4MDBA

Structure of mos1 transposase catalytic domain and raltegravir with mg
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
224
structure length
201
Chain Sequence
HELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFVNGKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mariner Mos1 transposase
publication title Structural Basis of Mos1 Transposase Inhibition by the Anti-retroviral Drug Raltegravir.
pubmed doi rcsb
source organism Drosophila mauritiana
molecule tags Hydrolase/hydrolase inhibitor
total genus 72
structure length 201
sequence length 224
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01359 Transposase_1 Transposase (partial DDE domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4mdbA00
3K9JA 5CR4A 3K9KA 4MDAA 4MDBA 5HOOA 3F2KA 3HOTA 3HOSA 4U7BA 2F7TA 4R79A
chains in the Genus database with same CATH superfamily
3QEPA 5IWAK 3C6AA 3AVJA 1BIUA 3FGUA 4CGGA 1NK6A 2HF3A 5GINA 4FM1A 3ZSOA 3CJ9A 3CCJN 2D0OA 1QQCA 1KLMA 3OYCA 1E4FT 3P83D 4FJNA 4IOAL 4Z4FA 1C1BA 2D0AA 4B9LA 5M1OA 4A5BA 2ZGZA 3CCVN 1J5OA 3BF1A 3MCPA 2PYLA 1RTJA 2AJQA 2F96A 4HUGA 1LAVA 4W5QA 3SQ4A 1S9EA 4BE0A 1ASUA 3ATUA 1VSHA 1KFDA 2F9TA 3CI5A 4ILJA 4OVLA 3OYDA 1X9SA 3ZSYA 3ZSZA 3U8XA 2WONA 1QVGM 3CERA 1U47A 4CJ7A 2BE2A 5BPNA 4QOZB 1VQ7N 1YJNN 3L4IA 2IVOA 4F8RA 4O44A 4JN4A 2O8CB 3QERA 4H5VA 3HVTA 3A5NC 1OH7A 4H5RA 1HNIA 2KKZA 4DSIA 1BDGA 4CHZA 2UUBK 2CGKA 1ZBUA 1BL3A 2XO7A 4IKFA 4GW6A 2PFUA 4JKHA 1ITGA 2DFHA 2R7YA 4Y1CA 5AQNA 4IFYA 1T6CA 4DTOA 3AVMA 3NGYA 2O8BA 2O8BB 3CETA 4LH5A 3BDPA 4RW7A 2RPIA 5ADXH 4XH5A 4HUFA 4ZTJA 4BRCA 4IG0A 4M45A 3U4LA 1RT7A 3L2QA 3VPZA 2UUCK 3VA3A 4BE1A 1VQLN 4BACA 4JKGA 4JKGB 1VQON 4XH1A 3V6DA 3VMFB 4CESA 4E89A 3O4NA 4OPJA 3DYAA 1G15A 2Q31A 4JI7K 4KHSA 2QXFA 3N4QA 1C0GA 1RTIA 4NXMK 4CGFA 1OH5A 4FZXC 3UE5A 4IDKA 3WT0A 1HMVA 4FJMA 1Q8IA 3D0PA 4QCLA 3RRGA 4DQIA 2QXLA 4X64K 3AO2A 4H0OA 2VG6A 4CK3A 3EZ5A 4NYNA 3NCIA 5BRDA 1Y97A 3MAQA 1QSLA 3V4IA 1WB9A 1TUYA 5E26A 2Q0RA 3T1YK 2O4IA 4FLZA 3ENHA 4FLXA 4CHYA 5SWMA 3HOSA 2ASOA 4K8XA 5K14A 5C0YA 1TV6A 1A5WA 3HI0A 4EZ6A 2HF4A 1NBWA 3IDHA 3RMCA 1IKYA 2ZD1A 1P90A 3ASMA 5JLFA 3FZHA 4MDBA 4CEZA 2BGGA 3VERA 3O9UA 3NDKA 2P9PA 2P9PB 1GOBA 4G1QA 3A5MC 3RWUA 3EZWA 3CM6A 2NNWA 3CCEN 1M1KO 3IKMA 5E41A 4PHTX 2NRZA 3O4WA 3ZEUB 4NYFA 3AVIA 1U4BA 3PX0A 1TYQA 2NRWA 1IBKK 3KWGA 2OTJN 3LDNA 1SL2A 4DLEA 1KLNA 4F2SA 3CM5A 3C0BA 5KGWA 1S3XA 4I9LA 4DSFA 4BWJA 4CI6A 2E2OA 1LOTB 4BC4A 4DU1A 3SBGA 4DR3K 2Z1JA 2QWPA 2W6LA 3LM9A 2QWOA 1U45A 3H08A 3AA5X 1S5JA 4DQQA 2HMPA 3TPQA 4F2RA 1O1WA 2ZF5O 1J5EK 2D5RA 3GBTA 4BROA 1HJRA 4EIAA 4FXDA 1VQMN 3NHGA 1QHAA 3QLHA 5MLCQ 4JKDA 4B08A 3RSEA 4H5WA 2BH1A 1TK5A 4GV9A 2ZJPL 3Q7BA 2B4JA 2E5LK 2ITGA 4DSEA 2O8EB 3QEVA 3VQ4A 3G6EN 1VAZA 4LF7K 4KHYA 1UWBA 2ATQA 2YHYA 4GKKK 3CCSN 3CCRN 3ALYA 2YNFA 1W9HA 1NLVA 5AR0A 1QZ6A 2QK9A 4IFEA 4M3WA 1SAZA 3J7YP 2Q36A 4GV6A 4EAHD 4DU4A 4M3RA 4HHTA 2WTUA 1RBSA 2Z1HA 4CZFA 2FBYA 5J2NA 5GADP 4NO7A 4TSXA 3CFOA 1IV0A 4BRAA 1JKHA 4E7LA 1NK8A 3KK3A 4CVNE 1NWKA 4KO0A 3SAGA 3QEXA 4FWNA 1QSSA 3CC7N 3M8PA 5AQFA 1BOTO 3CG7A 2CH6A 4M41A 3O9TA 1TAUA 4CJWA 2HHXA 4O0IA 3LDSA 3V9ZA 2V51B 3LWMA 4AILC 2F9WA 1XMQK 2YNHA 3SYZA 3UKRA 3DAWA 5BPLA 4JKFA 4DTXA 4JYAK 1XNQK 1C0TA 1NKCA 4CK1A 5I42A 2F8TA 3WXMB 4A57A 4FJKA 2KFNA 2E1YA 4E7HA 3ISNC 4FJ8A 3DLEA 1P8ZA 4FZYA 2NRRA 1S1WA 4CJFA 2GBZA 1BGXT 3S3MA 2JGUA 4CIEA 2G8IA 2DPNA 4JV5K 1TAQA 4B3SK 3SCXA 3M3ZA 2QWQA 2G8FA 3ATVA 5AQGA 1W7AA 1Q82O 3JSMA 1UOCA 2YCHA 3VQ5A 4CZLA 4JK7A 3TSPA 4EHUA 1WLJA 3U9DA 4DTPA 4IJAA 3KLGA 2KQ2A 1ATRA 5BRHA 4OPKA 5H1SQ 5FRMA 5LL6Z 1TGOA 4FM0A 4OKJA 3R1XA 2ZE2A 4RTFD 3GDQA 1GOCA 1XWLA 3H1VX 3AVCA 3EYZA 3MN9A 1Q86O 3ITHA 1XI1A 5JICA 2VGNA 4CCHA 3DRRA 1GLJO 3O1WA 1NJYA 3L2UA 1RT6A 1EXQA 1JL1A 3VQAA 4LF8K 4FCYA 5KQDA 1FW6A 2QEXN 2P9SA 3CQ8A 4BGBA 4DTNA 2HW3A 3LDPA 2QA4N 4V19S 3A0IX 5HRPA 4QS9A 4RWTA 5JLHA 4BRLA 5HRRA 2UXBK 5LY3A 3EN9A 4J2DA 4M3UA 2DY4A 4QS7A 3LZJA 2E6LA 3K5OA 2JLEA 1RGIA 3VGLA 4M3XA 4KFBA 1K8AO 3NH2A 5CY4A 5ADXA 1OKJA 3FZMA 3VENA 3OYHA 3MX5A 4K43A 3AAPA 3T7ZA 3K58A 2LSNA 3VEWA 2IS3A 3KWIA 3TTCA 4LFBK 1BA0A 3L2WA 2KTQA 3FFIA 4FO0A 4AM7A 3NF7A 3LPTA 3C7NB 2ZWHA 3CHWA 1NNEA 3PV8A 2FBTA 4CIGA 4JK9A 2NRHA 1KC8O 1U48A 1FKPA 5AQRA 2NRVA 4BDZA 4PWDA 5JS2A 5LMNK 2RE2A 4I2QA 5C42A 3MN5A 5DM6L 4CZEA 2XY5A 2VWJA 3MXIA 4DR1K 2GUPA 1Q81O 4LD0A 1JLCA 3ZT3A 1NK9A 1Z6RA 1O13A 1A5XA 3H1QA 1HKBA 3AO3A 3W3DA 2KZZA 3KLEA 2GELA 3V1QA 4FK2A 3OYAA 1T05A 3PSIA 1Q9YA 4BR2A 5HP1A 3ID6A 1S1XA 2PAVA 4BC5A 1GLAG 3KD1E 4DUYK 4LSLA 5AQZA 3THVA 3KKRA 4JKBA 3VEVA 4YOVA 3CCMN 1DTTA 3R9PA 2AA4A 4O4GA 3QB0A 3RTVA 3SPYA 4BRKA 4IO9L 3IS9A 4DTJA 3VGMA 3GL1A 4AQYK 5AQSA 4F9OA 3T1HK 4Z4GA 4O0JA 3ZT0A 4CJLA 2ETJA 2ZGYA 3KVGA 3J7ZO 5KRTA 1R0AA 1ZBSA 4CJKA 2X6SA 4DR2K 3OW2M 3OYIA 1F21A 1U2VA 1U2VB 2O8DA 2RF2A 4L3QA 3RMBA 4XEIA 4J2EA 4KH5A 4CF0A 2P9KA 3SAHA 2B6AA 2OYQA 4CJ4A 1HQEA 2YX6A 4FWQA 2Q97A 4ID5A 1RDBA 2O4GA 5JVGL 5FPNA 4CF8A 2FLOA 2W40A 1HPMA 4IO8A 3WXKA 1V4SA 5J2MA 4KH4A 1SL0A 5AQQA 1NJZA 3QNNA 2HHTA 3THXA 5EOYA 4O8KA 4CEDA 3CJCA 4DR7K 3OY9A 2Q0UA 3K5LA 4BE2A 4ELTA 4A2BA 5A2QO 4IZ9A 2HOEA 1M90O 2ASPA 3DLGA 1GLCG 4BDPA 3HTVA 3V9SA 3I8BA 3S3NA 2P9IB 3CC4N 3SZ2A 1YT3A 1KXPA 2A3ZA 3EE8A 3SQ2A 4DMNA 1KAZA 3LAMA 3DXKA 3K5NA 3E9OA 1TL3A 5AZIA 4DQ8A 2UXDK 1W97L 1HR0K 4DWIA 1SUQA 2E1ZA 3VN5A 3TWHA 1ZXOA 1QQNA 5CZ2A 2QKKA 3PO5A 2GWJA 3LL3A 1RT2A 3MN6A 2OANA 3CQXA 4K25A 4FJGA 3U9ZA 3O9QA 3RMDA 5FDLA 2HNZA 5LMUK 3HT3A 2Z1IA 4DFMA 3WNFA 1WSHA 3SMPA 3ZETB 4K42A 2KHOA 3OS2A 3SPZA 3EKUA 3RR8A 1KRPA 2HHWA 2KW4A 3D6RA 3ULEB 5M1PA 1D8YA 4FYDA 2NZTA 5KPRA 3A5LC 2QWRA 4CBWA 4KHPK 1YAGA 3OYLA 3LALA 4CHQA 3U6FA 1WSJA 3DOLA 3AARA 4CIFA 3M6GA 3KLIA 2P5OA 1RTDA 4CBUA 2YNIA 1CZBA 3VF4A 3IMXA 1ESVA 4FWSA 4Z4HA 3M1FA 4ILHA 1KTQA 5CHIA 3THYB 3I33A 4CK2A 4BQLA 4CHOA 3O3HA 2DFEA 1NK4A 5C2DA 2OPPA 3M8QA 4KB0A 4CECA 4AHUA 4N47A 4CFAA 3P1GA 3SAFA 4B9NA 3NH1A 3VQBA 2Q1NA 3I56N 5GIOA 3SV4A 1I94K 3FE1A 2O8CA 1IG8A 4OGEA 4E1MA 1ZBIA 1JLGA 3D7EO 4WF9L 2HHSA 1H1VA 4CJEA 3AV9A 5CZ1A 3WXLA 4DV1K 2YJFA 4IOCL 1Y64A 4RG8A 2HSTA 2BTFA 1HNVA 3D2FB 5KTQA 5LJVA 5EY4A 3KHYA 4CBXA 4R5PA 3AVAA 3VA0A 2G8KA 1VQKN 4BRHA 3EY1A 5BPMA 3MXJA 4DR5K 1GLLO 4YDUA 1JXEA 4PL7A 4CFBA 4AF1A 3J80O 3B8AX 4LF5K 5C12A 3J81O 4GVEA 3CCLN 2PZSA 1SZ2A 3E01A 5I3UA 3JS6A 5AQXA 3TANA 5M1QA 1BIZA 4C8MA 3OYGA 1U49A 2XHBA 4DF4A 2A6AA 3O08A 1XC9A 1SKWA 3IRXA 3HM9A 3T1AA 2GEMA 5AJ3K 3K59A 3R3LA 3PUFA 3CCUN 4BRGA 5GAHP 4WFAL 1JLQA 4HCBA 2O8FB 2ZJQL 3PO4A 2VQEK 4C8LA 4BRQA 1B9DA 5C25A 3CJ1A 5FPDA 3ZSWA 4OX9K 4PA1A 2P9NB 2GX9A 1LWCA 4HWIA 1SS6A 2NLXA 4BG9A 3C94A 3OJUA 1D9FA 5D3GA 1VSDA 2V7YA 1GLDG 4B3OA 1VSFA 3L4QA 1L3VA 4FJHA 3TSQA 1WAJA 1FXXA 1S1UA 3AGRA 3OYFA 4OPAA 3OVNA 1RBUA 5AQWA 4PKHA 2DTUA 4HTUA 3AA2A 4AH9A 3WNHA 3DOKA 2PYJA 5EX5A 3SUOA 1YTUA 1HRHA 5BR8K 1JLFA 4IFVA 2KFZA 2BUPA 4IJNA 3OA9A 4C8NA 1B92A 4WFBL 4GV3A 4W5TA 3SUPA 2D0BA 1LWEA 1YTAA 3NVMA 4FPBA 4I7FA 1RDWX 1NGIA 4E0DA 3VGKA 1RT3A 3MK6A 2NUBA 4JI3K 5KPTA 4A2AA 4FPAA 1G99A 2QW9A 1QHTA 1TKZA 1NKEA 1XNRK 1BWFO 3WQTA 4CGHA 3KD5E 3ZEUA 1VSIA 1IKVA 1S1TA 1XMOK 4YNQA 3TU5A 3KJVA 4M3YA 5TKYA 3QBWA 3VQEA 1VQNN 4CGIA 2HNDA 2DFFA 3UKUA 3UKUB 4FSVA 4B9VA 4FW2A 2HMIA 4OO1J 1FKOA 3QEWA 1KSPA 2IIRA 1K8KB 2HBKA 4H5TA 1BG3A 1WNSA 2WBNA 4B3MK 3LANA 1RDDA 5C2FA 2HHQA 4OGCA 3CQYA 1TKDA 3SJHA 1NJXA 4CEFA 4FLVA 2YI1A 3VEOA 4AHTA 5EU7A 1LCUA 1NGEA 1NMDA 1JCEA 4MO5A 3LP0A 4BR9A 1S6PA 3PIPL 3OTOK 3OYBA 4DU3A 1QQOA 4FJJA 4DS4A 4FJ9A 5KPZA 4CZIA 4C1NK 1NOYA 1U04A 2O8EA 3KK7A 4KREA 4ISGA 3CMAN 1L5UA 1KAXA 1NK0A 2F7TA 4JI2K 2J4RA 4FOIA 4F3TA 1RT4A 3C6HA 3SV3A 2OA8A 1HUXA 3ZSVA 1RT1A 4NCGA 3N4PA 4E7IA 3IAYA 4DV5K 5AQHA 4FK0A 4MFBA 4M3TA 2YNGA 2PBDA 3DI6A 3P39A 3BZCA 1YVNA 1KVAA 1ZBHA 4QAGA 4CJQA 3G25A 2NRXA 4G9ZA 2OZSA 3MXMA 4B3TK 3VQCA 3ZYYX 3E66A 1UA1A 2OZMA 2B5JA 5FLXO 4KI4A 3BEXA 4GY2B 1NGDA 3BZKA 3DXMB 1GOAA 1ATSA 1Z05A 5CYQA 4BC2A 4DV6K 3SNNA 4JI4K 1GLFO 4RW9A 4HTLA 4B9MA 1D5AA 2FSJA 2IGIA 4FVMA 1S72N 4DSKA 1Q9XA 4M3ZA 4BRIA 3VF2A 3E9PA 5E84A 4I2PA 3AVHA 2X6NA 2H3GX 2OPQA 5M1NA 3NGZA 2YKNA 1KD1O 2FC0A 4CJRA 3L8BA 3DLRA 1EKEA 3ZLJA 5EVZA 5DMRA 4PQUA 3QICA 1C1AA 1NGFA 1IBMK 2F4VK 4A61A 3J8AA 3AGKA 1NM1A 1IKXA 3H6EA 1MWMA 5AQJA 4LF9K 3T69A 4XH4A 1T03A 1X9JA 4FLUA 2A42A 4BRPA 1XQSC 3HL8A 1X3MA 4WCEL 3C6UA 5FPEA 1V4TA 5I9EB 4DTMA 2XY8A 1QSYA 2VWBA 3HVRA 3AVGA 5BRFA 3FR0A 3ZCMA 3LP3A 4FJ5A 3P38A 1XHZA 3NVKA 4W5RA 1YJ9N 5JVHL 1EQYA 1KAYA 3JAMO 3K9JA 3FLCO 1NU0A 4IBNA 1T3VA 2W41A 4OPHA 5KRSA 4RW6A 3OS0A 4CJ3A 4MO4A 3ZT1A 1NK5A 2YHXA 4FLYA 3HM8A 1VRUA 3SQ1A 4AHVA 1J54A 5C24A 4B1WB 3HPOA 4CJUA 4KPYA 3QIPA 1X3NA 3P4IA 4JKCA 1XUPO 4ZHRA 2I5JA 2IC3A 4IDHA 5HBMA 4GNIA 1NGBA 4BR7A 5F1XA 1E3MA 1TKXA 4Q0BA 2ZQBA 4BR4A 2Y1IA 3C7NA 1JLAA 1GLBG 4DQPA 3NFAA 4BC3A 3SMSA 3OHRA 4DFKA 4Y0WA 3QFPA 4E3SA 1IKWA 4CF9A 2CGLA 4O55A 1DLOA 1Z25A 1YI2N 5IT9O 1TL1A 1DTQA 3WNEA 4YDUC 4CZMA 4I9QA 1ZBLA 4OKKA 3RVCA 3GE1A 4CFCA 1S1VA 1L3UA 3C95A 5J2QA 4JLHA 4I6MA 4I6MB 1KQSM 1QE1A 3NE6A 3RR7A 4CEOA 2E6MA 4JD2A 4JD2B 5JMVA 3G71N 3MCAB 3OYMA 1IG9A 4DLGA 3OS1A 1ZC6A 1VQPN 2YV0X 4WFNL 3WEEB 5HROA 2HBLA 5AQLA 1YIJN 4MLHA 4WQ5A 3CF5L 3O80A 4FM2A 1IBLK 3NAEA 2E88A 2P1JA 1DT9A 4KKOA 3VQPA 1VQ9N 4LFCK 1LAWA 4U67L 3THWB 4PY5A 3MMVA 4K41A 2P9UA 1W0HA 2P9UB 3WXJA 2A5XA 2GV9A 3Q7CA 5JS1A 4NCAA 3V9UA 3KIOA 2UUAK 3KLFA 4Z94A 3NMUA 3QMLA 3FFKB 4M63C 1FK9A 4CF1A 2I7NA 3I0RA 5BR9A 1QQMA 1VRTA 4JS4A 3D2EB 3O3GA 1CLQA 4X62K 3V81A 2Q2RA 2WFBA 1C0FA 2Z1GA 4DV2K 1RDUA 4H8KA 3LP2A 3L6QA 3KLHA 2ZM6K 5CR4A 3G4SN 4YHHK 4UY8O 3FZLA 1BO5O 4CJSA 3SUNA 3VQ9A 3KZBA 3PX4A 3CIPA 1A5VA 1YVUA 3F5TA 4IWVA 2QM1A 3DLKA 1BUPA 4JI5K 1BU6O 1JLEA 4JI6K 4FWMA 3B6PA 4Z4EA 4BRFA 3WQUA 3OYEA 5F0XA 1EETA 1IO2A 1EWRA 3VF6A 3G10A 2D0CA 3NBPA 1RNHA 2X78A 4WQ4A 5T7BA 2XY6A 4YORA 3QBXA 3OBYA 1WBDA 3DLHA 5AZJA 3MX2A 5AZJB 1VQ6N 3AVBA 4BREA 1X9MA 4YY3K 3AVFA 4N41A 2IDOA 2QWMA 2P9IA 4A59A 3MECA 4NLCA 2HHHK 3LZIA 3I0SA 1N34K 1RDAA 4FJXA 1WN7A 4Y1DA 3HJFA 4FL9A 1DKGD 1RFQA 3EEQA 4BVPA 4JK8A 4CERA 3LM2A 1BA1A 4DS5A 1NK7A 3LDOA 2FBXA 1K73O 4EP4A 3BF3A 4NCBA 4E7KA 1BCOA 3TSUA 2BANA 1VHXA 2IVNA 5J2PA 2BDPA 4EFHA 2A1SA 5HLFA 4KHWA 1L3TA 1TK8A 4M7XA 2UU9K 2HNYA 3OYNA 4LF6K 1ZBFA 3ZETA 4B3RK 3K5MA 4H5NA 2HBJA 2VCPA 3TI0A 4BQZA 5FPMA 5DM7L 4BVOA 3CYMA 3RMAA 2EWSA 2FSNA 3ULEA 3DRPA 2YJEA 4AM6A 3P5JA 3GOIA 1JJ2M 3M8RA 1CXUA 3EKSA 5BN9A 2YHWA 3P31A 1T8EA 4AHRA 3CFPA 3R8EA 1OVQA 3TAPA 4CD1A 3QIOA 3UB5A 3H46O 5AQVA 4DFPA 1Z26A 4LFAK 4BR0A 4FK4A 4NLBA 4NB4A 4IOXA 2XRIA 4M7YA 4PL8A 4FWLA 4LF4K 1HPZA 2OPRA 4X65K 4B1UB 4MLEA 4O5FA 3AVLA 4C1NI 3HO1A 3D45A 1KVBA 3THYA 1MA9B 3QDKA 1EP4A 4DB3A 3C6TA 2PY5A 4CD3A 4CGJA 4KAZA 1IJJA 1HKGA 3ZSRA 2V7ZA 4ELUA 3F9KA 4O8UA 5GAEP 3O9SA 3L3VA 1T44A 4C23A 1K6YA 4GMJB 4DUZK 3H45C 5J1EA 2CGJA 1L3SA 4R79A 3F9MA 2VG5A 2HB5A 3ZX2A 4H0PA 3D2FA 4JI1K 2Q3SA 4IG3A 4B1XB 1MWKA 1XC3A 3SUQA 2FF6A 4LY7A 1HKCA 4A5AA 1SQKA 3AO4A 4A62A 1NJIO 1TUUA 1KCFA 5HRSA 3ZX3A 1EX4A 2VG7A 4KTQA 2HHVA 4BDYA 4KBOA 5GAGP 5GIPA 2YKMA 4DG1A 1I3AA 2RKIA 4FJIA 5AQOA 2GWKA 4AHSA 1JXBA 2YHAA 4B9TA 3OYKA 3O9RA 3HPGA 1NKBA 3LDLA 4LSNA 4F3OA 4DKWA 1VSMA 1RBVA 2O8FA 4GKJK 1LWFA 2YHBA 3CMEN 3ENOA 5C15A 1WSEA 1J6ZA 3DM2A 3JYTA 2G8WA 1WSFA 2P9NA 2WUSA 4DFJA 3U3YA 1QZ5A 3V9XA 4H03B 3AO1A 1SKRA 3MN7A 3CJAA 3F73A 3L0QA 4N56A 3TAFA 2Y1JA 1HYSA 3K9KA 1D4XA 3W0LA 4DQRA 4B9UA 3A2FA 1SL1A 3BUZB 3ID8A 4N5SA 4KH6A 3AAQA 4EZ9A 1QTMA 3QETA 4BGAA 3L3UA 3VQ8A 4DQSA 3E1YA 2A40A 1RTHA 4UQGA 3ZSQA 4CGDA 3ENBA 4LC9B 2IAJA 4FLWA 4DV0K 3MEEA 1B9FA 3OBWA 3L2VA 1WSGA 4H4MA 2JWLA 5AQTA 3CPWM 3DJCA 1RBTA 5AQYA 2FXUA 3V9WA 5B8HA 1X9WA 3CC2N 1NGGA 1XHXA 4DSLA 4DV3K 4NXNK 4CJTA 4KHQA 1HQUA 1JCGA 3SJJA 1E4GT 1HNZK 3J7AP 4IXCA 3NGIA 3VQ7A 3TARA 4DHYA 2E20A 3O6WA 4F4KA 3MWPA 1C6VA 1LW0A 3L2RA 1VQ4N 1EWQA 2HBMA 3KK1A 1MU2A 1YJWN 4ZTFA 1NGAA 2A41A 4MQ3A 3EE9A 4CJ5A 2WOMA 3JXUA 4WQ5C 3S3OA 4JI8K 1K8KA 4FWRA 1R59O 1UA0A 1TYQB 3NF9A 3O3FA 4CEEA 3TAMA 5C10A 5AFUH 2OTLN 3S41A 3WUHA 4DV7K 4KTWA 4GVMA 1YUWA 3ULDA 4B1VA 4YFUA 1YF5L 1S6QA 4ISEA 1EO1A 3O5BA 1BISA 1NGCA 2E4LA 2GTDA 5KGXA 4BG8A 3PIOL 3LDQA 1KFSA 3PLAA 3VQQA 4KHNA 2D4WA 4CZHA 1W2BM 1OVYA 1N33K 3S9HA 3KKSA 1OH6A 1OH8A 3VEXA 1VSLA 3RSEB 1BQNA 2JWKA 4H0YB 1N36K 3V1OA 3SI6A 4RW8A 5CYMA 5AQPA 4H0XB 3AA4A 1RCHA 2VGMA 1CZAN 1VQ5N 2RHKA 5FRNA 3TTFA 3OJSA 4K8ZA 1IH7A 4BRMA 4DR4K 4EHTA 3CJ7A 3VETA 1UAXA 4FWPA 1N6QA 3CD6N 4WQ4C 2XY7A 2WC9A 3BY5A 3CXCM 4BRDA 1RDCA 2E2NA 3DXMA 1U6ZA 4RCHA 3QNOA 4MDAA 3AVNA 4DCHA 4OJRA 3U3GA 2IOCA 1S9GA 4E1NA 3VTHA 4WYBA 4YOXA 1WSIA 2GUIA 1HYZA 3AVKA 1ILYA 4JKEA 1BHLA 2EX3A 3DRSA 4ID1A 3WXIA 1D9DA 1MDUB 1J9AA 4B1YB 4HUEA 3HBTA 2IVPA 4OLAA 4YOWA 2P51A 3IG1A 3MWTA 3NF8A 2G8HA 4DTSA 4DSJA 2P9LA 2P9LB 3LP1A 4KHUA 1HX1A 4FW1A 3UKRB 5KQ8A 3HRGA 3K2PA 3SBTA 4W5NA 3DMJA 2HVIA 4M42A 2V52B 4U7BA 5SZTA 4Z4IA 1RILA 2ZJRL 2KLAA 4CE9A 2FBVA 1ATNA 1VK0A 4ELVA 3CFRA 4LH4A 2A1RA 3CJBA 4BWMA 4KRFA 2HHUA 5AQKA 4CHNA 4JRQA 4RW4A 4J2AA 2D1KA 4CEAA 4IEIA 4FOEA 1LV5A 3ZSXA 4CHPA 4H0TB 3AY9A 4J2BA 2AP1A 3H3OB 3MEGA 3NF6A 3IUCA 4B8CA 1Q7YO 2FSKA 1BI4A 4QS8A 1BI4B 1GLEG 3UIQA 4ISFA 3I55N 2I7PA 4FLTA 1N8RO 2UXCK 1NGHA 1NOZA 2E8AA 1T7PA 5F2RA 2VYPA 4HCCA 4ILGB 4JEPA 3MEDA 1RBRA 2EHGA 4JAXA 5CE3A 1ASVA 1HLUA 2QI2A 2D0PA 4H4OA 3EO3A 2HVHA 1NG9A 1K9MO 4CJVA 4ICLA 2QTDA 1C1CA 1JL2A 1VSJA 5EXWA 3SQ0A 2P9SB 3HSTB 1C0UA 4PUOA 3TAGA 3VTIA 3CPEA 4JHDA 4JHDB 4O5BA 4FWKA 1HNXK 5BN8A 3C65A 4DTUA 3M5RA 3GG4A 4X66K 4N76A 5BREA 4AHCA 1NGJA 5ELZA 3O4QA 2VQFK 1TK0A 2X74A 4B9SA 2NRTA 3DWLA 1VSKA 1T6DA 5TKWA 3RRHA 4CJPA 2CH5A 3BGRA 4IEEA 4HVJA 1LW2A 4YOYA 3O8MA 3ZX0A 3HK2A 2KZMA 2W6KA 3VEZA 3NH0A 4CZJA 4J8FA 5HRNA 4B1ZA 3DLBA 1BQMA 2RN2A 5KI6A 3CCQN 4Z4CA 4E19A 1X1PA 5AQMA 3TAQA 3SK3A 5AQIA 3HOTA 3PY8A 1NMNA 3VOVA 3WEEA 3K57A 4JS5A 3BP8A 1I39A 2VWKA 1YHQN 1HJOA 3EL2A 1J53A 2F8SA 1HYVA 2E2QA 4DV4K 3VESA 3TABA 1RT5A 4DTRA 3O1BA 1N5YA 1QVFM 1BCMA 3HYFA 5DK5A 3I8DA 3THWA 2G8UA 1VQ8N 3B6OA 5HOOA 1WUAA 4OKEA 4B9QA 2ASMA 4JI0K 3QO9A 1Q18A 3H3NO 3ZT2A 1CXQA 1WOQA 3FZKA 3AO5A 3D2EA 5M1FA 3V1RA 3HPHA 3HZ6A 1N32K 5LJWA 4CZGA 4WE1A 3KTQA 4KB1A 3HXMA 3G0ZA 2OPSA 5HL7L 4C8KA 3IFRA 1CZ9A 3A8YA 4FJLA 4PKIA 1REVA 4YOUA 1YXQA 4FJ7A 3A5OC 3FZFA 3QESA 4FWOA 1JCFA 3AA3A 3PSFA 3PX6A 4KV8A 4BR5A 2FF3B 4CW7B 3E9LA 4KI6A 3T19A 1VSEA 4E1JA 2O8DB 1SV5A 2QWNA 3DLLL 1ZYQA 3TR8A 4OLBA 5M1KA 3VQ6A 5AFUA 2P9KB 3LPUA 1WAFA 1ASWA 4DR6K 4CZKA 4JKAA 1TVRA 4CFDA 3HP9A 4JNEA 3VEYA 4CEQA 4EP5A 1FJGK 3HP6A 3WNGA 4C8OA 4Q5VA 2UYTA 3HSCA 3TAEA 3KK2A 3T3FA 1DGKN 3R6MA 4FZZA 4L8RB 2E2PA 4H0VB 3K0SA 3THXB 2ITMA 3M8SA 4KTZA 3QFUA 2QWLA 3SLCA 1SKSA 4Z0UA 4BRNA 1YITN 2G8VA 4E7JA 1NJWA 2W42A 3VQDA 1TKTA 1JLBA 3LAKA 4YOTA 1WBBA 4B8AB 3QINA 1C0MA 4CF2A 1QS4A 3QEIA 3OYJA 4JRPA 3MDQA 4CEBA 3ZT4A 4XIUA 3DXKB 5AQUA 3TTDA 3LWLA 4DF8A 5AZIB 4W5OA 1S22A 3F2KA 1KVCA 4PKGA 4FVUA 2P5GA 2OCEA 2QKBA 4K0KK 1HNWK 5FROA 1DEJA 4BY9C
chains in the Genus database with same CATH topology
1Z6RA 3C6AA 1O13A 3FGUA 3E1YA 2A40A 1HKBA 3H1QA 3W3DA 2HF3A 1GLFO 4HTLA 5GINA 3ENBA 4LC9B 2GELA 3CJ9A 3CCJN 2D0OA 2FSJA 1S72N 1E4FT 4IOAL 4BR2A 3OBWA 3ID6A 4BRIA 3VF2A 2PAVA 4BC5A 1GLAG 3E9PA 2JWLA 5AQTA 3CPWM 3DJCA 5M1OA 4A5BA 2ZGZA 5AQYA 3CCVN 2FXUA 5E84A 5AQZA 3BF1A 3MCPA 4JKBA 5B8HA 3CC2N 2H3GX 1NGGA 5M1NA 3VEVA 4YOVA 3CCMN 1KD1O 3R9PA 1JCGA 1E4GT 2AA4A 3QB0A 4IXCA 5EVZA 4BRKA 4IO9L 4DHYA 3VGMA 2E20A 3GL1A 3O6WA 3QICA 3ATUA 3MWPA 5AQSA 1NGFA 4F9OA 1VQ4N 2F9TA 4A61A 3CI5A 2HBMA 3J8AA 3AGKA 1NM1A 1YJWN 3H6EA 5AQJA 1MWMA 3T69A 4ILJA 1NGAA 2A41A 4XH4A 1X9JA 2A42A 2ZGYA 3KVGA 4BRPA 3J7ZO 1XQSC 3EE9A 1ZBSA 3JXUA 1X3MA 4WCEL 4WQ5C 3U8XA 3OW2M 5FPEA 1K8KA 4FWRA 1V4TA 5I9EB 1QVGM 3CERA 1U2VA 1U2VB 4CJ7A 2VWBA 1R59O 4L3QA 5BPNA 5BRFA 1TYQB 1VQ7N 4XEIA 1YJNN 4KH5A 3FR0A 3L4IA 2IVOA 2P9KA 3SAHA 4JN4A 5C10A 4H5VA 3P38A 3NVKA 5AFUH 2OTLN 3A5NC 3S41A 1YJ9N 3WUHA 4H5RA 5JVHL 1EQYA 1KAYA 2KKZA 2YX6A 4FWQA 3K9JA 1BDGA 1YUWA 2Q97A 3FLCO 4B1VA 1EO1A 1YF5L 4ISEA 3O5BA 2CGKA 1NGCA 1T3VA 2W41A 5JVGL 5FPNA 4OPHA 2FLOA 2W40A 1HPMA 2GTDA 4IO8A 2PFUA 1V4SA 4JKHA 3WXKA 4BG8A 4KH4A 4MO4A 5AQQA 3LDQA 3PIOL 2YHXA 3PLAA 2D4WA 4CZHA 5EOYA 5AQNA 1W2BM 1T6CA 3HM8A 4O8KA 1OVYA 3CJCA 3CETA 2Q0UA 4B1WB 4A2BA 3VEXA 3RSEB 1X3NA 4IZ9A 2JWKA 2HOEA 5ADXH 1M90O 3P4IA 2ASPA 4H0YB 4XH5A 4JKCA 1GLCG 1XUPO 3HTVA 3I8BA 4BRCA 2P9IB 4IDHA 4H0XB 5AQPA 4GNIA 3U4LA 2VGMA 1NGBA 1CZAN 4BR7A 5F1XA 3CC4N 1VQ5N 2RHKA 4BR4A 3TTFA 3C7NA 3VPZA 1GLBG 1KXPA 2A3ZA 3EE8A 4BRMA 1VQLN 4BC3A 3SMSA 3OHRA 3CJ7A 4JKGA 4EHTA 4JKGB 1VQON 3VETA 4XH1A 1KAZA 4Y0WA 3VMFB 3DXKA 4FWPA 3CD6N 3E9OA 3QFPA 4WQ4C 2WC9A 2Q31A 5AZIA 4DQ8A 2CGLA 3CXCM 1W97L 4BRDA 1YI2N 2E1ZA 4CZMA 4YDUC 2E2NA 1ZXOA 1QQNA 1U6ZA 3DXMA 1C0GA 3N4QA 4MDAA 3GE1A 4RCHA 3RVCA 4DCHA 2GWJA 3UE5A 3LL3A 3WT0A 3VTHA 4WYBA 4YOXA 3MN6A 4I6MA 2OANA 3CQXA 4I6MB 4K25A 1KQSM 1ILYA 4JKEA 3O9QA 4JD2A 3U9ZA 4JD2B 2QXLA 5JMVA 3WXIA 3G71N 3MCAB 4H0OA 1MDUB 4B1YB 5BRDA 3SMPA 3HBTA 3ZETB 2IVPA 4K42A 1TUYA 5E26A 2KHOA 4YOWA 1ZC6A 2Q0RA 1VQPN 3EKUA 4WFNL 3MWTA 3WEEB 3ENHA 2HBLA 2P9LA 5AQLA 2P9LB 1YIJN 4MLHA 3D6RA 3ULEB 5M1PA 4WQ5A 3CF5L 3HOSA 3O80A 1HX1A 2ASOA 3UKRB 5C0YA 2NZTA 5KQ8A 5KPRA 2E88A 1DT9A 3A5LC 1VQ9N 3HI0A 2QWRA 3HRGA 3SBTA 4CBWA 4U67L 2HF4A 3MMVA 1YAGA 2P9UA 4K41A 2P9UB 3WXJA 2A5XA 3Q7CA 2V52B 1NBWA 3IDHA 4U7BA 1P90A 3AARA 5JLFA 3FZHA 4MDBA 3M6GA 2ZJRL 3VERA 4CBUA 3O9UA 3QMLA 3FFKB 2KLAA 4Z94A 3NMUA 4M63C 2P9PA 2P9PB 3IMXA 1ATNA 2I7NA 3VF4A 1ESVA 1QQMA 4FWSA 3A5MC 3M1FA 3D2EB 5BR9A 4ILHA 2Q2RA 2WFBA 5CHIA 3I33A 4BQLA 3EZWA 1C0FA 2NNWA 3CJBA 1RDUA 5AQKA 1M1KO 3CCEN 3IKMA 2D1KA 2NRZA 3O4WA 3L6QA 4PHTX 5C2DA 4IEIA 4FOEA 3ZEUB 4H0TB 3AY9A 2AP1A 3H3OB 5CR4A 1TYQA 2NRWA 3G4SN 2OTJN 3KWGA 3LDNA 3FZLA 1BO5O 3IUCA 4UY8O 3SAFA 1Q7YO 2FSKA 3KZBA 3C0BA 3CIPA 1S3XA 1GLEG 4QS8A 3I56N 2Q1NA 3F5TA 5GIOA 4IWVA 3FE1A 2QM1A 4ISFA 4CI6A 2I7PA 3I55N 1IG8A 2E2OA 1LOTB 1N8RO 4BC4A 1BUPA 1NGHA 3SBGA 2E8AA 3D7EO 1BU6O 4WF9L 2QWPA 5F2RA 2VYPA 1H1VA 3LM9A 2QWOA 4ILGB 4JEPA 3WXLA 2YJFA 4FWMA 4IOCL 1Y64A 4JAXA 4BRFA 2HSTA 2BTFA 5CE3A 3WQUA 1HLUA 3D2FB 2QI2A 2D0PA 3EO3A 5LJVA 5EY4A 3VF6A 5F0XA 2HMPA 3KHYA 3TPQA 4CBXA 2ZF5O 1VQKN 3GBTA 4BRHA 4BROA 4WQ4A 4EIAA 1VQMN 5BPMA 1K9MO 1QHAA 2QTDA 3QBXA 4YORA 1GLLO 4YDUA 5MLCQ 4PL7A 4JKDA 5EXWA 4AF1A 3OBYA 3B8AX 5AZJA 3RSEA 3MX2A 5AZJB 5C12A 1VQ6N 2P9SB 4BREA 4H5WA 2BH1A 4GVEA 4GV9A 3CCLN 3VTIA 3CPEA 1SZ2A 2QWMA 4JHDA 2P9IA 4JHDB 2ZJPL 4FWKA 3Q7BA 3JS6A 5BN8A 4A59A 3C65A 5AQXA 3M5RA 4NLCA 5M1QA 3GG4A 3G6EN 1VAZA 5BREA 2A6AA 3O08A 2YHYA 1NGJA 5ELZA 3CCSN 3CCRN 1NLVA 4FL9A 2GEMA 1DKGD 1RFQA 5AR0A 1QZ6A 2NRTA 3DWLA 3R3LA 4JK8A 1T6DA 4BVPA 5TKWA 4IFEA 3CCUN 1SAZA 1BA1A 3LM2A 4BRGA 5GAHP 4WFAL 2Q36A 4GV6A 4EAHD 2CH5A 2ZJQL 4IEEA 3LDOA 4BRQA 4CZFA 1K73O 3BF3A 5GADP 4YOYA 3CJ1A 5FPDA 3O8MA 3ZX0A 2P9NB 2GX9A 4NO7A 3TSUA 2IVNA 3VEZA 4BRAA 4CZJA 4EFHA 4HWIA 4J8FA 1SS6A 2NLXA 4BG9A 4B1ZA 4M7XA 1NWKA 2V7YA 3CCQN 1GLDG 3ZETA 3SAGA 3L4QA 5AQMA 4FWNA 4H5NA 3SK3A 3CC7N 5AQIA 3TSQA 2HBJA 2VCPA 5AQFA 3HOTA 1BOTO 4BQZA 2CH6A 3VOVA 3O9TA 5FPMA 3AGRA 3WEEA 4BVOA 4OPAA 5DM7L 3BP8A 1YHQN 2EWSA 5AQWA 4PKHA 1HJOA 3EL2A 2FSNA 3ULEA 2V51B 2YJEA 2E2QA 2F9WA 5EX5A 4AM6A 3VESA 3GOIA 3UKRA 3DAWA 1JJ2M 5BPLA 4JKFA 3EKSA 3O1BA 5BN9A 2YHWA 3P31A 1QVFM 2BUPA 4IJNA 3R8EA 3OA9A 1VQ8N 4CD1A 4WFBL 3UB5A 5HOOA 1WUAA 3H46O 4B9QA 4GV3A 2ASMA 5AQVA 3WXMB 4A57A 4BR0A 4NLBA 4NB4A 4IOXA 2E1YA 4M7YA 3NVMA 4FPBA 4PL8A 4FWLA 1RDWX 1NGIA 1Q18A 1P8ZA 3H3NO 3VGKA 4B1UB 4MLEA 2NRRA 3MK6A 4O5FA 1WOQA 3FZKA 4C1NI 3D2EA 5KPTA 4A2AA 5M1FA 4FPAA 1G99A 2QW9A 1MA9B 3HZ6A 2DPNA 3QDKA 1BWFO 5LJWA 4CZGA 4DB3A 3WQTA 3M3ZA 2QWQA 3ATVA 5AQGA 4CD3A 1Q82O 3ZEUA 5HL7L 1IJJA 1HKGA 2YCHA 4CZLA 3IFRA 4JK7A 3TSPA 3A8YA 4EHUA 2V7ZA 3TU5A 4PKIA 3U9DA 4YOUA 1YXQA 4IJAA 3A5OC 3QBWA 4O8UA 1ATRA 3FZFA 3O9SA 5TKYA 5GAEP 5BRHA 1VQNN 5H1SQ 4FWOA 1JCFA 3UKUA 1T44A 4FSVA 3UKUB 4BR5A 2FF3B 3R1XA 4RTFD 4C23A 4OO1J 3H45C 3E9LA 2CGJA 4R79A 2IIRA 3F9MA 3GDQA 1K8KB 2HBKA 4H5TA 1BG3A 3H1VX 3ZX2A 2WBNA 4E1JA 4H0PA 3D2FA 5C2FA 2QWNA 4B1XB 1MWKA 3DLLL 1XC3A 3CQYA 3MN9A 1Q86O 2FF6A 5M1KA 5JICA 2VGNA 5AFUA 2P9KB 1HKCA 4A5AA 3SJHA 1GLJO 1SQKA 4A62A 3O1WA 2YI1A 4CZKA 4JKAA 1TUUA 1NJIO 3VEOA 1NMDA 1NGEA 1LCUA 3ZX3A 5KQDA 1JCEA 2QEXN 2P9SA 4JNEA 4BGBA 3VEYA 4MO5A 3LDPA 4BR9A 2QA4N 3A0IX 4QS9A 4KBOA 5JLHA 4RWTA 4BRLA 5GAGP 3PIPL 2UYTA 1QQOA 5GIPA 3HSCA 5LY3A 3EN9A 1DGKN 4QS7A 5KPZA 3R6MA 4CZIA 4C1NK 1RGIA 2E2PA 3KK7A 4H0VB 4ISGA 5AQOA 2GWKA 3VGLA 3CMAN 2ITMA 1KAXA 1K8AO 5ADXA 2F7TA 3O9RA 2J4RA 2QWLA 3QFUA 4FOIA 1OKJA 3C6HA 3SLCA 3FZMA 3LDLA 3VENA 1HUXA 3MX5A 4K43A 3AAPA 3T7ZA 4BRNA 3N4PA 4DKWA 1YITN 3VEWA 3TTCA 3KWIA 5AQHA 1BA0A 4FO0A 3CMEN 3ENOA 5C15A 4AM7A 2PBDA 1J6ZA 3P39A 2P9NA 4YOTA 3C7NB 1YVNA 2WUSA 2ZWHA 3CHWA 1QZ5A 4H03B 3MDQA 4JK9A 2NRHA 3G25A 1KC8O 2NRXA 3DXKB 5AQRA 5AQUA 2NRVA 3CJAA 3MN7A 3L0QA 4G9ZA 3TTDA 3ZYYX 3E66A 2RE2A 5AZIB 3K9KA 1S22A 1D4XA 3BEXA 3F2KA 3W0LA 4GY2B 1NGDA 4PKGA 4FVUA 3MN5A 5DM6L 3BUZB 3DXMB 3ID8A 4KH6A 4CZEA 3AAQA 1ATSA 1Z05A 2GUPA 4BGAA 4BC2A 1DEJA 1Q81O 4BY9C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9J A;  5CR4 A;  3K9K A;  4MDA A;  4MDB A;  5HOO A;  3F2K A;  3HOT A;  3HOS A;  4U7B A;  2F7T A;  4R79 A; 
#chains in the Genus database with same CATH topology
 3QEP A;  5IWA K;  3C6A A;  3AVJ A;  1BIU A;  3FGU A;  4CGG A;  1NK6 A;  2HF3 A;  5GIN A;  4FM1 A;  3ZSO A;  3CJ9 A;  3CCJ N;  2D0O A;  1QQC A;  1KLM A;  3OYC A;  1E4F T;  3P83 D;  4FJN A;  4IOA L;  4Z4F A;  1C1B A;  2D0A A;  4B9L A;  5M1O A;  4A5B A;  2ZGZ A;  3CCV N;  1J5O A;  3BF1 A;  3MCP A;  2PYL A;  1RTJ A;  2AJQ A;  2F96 A;  4HUG A;  1LAV A;  4W5Q A;  3SQ4 A;  1S9E A;  4BE0 A;  1ASU A;  3ATU A;  1VSH A;  1KFD A;  2F9T A;  3CI5 A;  4ILJ A;  4OVL A;  3OYD A;  1X9S A;  3ZSY A;  3ZSZ A;  3U8X A;  2WON A;  1QVG M;  3CER A;  1U47 A;  4CJ7 A;  2BE2 A;  5BPN A;  4QOZ B;  1VQ7 N;  1YJN N;  3L4I A;  2IVO A;  4F8R A;  4O44 A;  4JN4 A;  2O8C B;  3QER A;  4H5V A;  3HVT A;  3A5N C;  1OH7 A;  4H5R A;  1HNI A;  2KKZ A;  4DSI A;  1BDG A;  4CHZ A;  2UUB K;  2CGK A;  1ZBU A;  1BL3 A;  2XO7 A;  4IKF A;  4GW6 A;  2PFU A;  4JKH A;  1ITG A;  2DFH A;  2R7Y A;  4Y1C A;  5AQN A;  4IFY A;  1T6C A;  4DTO A;  3AVM A;  3NGY A;  2O8B A;  2O8B B;  3CET A;  4LH5 A;  3BDP A;  4RW7 A;  2RPI A;  5ADX H;  4XH5 A;  4HUF A;  4ZTJ A;  4BRC A;  4IG0 A;  4M45 A;  3U4L A;  1RT7 A;  3L2Q A;  3VPZ A;  2UUC K;  3VA3 A;  4BE1 A;  1VQL N;  4BAC A;  4JKG A;  4JKG B;  1VQO N;  4XH1 A;  3V6D A;  3VMF B;  4CES A;  4E89 A;  3O4N A;  4OPJ A;  3DYA A;  1G15 A;  2Q31 A;  4JI7 K;  4KHS A;  2QXF A;  3N4Q A;  1C0G A;  1RTI A;  4NXM K;  4CGF A;  1OH5 A;  4FZX C;  3UE5 A;  4IDK A;  3WT0 A;  1HMV A;  4FJM A;  1Q8I A;  3D0P A;  4QCL A;  3RRG A;  4DQI A;  2QXL A;  4X64 K;  3AO2 A;  4H0O A;  2VG6 A;  4CK3 A;  3EZ5 A;  4NYN A;  3NCI A;  5BRD A;  1Y97 A;  3MAQ A;  1QSL A;  3V4I A;  1WB9 A;  1TUY A;  5E26 A;  2Q0R A;  3T1Y K;  2O4I A;  4FLZ A;  3ENH A;  4FLX A;  4CHY A;  5SWM A;  3HOS A;  2ASO A;  4K8X A;  5K14 A;  5C0Y A;  1TV6 A;  1A5W A;  3HI0 A;  4EZ6 A;  2HF4 A;  1NBW A;  3IDH A;  3RMC A;  1IKY A;  2ZD1 A;  1P90 A;  3ASM A;  5JLF A;  3FZH A;  4MDB A;  4CEZ A;  2BGG A;  3VER A;  3O9U A;  3NDK A;  2P9P A;  2P9P B;  1GOB A;  4G1Q A;  3A5M C;  3RWU A;  3EZW A;  3CM6 A;  2NNW A;  3CCE N;  1M1K O;  3IKM A;  5E41 A;  4PHT X;  2NRZ A;  3O4W A;  3ZEU B;  4NYF A;  3AVI A;  1U4B A;  3PX0 A;  1TYQ A;  2NRW A;  1IBK K;  3KWG A;  2OTJ N;  3LDN A;  1SL2 A;  4DLE A;  1KLN A;  4F2S A;  3CM5 A;  3C0B A;  5KGW A;  1S3X A;  4I9L A;  4DSF A;  4BWJ A;  4CI6 A;  2E2O A;  1LOT B;  4BC4 A;  4DU1 A;  3SBG A;  4DR3 K;  2Z1J A;  2QWP A;  2W6L A;  3LM9 A;  2QWO A;  1U45 A;  3H08 A;  3AA5 X;  1S5J A;  4DQQ A;  2HMP A;  3TPQ A;  4F2R A;  1O1W A;  2ZF5 O;  1J5E K;  2D5R A;  3GBT A;  4BRO A;  1HJR A;  4EIA A;  4FXD A;  1VQM N;  3NHG A;  1QHA A;  3QLH A;  5MLC Q;  4JKD A;  4B08 A;  3RSE A;  4H5W A;  2BH1 A;  1TK5 A;  4GV9 A;  2ZJP L;  3Q7B A;  2B4J A;  2E5L K;  2ITG A;  4DSE A;  2O8E B;  3QEV A;  3VQ4 A;  3G6E N;  1VAZ A;  4LF7 K;  4KHY A;  1UWB A;  2ATQ A;  2YHY A;  4GKK K;  3CCS N;  3CCR N;  3ALY A;  2YNF A;  1W9H A;  1NLV A;  5AR0 A;  1QZ6 A;  2QK9 A;  4IFE A;  4M3W A;  1SAZ A;  3J7Y P;  2Q36 A;  4GV6 A;  4EAH D;  4DU4 A;  4M3R A;  4HHT A;  2WTU A;  1RBS A;  2Z1H A;  4CZF A;  2FBY A;  5J2N A;  5GAD P;  4NO7 A;  4TSX A;  3CFO A;  1IV0 A;  4BRA A;  1JKH A;  4E7L A;  1NK8 A;  3KK3 A;  4CVN E;  1NWK A;  4KO0 A;  3SAG A;  3QEX A;  4FWN A;  1QSS A;  3CC7 N;  3M8P A;  5AQF A;  1BOT O;  3CG7 A;  2CH6 A;  4M41 A;  3O9T A;  1TAU A;  4CJW A;  2HHX A;  4O0I A;  3LDS A;  3V9Z A;  2V51 B;  3LWM A;  4AIL C;  2F9W A;  1XMQ K;  2YNH A;  3SYZ A;  3UKR A;  3DAW A;  5BPL A;  4JKF A;  4DTX A;  4JYA K;  1XNQ K;  1C0T A;  1NKC A;  4CK1 A;  5I42 A;  2F8T A;  3WXM B;  4A57 A;  4FJK A;  2KFN A;  2E1Y A;  4E7H A;  3ISN C;  4FJ8 A;  3DLE A;  1P8Z A;  4FZY A;  2NRR A;  1S1W A;  4CJF A;  2GBZ A;  1BGX T;  3S3M A;  2JGU A;  4CIE A;  2G8I A;  2DPN A;  4JV5 K;  1TAQ A;  4B3S K;  3SCX A;  3M3Z A;  2QWQ A;  2G8F A;  3ATV A;  5AQG A;  1W7A A;  1Q82 O;  3JSM A;  1UOC A;  2YCH A;  3VQ5 A;  4CZL A;  4JK7 A;  3TSP A;  4EHU A;  1WLJ A;  3U9D A;  4DTP A;  4IJA A;  3KLG A;  2KQ2 A;  1ATR A;  5BRH A;  4OPK A;  5H1S Q;  5FRM A;  5LL6 Z;  1TGO A;  4FM0 A;  4OKJ A;  3R1X A;  2ZE2 A;  4RTF D;  3GDQ A;  1GOC A;  1XWL A;  3H1V X;  3AVC A;  3EYZ A;  3MN9 A;  1Q86 O;  3ITH A;  1XI1 A;  5JIC A;  2VGN A;  4CCH A;  3DRR A;  1GLJ O;  3O1W A;  1NJY A;  3L2U A;  1RT6 A;  1EXQ A;  1JL1 A;  3VQA A;  4LF8 K;  4FCY A;  5KQD A;  1FW6 A;  2QEX N;  2P9S A;  3CQ8 A;  4BGB A;  4DTN A;  2HW3 A;  3LDP A;  2QA4 N;  4V19 S;  3A0I X;  5HRP A;  4QS9 A;  4RWT A;  5JLH A;  4BRL A;  5HRR A;  2UXB K;  5LY3 A;  3EN9 A;  4J2D A;  4M3U A;  2DY4 A;  4QS7 A;  3LZJ A;  2E6L A;  3K5O A;  2JLE A;  1RGI A;  3VGL A;  4M3X A;  4KFB A;  1K8A O;  3NH2 A;  5CY4 A;  5ADX A;  1OKJ A;  3FZM A;  3VEN A;  3OYH A;  3MX5 A;  4K43 A;  3AAP A;  3T7Z A;  3K58 A;  2LSN A;  3VEW A;  2IS3 A;  3KWI A;  3TTC A;  4LFB K;  1BA0 A;  3L2W A;  2KTQ A;  3FFI A;  4FO0 A;  4AM7 A;  3NF7 A;  3LPT A;  3C7N B;  2ZWH A;  3CHW A;  1NNE A;  3PV8 A;  2FBT A;  4CIG A;  4JK9 A;  2NRH A;  1KC8 O;  1U48 A;  1FKP A;  5AQR A;  2NRV A;  4BDZ A;  4PWD A;  5JS2 A;  5LMN K;  2RE2 A;  4I2Q A;  5C42 A;  3MN5 A;  5DM6 L;  4CZE A;  2XY5 A;  2VWJ A;  3MXI A;  4DR1 K;  2GUP A;  1Q81 O;  4LD0 A;  1JLC A;  3ZT3 A;  1NK9 A;  1Z6R A;  1O13 A;  1A5X A;  3H1Q A;  1HKB A;  3AO3 A;  3W3D A;  2KZZ A;  3KLE A;  2GEL A;  3V1Q A;  4FK2 A;  3OYA A;  1T05 A;  3PSI A;  1Q9Y A;  4BR2 A;  5HP1 A;  3ID6 A;  1S1X A;  2PAV A;  4BC5 A;  1GLA G;  3KD1 E;  4DUY K;  4LSL A;  5AQZ A;  3THV A;  3KKR A;  4JKB A;  3VEV A;  4YOV A;  3CCM N;  1DTT A;  3R9P A;  2AA4 A;  4O4G A;  3QB0 A;  3RTV A;  3SPY A;  4BRK A;  4IO9 L;  3IS9 A;  4DTJ A;  3VGM A;  3GL1 A;  4AQY K;  5AQS A;  4F9O A;  3T1H K;  4Z4G A;  4O0J A;  3ZT0 A;  4CJL A;  2ETJ A;  2ZGY A;  3KVG A;  3J7Z O;  5KRT A;  1R0A A;  1ZBS A;  4CJK A;  2X6S A;  4DR2 K;  3OW2 M;  3OYI A;  1F21 A;  1U2V A;  1U2V B;  2O8D A;  2RF2 A;  4L3Q A;  3RMB A;  4XEI A;  4J2E A;  4KH5 A;  4CF0 A;  2P9K A;  3SAH A;  2B6A A;  2OYQ A;  4CJ4 A;  1HQE A;  2YX6 A;  4FWQ A;  2Q97 A;  4ID5 A;  1RDB A;  2O4G A;  5JVG L;  5FPN A;  4CF8 A;  2FLO A;  2W40 A;  1HPM A;  4IO8 A;  3WXK A;  1V4S A;  5J2M A;  4KH4 A;  1SL0 A;  5AQQ A;  1NJZ A;  3QNN A;  2HHT A;  3THX A;  5EOY A;  4O8K A;  4CED A;  3CJC A;  4DR7 K;  3OY9 A;  2Q0U A;  3K5L A;  4BE2 A;  4ELT A;  4A2B A;  5A2Q O;  4IZ9 A;  2HOE A;  1M90 O;  2ASP A;  3DLG A;  1GLC G;  4BDP A;  3HTV A;  3V9S A;  3I8B A;  3S3N A;  2P9I B;  3CC4 N;  3SZ2 A;  1YT3 A;  1KXP A;  2A3Z A;  3EE8 A;  3SQ2 A;  4DMN A;  1KAZ A;  3LAM A;  3DXK A;  3K5N A;  3E9O A;  1TL3 A;  5AZI A;  4DQ8 A;  2UXD K;  1W97 L;  1HR0 K;  4DWI A;  1SUQ A;  2E1Z A;  3VN5 A;  3TWH A;  1ZXO A;  1QQN A;  5CZ2 A;  2QKK A;  3PO5 A;  2GWJ A;  3LL3 A;  1RT2 A;  3MN6 A;  2OAN A;  3CQX A;  4K25 A;  4FJG A;  3U9Z A;  3O9Q A;  3RMD A;  5FDL A;  2HNZ A;  5LMU K;  3HT3 A;  2Z1I A;  4DFM A;  3WNF A;  1WSH A;  3SMP A;  3ZET B;  4K42 A;  2KHO A;  3OS2 A;  3SPZ A;  3EKU A;  3RR8 A;  1KRP A;  2HHW A;  2KW4 A;  3D6R A;  3ULE B;  5M1P A;  1D8Y A;  4FYD A;  2NZT A;  5KPR A;  3A5L C;  2QWR A;  4CBW A;  4KHP K;  1YAG A;  3OYL A;  3LAL A;  4CHQ A;  3U6F A;  1WSJ A;  3DOL A;  3AAR A;  4CIF A;  3M6G A;  3KLI A;  2P5O A;  1RTD A;  4CBU A;  2YNI A;  1CZB A;  3VF4 A;  3IMX A;  1ESV A;  4FWS A;  4Z4H A;  3M1F A;  4ILH A;  1KTQ A;  5CHI A;  3THY B;  3I33 A;  4CK2 A;  4BQL A;  4CHO A;  3O3H A;  2DFE A;  1NK4 A;  5C2D A;  2OPP A;  3M8Q A;  4KB0 A;  4CEC A;  4AHU A;  4N47 A;  4CFA A;  3P1G A;  3SAF A;  4B9N A;  3NH1 A;  3VQB A;  2Q1N A;  3I56 N;  5GIO A;  3SV4 A;  1I94 K;  3FE1 A;  2O8C A;  1IG8 A;  4OGE A;  4E1M A;  1ZBI A;  1JLG A;  3D7E O;  4WF9 L;  2HHS A;  1H1V A;  4CJE A;  3AV9 A;  5CZ1 A;  3WXL A;  4DV1 K;  2YJF A;  4IOC L;  1Y64 A;  4RG8 A;  2HST A;  2BTF A;  1HNV A;  3D2F B;  5KTQ A;  5LJV A;  5EY4 A;  3KHY A;  4CBX A;  4R5P A;  3AVA A;  3VA0 A;  2G8K A;  1VQK N;  4BRH A;  3EY1 A;  5BPM A;  3MXJ A;  4DR5 K;  1GLL O;  4YDU A;  1JXE A;  4PL7 A;  4CFB A;  4AF1 A;  3J80 O;  3B8A X;  4LF5 K;  5C12 A;  3J81 O;  4GVE A;  3CCL N;  2PZS A;  1SZ2 A;  3E01 A;  5I3U A;  3JS6 A;  5AQX A;  3TAN A;  5M1Q A;  1BIZ A;  4C8M A;  3OYG A;  1U49 A;  2XHB A;  4DF4 A;  2A6A A;  3O08 A;  1XC9 A;  1SKW A;  3IRX A;  3HM9 A;  3T1A A;  2GEM A;  5AJ3 K;  3K59 A;  3R3L A;  3PUF A;  3CCU N;  4BRG A;  5GAH P;  4WFA L;  1JLQ A;  4HCB A;  2O8F B;  2ZJQ L;  3PO4 A;  2VQE K;  4C8L A;  4BRQ A;  1B9D A;  5C25 A;  3CJ1 A;  5FPD A;  3ZSW A;  4OX9 K;  4PA1 A;  2P9N B;  2GX9 A;  1LWC A;  4HWI A;  1SS6 A;  2NLX A;  4BG9 A;  3C94 A;  3OJU A;  1D9F A;  5D3G A;  1VSD A;  2V7Y A;  1GLD G;  4B3O A;  1VSF A;  3L4Q A;  1L3V A;  4FJH A;  3TSQ A;  1WAJ A;  1FXX A;  1S1U A;  3AGR A;  3OYF A;  4OPA A;  3OVN A;  1RBU A;  5AQW A;  4PKH A;  2DTU A;  4HTU A;  3AA2 A;  4AH9 A;  3WNH A;  3DOK A;  2PYJ A;  5EX5 A;  3SUO A;  1YTU A;  1HRH A;  5BR8 K;  1JLF A;  4IFV A;  2KFZ A;  2BUP A;  4IJN A;  3OA9 A;  4C8N A;  1B92 A;  4WFB L;  4GV3 A;  4W5T A;  3SUP A;  2D0B A;  1LWE A;  1YTA A;  3NVM A;  4FPB A;  4I7F A;  1RDW X;  1NGI A;  4E0D A;  3VGK A;  1RT3 A;  3MK6 A;  2NUB A;  4JI3 K;  5KPT A;  4A2A A;  4FPA A;  1G99 A;  2QW9 A;  1QHT A;  1TKZ A;  1NKE A;  1XNR K;  1BWF O;  3WQT A;  4CGH A;  3KD5 E;  3ZEU A;  1VSI A;  1IKV A;  1S1T A;  1XMO K;  4YNQ A;  3TU5 A;  3KJV A;  4M3Y A;  5TKY A;  3QBW A;  3VQE A;  1VQN N;  4CGI A;  2HND A;  2DFF A;  3UKU A;  3UKU B;  4FSV A;  4B9V A;  4FW2 A;  2HMI A;  4OO1 J;  1FKO A;  3QEW A;  1KSP A;  2IIR A;  1K8K B;  2HBK A;  4H5T A;  1BG3 A;  1WNS A;  2WBN A;  4B3M K;  3LAN A;  1RDD A;  5C2F A;  2HHQ A;  4OGC A;  3CQY A;  1TKD A;  3SJH A;  1NJX A;  4CEF A;  4FLV A;  2YI1 A;  3VEO A;  4AHT A;  5EU7 A;  1LCU A;  1NGE A;  1NMD A;  1JCE A;  4MO5 A;  3LP0 A;  4BR9 A;  1S6P A;  3PIP L;  3OTO K;  3OYB A;  4DU3 A;  1QQO A;  4FJJ A;  4DS4 A;  4FJ9 A;  5KPZ A;  4CZI A;  4C1N K;  1NOY A;  1U04 A;  2O8E A;  3KK7 A;  4KRE A;  4ISG A;  3CMA N;  1L5U A;  1KAX A;  1NK0 A;  2F7T A;  4JI2 K;  2J4R A;  4FOI A;  4F3T A;  1RT4 A;  3C6H A;  3SV3 A;  2OA8 A;  1HUX A;  3ZSV A;  1RT1 A;  4NCG A;  3N4P A;  4E7I A;  3IAY A;  4DV5 K;  5AQH A;  4FK0 A;  4MFB A;  4M3T A;  2YNG A;  2PBD A;  3DI6 A;  3P39 A;  3BZC A;  1YVN A;  1KVA A;  1ZBH A;  4QAG A;  4CJQ A;  3G25 A;  2NRX A;  4G9Z A;  2OZS A;  3MXM A;  4B3T K;  3VQC A;  3ZYY X;  3E66 A;  1UA1 A;  2OZM A;  2B5J A;  5FLX O;  4KI4 A;  3BEX A;  4GY2 B;  1NGD A;  3BZK A;  3DXM B;  1GOA A;  1ATS A;  1Z05 A;  5CYQ A;  4BC2 A;  4DV6 K;  3SNN A;  4JI4 K;  1GLF O;  4RW9 A;  4HTL A;  4B9M A;  1D5A A;  2FSJ A;  2IGI A;  4FVM A;  1S72 N;  4DSK A;  1Q9X A;  4M3Z A;  4BRI A;  3VF2 A;  3E9P A;  5E84 A;  4I2P A;  3AVH A;  2X6N A;  2H3G X;  2OPQ A;  5M1N A;  3NGZ A;  2YKN A;  1KD1 O;  2FC0 A;  4CJR A;  3L8B A;  3DLR A;  1EKE A;  3ZLJ A;  5EVZ A;  5DMR A;  4PQU A;  3QIC A;  1C1A A;  1NGF A;  1IBM K;  2F4V K;  4A61 A;  3J8A A;  3AGK A;  1NM1 A;  1IKX A;  3H6E A;  1MWM A;  5AQJ A;  4LF9 K;  3T69 A;  4XH4 A;  1T03 A;  1X9J A;  4FLU A;  2A42 A;  4BRP A;  1XQS C;  3HL8 A;  1X3M A;  4WCE L;  3C6U A;  5FPE A;  1V4T A;  5I9E B;  4DTM A;  2XY8 A;  1QSY A;  2VWB A;  3HVR A;  3AVG A;  5BRF A;  3FR0 A;  3ZCM A;  3LP3 A;  4FJ5 A;  3P38 A;  1XHZ A;  3NVK A;  4W5R A;  1YJ9 N;  5JVH L;  1EQY A;  1KAY A;  3JAM O;  3K9J A;  3FLC O;  1NU0 A;  4IBN A;  1T3V A;  2W41 A;  4OPH A;  5KRS A;  4RW6 A;  3OS0 A;  4CJ3 A;  4MO4 A;  3ZT1 A;  1NK5 A;  2YHX A;  4FLY A;  3HM8 A;  1VRU A;  3SQ1 A;  4AHV A;  1J54 A;  5C24 A;  4B1W B;  3HPO A;  4CJU A;  4KPY A;  3QIP A;  1X3N A;  3P4I A;  4JKC A;  1XUP O;  4ZHR A;  2I5J A;  2IC3 A;  4IDH A;  5HBM A;  4GNI A;  1NGB A;  4BR7 A;  5F1X A;  1E3M A;  1TKX A;  4Q0B A;  2ZQB A;  4BR4 A;  2Y1I A;  3C7N A;  1JLA A;  1GLB G;  4DQP A;  3NFA A;  4BC3 A;  3SMS A;  3OHR A;  4DFK A;  4Y0W A;  3QFP A;  4E3S A;  1IKW A;  4CF9 A;  2CGL A;  4O55 A;  1DLO A;  1Z25 A;  1YI2 N;  5IT9 O;  1TL1 A;  1DTQ A;  3WNE A;  4YDU C;  4CZM A;  4I9Q A;  1ZBL A;  4OKK A;  3RVC A;  3GE1 A;  4CFC A;  1S1V A;  1L3U A;  3C95 A;  5J2Q A;  4JLH A;  4I6M A;  4I6M B;  1KQS M;  1QE1 A;  3NE6 A;  3RR7 A;  4CEO A;  2E6M A;  4JD2 A;  4JD2 B;  5JMV A;  3G71 N;  3MCA B;  3OYM A;  1IG9 A;  4DLG A;  3OS1 A;  1ZC6 A;  1VQP N;  2YV0 X;  4WFN L;  3WEE B;  5HRO A;  2HBL A;  5AQL A;  1YIJ N;  4MLH A;  4WQ5 A;  3CF5 L;  3O80 A;  4FM2 A;  1IBL K;  3NAE A;  2E88 A;  2P1J A;  1DT9 A;  4KKO A;  3VQP A;  1VQ9 N;  4LFC K;  1LAW A;  4U67 L;  3THW B;  4PY5 A;  3MMV A;  4K41 A;  2P9U A;  1W0H A;  2P9U B;  3WXJ A;  2A5X A;  2GV9 A;  3Q7C A;  5JS1 A;  4NCA A;  3V9U A;  3KIO A;  2UUA K;  3KLF A;  4Z94 A;  3NMU A;  3QML A;  3FFK B;  4M63 C;  1FK9 A;  4CF1 A;  2I7N A;  3I0R A;  5BR9 A;  1QQM A;  1VRT A;  4JS4 A;  3D2E B;  3O3G A;  1CLQ A;  4X62 K;  3V81 A;  2Q2R A;  2WFB A;  1C0F A;  2Z1G A;  4DV2 K;  1RDU A;  4H8K A;  3LP2 A;  3L6Q A;  3KLH A;  2ZM6 K;  5CR4 A;  3G4S N;  4YHH K;  4UY8 O;  3FZL A;  1BO5 O;  4CJS A;  3SUN A;  3VQ9 A;  3KZB A;  3PX4 A;  3CIP A;  1A5V A;  1YVU A;  3F5T A;  4IWV A;  2QM1 A;  3DLK A;  1BUP A;  4JI5 K;  1BU6 O;  1JLE A;  4JI6 K;  4FWM A;  3B6P A;  4Z4E A;  4BRF A;  3WQU A;  3OYE A;  5F0X A;  1EET A;  1IO2 A;  1EWR A;  3VF6 A;  3G10 A;  2D0C A;  3NBP A;  1RNH A;  2X78 A;  4WQ4 A;  5T7B A;  2XY6 A;  4YOR A;  3QBX A;  3OBY A;  1WBD A;  3DLH A;  5AZJ A;  3MX2 A;  5AZJ B;  1VQ6 N;  3AVB A;  4BRE A;  1X9M A;  4YY3 K;  3AVF A;  4N41 A;  2IDO A;  2QWM A;  2P9I A;  4A59 A;  3MEC A;  4NLC A;  2HHH K;  3LZI A;  3I0S A;  1N34 K;  1RDA A;  4FJX A;  1WN7 A;  4Y1D A;  3HJF A;  4FL9 A;  1DKG D;  1RFQ A;  3EEQ A;  4BVP A;  4JK8 A;  4CER A;  3LM2 A;  1BA1 A;  4DS5 A;  1NK7 A;  3LDO A;  2FBX A;  1K73 O;  4EP4 A;  3BF3 A;  4NCB A;  4E7K A;  1BCO A;  3TSU A;  2BAN A;  1VHX A;  2IVN A;  5J2P A;  2BDP A;  4EFH A;  2A1S A;  5HLF A;  4KHW A;  1L3T A;  1TK8 A;  4M7X A;  2UU9 K;  2HNY A;  3OYN A;  4LF6 K;  1ZBF A;  3ZET A;  4B3R K;  3K5M A;  4H5N A;  2HBJ A;  2VCP A;  3TI0 A;  4BQZ A;  5FPM A;  5DM7 L;  4BVO A;  3CYM A;  3RMA A;  2EWS A;  2FSN A;  3ULE A;  3DRP A;  2YJE A;  4AM6 A;  3P5J A;  3GOI A;  1JJ2 M;  3M8R A;  1CXU A;  3EKS A;  5BN9 A;  2YHW A;  3P31 A;  1T8E A;  4AHR A;  3CFP A;  3R8E A;  1OVQ A;  3TAP A;  4CD1 A;  3QIO A;  3UB5 A;  3H46 O;  5AQV A;  4DFP A;  1Z26 A;  4LFA K;  4BR0 A;  4FK4 A;  4NLB A;  4NB4 A;  4IOX A;  2XRI A;  4M7Y A;  4PL8 A;  4FWL A;  4LF4 K;  1HPZ A;  2OPR A;  4X65 K;  4B1U B;  4MLE A;  4O5F A;  3AVL A;  4C1N I;  3HO1 A;  3D45 A;  1KVB A;  3THY A;  1MA9 B;  3QDK A;  1EP4 A;  4DB3 A;  3C6T A;  2PY5 A;  4CD3 A;  4CGJ A;  4KAZ A;  1IJJ A;  1HKG A;  3ZSR A;  2V7Z A;  4ELU A;  3F9K A;  4O8U A;  5GAE P;  3O9S A;  3L3V A;  1T44 A;  4C23 A;  1K6Y A;  4GMJ B;  4DUZ K;  3H45 C;  5J1E A;  2CGJ A;  1L3S A;  4R79 A;  3F9M A;  2VG5 A;  2HB5 A;  3ZX2 A;  4H0P A;  3D2F A;  4JI1 K;  2Q3S A;  4IG3 A;  4B1X B;  1MWK A;  1XC3 A;  3SUQ A;  2FF6 A;  4LY7 A;  1HKC A;  4A5A A;  1SQK A;  3AO4 A;  4A62 A;  1NJI O;  1TUU A;  1KCF A;  5HRS A;  3ZX3 A;  1EX4 A;  2VG7 A;  4KTQ A;  2HHV A;  4BDY A;  4KBO A;  5GAG P;  5GIP A;  2YKM A;  4DG1 A;  1I3A A;  2RKI A;  4FJI A;  5AQO A;  2GWK A;  4AHS A;  1JXB A;  2YHA A;  4B9T A;  3OYK A;  3O9R A;  3HPG A;  1NKB A;  3LDL A;  4LSN A;  4F3O A;  4DKW A;  1VSM A;  1RBV A;  2O8F A;  4GKJ K;  1LWF A;  2YHB A;  3CME N;  3ENO A;  5C15 A;  1WSE A;  1J6Z A;  3DM2 A;  3JYT A;  2G8W A;  1WSF A;  2P9N A;  2WUS A;  4DFJ A;  3U3Y A;  1QZ5 A;  3V9X A;  4H03 B;  3AO1 A;  1SKR A;  3MN7 A;  3CJA A;  3F73 A;  3L0Q A;  4N56 A;  3TAF A;  2Y1J A;  1HYS A;  3K9K A;  1D4X A;  3W0L A;  4DQR A;  4B9U A;  3A2F A;  1SL1 A;  3BUZ B;  3ID8 A;  4N5S A;  4KH6 A;  3AAQ A;  4EZ9 A;  1QTM A;  3QET A;  4BGA A;  3L3U A;  3VQ8 A;  4DQS A;  3E1Y A;  2A40 A;  1RTH A;  4UQG A;  3ZSQ A;  4CGD A;  3ENB A;  4LC9 B;  2IAJ A;  4FLW A;  4DV0 K;  3MEE A;  1B9F A;  3OBW A;  3L2V A;  1WSG A;  4H4M A;  2JWL A;  5AQT A;  3CPW M;  3DJC A;  1RBT A;  5AQY A;  2FXU A;  3V9W A;  5B8H A;  1X9W A;  3CC2 N;  1NGG A;  1XHX A;  4DSL A;  4DV3 K;  4NXN K;  4CJT A;  4KHQ A;  1HQU A;  1JCG A;  3SJJ A;  1E4G T;  1HNZ K;  3J7A P;  4IXC A;  3NGI A;  3VQ7 A;  3TAR A;  4DHY A;  2E20 A;  3O6W A;  4F4K A;  3MWP A;  1C6V A;  1LW0 A;  3L2R A;  1VQ4 N;  1EWQ A;  2HBM A;  3KK1 A;  1MU2 A;  1YJW N;  4ZTF A;  1NGA A;  2A41 A;  4MQ3 A;  3EE9 A;  4CJ5 A;  2WOM A;  3JXU A;  4WQ5 C;  3S3O A;  4JI8 K;  1K8K A;  4FWR A;  1R59 O;  1UA0 A;  1TYQ B;  3NF9 A;  3O3F A;  4CEE A;  3TAM A;  5C10 A;  5AFU H;  2OTL N;  3S41 A;  3WUH A;  4DV7 K;  4KTW A;  4GVM A;  1YUW A;  3ULD A;  4B1V A;  4YFU A;  1YF5 L;  1S6Q A;  4ISE A;  1EO1 A;  3O5B A;  1BIS A;  1NGC A;  2E4L A;  2GTD A;  5KGX A;  4BG8 A;  3PIO L;  3LDQ A;  1KFS A;  3PLA A;  3VQQ A;  4KHN A;  2D4W A;  4CZH A;  1W2B M;  1OVY A;  1N33 K;  3S9H A;  3KKS A;  1OH6 A;  1OH8 A;  3VEX A;  1VSL A;  3RSE B;  1BQN A;  2JWK A;  4H0Y B;  1N36 K;  3V1O A;  3SI6 A;  4RW8 A;  5CYM A;  5AQP A;  4H0X B;  3AA4 A;  1RCH A;  2VGM A;  1CZA N;  1VQ5 N;  2RHK A;  5FRN A;  3TTF A;  3OJS A;  4K8Z A;  1IH7 A;  4BRM A;  4DR4 K;  4EHT A;  3CJ7 A;  3VET A;  1UAX A;  4FWP A;  1N6Q A;  3CD6 N;  4WQ4 C;  2XY7 A;  2WC9 A;  3BY5 A;  3CXC M;  4BRD A;  1RDC A;  2E2N A;  3DXM A;  1U6Z A;  4RCH A;  3QNO A;  4MDA A;  3AVN A;  4DCH A;  4OJR A;  3U3G A;  2IOC A;  1S9G A;  4E1N A;  3VTH A;  4WYB A;  4YOX A;  1WSI A;  2GUI A;  1HYZ A;  3AVK A;  1ILY A;  4JKE A;  1BHL A;  2EX3 A;  3DRS A;  4ID1 A;  3WXI A;  1D9D A;  1MDU B;  1J9A A;  4B1Y B;  4HUE A;  3HBT A;  2IVP A;  4OLA A;  4YOW A;  2P51 A;  3IG1 A;  3MWT A;  3NF8 A;  2G8H A;  4DTS A;  4DSJ A;  2P9L A;  2P9L B;  3LP1 A;  4KHU A;  1HX1 A;  4FW1 A;  3UKR B;  5KQ8 A;  3HRG A;  3K2P A;  3SBT A;  4W5N A;  3DMJ A;  2HVI A;  4M42 A;  2V52 B;  4U7B A;  5SZT A;  4Z4I A;  1RIL A;  2ZJR L;  2KLA A;  4CE9 A;  2FBV A;  1ATN A;  1VK0 A;  4ELV A;  3CFR A;  4LH4 A;  2A1R A;  3CJB A;  4BWM A;  4KRF A;  2HHU A;  5AQK A;  4CHN A;  4JRQ A;  4RW4 A;  4J2A A;  2D1K A;  4CEA A;  4IEI A;  4FOE A;  1LV5 A;  3ZSX A;  4CHP A;  4H0T B;  3AY9 A;  4J2B A;  2AP1 A;  3H3O B;  3MEG A;  3NF6 A;  3IUC A;  4B8C A;  1Q7Y O;  2FSK A;  1BI4 A;  4QS8 A;  1BI4 B;  1GLE G;  3UIQ A;  4ISF A;  3I55 N;  2I7P A;  4FLT A;  1N8R O;  2UXC K;  1NGH A;  1NOZ A;  2E8A A;  1T7P A;  5F2R A;  2VYP A;  4HCC A;  4ILG B;  4JEP A;  3MED A;  1RBR A;  2EHG A;  4JAX A;  5CE3 A;  1ASV A;  1HLU A;  2QI2 A;  2D0P A;  4H4O A;  3EO3 A;  2HVH A;  1NG9 A;  1K9M O;  4CJV A;  4ICL A;  2QTD A;  1C1C A;  1JL2 A;  1VSJ A;  5EXW A;  3SQ0 A;  2P9S B;  3HST B;  1C0U A;  4PUO A;  3TAG A;  3VTI A;  3CPE A;  4JHD A;  4JHD B;  4O5B A;  4FWK A;  1HNX K;  5BN8 A;  3C65 A;  4DTU A;  3M5R A;  3GG4 A;  4X66 K;  4N76 A;  5BRE A;  4AHC A;  1NGJ A;  5ELZ A;  3O4Q A;  2VQF K;  1TK0 A;  2X74 A;  4B9S A;  2NRT A;  3DWL A;  1VSK A;  1T6D A;  5TKW A;  3RRH A;  4CJP A;  2CH5 A;  3BGR A;  4IEE A;  4HVJ A;  1LW2 A;  4YOY A;  3O8M A;  3ZX0 A;  3HK2 A;  2KZM A;  2W6K A;  3VEZ A;  3NH0 A;  4CZJ A;  4J8F A;  5HRN A;  4B1Z A;  3DLB A;  1BQM A;  2RN2 A;  5KI6 A;  3CCQ N;  4Z4C A;  4E19 A;  1X1P A;  5AQM A;  3TAQ A;  3SK3 A;  5AQI A;  3HOT A;  3PY8 A;  1NMN A;  3VOV A;  3WEE A;  3K57 A;  4JS5 A;  3BP8 A;  1I39 A;  2VWK A;  1YHQ N;  1HJO A;  3EL2 A;  1J53 A;  2F8S A;  1HYV A;  2E2Q A;  4DV4 K;  3VES A;  3TAB A;  1RT5 A;  4DTR A;  3O1B A;  1N5Y A;  1QVF M;  1BCM A;  3HYF A;  5DK5 A;  3I8D A;  3THW A;  2G8U A;  1VQ8 N;  3B6O A;  5HOO A;  1WUA A;  4OKE A;  4B9Q A;  2ASM A;  4JI0 K;  3QO9 A;  1Q18 A;  3H3N O;  3ZT2 A;  1CXQ A;  1WOQ A;  3FZK A;  3AO5 A;  3D2E A;  5M1F A;  3V1R A;  3HPH A;  3HZ6 A;  1N32 K;  5LJW A;  4CZG A;  4WE1 A;  3KTQ A;  4KB1 A;  3HXM A;  3G0Z A;  2OPS A;  5HL7 L;  4C8K A;  3IFR A;  1CZ9 A;  3A8Y A;  4FJL A;  4PKI A;  1REV A;  4YOU A;  1YXQ A;  4FJ7 A;  3A5O C;  3FZF A;  3QES A;  4FWO A;  1JCF A;  3AA3 A;  3PSF A;  3PX6 A;  4KV8 A;  4BR5 A;  2FF3 B;  4CW7 B;  3E9L A;  4KI6 A;  3T19 A;  1VSE A;  4E1J A;  2O8D B;  1SV5 A;  2QWN A;  3DLL L;  1ZYQ A;  3TR8 A;  4OLB A;  5M1K A;  3VQ6 A;  5AFU A;  2P9K B;  3LPU A;  1WAF A;  1ASW A;  4DR6 K;  4CZK A;  4JKA A;  1TVR A;  4CFD A;  3HP9 A;  4JNE A;  3VEY A;  4CEQ A;  4EP5 A;  1FJG K;  3HP6 A;  3WNG A;  4C8O A;  4Q5V A;  2UYT A;  3HSC A;  3TAE A;  3KK2 A;  3T3F A;  1DGK N;  3R6M A;  4FZZ A;  4L8R B;  2E2P A;  4H0V B;  3K0S A;  3THX B;  2ITM A;  3M8S A;  4KTZ A;  3QFU A;  2QWL A;  3SLC A;  1SKS A;  4Z0U A;  4BRN A;  1YIT N;  2G8V A;  4E7J A;  1NJW A;  2W42 A;  3VQD A;  1TKT A;  1JLB A;  3LAK A;  4YOT A;  1WBB A;  4B8A B;  3QIN A;  1C0M A;  4CF2 A;  1QS4 A;  3QEI A;  3OYJ A;  4JRP A;  3MDQ A;  4CEB A;  3ZT4 A;  4XIU A;  3DXK B;  5AQU A;  3TTD A;  3LWL A;  4DF8 A;  5AZI B;  4W5O A;  1S22 A;  3F2K A;  1KVC A;  4PKG A;  4FVU A;  2P5G A;  2OCE A;  2QKB A;  4K0K K;  1HNW K;  5FRO A;  1DEJ A;  4BY9 C; 
#chains in the Genus database with same CATH homology
 1Z6R A;  3C6A A;  1O13 A;  3FGU A;  3E1Y A;  2A40 A;  1HKB A;  3H1Q A;  3W3D A;  2HF3 A;  1GLF O;  4HTL A;  5GIN A;  3ENB A;  4LC9 B;  2GEL A;  3CJ9 A;  3CCJ N;  2D0O A;  2FSJ A;  1S72 N;  1E4F T;  4IOA L;  4BR2 A;  3OBW A;  3ID6 A;  4BRI A;  3VF2 A;  2PAV A;  4BC5 A;  1GLA G;  3E9P A;  2JWL A;  5AQT A;  3CPW M;  3DJC A;  5M1O A;  4A5B A;  2ZGZ A;  5AQY A;  3CCV N;  2FXU A;  5E84 A;  5AQZ A;  3BF1 A;  3MCP A;  4JKB A;  5B8H A;  3CC2 N;  2H3G X;  1NGG A;  5M1N A;  3VEV A;  4YOV A;  3CCM N;  1KD1 O;  3R9P A;  1JCG A;  1E4G T;  2AA4 A;  3QB0 A;  4IXC A;  5EVZ A;  4BRK A;  4IO9 L;  4DHY A;  3VGM A;  2E20 A;  3GL1 A;  3O6W A;  3QIC A;  3ATU A;  3MWP A;  5AQS A;  1NGF A;  4F9O A;  1VQ4 N;  2F9T A;  4A61 A;  3CI5 A;  2HBM A;  3J8A A;  3AGK A;  1NM1 A;  1YJW N;  3H6E A;  5AQJ A;  1MWM A;  3T69 A;  4ILJ A;  1NGA A;  2A41 A;  4XH4 A;  1X9J A;  2A42 A;  2ZGY A;  3KVG A;  4BRP A;  3J7Z O;  1XQS C;  3EE9 A;  1ZBS A;  3JXU A;  1X3M A;  4WCE L;  4WQ5 C;  3U8X A;  3OW2 M;  5FPE A;  1K8K A;  4FWR A;  1V4T A;  5I9E B;  1QVG M;  3CER A;  1U2V A;  1U2V B;  4CJ7 A;  2VWB A;  1R59 O;  4L3Q A;  5BPN A;  5BRF A;  1TYQ B;  1VQ7 N;  4XEI A;  1YJN N;  4KH5 A;  3FR0 A;  3L4I A;  2IVO A;  2P9K A;  3SAH A;  4JN4 A;  5C10 A;  4H5V A;  3P38 A;  3NVK A;  5AFU H;  2OTL N;  3A5N C;  3S41 A;  1YJ9 N;  3WUH A;  4H5R A;  5JVH L;  1EQY A;  1KAY A;  2KKZ A;  2YX6 A;  4FWQ A;  3K9J A;  1BDG A;  1YUW A;  2Q97 A;  3FLC O;  4B1V A;  1EO1 A;  1YF5 L;  4ISE A;  3O5B A;  2CGK A;  1NGC A;  1T3V A;  2W41 A;  5JVG L;  5FPN A;  4OPH A;  2FLO A;  2W40 A;  1HPM A;  2GTD A;  4IO8 A;  2PFU A;  1V4S A;  4JKH A;  3WXK A;  4BG8 A;  4KH4 A;  4MO4 A;  5AQQ A;  3LDQ A;  3PIO L;  2YHX A;  3PLA A;  2D4W A;  4CZH A;  5EOY A;  5AQN A;  1W2B M;  1T6C A;  3HM8 A;  4O8K A;  1OVY A;  3CJC A;  3CET A;  2Q0U A;  4B1W B;  4A2B A;  3VEX A;  3RSE B;  1X3N A;  4IZ9 A;  2JWK A;  2HOE A;  5ADX H;  1M90 O;  3P4I A;  2ASP A;  4H0Y B;  4XH5 A;  4JKC A;  1GLC G;  1XUP O;  3HTV A;  3I8B A;  4BRC A;  2P9I B;  4IDH A;  4H0X B;  5AQP A;  4GNI A;  3U4L A;  2VGM A;  1NGB A;  1CZA N;  4BR7 A;  5F1X A;  3CC4 N;  1VQ5 N;  2RHK A;  4BR4 A;  3TTF A;  3C7N A;  3VPZ A;  1GLB G;  1KXP A;  2A3Z A;  3EE8 A;  4BRM A;  1VQL N;  4BC3 A;  3SMS A;  3OHR A;  3CJ7 A;  4JKG A;  4EHT A;  4JKG B;  1VQO N;  3VET A;  4XH1 A;  1KAZ A;  4Y0W A;  3VMF B;  3DXK A;  4FWP A;  3CD6 N;  3E9O A;  3QFP A;  4WQ4 C;  2WC9 A;  2Q31 A;  5AZI A;  4DQ8 A;  2CGL A;  3CXC M;  1W97 L;  4BRD A;  1YI2 N;  2E1Z A;  4CZM A;  4YDU C;  2E2N A;  1ZXO A;  1QQN A;  1U6Z A;  3DXM A;  1C0G A;  3N4Q A;  4MDA A;  3GE1 A;  4RCH A;  3RVC A;  4DCH A;  2GWJ A;  3UE5 A;  3LL3 A;  3WT0 A;  3VTH A;  4WYB A;  4YOX A;  3MN6 A;  4I6M A;  2OAN A;  3CQX A;  4I6M B;  4K25 A;  1KQS M;  1ILY A;  4JKE A;  3O9Q A;  4JD2 A;  3U9Z A;  4JD2 B;  2QXL A;  5JMV A;  3WXI A;  3G71 N;  3MCA B;  4H0O A;  1MDU B;  4B1Y B;  5BRD A;  3SMP A;  3HBT A;  3ZET B;  2IVP A;  4K42 A;  1TUY A;  5E26 A;  2KHO A;  4YOW A;  1ZC6 A;  2Q0R A;  1VQP N;  3EKU A;  4WFN L;  3MWT A;  3WEE B;  3ENH A;  2HBL A;  2P9L A;  5AQL A;  2P9L B;  1YIJ N;  4MLH A;  3D6R A;  3ULE B;  5M1P A;  4WQ5 A;  3CF5 L;  3HOS A;  3O80 A;  1HX1 A;  2ASO A;  3UKR B;  5C0Y A;  2NZT A;  5KQ8 A;  5KPR A;  2E88 A;  1DT9 A;  3A5L C;  1VQ9 N;  3HI0 A;  2QWR A;  3HRG A;  3SBT A;  4CBW A;  4U67 L;  2HF4 A;  3MMV A;  1YAG A;  2P9U A;  4K41 A;  2P9U B;  3WXJ A;  2A5X A;  3Q7C A;  2V52 B;  1NBW A;  3IDH A;  4U7B A;  1P90 A;  3AAR A;  5JLF A;  3FZH A;  4MDB A;  3M6G A;  2ZJR L;  3VER A;  4CBU A;  3O9U A;  3QML A;  3FFK B;  2KLA A;  4Z94 A;  3NMU A;  4M63 C;  2P9P A;  2P9P B;  3IMX A;  1ATN A;  2I7N A;  3VF4 A;  1ESV A;  1QQM A;  4FWS A;  3A5M C;  3M1F A;  3D2E B;  5BR9 A;  4ILH A;  2Q2R A;  2WFB A;  5CHI A;  3I33 A;  4BQL A;  3EZW A;  1C0F A;  2NNW A;  3CJB A;  1RDU A;  5AQK A;  1M1K O;  3CCE N;  3IKM A;  2D1K A;  2NRZ A;  3O4W A;  3L6Q A;  4PHT X;  5C2D A;  4IEI A;  4FOE A;  3ZEU B;  4H0T B;  3AY9 A;  2AP1 A;  3H3O B;  5CR4 A;  1TYQ A;  2NRW A;  3G4S N;  2OTJ N;  3KWG A;  3LDN A;  3FZL A;  1BO5 O;  3IUC A;  4UY8 O;  3SAF A;  1Q7Y O;  2FSK A;  3KZB A;  3C0B A;  3CIP A;  1S3X A;  1GLE G;  4QS8 A;  3I56 N;  2Q1N A;  3F5T A;  5GIO A;  4IWV A;  3FE1 A;  2QM1 A;  4ISF A;  4CI6 A;  2I7P A;  3I55 N;  1IG8 A;  2E2O A;  1LOT B;  1N8R O;  4BC4 A;  1BUP A;  1NGH A;  3SBG A;  2E8A A;  3D7E O;  1BU6 O;  4WF9 L;  2QWP A;  5F2R A;  2VYP A;  1H1V A;  3LM9 A;  2QWO A;  4ILG B;  4JEP A;  3WXL A;  2YJF A;  4FWM A;  4IOC L;  1Y64 A;  4JAX A;  4BRF A;  2HST A;  2BTF A;  5CE3 A;  3WQU A;  1HLU A;  3D2F B;  2QI2 A;  2D0P A;  3EO3 A;  5LJV A;  5EY4 A;  3VF6 A;  5F0X A;  2HMP A;  3KHY A;  3TPQ A;  4CBX A;  2ZF5 O;  1VQK N;  3GBT A;  4BRH A;  4BRO A;  4WQ4 A;  4EIA A;  1VQM N;  5BPM A;  1K9M O;  1QHA A;  2QTD A;  3QBX A;  4YOR A;  1GLL O;  4YDU A;  5MLC Q;  4PL7 A;  4JKD A;  5EXW A;  4AF1 A;  3OBY A;  3B8A X;  5AZJ A;  3RSE A;  3MX2 A;  5AZJ B;  5C12 A;  1VQ6 N;  2P9S B;  4BRE A;  4H5W A;  2BH1 A;  4GVE A;  4GV9 A;  3CCL N;  3VTI A;  3CPE A;  1SZ2 A;  2QWM A;  4JHD A;  2P9I A;  4JHD B;  2ZJP L;  4FWK A;  3Q7B A;  3JS6 A;  5BN8 A;  4A59 A;  3C65 A;  5AQX A;  3M5R A;  4NLC A;  5M1Q A;  3GG4 A;  3G6E N;  1VAZ A;  5BRE A;  2A6A A;  3O08 A;  2YHY A;  1NGJ A;  5ELZ A;  3CCS N;  3CCR N;  1NLV A;  4FL9 A;  2GEM A;  1DKG D;  1RFQ A;  5AR0 A;  1QZ6 A;  2NRT A;  3DWL A;  3R3L A;  4JK8 A;  1T6D A;  4BVP A;  5TKW A;  4IFE A;  3CCU N;  1SAZ A;  1BA1 A;  3LM2 A;  4BRG A;  5GAH P;  4WFA L;  2Q36 A;  4GV6 A;  4EAH D;  2CH5 A;  2ZJQ L;  4IEE A;  3LDO A;  4BRQ A;  4CZF A;  1K73 O;  3BF3 A;  5GAD P;  4YOY A;  3CJ1 A;  5FPD A;  3O8M A;  3ZX0 A;  2P9N B;  2GX9 A;  4NO7 A;  3TSU A;  2IVN A;  3VEZ A;  4BRA A;  4CZJ A;  4EFH A;  4HWI A;  4J8F A;  1SS6 A;  2NLX A;  4BG9 A;  4B1Z A;  4M7X A;  1NWK A;  2V7Y A;  3CCQ N;  1GLD G;  3ZET A;  3SAG A;  3L4Q A;  5AQM A;  4FWN A;  4H5N A;  3SK3 A;  3CC7 N;  5AQI A;  3TSQ A;  2HBJ A;  2VCP A;  5AQF A;  3HOT A;  1BOT O;  4BQZ A;  2CH6 A;  3VOV A;  3O9T A;  5FPM A;  3AGR A;  3WEE A;  4BVO A;  4OPA A;  5DM7 L;  3BP8 A;  1YHQ N;  2EWS A;  5AQW A;  4PKH A;  1HJO A;  3EL2 A;  2FSN A;  3ULE A;  2V51 B;  2YJE A;  2E2Q A;  2F9W A;  5EX5 A;  4AM6 A;  3VES A;  3GOI A;  3UKR A;  3DAW A;  1JJ2 M;  5BPL A;  4JKF A;  3EKS A;  3O1B A;  5BN9 A;  2YHW A;  3P31 A;  1QVF M;  2BUP A;  4IJN A;  3R8E A;  3OA9 A;  1VQ8 N;  4CD1 A;  4WFB L;  3UB5 A;  5HOO A;  1WUA A;  3H46 O;  4B9Q A;  4GV3 A;  2ASM A;  5AQV A;  3WXM B;  4A57 A;  4BR0 A;  4NLB A;  4NB4 A;  4IOX A;  2E1Y A;  4M7Y A;  3NVM A;  4FPB A;  4PL8 A;  4FWL A;  1RDW X;  1NGI A;  1Q18 A;  1P8Z A;  3H3N O;  3VGK A;  4B1U B;  4MLE A;  2NRR A;  3MK6 A;  4O5F A;  1WOQ A;  3FZK A;  4C1N I;  3D2E A;  5KPT A;  4A2A A;  5M1F A;  4FPA A;  1G99 A;  2QW9 A;  1MA9 B;  3HZ6 A;  2DPN A;  3QDK A;  1BWF O;  5LJW A;  4CZG A;  4DB3 A;  3WQT A;  3M3Z A;  2QWQ A;  3ATV A;  5AQG A;  4CD3 A;  1Q82 O;  3ZEU A;  5HL7 L;  1IJJ A;  1HKG A;  2YCH A;  4CZL A;  3IFR A;  4JK7 A;  3TSP A;  3A8Y A;  4EHU A;  2V7Z A;  3TU5 A;  4PKI A;  3U9D A;  4YOU A;  1YXQ A;  4IJA A;  3A5O C;  3QBW A;  4O8U A;  1ATR A;  3FZF A;  3O9S A;  5TKY A;  5GAE P;  5BRH A;  1VQN N;  5H1S Q;  4FWO A;  1JCF A;  3UKU A;  1T44 A;  4FSV A;  3UKU B;  4BR5 A;  2FF3 B;  3R1X A;  4RTF D;  4C23 A;  4OO1 J;  3H45 C;  3E9L A;  2CGJ A;  4R79 A;  2IIR A;  3F9M A;  3GDQ A;  1K8K B;  2HBK A;  4H5T A;  1BG3 A;  3H1V X;  3ZX2 A;  2WBN A;  4E1J A;  4H0P A;  3D2F A;  5C2F A;  2QWN A;  4B1X B;  1MWK A;  3DLL L;  1XC3 A;  3CQY A;  3MN9 A;  1Q86 O;  2FF6 A;  5M1K A;  5JIC A;  2VGN A;  5AFU A;  2P9K B;  1HKC A;  4A5A A;  3SJH A;  1GLJ O;  1SQK A;  4A62 A;  3O1W A;  2YI1 A;  4CZK A;  4JKA A;  1TUU A;  1NJI O;  3VEO A;  1NMD A;  1NGE A;  1LCU A;  3ZX3 A;  5KQD A;  1JCE A;  2QEX N;  2P9S A;  4JNE A;  4BGB A;  3VEY A;  4MO5 A;  3LDP A;  4BR9 A;  2QA4 N;  3A0I X;  4QS9 A;  4KBO A;  5JLH A;  4RWT A;  4BRL A;  5GAG P;  3PIP L;  2UYT A;  1QQO A;  5GIP A;  3HSC A;  5LY3 A;  3EN9 A;  1DGK N;  4QS7 A;  5KPZ A;  3R6M A;  4CZI A;  4C1N K;  1RGI A;  2E2P A;  3KK7 A;  4H0V B;  4ISG A;  5AQO A;  2GWK A;  3VGL A;  3CMA N;  2ITM A;  1KAX A;  1K8A O;  5ADX A;  2F7T A;  3O9R A;  2J4R A;  2QWL A;  3QFU A;  4FOI A;  1OKJ A;  3C6H A;  3SLC A;  3FZM A;  3LDL A;  3VEN A;  1HUX A;  3MX5 A;  4K43 A;  3AAP A;  3T7Z A;  4BRN A;  3N4P A;  4DKW A;  1YIT N;  3VEW A;  3TTC A;  3KWI A;  5AQH A;  1BA0 A;  4FO0 A;  3CME N;  3ENO A;  5C15 A;  4AM7 A;  2PBD A;  1J6Z A;  3P39 A;  2P9N A;  4YOT A;  3C7N B;  1YVN A;  2WUS A;  2ZWH A;  3CHW A;  1QZ5 A;  4H03 B;  3MDQ A;  4JK9 A;  2NRH A;  3G25 A;  1KC8 O;  2NRX A;  3DXK B;  5AQR A;  5AQU A;  2NRV A;  3CJA A;  3MN7 A;  3L0Q A;  4G9Z A;  3TTD A;  3ZYY X;  3E66 A;  2RE2 A;  5AZI B;  3K9K A;  1S22 A;  1D4X A;  3BEX A;  3F2K A;  3W0L A;  4GY2 B;  1NGD A;  4PKG A;  4FVU A;  3MN5 A;  5DM6 L;  3BUZ B;  3DXM B;  3ID8 A;  4KH6 A;  4CZE A;  3AAQ A;  1ATS A;  1Z05 A;  2GUP A;  4BGA A;  4BC2 A;  1DEJ A;  1Q81 O;  4BY9 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...