65K 4BR4A 3QETA 5HROA 1DTQA 4A5AA 3SCXA 3MEDA 2EX3A 1S6QA 4XH1A 1WSHA 4YHHK 5AQKA 4B8CA 3AO1A 4FJGA 3E1YA 4Q0BA 3PSFA 4FWKA 4AHCA 3V9WA 1Z05A 1B92A 3TR8A 2D5RA 3OYGA 4F9OA 5M1QA 1B9FA 1NJWA 3A5LC 4X64K 4KTQA 2F8TA 2W6KA 2P9UB 1LOTB 3CM6A 4NLCA 2CGLA 1BUPA 3TSPA 2Q31A 2XRIA 4JAXA 1RDBA 3ZSYA 1JLEA 1ASVA 4F3TA 3V81A 4JEPA 3DJCA 4DWIA 3Q7BA 1S1TA 5DM7L 1T05A 2GTDA 2Q36A 3D6RA 3TSQA 3TAFA 3DLKA 2QKBA 4CFCA 3SAHA 1ZBUA 5C0YA 2HSTA 4OX9K 4DQQA 1Q7YO 5I3UA 2XY6A 3PUFA 4RTFD 3CI5A 3T3FA 3EKSA 3T1YK 2OCEA 1BISA 4FZYA 3K9JA 3P1GA 3TANA 2O8CB 1C0FA 1GLAG 5C24A 5HP1A 1RDDA 3VQ4A 2PYLA 2Q1NA 1Y64A 1DTTA 1TKTA 3O4NA 1I3AA 3DOKA 3EE8A 5C42A 1FJGK 3VEXA 2G8FA 1NGDA 4I9QA 1DLOA 3C65A 5FPNA 2J4RA 1U45A 3FE1A 1RBRA 3O9RA 4CFDA 1L3UA 4B3TK 2P9SA 1YVNA 4PY5A 4B3OA 3ASMA 1GOBA 3K5LA 5F1XA 4FWQA 1VQ4N 1CXUA 4DR5K 1HNZK 1WAFA 1HUXA 2QEXN 4CBXA 3BP8A 4H0PA 4BE1A 3AGKA 3S3NA 2FBTA 2E2OA 5E84A 5LY3A 4W5RA 4OLBA 1Q82O 4G9ZA 3BZCA 3VQ6A 4FVMA 1GOAA 4BRIA 3U4LA 3HM8A 3G10A 3ATVA 4FPBA 3FFKB 3HP6A 3U6FA 2VQFK 2HNDA 5SZTA 4CEOA 2YNIA 3TAQA 3LWMA 4DV7K 4H0TB 1T6CA 3E9PA 3CFOA 1XNRK 3P39A 1YVUA 3C6HA 4JKEA 5FPDA 5J1EA 3P31A 1YI2N 1Q8IA 3C6AA 2G8IA 2E8AA 3V1OA 4NXNK 4CEEA 4CZLA 5HLFA 4CZIA 3K5MA 2UXDK 3NHGA 3QBXA 4EP4A 4A2BA 4QS7A 4BG8A 4CGFA 3SV4A 5KQDA 4H8KA 2HOEA 3NH1A 1XNQK 4MFBA 2QW9A 2VGNA 1ZBSA 2D4WA 2VGMA 1Z26A 2W42A 3ZETB 3R9PA 3L2WA 1EWQA 1ZBLA 2F8SA 3J8AA 1QS4A 4LSNA 1YF5L 4DS5A 3MXIA 4FOIA 1ZYQA 4F8RA 1HRHA 2JWLA 3CPEA 2ITGA 2NRZA 3WQUA 4C1NI 3HI0A 1QE1A 3HVRA 1VQON 2FXUA 1NGHA 1W97L 1VQ6N 1BG3A 1RCHA 4DB3A 4IG3A 4CF2A 3QESA 1J5EK 3MX2A 4KHQA 3OYCA 5HRRA 4FXDA 2OANA 4M45A 1MU2A 1NK4A 3V4IA 1RNHA 2E2QA 3ZX0A 2BANA 1VQ8N 3QICA 3G4SN 1LW0A 2GELA 3QIPA 3CJBA 4FWMA 3DLHA 3W3DA 1IJJA 2ZF5O 3AVJA 3HPGA 4CF1A 3JAMO 1VSHA 3VEOA 1GLBG 3CD6N 5J2MA 1RTJA 1J53A 1S6PA 1TVRA 1GLFO 2G8WA 1JLAA 2P9LA 4E0DA 3K58A 1RTHA 1S9GA 3THYA 4V19S 2IAJA 4CF8A 3SNNA 5DM6L 3C7NB 2IDOA 5AQXA 3HJFA 3CQYA 1T44A 4HHTA 1TUYA 3CM5A 4FJJA 1HQUA 4B9LA 4PL8A 4FJLA 4CJWA 3KK2A 3L8BA 2RPIA 3QMLA 2JWKA 3BF3A 3CFRA 4BR9A 4CZJA 3A8YA 2QA4N 2ETJA 3NBPA 1U2VA 4RCHA 4XH5A 1ZC6A 1QQCA 1TL1A 3ZX3A 2QK9A 5H1SQ 4BR7A 3CQ8A 5DK5A 4JI2K 3R6MA 4DTSA 1NGBA 5KI6A 1SQKA 4CEBA 4CZKA 5JMVA 1S72N 3RRHA 4CGJA 1QSSA 1ESVA 4W5TA 1OVQA 3RSEB 2VG7A 4NYNA 2IVNA 3MEEA 3THWB 4LF5K 5EOYA 1JL1A 2AP1A 3QEXA 3L6QA 4N56A 1JCEA 4JNEA 4DR7K 1QHTA 3HO1A 4DTRA 2DPNA 5IWAK 5AQFA 4CFBA 3M3ZA 1YITN 1OH7A 1QZ6A 3VEWA 3PY8A 2RHKA 3O3FA 1QQMA 2FBXA 1KLMA 2E2NA 2B6AA 4IBNA 4GMJB 4DKWA 3ZT2A 4XH4A 4KHWA 3LDPA 4B1YB 4FM0A 4ILGB 1IV0A 4DSFA 3QEWA 3ZSXA 1WSGA 3MX5A 2BUPA 4DSKA 4WFAL 3DXKA 4K41A 1HPMA 3B6OA 4Y1DA 5HBMA 4AILC 1RDAA 3R8EA 3MK6A 2QXLA 3M1FA 3SAFA 2F4VK 2OPQA 2ASOA 3KWIA 4RW6A 1C1CA 4H5VA 4B9QA 2Y1IA 4Z4HA 5LJWA 5BR8K 1FW6A 1IKXA 5AQIA 1U2VB 1U6ZA 4CJSA 2YHYA 5E41A 3LP0A 2HHUA 3VTIA 4KI6A 3OTOK 4H0YB 4JK7A 5AQOA 3ZT3A 3KIOA 3CETA 3CCLN 1X1PA 4L3QA 3KLHA 5J2QA 1N33K 4QOZB 2O8BA 5GINA 3UKRA 1J9AA 1TAQA 4DLEA 2GBZA 3KJVA 2W41A 3HM9A 1CZAN 2P9PA 3AA4A 5HRNA 4QS8A 1QZ5A 3O3GA 1SKSA 4YOTA 1DGKN 4H5NA 4E19A 4JS4A 1HYSA 3KLFA 4IDKA 2GV9A 5HRPA 4O8UA 4KV8A 1SS6A 2QWQA 4CE9A 2O8EA 3CC7N 2D0AA 2W6LA 4IJAA 4Q5VA 2XY8A 1JCGA 4A5BA 1RDWX 1NBWA 2HNYA 5F0XA 2YNFA 4UQGA 4K0KK 2OTLN 3M8PA 2BTFA 5I42A 4FZXC 4M3YA 5AFUH 3AA3A 3S41A 3HOSA 3ULEA 3LP2A 3VQDA 3ENHA 1NKEA 3ZSRA 3G25A 2E1YA 3DXMA 2EHGA 3DXKB 1YIJN 3K59A 1SKWA 1GLEG 3THXA 3AO5A 3DI6A 2IIRA 4NB4A 1N36K 3U9DA 3OYIA 3CC4N 3U3GA 5JS2A 1BI4B 5AQSA 3VQAA 4A62A 3D7EO 1IG8A 4CIEA 4FJ5A 1FK9A 1QVFM 4KH5A 1GLDG 1O13A 2ZD1A 1LWCA 4B1XB 4FLVA 3KK1A 1XC3A 4ID5A 4FJMA 3DLLL 1CLQA 3VEZA 4B9MA 4CBWA 1KVBA 4ZTJA 3OJSA 4DF4A 2R7YA 2HBLA 3D2EB 4H5WA 4CJ3A 4CJTA 3AY9A 2O8BB 4C1NK 4BE2A 3LDOA 2YV0X 3I0SA 3M8QA 2P9KB 4NCGA 4CEDA 3AV9A 3PX0A 4CGIA 2IVOA 3K5NA 4CECA 3EEQA 3CJCA 4BR0A 3WT0A 4BRGA 4NCBA 1CZ9A 3GDQA 3SQ4A 4FWLA 5E26A 2O8EB 4CBUA 1NJIO 4Z94A 4CHYA 2XO7A 2YHXA 1TK8A 1OVYA 4JKCA 2OYQA 4FK2A 2P9UA 2KFNA 3DRSA 1QVGM 3IRXA 3QEPA 1ZBHA 2NRHA 3QFPA 3NAEA 3ULDA 3PSIA 3SUOA 1Q86O 2VWBA 1RT7A 3RTVA 1M90O 3RR7A 4Y1CA 1HNWK 3K0SA 4CGHA 3ULEB 4DV3K 2UU9K 1WNSA 3R1XA 2I7PA 3THXB 2O8DA 5LMUK 1MDUB 3FLCO 1XQSC 3TI0A 4AHSA 1XHZA 4DQPA 3LL3A 4CZGA 2FF6A 4M7YA 3AARA 1Q9YA 2O4IA 4BWMA 3WNEA 3ZSWA 2O8CA 5IT9O 4EZ9A 3LPTA 4DLGA 3CJ9A 2HVHA 2G8HA 4OJRA 1B9DA 4OPHA 1C0MA 2QM1A 2D0BA 3V9UA 1C1BA 3SI6A 4ELUA 4JI7K 1WN7A 4E7LA 4DUZK 3H45C 1SL1A 2HBMA 1VQ5N 4KH6A 5BN8A 2X74A 1HKGA 1VQLN 4CJEA 2Q97A 1NJZA 3GBTA 3QFUA 4KHSA 3QNNA 4M3XA 1U48A 1RT4A 2UUBK 3P4IA 1IH7A 1WLJA 1HMVA 2PFUA 3BZKA 4CJFA 3I56N 4WFNL 1WUAA 1JLBA 5CR4A 4OKJA 3C0BA 4DQRA 3L4IA 3TAPA 5AQNA 2E6LA 3VQ8A 4AHTA 1NK6A 5B8HA 4BRNA 2GUIA 3IFRA 3O4WA 3SMSA 5AFUA 4JKFA 4BVOA 2HB5A 5KPZA 4BACA 3TSUA 2VWKA 5M1OA 4I2PA 4M3RA 3SQ1A 4DTUA 4Z4FA 1DEJA 1NM1A 3TABA 1HNVA 4DFMA 3T69A 5LMNK 4C8NA 4N5SA 1X3NA 1KVCA 1XUPO 3NCIA 4YNQA 2O8DB 5ELZA 3OW2M 3VEYA 3RWUA 3NH0A 3BDPA 1KFSA 1YAGA 4BDYA 1JLQA 4EFHA 4WQ4A 1VHXA 3DLEA 4JKAA 1QSLA 4XEIA 3VESA 4HCBA 2WONA 5AZIB 3LZJA 3SUQA 1QHAA 5KPRA 2XY7A 4Z4CA 4CJUA 3NMUA
chains in the Genus database with same CATH topology
3QICA 3G4SN 1K8KA 4CZHA 2GELA 3H46O 3ZETA 2NRTA 3CJBA 1HKBA 1ZXOA 3LM9A 4FWMA 4NLBA 5HOOA 3FZFA 1J6ZA 5LJVA 3O9UA 3W3DA 1BA1A 3VERA 1EO1A 1IJJA 4NO7A 3CC2N 3VPZA 1MWKA 2Q2RA 2ZF5O 2F9TA 3SLCA 3Q7CA 3UKUB 4ISFA 4BG9A 1G99A 3LDQA 2IVPA 2YCHA 4EHTA 5AQWA 2QWRA 3H3NO 3VEOA 3VETA 1JCFA 1GLBG 3MCAB 4AF1A 3AAPA 3ID6A 3UB5A 5ADXA 3EKUA 3CD6N 4JKHA 3P38A 4BQLA 2QWNA 2FSJA 4PHTX 2P9IA 4EIAA 1RFQA 3F2KA 2A42A 2OTJN 1GLFO 3CQXA 2PAVA 4ILJA 3HRGA 1KAYA 3ZYYX 2ZGYA 4JD2B 2A40A 2P9LA 3ZX0A 1E4FT 2YX6A 3KK7A 4FWNA 3VOVA 3BUZB 3OHRA 1NGGA 3RVCA 4BRAA 3GL1A 5AQVA 3HOTA 1NGIA 5AZIA 4EHUA 4JHDB 4B1VA 3O9SA 3VF6A 4YOYA 4FO0A 1H1VA 5DM6L 3C7NB 4BRMA 4GV9A 3FZHA 5AQXA 1VQ9N 2BH1A 1T44A 3CQYA 2GWKA 3VGKA 2KHOA 5AZJB 1TUYA 4ISEA 4BGBA 4JN4A 4PL8A 1YJ9N 1HJOA 4WCEL 3CERA 3WXKA 2VYPA 3UKUA 2P9NA 2E1ZA 3KHYA 3QMLA 2JWKA 3BF3A 3H1VX 3SAGA 3FGUA 3D2FB 3KVGA 5F2RA 2NRVA 3UE5A 4BR9A 3A8YA 4CZJA 4MLHA 5GAGP 4M63C 2QA4N 3E66A 1U2VA 4MDAA 3LM2A 4RCHA 5BRFA 2YJEA 4FSVA 4XH5A 3SK3A 4HTLA 4A2AA 1ZC6A 3JXUA 3VMFB 1VQKN 1BOTO 1NMDA 4WQ4C 3ZX3A 2ZJPL 5H1SQ 2UYTA 2V7ZA 5BREA 4GVEA 4BR7A 5I9EB 3O5BA 4BRPA 3CMEN 4C23A 4EAHD 4A61A 1DT9A 1BA0A 4JD2A 3A5OC 3R6MA 3VF4A 3DWLA 5EVZA 4FWSA 2HBJA 2V51B 1BWFO 4RWTA 1NGBA 4JHDA 4I6MA 4HWIA 3LDLA 3BEXA 2YI1A 1SQKA 4CZKA 5BRDA 5JMVA 1S72N 3TTDA 2NLXA 3E9LA 1ESVA 3C7NA 2I7NA 1K8KB 3RSEB 1RDUA 2IVNA 5AZJA 5AQRA 3NVKA 3TPQA 5EOYA 3O8MA 2Q0RA 2AP1A 4MDBA 3KWGA 3L6QA 4H03B 1EQYA 4YOWA 1JCEA 4JNEA 3VTHA 3TTFA 4BRFA 5GAHP 3GG4A 3CHWA 3D2FA 2DPNA 2HMPA 5M1KA 3CCVN 5JVHL 4AM7A 5AQFA 3IKMA 3CCJN 2CGKA 3M3ZA 3ZEUA 1YITN 1QZ6A 3VEWA 5M1PA 2RHKA 2FSNA 2E20A 5AQTA 4MO4A 3W0LA 1QQMA 1NGEA 1X3MA 2A3ZA 3EE9A 5C12A 1ATRA 4YDUA 2E2NA 2WBNA 4WF9L 2EWSA 3FR0A 3PLAA 4IOXA 4DKWA 1KD1O 4U67L 1WOQA 2FLOA 3MN6A 3LDPA 4MLEA 4O8KA 4XH4A 4B1YB 4FL9A 4ILGB 2F9WA 4IWVA 1ATNA 3CMAN 5MLCQ 1VQ5N 1QQNA 3MX5A 4GV3A 3O9QA 3EN9A 2BUPA 5M1FA 4H0OA 4WQ5A 2ZJRL 3UKRB 2A6AA 4WFAL 4LC9B 3DXKA 1K8AO 4K41A 1HPMA 4DHYA 1TYQB 4UY8O 2P9PB 4CZFA 2WFBA 4IDHA 3RSEA 5BRHA 1MWMA 1T3VA 3R8EA 3VGMA 3WXMB 3MK6A 2QI2A 2QXLA 4BC4A 3M1FA 3O9TA 2GWJA 2HF3A 3OBYA 4BR2A 3SAFA 4CD1A 4BRKA 5ADXH 2D0OA 2ASOA 3N4PA 3KWIA 4H5VA 4B9QA 1Q81O 3FZLA 3IDHA 3WUHA 2P9NB 3OBWA 4IEIA 5LJWA 3J7ZO 1YJWN 3BF1A 3ENOA 5C10A 4MO5A 4BRCA 5AQIA 3A5MC 4BRHA 1U2VB 1U6ZA 2E2PA 3WXIA 2YHYA 3MDQA 5JICA 2FSKA 5AQUA 4IOCL 3VTIA 5FPEA 4FWRA 2YHWA 1P90A 2CH6A 4H0YB 4IJNA 4JK7A 3CF5L 1W2BM 2NRWA 5AQOA 3CCMN 4KH4A 2GX9A 3CETA 3FZMA 4H5RA 3CCLN 4B1UB 4L3QA 4PKHA 5GINA 3UKRA 4YORA 5C15A 3PIOL 1KAZA 5HL7L 1VQ7N 3EZWA 4I6MB 3QB0A 3DXMB 2W41A 1TYQA 1YHQN 1CZAN 4K42A 2P9PA 2V7YA 1YJNN 4QS8A 1QZ5A 5BPNA 4IZ9A 3H3OB 1YUWA 1SZ2A 5EXWA 4CI6A 4PKIA 2Q0UA 4BVPA 4IFEA 1N8RO 1VQPN 4YOTA 5AQQA 1DGKN 4H5NA 4JKBA 4K43A 3O1BA 3CIPA 2D0PA 4K25A 4O5FA 1JJ2M 1TUUA 4QS9A 4WYBA 3MN9A 1HX1A 2QWMA 4O8UA 3TTCA 1SS6A 2QWQA 5GIPA 3U9ZA 3CC7N 4B1WB 4B1ZA 4M7XA 4IJAA 4PKGA 5CHIA 4IO8A 5EX5A 4BR5A 3ZEUB 1JCGA 1ILYA 5AQGA 3H1QA 4A5BA 3ATUA 4H0XB 5BR9A 1RDWX 1RGIA 1NBWA 5BN9A 3ZX2A 3CCRN 1NGCA 5F0XA 3ENBA 3K9KA 4WQ5C 2OTLN 3CCSN 5GAEP 2V52B 1HLUA 4H0VB 2BTFA 3L0QA 4BROA 2ZJQL 2F7TA 3CCQN 2WUSA 5AFUH 3PIPL 3S41A 3HOSA 2QWLA 4JKGB 3HTVA 3ULEA 3ENHA 4CZEA 3MN7A 3CJAA 4IXCA 5JLHA 3G25A 2E1YA 1SAZA 3DXMA 3DXKB 4BGAA 3G71N 5C2DA 1YIJN 4GV6A 1GLEG 1NLVA 4BR4A 5GIOA 2IIRA 1K73O 4A5AA 4NB4A 3HZ6A 3U9DA 5AQLA 1R59O 1GLLO 4BRLA 3CC4N 2PBDA 1ATSA 2ITMA 4XH1A 3A0IX 1NGFA 5AQKA 4A59A 5AQSA 2NNWA 4BRQA 4DQ8A 3E1YA 4A62A 3D7EO 4FWKA 1IG8A 4FOEA 1BDGA 1QVFM 1Z05A 4KH5A 5KPTA 1GLDG 1O13A 1K9MO 4YOUA 5GADP 4F9OA 5M1QA 3I55N 4BC5A 3A5LC 4KBOA 2H3GX 3EO3A 2P9UB 4YOVA 2GEMA 4B1XB 1KXPA 5CE3A 1LOTB 3VF2A 4NLCA 1BU6O 3O08A 2CGLA 3CJ1A 4DCHA 4FWPA 1XC3A 1BUPA 2KKZA 3F9MA 3TSPA 2Q31A 5AQMA 4JAXA 3DAWA 3DLLL 3EL2A 2A41A 3VEZA 4CBWA 3SMPA 4JKGA 4JEPA 3U8XA 2HBLA 3D2EB 3DJCA 4H5WA 3AY9A 3Q7BA 4C1NK 5DM7L 3LDOA 4BREA 5JLFA 3IMXA 2GTDA 2P9KB 2P9SB 2Q36A 3D6RA 3TSQA 4IOAL 1GLCG 3O6WA 3SAHA 5C0YA 2IVOA 2HSTA 1Q7YO 3CJCA 4BR0A 3WT0A 1QQOA 4RTFD 4BRGA 3CI5A 3OA9A 3GDQA 1VQMN 4BY9C 3EKSA 4FWLA 5E26A 3SJHA 4CBUA 1NJIO 3AAQA 4Z94A 3K9JA 4IO9L 1C0FA 2YHXA 1OVYA 1GLAG 1LCUA 4FWOA 2KLAA 4JKCA 3CCUN 3WEEA 2P9UA 1QVGM 1T6DA 2Q1NA 1Y64A 3TU5A 4E1JA 3CPWM 2NRHA 2A5XA 3QFPA 4BC2A 2WC9A 3O80A 1VAZA 3EE8A 1Q86O 1HKCA 2VWBA 3AGRA 1VQNN 3VEXA 1NGDA 3F5TA 4U7BA 1M90O 1BO5O 3D2EA 3MWTA 4J8FA 3ULEB 3C65A 5FPNA 2J4RA 3N4QA 3MCPA 5C2FA 2NZTA 3FE1A 3O9RA 2P9KA 2P9SA 3B8AX 1YVNA 2HBKA 2I7PA 3R1XA 3VGLA 4PL7A 3H6EA 5FPMA 5F1XA 1MDUB 3FLCO 1XQSC 4FWQA 4BQZA 1VQ4N 3HSCA 3LL3A 3IUCA 4CZGA 2FF6A 4OO1J 1HUXA 4M7YA 2QEXN 3AARA 3E9OA 4CBXA 3BP8A 3ID8A 3QDKA 4H0PA 1Z6RA 3AGKA 4FPAA 2E2OA 5E84A 4YDUC 5LY3A 2D1KA 1Q82O 4CZMA 4G9ZA 4BC3A 3I8BA 4BRIA 3U4LA 2W40A 5AQJA 3HM8A 4AM6A 1NGAA 2ZWHA 4JK9A 3CJ9A 3ATVA 4FPBA 2QWPA 4IEEA 4OPHA 3FFKB 2QWOA 3L4QA 2QM1A 4GNIA 2ZGZA 2HF4A 5AQZA 4R79A 4H0TB 1T6CA 3E9PA 3P39A 2FF3B 3H45C 3HBTA 3C6HA 3M6GA 4JKEA 1NGJA 5FPDA 3JS6A 3MWPA 2AA4A 3KZBA 3GOIA 2HBMA 1NWKA 3QBWA 2NRRA 4KH6A 3P31A 3VEVA 5BN8A 4WFBL 1HKGA 1YI2N 1E4GT 3MN5A 1VQLN 3C6AA 4JK8A 2CH5A 2E88A 1V4TA 4Y0WA 2Q97A 3R3LA 2E8AA 4A57A 3GBTA 3QFUA 1OKJA 2GUPA 4JKDA 3CXCM 1DKGD 4CZLA 5AQYA 3P4IA 4CZIA 3CCEN 3T7ZA 2PFUA 5AQPA 3QBXA 4A2BA 4QS7A 4BG8A 3I56N 3VENA 1WUAA 4WFNL 5CR4A 1C0GA 3CJ7A 3C0BA 3L4IA 3WXLA 5KQDA 2HOEA 5TKWA 4CD3A 2YJFA 5AQNA 2QW9A 3WXJA 4CJ7A 4H5TA 2VGNA 2VCPA 5AQHA 1ZBSA 5B8HA 1S22A 4BRNA 2D4WA 2VGMA 1YXQA 3WQTA 4FVUA 3IFRA 1KC8O 3O1WA 2QTDA 3WEEB 1D4XA 3O4WA 3ZETB 3SMSA 1M1KO 3MMVA 4BRDA 3R9PA 3M5RA 5AFUA 4JKFA 4BVOA 4YOXA 1Q18A 5KPZA 3J8AA 5TKYA 1X9JA 5BPLA 1YF5L 5M1OA 1P8ZA 3A5NC 3NVMA 2ASMA 4FOIA 3TSUA 3GE1A 3LDNA 1DEJA 1NM1A 1KAXA 2JWLA 3CPEA 2NRZA 3FZKA 3WQUA 4C1NI 4ILHA 3HI0A 3T69A 1VQON 5KQ8A 2FXUA 1X3NA 5AR0A 1NGHA 1W97L 1XUPO 1BG3A 4DB3A 1VQ6N 2ASPA 5EY4A 5JVGL 5ELZA 3MX2A 2P9IB 3OW2M 5M1NA 4ISGA 3VEYA 2CGJA 4OPAA 2OANA 1YAGA 1GLJO 3SBTA 2P9LB 4EFHA 4WQ4A 2RE2A 3SBGA 4GY2B 4JKAA 4XEIA 3VESA 5BPMA 1S3XA 2NRXA 5AZIB 3G6EN 1KQSM 1V4SA 1QHAA 2E2QA 5KPRA 3I33A 1MA9B 1VQ8N 3NMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HOO A;  3K9K A;  2F7T A;  3F2K A;  3K9J A;  3HOS A;  4R79 A;  3HOT A;  4MDA A;  4U7B A;  4MDB A;  5CR4 A; 
#chains in the Genus database with same CATH topology
 1K8K A;  3ZET A;  1NJY A;  4CJV A;  1HKB A;  1ZXO A;  3I0R A;  4NLB A;  1BA1 A;  4F2S A;  4DV5 K;  1EO1 A;  4NO7 A;  1IKW A;  1JXE A;  2F9T A;  4BG9 A;  2WOM A;  1G99 A;  4RW4 A;  3QIO A;  1X9W A;  2QWR A;  3H3N O;  4ICL A;  1JCF A;  1UAX A;  3EKU A;  2Q3S A;  4E7H A;  5FRO A;  4W5O A;  4EIA A;  4CER A;  1RFQ A;  3VQ7 A;  2A42 A;  1KAY A;  2ZGY A;  3UIQ A;  4JD2 B;  3PX6 A;  3ZSZ A;  2YX6 A;  4DV2 K;  3KK7 A;  4PUO A;  4BRA A;  3RMD A;  5AQV A;  1NGI A;  1IBM K;  3SPZ A;  3AVN A;  3VF6 A;  4OVL A;  4M3U A;  1H1V A;  1D9D A;  1S1W A;  4E7I A;  1VQ9 N;  2KHO A;  5AZJ B;  3S3M A;  4RW7 A;  4JN4 A;  1YJ9 N;  4ID1 A;  1HJO A;  3WXK A;  4CEZ A;  4E1M A;  1IBL K;  3SAG A;  2HVI A;  3KVG A;  5GAG P;  2NRV A;  1D8Y A;  4CHQ A;  5C25 A;  5BRF A;  4FSV A;  4NYF A;  1UWB A;  4A2A A;  3VMF B;  3JXU A;  2VWJ A;  1BOT O;  3ZT1 A;  4CGG A;  2V7Z A;  5BRE A;  1N32 K;  3O5B A;  4DFJ A;  3CME N;  4A61 A;  3AVL A;  1VSF A;  4MQ3 A;  1RBU A;  3DOL A;  1TK5 A;  4KO0 A;  3PV8 A;  2HBJ A;  2I5J A;  2V51 B;  1BWF O;  1FKO A;  2FBV A;  1G15 A;  4I6M A;  3J7A P;  1WBB A;  5BRD A;  3NFA A;  3TTD A;  4CGD A;  2NLX A;  3E9L A;  3C7N A;  2E4L A;  2I7N A;  1K8K B;  4L8R B;  5AQR A;  3NVK A;  3NF9 A;  2Q0R A;  4N76 A;  4CHP A;  2FC0 A;  4O5B A;  3TTF A;  3VTH A;  2Y1J A;  4DSL A;  3CHW A;  5JVH L;  3CCV N;  4DV4 K;  4GKK K;  1C0U A;  3IKM A;  3CCJ N;  5CZ2 A;  3V1R A;  2HHQ A;  3VA3 A;  1L5U A;  1IG9 A;  4DFK A;  5C12 A;  4WF9 L;  1ATR A;  3TAM A;  4FK0 A;  2EWS A;  3FR0 A;  3L2V A;  4IOX A;  1KD1 O;  1RT1 A;  4O8K A;  2QKK A;  5MLC Q;  1QQN A;  4F3O A;  3SQ0 A;  3KKR A;  5M1F A;  3PX4 A;  4WQ5 A;  4KB1 A;  2A6A A;  3DMJ A;  4KI4 A;  3OY9 A;  1SL2 A;  1TYQ B;  2X78 A;  3RSE A;  1O1W A;  4BC4 A;  3THW A;  3O9T A;  4BR2 A;  2HF3 A;  4RG8 A;  2UXC K;  1IKV A;  4CD1 A;  4BRK A;  1SV5 A;  5ADX H;  4DG1 A;  4OPK A;  4WE1 A;  3IDH A;  3WUH A;  3QEI A;  1VSK A;  3A2F A;  4IEI A;  4DFP A;  3J7Z O;  1RTD A;  1U49 A;  3ENO A;  2DFE A;  3A5M C;  2E2P A;  4DR4 K;  1OH5 A;  4DU1 A;  4PQU A;  3LDS A;  2FSK A;  5AQU A;  1LAV A;  5FDL A;  4OGC A;  4FWR A;  4F2R A;  1W2B M;  4IJN A;  2CH6 A;  3SPY A;  2NRW A;  3NE6 A;  3CG7 A;  1HJR A;  4KH4 A;  1NU0 A;  4B3S K;  1LWF A;  3OYD A;  3NGI A;  5FRM A;  4CJL A;  3AO2 A;  2HW3 A;  2RKI A;  4LF4 K;  4YOR A;  3PIO L;  4Z4G A;  1VQ7 N;  4I6M B;  2LSN A;  3WNH A;  1SL0 A;  1YJN N;  4DU3 A;  3H3O B;  1YUW A;  1SZ2 A;  5EXW A;  4CI6 A;  1NK0 A;  4PKI A;  2Q0U A;  4IFE A;  1N8R O;  5AQQ A;  4CES A;  2D0P A;  4K25 A;  4O5F A;  1UA0 A;  3RR8 A;  4FK4 A;  1HX1 A;  3TTC A;  4LF8 K;  5GIP A;  4DUY K;  4M7X A;  4J2B A;  4IO8 A;  4BR5 A;  4FJX A;  2IC3 A;  4H0X B;  4FW2 A;  1RGI A;  5BN9 A;  3DYA A;  1NG9 A;  1NGC A;  3OYL A;  4KHY A;  2V52 B;  1HLU A;  4H0V B;  2OZM A;  3CCQ N;  2IGI A;  4DV1 K;  4JKG B;  4B9T A;  4CZE A;  4B9V A;  5JLH A;  1HNI A;  4B3R K;  1BIU A;  5GIO A;  3KLE A;  1RTI A;  1IO2 A;  3ZSV A;  1WSI A;  1K73 O;  3HZ6 A;  1VRT A;  5AQL A;  1R59 O;  4BRL A;  1JKH A;  3HK2 A;  4HCC A;  1ATS A;  1BQN A;  3AA5 X;  2NUB A;  4A59 A;  3THV A;  2NNW A;  4DQ8 A;  4FOE A;  4JV5 K;  5GAD P;  3VA0 A;  1RT6 A;  2ZQB A;  4KBO A;  2H3G X;  1BCO A;  4YOV A;  2GEM A;  1KXP A;  5CE3 A;  4JI6 K;  1RT5 A;  4C8K A;  1A5X A;  3CJ1 A;  4DCH A;  4FWP A;  1HYV A;  2KKZ A;  3F9M A;  4KTZ A;  3VQC A;  3DAW A;  3EL2 A;  3SMP A;  3OJU A;  2P5O A;  1SKR A;  3U8X A;  4HUG A;  2A1S A;  5JLF A;  3IMX A;  3KD1 E;  4IOA L;  1BHL A;  2Z1H A;  1T03 A;  3O6W A;  1D5A A;  4KRE A;  2ZM6 K;  3VQ9 A;  1BI4 A;  3OA9 A;  3CFP A;  4FCY A;  4BY9 C;  2X6S A;  3DRP A;  1EXQ A;  3SJH A;  1RT3 A;  1WAJ A;  3AAQ A;  1VSM A;  3G0Z A;  4FWO A;  3CCU N;  4O55 A;  4BDP A;  1T6D A;  3LP3 A;  4E1N A;  3L3U A;  1NNE A;  3CPW M;  4BWJ A;  2Z1J A;  2A5X A;  3L2U A;  2Z1I A;  4BC2 A;  2WC9 A;  3O80 A;  5DMR A;  3WNF A;  1U47 A;  1KFD A;  3F5T A;  4U7B A;  2E6M A;  3LWL A;  3LP1 A;  3D2E A;  3MWT A;  4FLT A;  2JGU A;  1WSE A;  3N4Q A;  2P9K A;  3B8A X;  4HVJ A;  3M8S A;  2HBK A;  4PL7 A;  1KSP A;  3H6E A;  3HL8 A;  4CJK A;  1ASW A;  5JS1 A;  3RMA A;  3IUC A;  1XI1 A;  3E9O A;  3QDK A;  3ID8 A;  1LW2 A;  4YDU C;  2D1K A;  1CZB A;  3AVC A;  4KPY A;  3I8B A;  2W40 A;  4CEF A;  4AM6 A;  4JS5 A;  3RMB A;  2ZWH A;  3C94 A;  1NK9 A;  3T1A A;  1OH6 A;  1FXX A;  4B3M K;  4GNI A;  1TKZ A;  4DV6 K;  2FF3 B;  3M6G A;  1NGJ A;  3KK3 A;  2AA4 A;  3KZB A;  4FLW A;  1E4G T;  2CH5 A;  2E88 A;  1V4T A;  4Y0W A;  3S3O A;  4DTP A;  1OKJ A;  4JKD A;  1KLN A;  4QCL A;  1DKG D;  5AQY A;  4RW8 A;  4LSL A;  3CCE N;  3T7Z A;  5CY4 A;  5AQP A;  3VEN A;  1C0G A;  2ATQ A;  3CJ7 A;  2IS3 A;  5TKW A;  4CD3 A;  2YJF A;  4JI5 K;  1J5O A;  5AQH A;  3H08 A;  4KHU A;  2B5J A;  1S22 A;  3WQT A;  4CJ4 A;  3O1W A;  2QTD A;  1YT3 A;  1D4X A;  1KC8 O;  4F4K A;  3BGR A;  4BRD A;  3M5R A;  3NF8 A;  1KTQ A;  1C6V A;  1Q18 A;  5TKY A;  5BPL A;  3IS9 A;  3NVM A;  2ASM A;  3AVI A;  2HHS A;  1KAX A;  1QSY A;  2AJQ A;  4J2D A;  4ILH A;  4LD0 A;  3AO3 A;  5KQ8 A;  1NKB A;  3F9K A;  2VG5 A;  3QER A;  3C6T A;  2ASP A;  2YKN A;  5EY4 A;  3CYM A;  2P9I B;  5KGX A;  5M1N A;  1HNX K;  2KZM A;  1A5V A;  1BGX T;  2CGJ A;  2KW4 A;  1EKE A;  1S5J A;  3OYH A;  2D0C A;  4DQS A;  4YY3 K;  3HT3 A;  4ZHR A;  3OYK A;  1ZBF A;  3G6E N;  1KQS M;  1QTM A;  1V4S A;  1MA9 B;  3S9H A;  4CZH A;  3LM9 A;  3SYZ A;  3FZF A;  1J6Z A;  3O9U A;  3VER A;  1TV6 A;  5FRN A;  2Q2R A;  2PYJ A;  3UKU B;  3Q7C A;  4ISF A;  1Q9X A;  3LDQ A;  3QLH A;  4DR3 K;  4IG0 A;  3MCA B;  4AF1 A;  3UB5 A;  4GVM A;  4DSE A;  1NK8 A;  3RRG A;  4KHN A;  4JKH A;  3P5J A;  4BQL A;  2QWN A;  4PHT X;  3OS2 A;  4IFV A;  2OTJ N;  3CQX A;  4ILJ A;  3HRG A;  3SV3 A;  2A40 A;  4LF7 K;  5SWM A;  3VOV A;  2JLE A;  3C95 A;  1NGG A;  3RVC A;  3GL1 A;  3HOT A;  5AZI A;  1XMQ K;  4JHD B;  3O9S A;  4LH4 A;  4CF0 A;  4H4O A;  5EU7 A;  4N41 A;  4AQY K;  4GW6 A;  4LF6 K;  3FZH A;  1BQM A;  3VGK A;  2YHA A;  3AVH A;  4ISE A;  5CYQ A;  1NK7 A;  4DQI A;  1KRP A;  4WCE L;  1XMO K;  1Q81 O;  3FGU A;  3D2F B;  5F2R A;  4DR1 K;  2YNH A;  3UE5 A;  1TAU A;  3E66 A;  2YKM A;  3SK3 A;  4E3S A;  2UUC K;  1VQK N;  4WQ4 C;  2ZJP L;  2UYT A;  4GVE A;  4QAG A;  4W5N A;  4BRP A;  4C23 A;  4CVN E;  4EAH D;  5J2N A;  4EZ6 A;  4JD2 A;  3A5O C;  4O0J A;  4RWT A;  3LAN A;  3MAQ A;  2B4J A;  3LDL A;  5KRS A;  4DF8 A;  2FBY A;  3TWH A;  2KZZ A;  3O4Q A;  5KRT A;  4OLA A;  4K8X A;  5AZJ A;  3TPQ A;  3O8M A;  5A2Q O;  1KVA A;  3IAY A;  1EQY A;  5FLX O;  4K8Z A;  4BRF A;  3GG4 A;  2HMP A;  5M1K A;  4AM7 A;  3ZEU A;  3LPU A;  3ISN C;  5M1P A;  4X66 K;  1S1X A;  2OA8 A;  2FSN A;  5AQT A;  4MO4 A;  3W0L A;  3OS0 A;  4JI1 K;  3EE9 A;  4CIF A;  4B08 A;  3PLA A;  1BCM A;  3SUP A;  3MN6 A;  1X9S A;  4FL9 A;  2F9W A;  4CJR A;  4IWV A;  2O8F A;  4GV3 A;  1ITG A;  3O9Q A;  4LFC K;  3EN9 A;  2ZJR L;  2P1J A;  3AVA A;  1EP4 A;  1RT2 A;  2P5G A;  4YFU A;  3VN5 A;  2WFB A;  1BIZ A;  3MXJ A;  2HHX A;  3VGM A;  2QI2 A;  2GWJ A;  3OBY A;  4CIG A;  3L3V A;  2RF2 A;  3FZL A;  4AHV A;  4KRF A;  3OBW A;  4CJQ A;  4FJN A;  3AVB A;  3AVK A;  4BE0 A;  4BRH A;  3WXI A;  3MDQ A;  4ELV A;  1FKP A;  5D3G A;  5FPE A;  2YHW A;  1L3S A;  3O3H A;  3CCM N;  2GX9 A;  4EP5 A;  4H5R A;  3T19 A;  4B1U B;  4PKH A;  2X6N A;  3K2P A;  1C1A A;  2P51 A;  1ASU A;  1KAZ A;  4O44 A;  1W7A A;  1TYQ A;  4K42 A;  2V7Y A;  5BPN A;  4IZ9 A;  2XHB A;  1WSJ A;  3V9X A;  2G8K A;  4ZTF A;  1VQP N;  3F73 A;  4B9S A;  4CW7 B;  3CIP A;  1JJ2 M;  3FFI A;  1TUU A;  4QS9 A;  4WYB A;  3MN9 A;  4DS4 A;  4B1W B;  4LFA K;  4B1Z A;  3D0P A;  1J54 A;  5EX5 A;  4J2A A;  3ZEU B;  4CJP A;  5AQG A;  3H1Q A;  3ZX2 A;  4CK3 A;  4FLX A;  4LY7 A;  3ENB A;  3K9K A;  4WQ5 C;  1NJX A;  1NMN A;  2G8V A;  4M3W A;  5GAE P;  3HYF A;  4DR2 K;  3SUN A;  4CJ5 A;  3L0Q A;  1TL3 A;  2ZJQ L;  2HHH K;  2F7T A;  2WUS A;  2O8F B;  1W9H A;  3SZ2 A;  3CJA A;  3HVT A;  3G71 N;  4BGA A;  5C2D A;  2QXF A;  4GV6 A;  3DLB A;  1D9F A;  1NLV A;  1LAW A;  1HR0 K;  1GLL O;  5HRS A;  2PBD A;  2BGG A;  4OPJ A;  2ITM A;  3A0I X;  1NGF A;  3QNO A;  4BRQ A;  1JL2 A;  4LF9 K;  1NK5 A;  1BDG A;  3HPO A;  5KPT A;  1EX4 A;  1K9M O;  4YOU A;  4O4G A;  3I55 N;  4BC5 A;  3KKS A;  2HHV A;  3EO3 A;  1JLC A;  3DRR A;  3VF2 A;  1BU6 O;  3O08 A;  4HUE A;  5AQM A;  1Y97 A;  3LAL A;  3ZT0 A;  3E01 A;  2A41 A;  1N6Q A;  3KTQ A;  3OYJ A;  4JKG A;  1RBT A;  3KLI A;  3LAM A;  4BRE A;  4B9N A;  3OYN A;  2A1R A;  2P9S B;  3SJJ A;  4FM2 A;  1GLC G;  3HPH A;  4KHP K;  1QQO A;  2G8U A;  4DSI A;  2KFZ A;  5KGW A;  1WB9 A;  1VQM N;  4FYD A;  3OYF A;  4JI8 K;  3DM2 A;  3WNG A;  3NDK A;  4IO9 L;  4Z0U A;  1LCU A;  2KLA A;  3WEE A;  4KB0 A;  2IOC A;  3TU5 A;  4CHO A;  1WSF A;  4E1J A;  3BY5 A;  5KTQ A;  3M8R A;  1A5W A;  1VAZ A;  4OKK A;  3V9Z A;  1VSD A;  1HKC A;  3AGR A;  1VQN N;  3QO9 A;  3V1Q A;  4CFA A;  3I8D A;  1LV5 A;  3DLR A;  1BO5 O;  4J8F A;  4DTJ A;  5C2F A;  3MCP A;  3LZI A;  2NZT A;  1S1V A;  1JLF A;  3VGL A;  1RBS A;  5FPM A;  4FJI A;  1VSI A;  4BQZ A;  3HSC A;  3SQ2 A;  3PO4 A;  1TKX A;  4OO1 J;  1JLG A;  1BL3 A;  1HPZ A;  4G1Q A;  1Z6R A;  2HMI A;  4FPA A;  1LWE A;  4RW9 A;  4CZM A;  4BC3 A;  5AQJ A;  4FZZ A;  4LFB K;  1NGA A;  4JK9 A;  4E89 A;  4FJK A;  4IEE A;  2QWP A;  2QWO A;  3L4Q A;  3U3Y A;  1VSL A;  2ZGZ A;  4AH9 A;  1CXQ A;  4FLY A;  2HF4 A;  5AQZ A;  4M41 A;  3MEG A;  4R79 A;  4CEA A;  3OVN A;  3HBT A;  4HUF A;  3JS6 A;  4GKJ K;  3MWP A;  3GOI A;  4IFY A;  1NWK A;  3QBW A;  2NRR A;  3VEV A;  4WFB L;  2OPP A;  3MN5 A;  3NH2 A;  4JK8 A;  3R3L A;  4A57 A;  3JYT A;  2GUP A;  4NXM K;  1RIL A;  3QIN A;  3CXC M;  4M3Z A;  1EET A;  4IKF A;  1C0T A;  4KAZ A;  4I9L A;  4DSJ A;  3WXL A;  1T8E A;  4FJH A;  3MEC A;  3WXJ A;  4CJ7 A;  4H5T A;  2VCP A;  1NOY A;  4FJ9 A;  4FVU A;  1YXQ A;  2KTQ A;  3WEE B;  1X9M A;  1M1K O;  3MMV A;  1TKD A;  4YOX A;  4FLU A;  1UOC A;  1X9J A;  4I7F A;  1P8Z A;  3A5N C;  4CHZ A;  4X62 K;  3EYZ A;  3GE1 A;  3LDN A;  3DLG A;  3FZK A;  1L3V A;  2VG6 A;  4JLH A;  1XC9 A;  1HYZ A;  5AR0 A;  1VRU A;  2OPR A;  4CCH A;  1KCF A;  5JVG L;  1T7P A;  2PY5 A;  4ISG A;  4OPA A;  5LL6 Z;  1GLJ O;  3OYA A;  3SBT A;  2P9L B;  4DTN A;  4KTW A;  2RE2 A;  3SBG A;  4GY2 B;  4O0I A;  5BPM A;  1S3X A;  1UA1 A;  2NRX A;  3THY B;  2PZS A;  2Z1G A;  3I33 A;  1YHQ N;  4FJ7 A;  3ZSO A;  1TK0 A;  3AVF A;  3ZSQ A;  1NOZ A;  3H46 O;  2NRT A;  3ITH A;  5HOO A;  5LJV A;  3KD5 E;  4PA1 A;  3CC2 N;  4OKE A;  4KKO A;  3VPZ A;  1MWK A;  3L2R A;  1YTU A;  3SLC A;  4W5Q A;  4DU4 A;  2IVP A;  2YCH A;  4EHT A;  5AQW A;  1NKC A;  3VET A;  3AAP A;  3ID6 A;  5ADX A;  4DV0 K;  3P38 A;  2DFF A;  2FSJ A;  2P9I A;  4Z4I A;  4J2E A;  1U04 A;  3L2Q A;  3F2K A;  2PAV A;  3ZYY X;  3K57 A;  1N34 K;  1K6Y A;  1E4F T;  4FWN A;  5CYM A;  3BUZ B;  3OHR A;  3RMC A;  4EHU A;  4B1V A;  1RDC A;  4YOY A;  3K5O A;  4FO0 A;  4BRM A;  1OH8 A;  4ELT A;  4GV9 A;  4AHR A;  2BH1 A;  2GWK A;  5K14 A;  3ZLJ A;  4CF9 A;  4BGB A;  1RBV A;  4I2Q A;  3CER A;  2VYP A;  1Z25 A;  5CZ1 A;  4CHN A;  3UKU A;  2P9N A;  2E1Z A;  3KHY A;  3H1V X;  4NCA A;  3V6D A;  4MLH A;  4M63 C;  4MDA A;  3LM2 A;  5T7B A;  2YJE A;  4JYA K;  1I94 K;  4HTL A;  3PO5 A;  3B6P A;  1ZBI A;  4LH5 A;  1JXB A;  1NMD A;  4CEQ A;  4M3T A;  5I9E B;  3OS1 A;  3NGY A;  1DT9 A;  1BA0 A;  2UUA K;  3AO4 A;  3VF4 A;  3DWL A;  5EVZ A;  1E3M A;  3AA2 A;  4FWS A;  4E7J A;  2XY5 A;  2DFH A;  3TAR A;  4JHD A;  4HWI A;  3BEX A;  2YI1 A;  3VQE A;  4CK2 A;  3JSM A;  1L3T A;  1I39 A;  1RDU A;  3HST B;  3P83 D;  4DMN A;  1W0H A;  1TGO A;  1VK0 A;  3KLG A;  3VQ5 A;  2RN2 A;  4XIU A;  4MDB A;  1SUQ A;  3KWG A;  1GOC A;  4H03 B;  4YOW A;  3AVM A;  4E7K A;  3TAE A;  5GAH P;  5AJ3 K;  3D2F A;  4PWD A;  1IKY A;  3HP9 A;  3TAG A;  2F96 A;  2HHT A;  1S1U A;  2CGK A;  2HHW A;  1R0A A;  3VQB A;  3AVG A;  2E20 A;  1NGE A;  1X3M A;  2A3Z A;  1XWL A;  4YDU A;  2WBN A;  4FM1 A;  3ZT4 A;  3ALY A;  2E5L K;  3D45 A;  3VQP A;  4U67 L;  1WOQ A;  2FLO A;  4MLE A;  3J80 O;  1WBD A;  1ATN A;  2O4G A;  3CMA N;  3MXM A;  3OYM A;  3QEV A;  4H0O A;  3UKR B;  3C6U A;  3V9S A;  2YHB A;  4LC9 B;  1K8A O;  4M42 A;  3IG1 A;  2WTU A;  4FW1 A;  4DHY A;  1S9E A;  4UY8 O;  4TSX A;  2P9P B;  2HNZ A;  4CZF A;  4IDH A;  5BRH A;  4HTU A;  4DTX A;  1MWM A;  1HQE A;  1T3V A;  3WXM B;  4DTO A;  4H4M A;  4JRQ A;  3LAK A;  2D0O A;  1U4B A;  2DTU A;  3N4P A;  3NF6 A;  3EY1 A;  2P9N B;  1YJW N;  4DR6 K;  3BF1 A;  5C10 A;  4MO5 A;  4BRC A;  4KFB A;  3EZ5 A;  2BE2 A;  5JIC A;  4IOC L;  3OYE A;  4DTM A;  4OGE A;  1P90 A;  3CF5 L;  3NGZ A;  2OPS A;  4JI0 K;  4C8O A;  3HXM A;  3FZM A;  1EWR A;  3T1H K;  4FLZ A;  5C15 A;  5HL7 L;  3EZW A;  3QB0 A;  3DXM B;  4JI3 K;  1VSE A;  4BDZ A;  2OZS A;  3NF7 A;  4BVP A;  2ZE2 A;  3OYB A;  1N5Y A;  1REV A;  4JKB A;  4K43 A;  1XHX A;  3O1B A;  1F21 A;  2QWM A;  2DY4 A;  2KQ2 A;  3U9Z A;  2YNG A;  4N47 A;  4JRP A;  1VSJ A;  4PKG A;  5CHI A;  1ILY A;  4Z4E A;  5J2P A;  3J7Y P;  3ATU A;  5BR9 A;  1IBK K;  2BDP A;  3CCR N;  4AHU A;  2UXB K;  3VQQ A;  4C8M A;  3CCS N;  3J81 O;  4FJ8 A;  1YTA A;  4B9U A;  4BRO A;  4R5P A;  2VQE K;  3PIP L;  2QWL A;  3HTV A;  3ZCM A;  4C8L A;  4B8A B;  4CK1 A;  3MN7 A;  4JI4 K;  4IXC A;  1SAZ A;  4X65 K;  4BR4 A;  3QET A;  5HRO A;  1DTQ A;  4A5A A;  3SCX A;  3MED A;  2EX3 A;  1S6Q A;  4XH1 A;  1WSH A;  4YHH K;  5AQK A;  4B8C A;  3AO1 A;  4FJG A;  3E1Y A;  4Q0B A;  3PSF A;  4FWK A;  4AHC A;  3V9W A;  1Z05 A;  1B92 A;  3TR8 A;  2D5R A;  3OYG A;  4F9O A;  5M1Q A;  1B9F A;  1NJW A;  3A5L C;  4X64 K;  4KTQ A;  2F8T A;  2W6K A;  2P9U B;  1LOT B;  3CM6 A;  4NLC A;  2CGL A;  1BUP A;  3TSP A;  2Q31 A;  2XRI A;  4JAX A;  1RDB A;  3ZSY A;  1JLE A;  1ASV A;  4F3T A;  3V81 A;  4JEP A;  3DJC A;  4DWI A;  3Q7B A;  1S1T A;  5DM7 L;  1T05 A;  2GTD A;  2Q36 A;  3D6R A;  3TSQ A;  3TAF A;  3DLK A;  2QKB A;  4CFC A;  3SAH A;  1ZBU A;  5C0Y A;  2HST A;  4OX9 K;  4DQQ A;  1Q7Y O;  5I3U A;  2XY6 A;  3PUF A;  4RTF D;  3CI5 A;  3T3F A;  3EKS A;  3T1Y K;  2OCE A;  1BIS A;  4FZY A;  3K9J A;  3P1G A;  3TAN A;  2O8C B;  1C0F A;  1GLA G;  5C24 A;  5HP1 A;  1RDD A;  3VQ4 A;  2PYL A;  2Q1N A;  1Y64 A;  1DTT A;  1TKT A;  3O4N A;  1I3A A;  3DOK A;  3EE8 A;  5C42 A;  1FJG K;  3VEX A;  2G8F A;  1NGD A;  4I9Q A;  1DLO A;  3C65 A;  5FPN A;  2J4R A;  1U45 A;  3FE1 A;  1RBR A;  3O9R A;  4CFD A;  1L3U A;  4B3T K;  2P9S A;  1YVN A;  4PY5 A;  4B3O A;  3ASM A;  1GOB A;  3K5L A;  5F1X A;  4FWQ A;  1VQ4 N;  1CXU A;  4DR5 K;  1HNZ K;  1WAF A;  1HUX A;  2QEX N;  4CBX A;  3BP8 A;  4H0P A;  4BE1 A;  3AGK A;  3S3N A;  2FBT A;  2E2O A;  5E84 A;  5LY3 A;  4W5R A;  4OLB A;  1Q82 O;  4G9Z A;  3BZC A;  3VQ6 A;  4FVM A;  1GOA A;  4BRI A;  3U4L A;  3HM8 A;  3G10 A;  3ATV A;  4FPB A;  3FFK B;  3HP6 A;  3U6F A;  2VQF K;  2HND A;  5SZT A;  4CEO A;  2YNI A;  3TAQ A;  3LWM A;  4DV7 K;  4H0T B;  1T6C A;  3E9P A;  3CFO A;  1XNR K;  3P39 A;  1YVU A;  3C6H A;  4JKE A;  5FPD A;  5J1E A;  3P31 A;  1YI2 N;  1Q8I A;  3C6A A;  2G8I A;  2E8A A;  3V1O A;  4NXN K;  4CEE A;  4CZL A;  5HLF A;  4CZI A;  3K5M A;  2UXD K;  3NHG A;  3QBX A;  4EP4 A;  4A2B A;  4QS7 A;  4BG8 A;  4CGF A;  3SV4 A;  5KQD A;  4H8K A;  2HOE A;  3NH1 A;  1XNQ K;  4MFB A;  2QW9 A;  2VGN A;  1ZBS A;  2D4W A;  2VGM A;  1Z26 A;  2W42 A;  3ZET B;  3R9P A;  3L2W A;  1EWQ A;  1ZBL A;  2F8S A;  3J8A A;  1QS4 A;  4LSN A;  1YF5 L;  4DS5 A;  3MXI A;  4FOI A;  1ZYQ A;  4F8R A;  1HRH A;  2JWL A;  3CPE A;  2ITG A;  2NRZ A;  3WQU A;  4C1N I;  3HI0 A;  1QE1 A;  3HVR A;  1VQO N;  2FXU A;  1NGH A;  1W97 L;  1VQ6 N;  1BG3 A;  1RCH A;  4DB3 A;  4IG3 A;  4CF2 A;  3QES A;  1J5E K;  3MX2 A;  4KHQ A;  3OYC A;  5HRR A;  4FXD A;  2OAN A;  4M45 A;  1MU2 A;  1NK4 A;  3V4I A;  1RNH A;  2E2Q A;  3ZX0 A;  2BAN A;  1VQ8 N;  3QIC A;  3G4S N;  1LW0 A;  2GEL A;  3QIP A;  3CJB A;  4FWM A;  3DLH A;  3W3D A;  1IJJ A;  2ZF5 O;  3AVJ A;  3HPG A;  4CF1 A;  3JAM O;  1VSH A;  3VEO A;  1GLB G;  3CD6 N;  5J2M A;  1RTJ A;  1J53 A;  1S6P A;  1TVR A;  1GLF O;  2G8W A;  1JLA A;  2P9L A;  4E0D A;  3K58 A;  1RTH A;  1S9G A;  3THY A;  4V19 S;  2IAJ A;  4CF8 A;  3SNN A;  5DM6 L;  3C7N B;  2IDO A;  5AQX A;  3HJF A;  3CQY A;  1T44 A;  4HHT A;  1TUY A;  3CM5 A;  4FJJ A;  1HQU A;  4B9L A;  4PL8 A;  4FJL A;  4CJW A;  3KK2 A;  3L8B A;  2RPI A;  3QML A;  2JWK A;  3BF3 A;  3CFR A;  4BR9 A;  4CZJ A;  3A8Y A;  2QA4 N;  2ETJ A;  3NBP A;  1U2V A;  4RCH A;  4XH5 A;  1ZC6 A;  1QQC A;  1TL1 A;  3ZX3 A;  2QK9 A;  5H1S Q;  4BR7 A;  3CQ8 A;  5DK5 A;  4JI2 K;  3R6M A;  4DTS A;  1NGB A;  5KI6 A;  1SQK A;  4CEB A;  4CZK A;  5JMV A;  1S72 N;  3RRH A;  4CGJ A;  1QSS A;  1ESV A;  4W5T A;  1OVQ A;  3RSE B;  2VG7 A;  4NYN A;  2IVN A;  3MEE A;  3THW B;  4LF5 K;  5EOY A;  1JL1 A;  2AP1 A;  3QEX A;  3L6Q A;  4N56 A;  1JCE A;  4JNE A;  4DR7 K;  1QHT A;  3HO1 A;  4DTR A;  2DPN A;  5IWA K;  5AQF A;  4CFB A;  3M3Z A;  1YIT N;  1OH7 A;  1QZ6 A;  3VEW A;  3PY8 A;  2RHK A;  3O3F A;  1QQM A;  2FBX A;  1KLM A;  2E2N A;  2B6A A;  4IBN A;  4GMJ B;  4DKW A;  3ZT2 A;  4XH4 A;  4KHW A;  3LDP A;  4B1Y B;  4FM0 A;  4ILG B;  1IV0 A;  4DSF A;  3QEW A;  3ZSX A;  1WSG A;  3MX5 A;  2BUP A;  4DSK A;  4WFA L;  3DXK A;  4K41 A;  1HPM A;  3B6O A;  4Y1D A;  5HBM A;  4AIL C;  1RDA A;  3R8E A;  3MK6 A;  2QXL A;  3M1F A;  3SAF A;  2F4V K;  2OPQ A;  2ASO A;  3KWI A;  4RW6 A;  1C1C A;  4H5V A;  4B9Q A;  2Y1I A;  4Z4H A;  5LJW A;  5BR8 K;  1FW6 A;  1IKX A;  5AQI A;  1U2V B;  1U6Z A;  4CJS A;  2YHY A;  5E41 A;  3LP0 A;  2HHU A;  3VTI A;  4KI6 A;  3OTO K;  4H0Y B;  4JK7 A;  5AQO A;  3ZT3 A;  3KIO A;  3CET A;  3CCL N;  1X1P A;  4L3Q A;  3KLH A;  5J2Q A;  1N33 K;  4QOZ B;  2O8B A;  5GIN A;  3UKR A;  1J9A A;  1TAQ A;  4DLE A;  2GBZ A;  3KJV A;  2W41 A;  3HM9 A;  1CZA N;  2P9P A;  3AA4 A;  5HRN A;  4QS8 A;  1QZ5 A;  3O3G A;  1SKS A;  4YOT A;  1DGK N;  4H5N A;  4E19 A;  4JS4 A;  1HYS A;  3KLF A;  4IDK A;  2GV9 A;  5HRP A;  4O8U A;  4KV8 A;  1SS6 A;  2QWQ A;  4CE9 A;  2O8E A;  3CC7 N;  2D0A A;  2W6L A;  4IJA A;  4Q5V A;  2XY8 A;  1JCG A;  4A5B A;  1RDW X;  1NBW A;  2HNY A;  5F0X A;  2YNF A;  4UQG A;  4K0K K;  2OTL N;  3M8P A;  2BTF A;  5I42 A;  4FZX C;  4M3Y A;  5AFU H;  3AA3 A;  3S41 A;  3HOS A;  3ULE A;  3LP2 A;  3VQD A;  3ENH A;  1NKE A;  3ZSR A;  3G25 A;  2E1Y A;  3DXM A;  2EHG A;  3DXK B;  1YIJ N;  3K59 A;  1SKW A;  1GLE G;  3THX A;  3AO5 A;  3DI6 A;  2IIR A;  4NB4 A;  1N36 K;  3U9D A;  3OYI A;  3CC4 N;  3U3G A;  5JS2 A;  1BI4 B;  5AQS A;  3VQA A;  4A62 A;  3D7E O;  1IG8 A;  4CIE A;  4FJ5 A;  1FK9 A;  1QVF M;  4KH5 A;  1GLD G;  1O13 A;  2ZD1 A;  1LWC A;  4B1X B;  4FLV A;  3KK1 A;  1XC3 A;  4ID5 A;  4FJM A;  3DLL L;  1CLQ A;  3VEZ A;  4B9M A;  4CBW A;  1KVB A;  4ZTJ A;  3OJS A;  4DF4 A;  2R7Y A;  2HBL A;  3D2E B;  4H5W A;  4CJ3 A;  4CJT A;  3AY9 A;  2O8B B;  4C1N K;  4BE2 A;  3LDO A;  2YV0 X;  3I0S A;  3M8Q A;  2P9K B;  4NCG A;  4CED A;  3AV9 A;  3PX0 A;  4CGI A;  2IVO A;  3K5N A;  4CEC A;  3EEQ A;  3CJC A;  4BR0 A;  3WT0 A;  4BRG A;  4NCB A;  1CZ9 A;  3GDQ A;  3SQ4 A;  4FWL A;  5E26 A;  2O8E B;  4CBU A;  1NJI O;  4Z94 A;  4CHY A;  2XO7 A;  2YHX A;  1TK8 A;  1OVY A;  4JKC A;  2OYQ A;  4FK2 A;  2P9U A;  2KFN A;  3DRS A;  1QVG M;  3IRX A;  3QEP A;  1ZBH A;  2NRH A;  3QFP A;  3NAE A;  3ULD A;  3PSI A;  3SUO A;  1Q86 O;  2VWB A;  1RT7 A;  3RTV A;  1M90 O;  3RR7 A;  4Y1C A;  1HNW K;  3K0S A;  4CGH A;  3ULE B;  4DV3 K;  2UU9 K;  1WNS A;  3R1X A;  2I7P A;  3THX B;  2O8D A;  5LMU K;  1MDU B;  3FLC O;  1XQS C;  3TI0 A;  4AHS A;  1XHZ A;  4DQP A;  3LL3 A;  4CZG A;  2FF6 A;  4M7Y A;  3AAR A;  1Q9Y A;  2O4I A;  4BWM A;  3WNE A;  3ZSW A;  2O8C A;  5IT9 O;  4EZ9 A;  3LPT A;  4DLG A;  3CJ9 A;  2HVH A;  2G8H A;  4OJR A;  1B9D A;  4OPH A;  1C0M A;  2QM1 A;  2D0B A;  3V9U A;  1C1B A;  3SI6 A;  4ELU A;  4JI7 K;  1WN7 A;  4E7L A;  4DUZ K;  3H45 C;  1SL1 A;  2HBM A;  1VQ5 N;  4KH6 A;  5BN8 A;  2X74 A;  1HKG A;  1VQL N;  4CJE A;  2Q97 A;  1NJZ A;  3GBT A;  3QFU A;  4KHS A;  3QNN A;  4M3X A;  1U48 A;  1RT4 A;  2UUB K;  3P4I A;  1IH7 A;  1WLJ A;  1HMV A;  2PFU A;  3BZK A;  4CJF A;  3I56 N;  4WFN L;  1WUA A;  1JLB A;  5CR4 A;  4OKJ A;  3C0B A;  4DQR A;  3L4I A;  3TAP A;  5AQN A;  2E6L A;  3VQ8 A;  4AHT A;  1NK6 A;  5B8H A;  4BRN A;  2GUI A;  3IFR A;  3O4W A;  3SMS A;  5AFU A;  4JKF A;  4BVO A;  2HB5 A;  5KPZ A;  4BAC A;  3TSU A;  2VWK A;  5M1O A;  4I2P A;  4M3R A;  3SQ1 A;  4DTU A;  4Z4F A;  1DEJ A;  1NM1 A;  3TAB A;  1HNV A;  4DFM A;  3T69 A;  5LMN K;  4C8N A;  4N5S A;  1X3N A;  1KVC A;  1XUP O;  3NCI A;  4YNQ A;  2O8D B;  5ELZ A;  3OW2 M;  3VEY A;  3RWU A;  3NH0 A;  3BDP A;  1KFS A;  1YAG A;  4BDY A;  1JLQ A;  4EFH A;  4WQ4 A;  1VHX A;  3DLE A;  4JKA A;  1QSL A;  4XEI A;  3VES A;  4HCB A;  2WON A;  5AZI B;  3LZJ A;  3SUQ A;  1QHA A;  5KPR A;  2XY7 A;  4Z4C A;  4CJU A;  3NMU A; 
#chains in the Genus database with same CATH homology
 3QIC A;  3G4S N;  1K8K A;  4CZH A;  2GEL A;  3H46 O;  3ZET A;  2NRT A;  3CJB A;  1HKB A;  1ZXO A;  3LM9 A;  4FWM A;  4NLB A;  5HOO A;  3FZF A;  1J6Z A;  5LJV A;  3O9U A;  3W3D A;  1BA1 A;  3VER A;  1EO1 A;  1IJJ A;  4NO7 A;  3CC2 N;  3VPZ A;  1MWK A;  2Q2R A;  2ZF5 O;  2F9T A;  3SLC A;  3Q7C A;  3UKU B;  4ISF A;  4BG9 A;  1G99 A;  3LDQ A;  2IVP A;  2YCH A;  4EHT A;  5AQW A;  2QWR A;  3H3N O;  3VEO A;  3VET A;  1JCF A;  1GLB G;  3MCA B;  4AF1 A;  3AAP A;  3ID6 A;  3UB5 A;  5ADX A;  3EKU A;  3CD6 N;  4JKH A;  3P38 A;  4BQL A;  2QWN A;  2FSJ A;  4PHT X;  2P9I A;  4EIA A;  1RFQ A;  3F2K A;  2A42 A;  2OTJ N;  1GLF O;  3CQX A;  2PAV A;  4ILJ A;  3HRG A;  1KAY A;  3ZYY X;  2ZGY A;  4JD2 B;  2A40 A;  2P9L A;  3ZX0 A;  1E4F T;  2YX6 A;  3KK7 A;  4FWN A;  3VOV A;  3BUZ B;  3OHR A;  1NGG A;  3RVC A;  4BRA A;  3GL1 A;  5AQV A;  3HOT A;  1NGI A;  5AZI A;  4EHU A;  4JHD B;  4B1V A;  3O9S A;  3VF6 A;  4YOY A;  4FO0 A;  1H1V A;  5DM6 L;  3C7N B;  4BRM A;  4GV9 A;  3FZH A;  5AQX A;  1VQ9 N;  2BH1 A;  1T44 A;  3CQY A;  2GWK A;  3VGK A;  2KHO A;  5AZJ B;  1TUY A;  4ISE A;  4BGB A;  4JN4 A;  4PL8 A;  1YJ9 N;  1HJO A;  4WCE L;  3CER A;  3WXK A;  2VYP A;  3UKU A;  2P9N A;  2E1Z A;  3KHY A;  3QML A;  2JWK A;  3BF3 A;  3H1V X;  3SAG A;  3FGU A;  3D2F B;  3KVG A;  5F2R A;  2NRV A;  3UE5 A;  4BR9 A;  3A8Y A;  4CZJ A;  4MLH A;  5GAG P;  4M63 C;  2QA4 N;  3E66 A;  1U2V A;  4MDA A;  3LM2 A;  4RCH A;  5BRF A;  2YJE A;  4FSV A;  4XH5 A;  3SK3 A;  4HTL A;  4A2A A;  1ZC6 A;  3JXU A;  3VMF B;  1VQK N;  1BOT O;  1NMD A;  4WQ4 C;  3ZX3 A;  2ZJP L;  5H1S Q;  2UYT A;  2V7Z A;  5BRE A;  4GVE A;  4BR7 A;  5I9E B;  3O5B A;  4BRP A;  3CME N;  4C23 A;  4EAH D;  4A61 A;  1DT9 A;  1BA0 A;  4JD2 A;  3A5O C;  3R6M A;  3VF4 A;  3DWL A;  5EVZ A;  4FWS A;  2HBJ A;  2V51 B;  1BWF O;  4RWT A;  1NGB A;  4JHD A;  4I6M A;  4HWI A;  3LDL A;  3BEX A;  2YI1 A;  1SQK A;  4CZK A;  5BRD A;  5JMV A;  1S72 N;  3TTD A;  2NLX A;  3E9L A;  1ESV A;  3C7N A;  2I7N A;  1K8K B;  3RSE B;  1RDU A;  2IVN A;  5AZJ A;  5AQR A;  3NVK A;  3TPQ A;  5EOY A;  3O8M A;  2Q0R A;  2AP1 A;  4MDB A;  3KWG A;  3L6Q A;  4H03 B;  1EQY A;  4YOW A;  1JCE A;  4JNE A;  3VTH A;  3TTF A;  4BRF A;  5GAH P;  3GG4 A;  3CHW A;  3D2F A;  2DPN A;  2HMP A;  5M1K A;  3CCV N;  5JVH L;  4AM7 A;  5AQF A;  3IKM A;  3CCJ N;  2CGK A;  3M3Z A;  3ZEU A;  1YIT N;  1QZ6 A;  3VEW A;  5M1P A;  2RHK A;  2FSN A;  2E20 A;  5AQT A;  4MO4 A;  3W0L A;  1QQM A;  1NGE A;  1X3M A;  2A3Z A;  3EE9 A;  5C12 A;  1ATR A;  4YDU A;  2E2N A;  2WBN A;  4WF9 L;  2EWS A;  3FR0 A;  3PLA A;  4IOX A;  4DKW A;  1KD1 O;  4U67 L;  1WOQ A;  2FLO A;  3MN6 A;  3LDP A;  4MLE A;  4O8K A;  4XH4 A;  4B1Y B;  4FL9 A;  4ILG B;  2F9W A;  4IWV A;  1ATN A;  3CMA N;  5MLC Q;  1VQ5 N;  1QQN A;  3MX5 A;  4GV3 A;  3O9Q A;  3EN9 A;  2BUP A;  5M1F A;  4H0O A;  4WQ5 A;  2ZJR L;  3UKR B;  2A6A A;  4WFA L;  4LC9 B;  3DXK A;  1K8A O;  4K41 A;  1HPM A;  4DHY A;  1TYQ B;  4UY8 O;  2P9P B;  4CZF A;  2WFB A;  4IDH A;  3RSE A;  5BRH A;  1MWM A;  1T3V A;  3R8E A;  3VGM A;  3WXM B;  3MK6 A;  2QI2 A;  2QXL A;  4BC4 A;  3M1F A;  3O9T A;  2GWJ A;  2HF3 A;  3OBY A;  4BR2 A;  3SAF A;  4CD1 A;  4BRK A;  5ADX H;  2D0O A;  2ASO A;  3N4P A;  3KWI A;  4H5V A;  4B9Q A;  1Q81 O;  3FZL A;  3IDH A;  3WUH A;  2P9N B;  3OBW A;  4IEI A;  5LJW A;  3J7Z O;  1YJW N;  3BF1 A;  3ENO A;  5C10 A;  4MO5 A;  4BRC A;  5AQI A;  3A5M C;  4BRH A;  1U2V B;  1U6Z A;  2E2P A;  3WXI A;  2YHY A;  3MDQ A;  5JIC A;  2FSK A;  5AQU A;  4IOC L;  3VTI A;  5FPE A;  4FWR A;  2YHW A;  1P90 A;  2CH6 A;  4H0Y B;  4IJN A;  4JK7 A;  3CF5 L;  1W2B M;  2NRW A;  5AQO A;  3CCM N;  4KH4 A;  2GX9 A;  3CET A;  3FZM A;  4H5R A;  3CCL N;  4B1U B;  4L3Q A;  4PKH A;  5GIN A;  3UKR A;  4YOR A;  5C15 A;  3PIO L;  1KAZ A;  5HL7 L;  1VQ7 N;  3EZW A;  4I6M B;  3QB0 A;  3DXM B;  2W41 A;  1TYQ A;  1YHQ N;  1CZA N;  4K42 A;  2P9P A;  2V7Y A;  1YJN N;  4QS8 A;  1QZ5 A;  5BPN A;  4IZ9 A;  3H3O B;  1YUW A;  1SZ2 A;  5EXW A;  4CI6 A;  4PKI A;  2Q0U A;  4BVP A;  4IFE A;  1N8R O;  1VQP N;  4YOT A;  5AQQ A;  1DGK N;  4H5N A;  4JKB A;  4K43 A;  3O1B A;  3CIP A;  2D0P A;  4K25 A;  4O5F A;  1JJ2 M;  1TUU A;  4QS9 A;  4WYB A;  3MN9 A;  1HX1 A;  2QWM A;  4O8U A;  3TTC A;  1SS6 A;  2QWQ A;  5GIP A;  3U9Z A;  3CC7 N;  4B1W B;  4B1Z A;  4M7X A;  4IJA A;  4PKG A;  5CHI A;  4IO8 A;  5EX5 A;  4BR5 A;  3ZEU B;  1JCG A;  1ILY A;  5AQG A;  3H1Q A;  4A5B A;  3ATU A;  4H0X B;  5BR9 A;  1RDW X;  1RGI A;  1NBW A;  5BN9 A;  3ZX2 A;  3CCR N;  1NGC A;  5F0X A;  3ENB A;  3K9K A;  4WQ5 C;  2OTL N;  3CCS N;  5GAE P;  2V52 B;  1HLU A;  4H0V B;  2BTF A;  3L0Q A;  4BRO A;  2ZJQ L;  2F7T A;  3CCQ N;  2WUS A;  5AFU H;  3PIP L;  3S41 A;  3HOS A;  2QWL A;  4JKG B;  3HTV A;  3ULE A;  3ENH A;  4CZE A;  3MN7 A;  3CJA A;  4IXC A;  5JLH A;  3G25 A;  2E1Y A;  1SAZ A;  3DXM A;  3DXK B;  4BGA A;  3G71 N;  5C2D A;  1YIJ N;  4GV6 A;  1GLE G;  1NLV A;  4BR4 A;  5GIO A;  2IIR A;  1K73 O;  4A5A A;  4NB4 A;  3HZ6 A;  3U9D A;  5AQL A;  1R59 O;  1GLL O;  4BRL A;  3CC4 N;  2PBD A;  1ATS A;  2ITM A;  4XH1 A;  3A0I X;  1NGF A;  5AQK A;  4A59 A;  5AQS A;  2NNW A;  4BRQ A;  4DQ8 A;  3E1Y A;  4A62 A;  3D7E O;  4FWK A;  1IG8 A;  4FOE A;  1BDG A;  1QVF M;  1Z05 A;  4KH5 A;  5KPT A;  1GLD G;  1O13 A;  1K9M O;  4YOU A;  5GAD P;  4F9O A;  5M1Q A;  3I55 N;  4BC5 A;  3A5L C;  4KBO A;  2H3G X;  3EO3 A;  2P9U B;  4YOV A;  2GEM A;  4B1X B;  1KXP A;  5CE3 A;  1LOT B;  3VF2 A;  4NLC A;  1BU6 O;  3O08 A;  2CGL A;  3CJ1 A;  4DCH A;  4FWP A;  1XC3 A;  1BUP A;  2KKZ A;  3F9M A;  3TSP A;  2Q31 A;  5AQM A;  4JAX A;  3DAW A;  3DLL L;  3EL2 A;  2A41 A;  3VEZ A;  4CBW A;  3SMP A;  4JKG A;  4JEP A;  3U8X A;  2HBL A;  3D2E B;  3DJC A;  4H5W A;  3AY9 A;  3Q7B A;  4C1N K;  5DM7 L;  3LDO A;  4BRE A;  5JLF A;  3IMX A;  2GTD A;  2P9K B;  2P9S B;  2Q36 A;  3D6R A;  3TSQ A;  4IOA L;  1GLC G;  3O6W A;  3SAH A;  5C0Y A;  2IVO A;  2HST A;  1Q7Y O;  3CJC A;  4BR0 A;  3WT0 A;  1QQO A;  4RTF D;  4BRG A;  3CI5 A;  3OA9 A;  3GDQ A;  1VQM N;  4BY9 C;  3EKS A;  4FWL A;  5E26 A;  3SJH A;  4CBU A;  1NJI O;  3AAQ A;  4Z94 A;  3K9J A;  4IO9 L;  1C0F A;  2YHX A;  1OVY A;  1GLA G;  1LCU A;  4FWO A;  2KLA A;  4JKC A;  3CCU N;  3WEE A;  2P9U A;  1QVG M;  1T6D A;  2Q1N A;  1Y64 A;  3TU5 A;  4E1J A;  3CPW M;  2NRH A;  2A5X A;  3QFP A;  4BC2 A;  2WC9 A;  3O80 A;  1VAZ A;  3EE8 A;  1Q86 O;  1HKC A;  2VWB A;  3AGR A;  1VQN N;  3VEX A;  1NGD A;  3F5T A;  4U7B A;  1M90 O;  1BO5 O;  3D2E A;  3MWT A;  4J8F A;  3ULE B;  3C65 A;  5FPN A;  2J4R A;  3N4Q A;  3MCP A;  5C2F A;  2NZT A;  3FE1 A;  3O9R A;  2P9K A;  2P9S A;  3B8A X;  1YVN A;  2HBK A;  2I7P A;  3R1X A;  3VGL A;  4PL7 A;  3H6E A;  5FPM A;  5F1X A;  1MDU B;  3FLC O;  1XQS C;  4FWQ A;  4BQZ A;  1VQ4 N;  3HSC A;  3LL3 A;  3IUC A;  4CZG A;  2FF6 A;  4OO1 J;  1HUX A;  4M7Y A;  2QEX N;  3AAR A;  3E9O A;  4CBX A;  3BP8 A;  3ID8 A;  3QDK A;  4H0P A;  1Z6R A;  3AGK A;  4FPA A;  2E2O A;  5E84 A;  4YDU C;  5LY3 A;  2D1K A;  1Q82 O;  4CZM A;  4G9Z A;  4BC3 A;  3I8B A;  4BRI A;  3U4L A;  2W40 A;  5AQJ A;  3HM8 A;  4AM6 A;  1NGA A;  2ZWH A;  4JK9 A;  3CJ9 A;  3ATV A;  4FPB A;  2QWP A;  4IEE A;  4OPH A;  3FFK B;  2QWO A;  3L4Q A;  2QM1 A;  4GNI A;  2ZGZ A;  2HF4 A;  5AQZ A;  4R79 A;  4H0T B;  1T6C A;  3E9P A;  3P39 A;  2FF3 B;  3H45 C;  3HBT A;  3C6H A;  3M6G A;  4JKE A;  1NGJ A;  5FPD A;  3JS6 A;  3MWP A;  2AA4 A;  3KZB A;  3GOI A;  2HBM A;  1NWK A;  3QBW A;  2NRR A;  4KH6 A;  3P31 A;  3VEV A;  5BN8 A;  4WFB L;  1HKG A;  1YI2 N;  1E4G T;  3MN5 A;  1VQL N;  3C6A A;  4JK8 A;  2CH5 A;  2E88 A;  1V4T A;  4Y0W A;  2Q97 A;  3R3L A;  2E8A A;  4A57 A;  3GBT A;  3QFU A;  1OKJ A;  2GUP A;  4JKD A;  3CXC M;  1DKG D;  4CZL A;  5AQY A;  3P4I A;  4CZI A;  3CCE N;  3T7Z A;  2PFU A;  5AQP A;  3QBX A;  4A2B A;  4QS7 A;  4BG8 A;  3I56 N;  3VEN A;  1WUA A;  4WFN L;  5CR4 A;  1C0G A;  3CJ7 A;  3C0B A;  3L4I A;  3WXL A;  5KQD A;  2HOE A;  5TKW A;  4CD3 A;  2YJF A;  5AQN A;  2QW9 A;  3WXJ A;  4CJ7 A;  4H5T A;  2VGN A;  2VCP A;  5AQH A;  1ZBS A;  5B8H A;  1S22 A;  4BRN A;  2D4W A;  2VGM A;  1YXQ A;  3WQT A;  4FVU A;  3IFR A;  1KC8 O;  3O1W A;  2QTD A;  3WEE B;  1D4X A;  3O4W A;  3ZET B;  3SMS A;  1M1K O;  3MMV A;  4BRD A;  3R9P A;  3M5R A;  5AFU A;  4JKF A;  4BVO A;  4YOX A;  1Q18 A;  5KPZ A;  3J8A A;  5TKY A;  1X9J A;  5BPL A;  1YF5 L;  5M1O A;  1P8Z A;  3A5N C;  3NVM A;  2ASM A;  4FOI A;  3TSU A;  3GE1 A;  3LDN A;  1DEJ A;  1NM1 A;  1KAX A;  2JWL A;  3CPE A;  2NRZ A;  3FZK A;  3WQU A;  4C1N I;  4ILH A;  3HI0 A;  3T69 A;  1VQO N;  5KQ8 A;  2FXU A;  1X3N A;  5AR0 A;  1NGH A;  1W97 L;  1XUP O;  1BG3 A;  4DB3 A;  1VQ6 N;  2ASP A;  5EY4 A;  5JVG L;  5ELZ A;  3MX2 A;  2P9I B;  3OW2 M;  5M1N A;  4ISG A;  3VEY A;  2CGJ A;  4OPA A;  2OAN A;  1YAG A;  1GLJ O;  3SBT A;  2P9L B;  4EFH A;  4WQ4 A;  2RE2 A;  3SBG A;  4GY2 B;  4JKA A;  4XEI A;  3VES A;  5BPM A;  1S3X A;  2NRX A;  5AZI B;  3G6E N;  1KQS M;  1V4S A;  1QHA A;  2E2Q A;  5KPR A;  3I33 A;  1MA9 B;  1VQ8 N;  3NMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...