4MDBA

Structure of mos1 transposase catalytic domain and raltegravir with mg
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
224
structure length
201
Chain Sequence
HELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFVNGKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Mos1 Transposase Inhibition by the Anti-retroviral Drug Raltegravir.
pubmed doi rcsb
molecule keywords Mariner Mos1 transposase
molecule tags Hydrolase/hydrolase inhibitor
source organism Drosophila mauritiana
total genus 72
structure length 201
sequence length 224
ec nomenclature ec 3.1.-.-:
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01359 Transposase_1 Transposase (partial DDE domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.470 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 4mdbA00
3F2KA 3K9KA 4MDAA 3HOTA 4R79A 3HOSA 2F7TA 4U7BA 3K9JA 5CR4A 5HOOA 4MDBA
chains in the Genus database with same CATH superfamily
5C2DA 4AHUA 4BROA 2QWLA 1WN7A 2Q1NA 4J2AA 2F8SA 1T6DA 2WONA 1RDUA 4DF8A 2F8TA 3U6FA 4DTJA 3VEYA 3K9KA 3QNNA 3SQ0A 2QWPA 5M1OA 1DLOA 2O4GA 3QBWA 3VQCA 1NGIA 5C42A 2XHBA 1EWRA 1QQOA 5I3UA 3LP0A 3LAKA 2ETJA 3IKMA 2ZM6K 2HVHA 2IIRA 4J2BA 3L2UA 4BY9C 3B8AX 1NGJA 4BRIA 4KB1A 4OPHA 1C1BA 4IFEA 1HYSA 1S5JA 4X66K 4GV3A 1W97L 1BA0A 2Q0RA 1R0AA 1LCUA 3A5OC 3VOVA 3TANA 5I9EB 1XHXA 4O4GA 1TKDA 1QVFM 1K8KA 1UOCA 4RW4A 4QOZB 4AHCA 1Q81O 4FWKA 2V7YA 1TV6A 1C1CA 2P9UA 2Z1HA 3HOTA 1CXUA 1JLFA 3EYZA 5AQXA 4ELUA 2P9NB 4J8FA 4LC9B 3JS6A 4C1NK 1BO5O 5HRSA 1C0UA 3IAYA 4LFAK 4BRHA 4DTNA 1L3SA 1H1VA 1DEJA 1JLAA 3S3NA 2OPSA 3K2PA 2G8FA 1XNQK 1VSDA 1JL2A 2P51A 3G0ZA 3ITHA 1J53A 1T7PA 4JI0K 4LSLA 4LF4K 3O6WA 3C0BA 4XH5A 5LJWA 3QESA 4LY7A 4B9VA 4ID5A 3SQ2A 3JXUA 3O4NA 3O80A 3WUHA 3VEOA 3VETA 3SQ1A 1BU6O 4BC5A 3A2FA 3EO3A 3SPYA 3NGZA 1NK5A 1SL1A 1VQ8N 3T1HK 2ASPA 2RF2A 3ISNC 1ATSA 5AQRA 4IOXA 2YKNA 4LF9K 2A3ZA 3J7AP 3GDQA 2XY5A 2NUBA 1T6CA 3CQXA 3HO1A 5BREA 1S1XA 3AVAA 2XY7A 3Q7CA 1K6YA 2CH6A 2VYPA 4FWOA 5M1QA 4BGAA 1SL2A 3U9ZA 3J8AA 3DXMB 3CG7A 2G8UA 4CF9A 3HSCA 3KTQA 4CFBA 4BC4A 4BC3A 3MEGA 5DM7L 4H5TA 1HKGA 1XHZA 2O8CA 4FJ7A 1U04A 4DFPA 1HMVA 2AJQA 3G71N 3TSUA 4DSIA 4GV6A 3RMDA 4K42A 3OHRA 2YHAA 4XEIA 4B1UB 4BQLA 2OPRA 3DM2A 4FLYA 3MK6A 4WQ4C 5GAGP 5JICA 3HP9A 4W5OA 3VF6A 2VGMA 3DI6A 3OBWA 3LDNA 4RW9A 2WBNA 3VQEA 4FM1A 2QI2A 1OVQA 2D0OA 4I6MA 2E88A 4YDUA 4ZHRA 3DRSA 2OZSA 4DQIA 1VK0A 2E6MA 2BH1A 1UWBA 1KCFA 3H46O 4IFYA 4F3OA 2FSKA 4FJ8A 5GIPA 3F9MA 4Z4GA 3L4QA 3OJUA 2JGUA 4KHNA 4IEIA 3SYZA 3AVGA 1VSHA 4CIEA 1YTAA 4CZMA 1T44A 5AQUA 1YJWN 1TUYA 3AVFA 4CJQA 5EX5A 5JVGL 1S1VA 1JLGA 1KLNA 2FSNA 3O9SA 1LOTB 4CZGA 2ITMA 3AV9A 3KD1E 4KHWA 3PUFA 4Y1DA 4CJEA 3QEXA 4N41A 4LSNA 3ID6A 2ZWHA 5J2PA 1NGFA 1WLJA 4MLHA 4B3TK 1S6PA 3P83D 3O1WA 1RBVA 4JKEA 4CHOA 2HHXA 4PHTX 2D0PA 4U67L 3RMCA 1RGIA 3THXB 2GX9A 4JI4K 3AO5A 4IO8A 3NGYA 2V52B 2CGKA 3QMLA 1ASVA 3RSEA 1SZ2A 2GUIA 3DJCA 1SUQA 4FW2A 1WSIA 2NRVA 4JKGA 3I33A 1NJWA 3TAGA 1NKBA 1S72N 2EWSA 3CI5A 1DTQA 4B1WB 3HRGA 1OVYA 1JLQA 1U2VA 4CJFA 4EHTA 2UXBK 3R9PA 2A41A 3LZIA 5AZJA 1JXBA 1ZBUA 4FWPA 3CCQN 3TSPA 3WNEA 4CJLA 3SBGA 2PYLA 2Q2RA 3AO3A 4O8UA 1VRUA 3RTVA 4MLEA 3QFUA 4K8ZA 2OPPA 1JLEA 2P9IB 2DTUA 5AQWA 1L3VA 4M7YA 4B8CA 1EO1A 3OYIA 3CC2N 4KBOA 5E26A 3QO9A 4IDKA 1ITGA 4R5PA 1F21A 3F5TA 3KWGA 4GVMA 3DLGA 1IG8A 1BG3A 5AQSA 3VQAA 4N56A 1HNXK 4OPJA 4TSXA 4F4KA 1SKSA 4EZ6A 1NMDA 1MWKA 4CF0A 3I8DA 3SCXA 4B9LA 3I0RA 4DV6K 3ATVA 4LFBK 2QXFA 4I9LA 3WEEA 2D4WA 4B1YB 4C1NI 4FLTA 4BRDA 5HRPA 5FROA 3KVGA 3BZKA 4CZIA 1FW6A 1Z05A 1WBDA 5BRDA 3CJAA 3MEEA 3KLGA 4C8KA 4CFCA 4AHRA 2VGNA 2KQ2A 3EL2A 3PIOL 2UU9K 4CK1A 4L8RB 3H08A 1WOQA 4IG3A 5FDLA 4E89A 1WAFA 1TUUA 5HBMA 1TAUA 3HP6A 2OZMA 3LANA 1NJXA 2KTQA 1JCFA 1IKWA 4NXNK 4ELVA 4JD2B 1BI4A 1E4FT 1QSSA 2P9SA 3D2FA 3AO1A 5JS2A 3U4LA 3O9RA 1A5VA 4DG1A 5BRHA 3RRGA 3KZBA 3GE1A 3WXIA 4CESA 5LJVA 1RBTA 3THYA 4FWMA 3O4QA 3CCJN 1ILYA 2GV9A 4FLUA 2HNZA 4AM7A 1NGBA 3RMBA 4EAHD 3MN9A 4W5QA 3V9WA 1NGEA 4K43A 1SL0A 2D5RA 4E7IA 4ZTJA 4F3TA 3ZT2A 2P9LA 1BIUA 2E6LA 4DWIA 3SMSA 2XRIA 3CC7N 1QZ6A 4A59A 3ZX2A 1NOYA 4IO9L 4BVPA 4M63C 4BRNA 4B9NA 2P5GA 4JI8K 3M8SA 2BUPA 4CEZA 4FJ9A 2XO7A 4Z4IA 4C23A 4OPKA 2B6AA 2DPNA 3E66A 4KHQA 1YITN 1IKXA 3OYGA 4CCHA 4LF5K 1BDGA 4KPYA 1S9EA 5I42A 3VGKA 4CJRA 5H1SQ 4FJHA 5DK5A 4JHDA 3RR7A 3OYLA 4X64K 4FLZA 3VGMA 2W40A 5CR4A 3V1OA 3MX5A 2QWQA 3AO4A 3GBTA 1UAXA 4DQRA 2PY5A 4JRPA 3N4QA 4JK9A 4DSLA 2E1YA 1X1PA 4DV4K 4JRQA 2IVOA 1SKWA 2HBJA 4MDAA 3NH0A 4E7LA 3SV4A 2ATQA 5AQJA 4A62A 5AQIA 2YNFA 1XC9A 3O3HA 3TU5A 4DR2K 1Q86O 4B9QA 3O9TA 3TAFA 1BWFO 4A5BA 4HCCA 4FLVA 2HHWA 4W5NA 4CW7B 3PSIA 1YTUA 4YDUC 4CJPA 3M5RA 4K25A 4KI6A 1S9GA 1REVA 4RW8A 3BP8A 3E9OA 2VWKA 2W6LA 3NE6A 3ZSVA 1HYZA 3MWTA 1EQYA 5IWAK 3QLHA 1D5AA 3KHYA 3L0QA 2Y1JA 2KZZA 4DTSA 5FRNA 4DR5K 3VA0A 3P38A 2WUSA 4G1QA 1TK8A 1RT6A 3NH2A 5T7BA 3KLEA 4AILC 1RT2A 3LDOA 2VWJA 3RWUA 1A5WA 3U3GA 4C8NA 5EU7A 1X9WA 3AVIA 4CF8A 4KRFA 3K5LA 2FSJA 3W3DA 3TTCA 3U8XA 3AAPA 1P90A 5J1EA 4CHYA 2V51B 4DV5K 2ZE2A 2P9KB 3ZSOA 1XUPO 2F9TA 3C6HA 3P1GA 3KK7A 2R7YA 5FLXO 4LF6K 4Y0WA 3UKUB 3CM6A 1ASWA 3D2EA 3ALYA 2UUBK 3ZT1A 4ID1A 5BR9A 1NGHA 5FPEA 4CFAA 3LDSA 1OH6A 1ZBIA 4JKCA 4IG0A 4RWTA 1ZBFA 4DB3A 2ZQBA 4CZFA 4DTOA 1TKTA 4X62K 1NWKA 4OPAA 1VQNN 1RT1A 2OA8A 4BE2A 3T19A 4GW6A 1C6VA 2BGGA 4O5FA 3TAEA 4OX9K 3NFAA 3AO2A 4BR2A 4OJRA 4E1JA 3WNFA 4BR7A 1NGCA 3CQ8A 3CIPA 1VQ5N 3B6PA 4CBUA 4M42A 2VG5A 1OH7A 2IC3A 5J2QA 1KFDA 3UB5A 3RRHA 4KHPK 2B5JA 4DV0K 1BHLA 1NGAA 3L2WA 4DLGA 2Q0UA 1G99A 3KLHA 4FJGA 1C0TA 3MEDA 1UA1A 3ID8A 3EKSA 3L8BA 1E3MA 4CIFA 4ZTFA 2GTDA 1VSFA 1LAWA 2G8KA 3DLRA 1DGKN 1Q9XA 4BRMA 2WOMA 4NLCA 4DR1K 1RT4A 1K8AO 4F2RA 5AZJB 3NVMA 1XMOK 2JWLA 3R8EA 4UY8O 3V6DA 4PKHA 4HHTA 3S9HA 4ILGB 1VQMN 2FBXA 1NNEA 2OPQA 3PV8A 2HNDA 4DFMA 4IXCA 5TKWA 3NGIA 3D7EO 4B9UA 4AH9A 5GAEP 4CJWA 4WCEL 3AAQA 4I2QA 4AQYK 4CJKA 4H0XB 1D9FA 4EIAA 4K0KK 3LL3A 4KHYA 3L3VA 4KO0A 3NF8A 1Q82O 3ZEUA 1IO2A 3FZLA 3ZX3A 3K57A 3CJ9A 2IGIA 1WNSA 4UQGA 1TK0A 4O5BA 1ZC6A 3H1VX 3AY9A 3VEWA 4CGDA 4KREA 3VENA 4M3TA 2FLOA 3QERA 3ULDA 2HHVA 3CCRN 3IFRA 1KRPA 4I7FA 4E19A 5CYMA 3A8YA 3VQ4A 1EWQA 4FJJA 4CJ5A 3CCLN 3THWA 2NRXA 4NO7A 2AP1A 4KFBA 2HMPA 4KH4A 3OS0A 2O8FB 3TPQA 3OS1A 1Z26A 1WSEA 4O8KA 1HRHA 3ZSYA 4LH4A 4GMJB 3ZT0A 4IOCL 1N6QA 5JLHA 4H0VB 1BIZA 3HM9A 3HYFA 1CXQA 2JLEA 3HI0A 2HF3A 4R79A 3OYJA 5C24A 5F2RA 4Z4HA 4YOWA 3F73A 2W6KA 4DQSA 4CHQA 1NKCA 2P9SB 4LF7K 4CVNE 3UKRB 4CGGA 3NHGA 1KAXA 4CGJA 5FPMA 3DLLL 3NF7A 3PO5A 2Q97A 3AARA 4BRQA 4NLBA 4FLXA 3CC4N 3LM2A 3T1AA 2QWRA 4FWNA 3HXMA 3LP1A 3SJHA 4W5TA 4DR4K 3L2VA 1GLCG 3SNNA 1TL1A 1YT3A 4RCHA 3TTFA 1C0MA 2VWBA 3AA4A 4FJXA 3KKSA 3CMAN 2QWMA 1FK9A 3ENHA 1LWCA 3SK3A 2P9LB 3HSTB 3L2RA 2YJFA 3QIPA 2QK9A 5F1XA 4EHUA 1VQ7N 1RTJA 4H5RA 2PAVA 3BDPA 4CEBA 2F9WA 3RR8A 3K59A 3D6RA 3SUOA 3SJJA 5AQKA 4GNIA 4QS9A 4B3SK 4KV8A 3PIPL 3OVNA 1S1UA 2O8DB 1NLVA 2ASOA 2E4LA 1J5EK 3G6EN 2FC0A 4M45A 1ATRA 4ISGA 2VCPA 3DLKA 4DKWA 5CZ2A 3O9UA 2PZSA 5B8HA 1NU0A 4JI2K 3C6UA 2CGLA 3SUNA 1OH5A 1X3MA 3ZETB 3WXJA 3V9XA 3M3ZA 4JNEA 1K73O 2GWKA 4IBNA 3OYHA 4FJNA 4LH5A 1RT3A 1JJ2M 3KIOA 1QZ5A 2XY6A 3OS2A 3EE9A 3ENOA 1HUXA 1KVCA 3SI6A 4A61A 4CI6A 3CYMA 3CCMN 3M8QA 3KK3A 5KRTA 3M1FA 2HBLA 5JLFA 2HNYA 1HJRA 3M8RA 3RMAA 1RDDA 4EZ9A 1GLLO 3TR8A 3TTDA 2HSTA 2P5OA 3AVCA 3ZSQA 2CGJA 4M3UA 1U49A 4YOUA 4KKOA 2HBMA 4HUFA 1HKBA 2KKZA 5SZTA 3SPZA 1KVBA 5A2QO 2O8BB 2YKMA 2A40A 4CECA 3AGKA 5FPNA 3MDQA 1J9AA 3V1RA 3L6QA 3OYAA 3DOKA 3H3OB 3SAFA 4BDZA 4IZ9A 3HZ6A 2Q31A 3EEQA 4IKFA 5ELZA 1KC8O 4H4OA 4NXMK 2FF3B 1Y64A 4DHYA 5BPLA 5AZIB 4H03B 4LD0A 5GINA 3VF2A 3CERA 5JVHL 3FLCO 3T1YK 1VAZA 1X9MA 1WAJA 2E8AA 3VN5A 4B1VA 2Z1JA 2EX3A 2NZTA 1KQSM 1EETA 5C0YA 2YCHA 4RTFD 1W2BM 1FJGK 3OYMA 3A0IX 3CPEA 1TYQB 2BDPA 4M3XA 1B92A 4OVLA 3V1QA 1HR0K 3AVJA 1ESVA 4BE1A 3CHWA 5BPMA 3G4SN 1WUAA 3HTVA 3SUPA 4M3WA 4H0YB 3B6OA 1NK7A 2YI1A 4FSVA 3R3LA 1TKZA 1VSLA 3VTHA 5EY4A 4CK2A 4HCBA 2KW4A 3MECA 4BVOA 4CEAA 2P9NA 4CJVA 1G15A 4J2EA 3TARA 2X6NA 1Z25A 1NK8A 5KTQA 2YJEA 3T7ZA 3O5BA 4H4MA 1Q18A 4C8MA 1HPZA 4OGCA 4B3MK 3OW2M 1VQON 1IH7A 5HROA 3VQ6A 1BQMA 3OY9A 3MX2A 2O8EB 1CZBA 3IS9A 4MQ3A 3IMXA 3WT0A 4ILJA 4GY2B 4NCGA 4BRGA 4IFVA 4YNQA 4CJTA 3NBPA 3CQYA 2B4JA 1RTDA 4OO1J 1M90O 4WQ5A 1CZAN 3LP2A 1C1AA 4CFDA 4O44A 1HNIA 1VQKN 1BOTO 4PKIA 3OYNA 1W7AA 4BG8A 1HNVA 1J6ZA 3QIOA 3OJSA 3DXMA 4ILHA 2OYQA 3FGUA 2QEXN 3LDLA 2HHQA 1S3XA 5AQMA 4JS4A 2FBYA 4FWSA 3ZT3A 3HVRA 3H1QA 3HPOA 3GL1A 4CEFA 4DV3K 1K8KB 1RBUA 2J4RA 4DSJA 1WSFA 3RVCA 1RDWX 4Z4CA 4DU3A 2DFFA 4CHPA 5KQDA 4FYDA 4FZYA 4E3SA 2P9UB 2V7ZA 4FPBA 4JV5K 1IBKK 3DRRA 4M41A 1HJOA 1GOCA 2FBVA 2KHOA 1S1TA 1T8EA 3I56N 4W5RA 1C0FA 1CZ9A 1QHTA 1ZBSA 5K14A 1SQKA 2ZGYA 4YOXA 4B9TA 4QCLA 5AQQA 3LALA 2P1JA 1KSPA 4RW6A 3LWMA 1L5UA 1T05A 3QNOA 1XWLA 4DV7K 4OKKA 5C12A 4FCYA 4YY3K 1KFSA 2YX6A 2YHYA 3DOLA 4JI7K 3MN5A 1T03A 1YVNA 3CXCM 3L4IA 4FOEA 2YNGA 3BGRA 2Q36A 5AQGA 3WXMB 1O1WA 1LAVA 4BRAA 4E7KA 4PWDA 4E1MA 4XH1A 4JKDA 4BQZA 3VGLA 1HYVA 5CZ1A 1EXQA 3K5OA 4KAZA 5M1FA 4K41A 4BRPA 3OYKA 3OYEA 3NCIA 3QFPA 2BANA 4FK4A 2HF4A 1QSYA 3VTIA 1KAYA 3JAMO 3HK2A 4KHSA 1RTIA 2NRTA 2QWOA 2YNIA 3WNGA 3ZSZA 3NDKA 5HLFA 3OYFA 2QM1A 3WXLA 2X6SA 2A1RA 3THXA 5BN8A 4CZKA 1LWEA 2PFUA 4E7HA 2O8CB 2QWNA 1GLJO 1BGXT 1WBBA 3TAPA 3L2QA 3AVNA 4JLHA 4YORA 1LW2A 2RN2A 1VQ9N 1MWMA 1I94K 4Z0UA 4H0PA 3NVKA 3J7YP 2KZMA 4EP4A 1C0GA 3M6GA 3ATUA 1B9DA 1NK4A 4O55A 1ZXOA 3I0SA 4CEOA 4I6MB 1QSLA 3S3MA 5LMNK 3TABA 3QEVA 4DUYK 4BWMA 2QKBA 1ZBHA 2P9IA 3ULEA 4CJUA 2WTUA 1U45A 2W42A 2KLAA 4JI6K 3FZFA 1D4XA 3U3YA 2UYTA 3SQ4A 5MLCQ 1U47A 4DR7K 4WYBA 1VSKA 4BE0A 5AQVA 4G9ZA 2JWKA 1IJJA 2A6AA 5AQHA 4FJLA 3QEPA 4NCAA 1NK6A 3HT3A 3CF5L 4BR0A 3WQTA 3V9SA 3HL8A 3IUCA 3THVA 4YOVA 1U48A 3P31A 3BUZB 4U7BA 1B9FA 4H0OA 4H5WA 3BF1A 1JLBA 4DLEA 1X9SA 5BPNA 1V4SA 1MDUB 2D0BA 4BRFA 2HOEA 4CJ3A 5J2NA 1WB9A 2E20A 3BF3A 3VEVA 3A5LC 3WXKA 3TSQA 5KQ8A 2IDOA 4CGFA 3ZSRA 2D1KA 3SMPA 3RSEB 2VQEK 4CIGA 2E2NA 4JKGB 4E7JA 1Y97A 2BE2A 4I9QA 4JD2A 4CEDA 1R59O 1LW0A 3P5JA 4JI5K 3R1XA 1BUPA 3VF4A 2F4VK 1U2VB 1NM1A 3S41A 3MXJA 5AQLA 1KXPA 3UIQA 3VQPA 5D3GA 4FJIA 3OTOK 3SAGA 2CH5A 3C7NA 3EZWA 2Y1IA 4F8RA 3I8BA 3E9PA 3JSMA 1DTTA 2HHSA 3F2KA 1MA9B 5LL6Z 4A2AA 5F0XA 4OKEA 3FR0A 4IWVA 4JKHA 1SAZA 4OLAA 4M7XA 2Q3SA 4CZEA 5BN9A 3AA5X 4DTRA 1P8ZA 3KWIA 1HKCA 4JYAK 3VQ9A 3OBYA 3VQ7A 1WSHA 4CF2A 1TKXA 1V4TA 4GVEA 5HRRA 3SLCA 4JI1K 4WE1A 1NMNA 1NG9A 4FVMA 4FWLA 5KGWA 3JYTA 3EY1A 3LPUA 4IJNA 1ASUA 1WSJA 2QTDA 5AQZA 4DFKA 3FFKB 4M3ZA 2HBKA 3CETA 3WEEB 4FVUA 1VHXA 5LY3A 2DY4A 4WQ5C 1JCGA 3VQDA 3CFPA 1M1KO 2NRZA 4Z4FA 4PQUA 4KB0A 4FXDA 3MCPA 4CJ7A 2A42A 2KFZA 1D9DA 2E5LK 1DT9A 3TWHA 3DMJA 5AQNA 1VSIA 3J7ZO 4KTWA 4YOYA 5M1KA 1QE1A 5AQPA 3NH1A 4DR3K 3CCEN 2GBZA 2VG6A 1GOAA 3O1BA 2XY8A 1XMQK 2ASMA 4H8KA 2ZF5O 4A2BA 1RFQA 3GG4A 2PYJA 3QEIA 1BI4B 3H45C 3PLAA 2G8VA 4N76A 4JK8A 2F7TA 3D2FB 5KGXA 4KHUA 2WFBA 5FPDA 4DV1K 1NGGA 3AVBA 4FWQA 4B8AB 4BREA 3HBTA 4EP5A 4ICLA 4CF1A 3PSFA 4N47A 4C8LA 3THYB 1RBRA 4K8XA 3CD6N 2G8IA 1GLFO 3OYCA 4DTUA 2ZJRL 3MXMA 1L3UA 2D0CA 3MAQA 1IV0A 4OGEA 3O3FA 5AFUH 3D0PA 1VSJA 1D8YA 4M3RA 3ZCMA 3ZT4A 3AVLA 2OCEA 3BEXA 1RDCA 1EX4A 3CCVN 4BC2A 4KH5A 3N4PA 2FBTA 1GLBG 3C65A 4WFAL 3P4IA 4DTXA 1XQSC 1Q9YA 1ZYQA 1HNWK 1VSEA 4DS5A 3DXKA 4F2SA 3NF9A 4ELTA 2UUCK 5C25A 1IKYA 3Q7BA 1J5OA 3AA3A 2YHBA 2D0AA 5HL7L 2AA4A 1I39A 3EE8A 2P9PA 3QICA 5GIOA 5C15A 4DU1A 4JHDB 2OTLN 2P9KA 3CJ7A 1YUWA 4DFJA 5AQYA 3VESA 4DF4A 3O8MA 5BRFA 2GUPA 5GADP 3UKUA 4FM0A 4XH4A 1RILA 4O0IA 5J2MA 3MXIA 3CM5A 4DSFA 4LFCK 4FM2A 5ADXH 1WSGA 3E9LA 2LSNA 3IDHA 3T3FA 4JKAA 3W0LA 4DCHA 3PX4A 5E84A 3V4IA 3V81A 4CE9A 1RT7A 1NJYA 2ZGZA 1KAZA 5GAHP 4BWJA 4GV9A 5C2FA 4MO4A 1BA1A 4QAGA 3VQBA 2HHHK 3DWLA 4BRCA 1QTMA 4RW7A 1NOZA 4CZLA 3DAWA 3FZMA 2E2OA 4MFBA 1QVGM 2RKIA 3DLEA 5LMUK 1XC3A 3AA2A 3C6AA 3DYAA 3LM9A 5HOOA 5AQTA 3PO4A 1YIJN 3C95A 4B3RK 3SZ2A 3A5NC 3ZYYX 2HB5A 3G10A 4CJSA 4CK3A 3QEWA 4IJAA 4M3YA 1Q7YO 2HW3A 3K5MA 3O4WA 3F9KA 1LV5A 4E1NA 1N32K 2ZD1A 3QB0A 1N36K 1KD1O 3H3NO 3ZX0A 4X65K 1A5XA 4NB4A 4AM6A 3QBXA 3ZLJA 2H3GX 2Z1IA 1SKRA 1NJIO 4FK2A 4FZXC 4PUOA 1NGDA 4PL7A 4ISEA 3J80O 2IVPA 5HP1A 4EFHA 1NBWA 3UE5A 5E41A 3SUQA 2GEMA 3MMVA 2QW9A 2FF6A 3OYDA 4E0DA 4WFNL 4CBWA 1RDBA 2QXLA 3D2EB 4NYFA 4CD3A 1XI1A 2UXCK 1X9JA 4JN4A 4B1ZA 1LWFA 1JKHA 3FE1A 3ULEB 1VQPN 1U6ZA 3CMEN 3AVKA 1GLEG 3DLBA 4BR9A 4Q5VA 3R6MA 1FKOA 2VQFK 3TAMA 1IBMK 1N33K 3ENBA 4BDYA 1HQEA 1TGOA 2HHTA 2X78A 1KTQA 1CLQA 3CCUN 3WQUA 1GLDG 1VQ4N 5KPZA 3KK1A 1YVUA 2HHUA 4BDPA 5JS1A 1EKEA 3SBTA 5DM6L 4JKBA 3K5NA 4MDBA 3C6TA 5C10A 4CHZA 2I7PA 4FW1A 2RE2A 3K58A 3PX0A 4LF8K 4FZZA 2O4IA 3C94A 4XIUA 1TVRA 4FK0A 2GWJA 5AJ3K 2EHGA 3VQ5A 1TL3A 3ZSWA 3T69A 4Z94A 5CE3A 1J54A 3MWPA 4C8OA 4DUZK 3LP3A 5KRSA 1HLUA 2O8FA 2I5JA 2NRHA 3DLHA 4JEPA 4HWIA 1HQUA 4JI3K 4Z4EA 1RNHA 5CY4A 4DSKA 4DR6K 4BG9A 2WC9A 5KI6A 4ISFA 1VQLN 1IKVA 4BGBA 3PX6A 3WNHA 4QS7A 1HX1A 4JKFA 4MO5A 3UKRA 3IRXA 2YV0X 3QETA 3CJCA 1FKPA 4BR4A 5AQOA 1EP4A 3KKRA 1YHQN 5FRMA 4NCBA 3FFIA 4KTQA 4JAXA 4YHHK 1U4BA 4KH6A 1YXQA 5AR0A 3C7NB 4H5VA 2IVNA 3LWLA 3H6EA 3CJBA 3VMFB 5SWMA 2KFNA 4HUEA 5EXWA 1NJZA 1IG9A 4BR5A 4JK7A 2NNWA 3FZHA 3VPZA 1W9HA 2ITGA 3PY8A 2A5XA 3VQQA 1IBLK 2NLXA 4DV2K 4FWRA 3ZEUB 1W0HA 3KD5E 3CCSN 2X74A 1SS6A 2Z1GA 1YI2N 2HMIA 1MU2A 5TKYA 4WF9L 1NKEA 3LAMA 4L3QA 2FXUA 2E1ZA 1QQMA 4DU4A 1YJ9N 4V19S 2YHXA 3MCAB 4O0JA 3S3OA 4KI4A 4IOAL 1JL1A 5M1NA 2VG7A 4AHVA 1L3TA 3THWB 4H5NA 4OKJA 1X3NA 4DTMA 2G8WA 1RCHA 4HUGA 4B08A 2O8DA 2ZJPL 4B1XB 3SAHA 4DS4A 1VQ6N 5CHIA 1QHAA 2ZJQL 1BISA 1E4GT 4A5AA 2DFEA 3EN9A 1BCOA 3HPHA 4N5SA 1SV5A 3KK2A 4I2PA 4Q0BA 1BCMA 4FJ5A 5CYQA 3ZETA 3QINA 5BR8K 1XNRK 3KJVA 3MN6A 1S1WA 4AHTA 4B9SA 4BACA 4CHNA 3MN7A 5KPRA 3OA9A 4HVJA 1NK9A 4FJKA 4AHSA 4HTLA 3FZKA 1KVAA 1HPMA 1Q8IA 4F9OA 1RDAA 2YHWA 4WFBL 1S6QA 3DRPA 4FJMA 3OYBA 2PBDA 5AFUA 2OTJN 2RPIA 4NYNA 4YOTA 4WQ4A 5AQFA 1GOBA 3AVHA 4QS8A 3O08A 3LDQA 5EOYA 4DQQA 4DQPA 1YF5L 4CGHA 2QA4N 4CERA 3IG1A 1N8RO 4H0TB 1N5YA 1RBSA 4KTZA 1OH8A 4IEEA 3TI0A 1FXXA 2W41A 3U9DA 3ZSXA 2O8BA 4CEQA 1Z6RA 2OANA 1S22A 4CZJA 4DSEA 2A1SA 1TAQA 3DXKB 1RTHA 1T3VA 3G25A 3SV3A 4A57A 2E2QA 1HNZK 4AF1A 4RG8A 4PL8A 4CBXA 3CFOA 1YJNN 2GELA 2E2PA 2IAJA 1QS4A 4CEEA 1N34K 4J2DA 2P9PB 3CPWM 3A5MC 1JLCA 4PA1A 5HRNA 2HVIA 5DMRA 3V9ZA 4HTUA 3AGRA 3M8PA 5AZIA 5IT9O 4GKJK 3V9UA 3GOIA 3J81O 3CJ1A 3LZJA 3BY5A 4FL9A 4OLBA 1QQCA 5ADXA 3HVTA 3VEXA 1BL3A 3EKUA 2YNHA 4IDHA 2I7NA 3NMUA 4Y1CA 1GLAG 1JCEA 3O9QA 4FLWA 3VEZA 1OKJA 5JMVA 1YAGA 1I3AA 2F96A 2G8HA 3VA3A 1VSMA 2IS3A 4B9MA 4JS5A 1TYQA 3LDPA 4CGIA 2UUAK 4FOIA 3AVMA 3KLFA 1JXEA 3NAEA 3TAQA 3VQ8A 3HPGA 3LPTA 2NRWA 5EVZA 1K9MO 4DMNA 5KPTA 4PY5A 4FPAA 3P39A 3K9JA 1KLMA 1O13A 2BTFA 1DKGD 4CD1A 3L3UA 1QQNA 3D45A 3VERA 2DFHA 1ATNA 3QDKA 3CFRA 4CJ4A 3KLIA 2QKKA 1VRTA 4DTPA 1NK0A 3K0SA 3HJFA 4PKGA 2RHKA 4BRKA 2NRRA 4CZHA 1RT5A 3EZ5A 2UXDK 1BQNA 5M1PA 1UA0A 3HOSA 4BRLA 3E1YA 3E01A 3NF6A 1TK5A 3BZCA 2O8EA 3O3GA 4B3OA 2IOCA 4DQ8A 4GKKK 3ASMA 3HM8A 1ZBLA 4YFUA 4FO0A 3I55N
chains in the Genus database with same CATH topology
1WUAA 2AA4A 3HTVA 5C2DA 4H0YB 4YDUC 3M5RA 4BROA 3EE8A 4K25A 2QWLA 2P9PA 2YI1A 3QICA 4FSVA 5GIOA 5C15A 3R3LA 2Q1NA 4JHDB 2OTLN 3VTHA 1T6DA 2P9KA 3CJ7A 5EY4A 1RDUA 3BP8A 1YUWA 3E9OA 5AQYA 3VEYA 3VESA 3K9KA 4BVOA 2P9NA 3O8MA 3MWTA 5BRFA 1EQYA 2QWPA 5M1OA 2GUPA 5GADP 3QBWA 3UKUA 4XH4A 3KHYA 1NGIA 3L0QA 2YJEA 1QQOA 3O5BA 3T7ZA 1Q18A 5ADXH 3E9LA 3IKMA 2IIRA 3OW2M 1VQON 3IDHA 3P38A 4BY9C 2WUSA 3B8AX 1NGJA 4BRIA 4JKAA 3MX2A 3W0LA 4DCHA 4OPHA 4IFEA 5E84A 3LDOA 3IMXA 4GV3A 3WT0A 1W97L 2ZGZA 1BA0A 2Q0RA 1KAZA 1LCUA 5GAHP 4ILJA 4GY2B 4GV9A 3A5OC 3VOVA 5C2FA 4MO4A 4BRGA 1BA1A 5I9EB 1QVFM 3DWLA 1K8KA 2FSJA 3W3DA 4BRCA 3TTCA 3U8XA 3AAPA 1P90A 1Q81O 4FWKA 4CZLA 3CQYA 3DAWA 3FZMA 2V51B 2V7YA 2E2OA 2P9KB 4OO1J 2P9UA 1XUPO 2F9TA 1M90O 3C6HA 3HOTA 1QVGM 4WQ5A 1CZAN 5AQXA 3KK7A 2P9NB 4J8FA 4LC9B 3JS6A 4C1NK 4Y0WA 1BO5O 1VQKN 1XC3A 1BOTO 3UKUB 3C6AA 4BRHA 3LM9A 4PKIA 3D2EA 5HOOA 5AQTA 5BR9A 1NGHA 1H1VA 4BG8A 1DEJA 1YIJN 5FPEA 1J6ZA 3A5NC 3DXMA 4ILHA 4JKCA 3ZYYX 3O6WA 3C0BA 4XH5A 5LJWA 4RWTA 3FGUA 2QEXN 3LDLA 4IJAA 4DB3A 1Q7YO 4CZFA 1S3XA 5AQMA 3JXUA 3O4WA 4FWSA 1NWKA 3O80A 3H1QA 4OPAA 3QB0A 3WUHA 3VEOA 3GL1A 3VETA 1VQNN 1KD1O 1BU6O 3H3NO 1K8KB 2J4RA 3ZX0A 4BC5A 3RVCA 1RDWX 3EO3A 4NB4A 4AM6A 3QBXA 5KQDA 4O5FA 2H3GX 2P9UB 2V7ZA 1NJIO 1VQ8N 4FPBA 1NGDA 2ASPA 4BR2A 4PL7A 4ISEA 4E1JA 2IVPA 1ATSA 4EFHA 1NBWA 5AQRA 3UE5A 1HJOA 4IOXA 4BR7A 2KHOA 2GEMA 1NGCA 2QW9A 2A3ZA 3MMVA 3GDQA 2FF6A 1T6CA 3CQXA 4WFNL 4CBWA 3CIPA 3I56N 1VQ5N 4CBUA 5BREA 2QXLA 3D2EB 4CD3A 1C0FA 1X9JA 4JN4A 1ZBSA 3Q7CA 4B1ZA 3FE1A 2CH6A 2VYPA 1SQKA 2ZGYA 4FWOA 5M1QA 3UB5A 3ULEB 1U6ZA 4BGAA 4YOXA 3U9ZA 1VQPN 3CMEN 5AQQA 3J8AA 3DXMB 1NGAA 1GLEG 4BR9A 2Q0UA 1G99A 3R6MA 3HSCA 4BC4A 4BC3A 5DM7L 4H5TA 3ENBA 5C12A 1HKGA 3ID8A 2YX6A 2YHYA 3EKSA 3G71N 3MN5A 3CCUN 3WQUA 1GLDG 3TSUA 5KPZA 1VQ4N 1YVNA 4GV6A 2GTDA 3CXCM 3L4IA 4K42A 3OHRA 4FOEA 3SBTA 4XEIA 4B1UB 1DGKN 2Q36A 4JKBA 5AQGA 4MDBA 5DM6L 3WXMB 4BRMA 4BQLA 5C10A 4NLCA 2I7PA 3MK6A 4WQ4C 4BRAA 5HL7L 5GAGP 5JICA 1K8AO 2RE2A 5AZJB 3NVMA 3VF6A 4XH1A 2VGMA 2JWLA 4JKDA 3OBWA 3R8EA 4UY8O 3LDNA 2GWJA 4BQZA 3VGLA 2WBNA 4PKHA 4ILGB 1VQMN 5M1FA 2QI2A 4K41A 4BRPA 3T69A 2D0OA 4I6MA 2E88A 4YDUA 4Z94A 5CE3A 3QFPA 4IXCA 3MWPA 2HF4A 5TKWA 2BH1A 1KAYA 3VTIA 3D7EO 2NRTA 1HLUA 2QWOA 3H46O 5GAEP 2NRHA 2FSKA 4WCEL 3AAQA 2QM1A 3F9MA 5GIPA 4H0XB 3WXLA 4JEPA 4EIAA 3LL3A 5BN8A 4CZKA 3L4QA 4HWIA 1Q82O 3ZEUA 2PFUA 4IEIA 2QWNA 1GLJO 3FZLA 4BG9A 2WC9A 3ZX3A 4ISFA 1VQLN 3CJ9A 4YORA 4BGBA 4CZMA 4QS7A 1VQ9N 1HX1A 1MWMA 4JKFA 1T44A 5AQUA 4MO5A 1ZC6A 3UKRA 1YJWN 3H1VX 3AY9A 3CJCA 4H0PA 3VEWA 1TUYA 3NVKA 4BR4A 5AQOA 5EX5A 5JVGL 3VENA 1YHQN 1C0GA 2FLOA 2FSNA 3M6GA 3O9SA 1LOTB 4CZGA 3IFRA 4JAXA 2ITMA 3CCRN 3ATUA 4KH6A 1YXQA 3A8YA 5AR0A 3C7NB 4H5VA 1ZXOA 3CCLN 3ID6A 2ZWHA 2IVNA 2NRXA 4I6MB 1NGFA 2AP1A 4MLHA 4NO7A 3H6EA 2HMPA 3CJBA 3VMFB 2P9IA 3ULEA 4KH4A 5EXWA 3O1WA 4JKEA 3TPQA 4BR5A 2KLAA 2NNWA 3FZHA 4JK7A 4O8KA 3VPZA 2D0PA 4PHTX 3FZFA 2A5XA 4IOCL 1D4XA 4U67L 5JLHA 1RGIA 4H0VB 2GX9A 2NLXA 4FWRA 2UYTA 3ZEUB 4IO8A 5MLCQ 2V52B 3CCSN 2CGKA 3HI0A 3QMLA 3RSEA 4WYBA 1SZ2A 1SS6A 2HF3A 3DJCA 5AQVA 1YI2N 4R79A 2NRVA 4JKGA 5F2RA 3I33A 5TKYA 2JWKA 4WF9L 1IJJA 2A6AA 4YOWA 4G9ZA 5AQHA 1S72N 2EWSA 2P9SB 3CI5A 4B1WB 3HRGA 4L3QA 3UKRB 1OVYA 3CF5L 1KAXA 1U2VA 2FXUA 5FPMA 4EHTA 4BR0A 3R9PA 2A41A 3WQTA 3DLLL 2E1ZA 1QQMA 2Q97A 3IUCA 4FWPA 5AZJA 3AARA 3CCQN 1YJ9N 3TSPA 4BRQA 4NLBA 4YOVA 3P31A 3BUZB 2YHXA 3LM2A 3MCAB 3SBGA 4U7BA 3CC4N 4IOAL 2QWRA 4H0OA 4H5WA 3BF1A 5M1NA 4FWNA 2Q2RA 4O8UA 1V4SA 5BPNA 4H5NA 1MDUB 1X3NA 4MLEA 3SJHA 3QFUA 4BRFA 2HOEA 2P9IB 2E20A 1GLCG 5AQWA 4M7YA 4B1XB 3SAHA 3BF3A 2ZJPL 4RCHA 1VQ6N 3VEVA 3TTFA 3A5LC 3WXKA 5CHIA 3CC2N 1QHAA 3TSQA 2VWBA 2ZJQL 5KQ8A 2D1KA 1E4GT 4KBOA 5E26A 2QWMA 3CMAN 4A5AA 3EN9A 3F5TA 3KWGA 3SMPA 3ENHA 1IG8A 1BG3A 3RSEB 3SK3A 2P9LB 5AQSA 2E2NA 4JKGB 2YJFA 4JD2A 1R59O 3ZETA 5F1XA 4EHUA 1NMDA 1MWKA 3R1XA 1BUPA 1VQ7N 3VF4A 3MN6A 4H5RA 1U2VB 2PAVA 1NM1A 3ATVA 3S41A 5AQLA 1KXPA 3WEEA 2F9WA 2D4WA 3D6RA 3MN7A 3OA9A 4B1YB 5KPRA 3SAGA 5AQKA 2CH5A 4C1NI 4GNIA 4HTLA 4QS9A 3C7NA 3EZWA 3FZKA 4BRDA 3I8BA 3E9PA 1HPMA 3PIPL 3KVGA 4F9OA 2YHWA 3F2KA 4CZIA 4WFBL 1MA9B 1NLVA 4A2AA 5F0XA 1Z05A 2PBDA 3FR0A 5AFUA 2ASOA 4IWVA 2OTJN 4JKHA 3CJAA 1SAZA 4YOTA 4WQ4A 5AQFA 5BRDA 3G6EN 1ATRA 4QS8A 4ISGA 4M7XA 3O08A 2VCPA 3LDQA 5EOYA 2VGNA 3EL2A 4CZEA 4DKWA 5BN9A 3PIOL 3PLAA 1YF5L 1P8ZA 3KWIA 1HKCA 1WOQA 3OBYA 3O9UA 2QA4N 1TUUA 5B8HA 1V4TA 1N8RO 1JCFA 4GVEA 4H0TB 2CGLA 3SLCA 1X3MA 4JD2B 4IEEA 3ZETB 1E4FT 3WXJA 4FWLA 2P9SA 3D2FA 3M3ZA 2W41A 4IJNA 4JNEA 3U4LA 3U9DA 1K73O 3O9RA 2GWKA 2QTDA 1Z6RA 2OANA 5AQZA 1S22A 5BRHA 3FFKB 4CZJA 2HBKA 3CETA 3WEEB 4FVUA 3DXKB 1T3VA 3G25A 3KZBA 4WQ5C 1JCGA 3GE1A 4A57A 5LY3A 2E2QA 3WXIA 1M1KO 2NRZA 1JJ2M 4AF1A 5LJVA 1QZ5A 3EE9A 4PL8A 4CBXA 3MCPA 4FWMA 1YJNN 3CCJN 2GELA 3ENOA 4CJ7A 1HUXA 1ILYA 2A42A 4A61A 2E2PA 4CI6A 1DT9A 3CCMN 4AM7A 2P9PB 5AQNA 3CPWM 1NGBA 3J7ZO 3A5MC 3M1FA 4EAHD 4YOYA 2HBLA 3MN9A 5M1KA 5JLFA 1NGEA 3AGRA 4K43A 5AQPA 5AZIA 3CCEN 1GLLO 3GOIA 3CJ1A 4FL9A 3O1BA 2HSTA 3TTDA 5ADXA 2CGJA 2ASMA 3VEXA 2ZF5O 3EKUA 4A2BA 4IDHA 1RFQA 2P9LA 2I7NA 3NMUA 3GG4A 1GLAG 1JCEA 4YOUA 3SMSA 2HBMA 3O9QA 3VEZA 3CC7N 1HKBA 1OKJA 1QZ6A 2KKZA 1YAGA 3H45C 3ZX2A 4A59A 4BVPA 5JMVA 4JK8A 2F7TA 3D2FB 4IO9L 4M63C 4BRNA 2A40A 2WFBA 2BUPA 3AGKA 5FPNA 3MDQA 5FPDA 1NGGA 1TYQA 3LDPA 4FWQA 4C23A 3L6QA 4BREA 3HBTA 4FOIA 2DPNA 3E66A 3H3OB 3SAFA 3CD6N 4IZ9A 1GLFO 3HZ6A 1YITN 5EVZA 2Q31A 2NRWA 1K9MO 1BDGA 5KPTA 3VGKA 4FPAA 3P39A 3K9JA 5ELZA 2ZJRL 1O13A 1KC8O 5H1SQ 2BTFA 2FF3B 1Y64A 4DHYA 4JHDA 1DKGD 5BPLA 4CD1A 1QQNA 3VERA 1ATNA 4H03B 5AZIB 3VGMA 2W40A 3QDKA 5CR4A 3VF2A 5GINA 3CERA 3MX5A 2QWQA 5JVHL 3FLCO 5AFUH 3GBTA 1VAZA 3N4QA 4JK9A 4PKGA 2RHKA 2E8AA 4BRKA 2NRRA 4B1VA 2E1YA 3BEXA 4CZHA 2NZTA 3CCVN 4BC2A 2IVOA 4KH5A 3N4PA 1KQSM 5C0YA 2HBJA 2YCHA 4MDAA 4RTFD 5M1PA 3HOSA 1GLBG 3C65A 4WFAL 3P4IA 1W2BM 5AQJA 1XQSC 4BRLA 3E1YA 4A62A 5AQIA 3A0IX 3CPEA 3DXKA 1TYQB 3TU5A 4DQ8A 1Q86O 4B9QA 3O9TA 1BWFO 3Q7BA 4A5BA 1EO1A 3HM8A 1ESVA 4FO0A 3CHWA 3I55N 5BPMA 3G4SN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F2K A;  3K9K A;  4MDA A;  3HOT A;  4R79 A;  3HOS A;  2F7T A;  4U7B A;  3K9J A;  5CR4 A;  5HOO A;  4MDB A; 
#chains in the Genus database with same CATH topology
 5C2D A;  4AHU A;  4BRO A;  2QWL A;  1WN7 A;  2Q1N A;  4J2A A;  2F8S A;  1T6D A;  2WON A;  1RDU A;  4DF8 A;  2F8T A;  3U6F A;  4DTJ A;  3VEY A;  3K9K A;  3QNN A;  3SQ0 A;  2QWP A;  5M1O A;  1DLO A;  2O4G A;  3QBW A;  3VQC A;  1NGI A;  5C42 A;  2XHB A;  1EWR A;  1QQO A;  5I3U A;  3LP0 A;  3LAK A;  2ETJ A;  3IKM A;  2ZM6 K;  2HVH A;  2IIR A;  4J2B A;  3L2U A;  4BY9 C;  3B8A X;  1NGJ A;  4BRI A;  4KB1 A;  4OPH A;  1C1B A;  4IFE A;  1HYS A;  1S5J A;  4X66 K;  4GV3 A;  1W97 L;  1BA0 A;  2Q0R A;  1R0A A;  1LCU A;  3A5O C;  3VOV A;  3TAN A;  5I9E B;  1XHX A;  4O4G A;  1TKD A;  1QVF M;  1K8K A;  1UOC A;  4RW4 A;  4QOZ B;  4AHC A;  1Q81 O;  4FWK A;  2V7Y A;  1TV6 A;  1C1C A;  2P9U A;  2Z1H A;  3HOT A;  1CXU A;  1JLF A;  3EYZ A;  5AQX A;  4ELU A;  2P9N B;  4J8F A;  4LC9 B;  3JS6 A;  4C1N K;  1BO5 O;  5HRS A;  1C0U A;  3IAY A;  4LFA K;  4BRH A;  4DTN A;  1L3S A;  1H1V A;  1DEJ A;  1JLA A;  3S3N A;  2OPS A;  3K2P A;  2G8F A;  1XNQ K;  1VSD A;  1JL2 A;  2P51 A;  3G0Z A;  3ITH A;  1J53 A;  1T7P A;  4JI0 K;  4LSL A;  4LF4 K;  3O6W A;  3C0B A;  4XH5 A;  5LJW A;  3QES A;  4LY7 A;  4B9V A;  4ID5 A;  3SQ2 A;  3JXU A;  3O4N A;  3O80 A;  3WUH A;  3VEO A;  3VET A;  3SQ1 A;  1BU6 O;  4BC5 A;  3A2F A;  3EO3 A;  3SPY A;  3NGZ A;  1NK5 A;  1SL1 A;  1VQ8 N;  3T1H K;  2ASP A;  2RF2 A;  3ISN C;  1ATS A;  5AQR A;  4IOX A;  2YKN A;  4LF9 K;  2A3Z A;  3J7A P;  3GDQ A;  2XY5 A;  2NUB A;  1T6C A;  3CQX A;  3HO1 A;  5BRE A;  1S1X A;  3AVA A;  2XY7 A;  3Q7C A;  1K6Y A;  2CH6 A;  2VYP A;  4FWO A;  5M1Q A;  4BGA A;  1SL2 A;  3U9Z A;  3J8A A;  3DXM B;  3CG7 A;  2G8U A;  4CF9 A;  3HSC A;  3KTQ A;  4CFB A;  4BC4 A;  4BC3 A;  3MEG A;  5DM7 L;  4H5T A;  1HKG A;  1XHZ A;  2O8C A;  4FJ7 A;  1U04 A;  4DFP A;  1HMV A;  2AJQ A;  3G71 N;  3TSU A;  4DSI A;  4GV6 A;  3RMD A;  4K42 A;  3OHR A;  2YHA A;  4XEI A;  4B1U B;  4BQL A;  2OPR A;  3DM2 A;  4FLY A;  3MK6 A;  4WQ4 C;  5GAG P;  5JIC A;  3HP9 A;  4W5O A;  3VF6 A;  2VGM A;  3DI6 A;  3OBW A;  3LDN A;  4RW9 A;  2WBN A;  3VQE A;  4FM1 A;  2QI2 A;  1OVQ A;  2D0O A;  4I6M A;  2E88 A;  4YDU A;  4ZHR A;  3DRS A;  2OZS A;  4DQI A;  1VK0 A;  2E6M A;  2BH1 A;  1UWB A;  1KCF A;  3H46 O;  4IFY A;  4F3O A;  2FSK A;  4FJ8 A;  5GIP A;  3F9M A;  4Z4G A;  3L4Q A;  3OJU A;  2JGU A;  4KHN A;  4IEI A;  3SYZ A;  3AVG A;  1VSH A;  4CIE A;  1YTA A;  4CZM A;  1T44 A;  5AQU A;  1YJW N;  1TUY A;  3AVF A;  4CJQ A;  5EX5 A;  5JVG L;  1S1V A;  1JLG A;  1KLN A;  2FSN A;  3O9S A;  1LOT B;  4CZG A;  2ITM A;  3AV9 A;  3KD1 E;  4KHW A;  3PUF A;  4Y1D A;  4CJE A;  3QEX A;  4N41 A;  4LSN A;  3ID6 A;  2ZWH A;  5J2P A;  1NGF A;  1WLJ A;  4MLH A;  4B3T K;  1S6P A;  3P83 D;  3O1W A;  1RBV A;  4JKE A;  4CHO A;  2HHX A;  4PHT X;  2D0P A;  4U67 L;  3RMC A;  1RGI A;  3THX B;  2GX9 A;  4JI4 K;  3AO5 A;  4IO8 A;  3NGY A;  2V52 B;  2CGK A;  3QML A;  1ASV A;  3RSE A;  1SZ2 A;  2GUI A;  3DJC A;  1SUQ A;  4FW2 A;  1WSI A;  2NRV A;  4JKG A;  3I33 A;  1NJW A;  3TAG A;  1NKB A;  1S72 N;  2EWS A;  3CI5 A;  1DTQ A;  4B1W B;  3HRG A;  1OVY A;  1JLQ A;  1U2V A;  4CJF A;  4EHT A;  2UXB K;  3R9P A;  2A41 A;  3LZI A;  5AZJ A;  1JXB A;  1ZBU A;  4FWP A;  3CCQ N;  3TSP A;  3WNE A;  4CJL A;  3SBG A;  2PYL A;  2Q2R A;  3AO3 A;  4O8U A;  1VRU A;  3RTV A;  4MLE A;  3QFU A;  4K8Z A;  2OPP A;  1JLE A;  2P9I B;  2DTU A;  5AQW A;  1L3V A;  4M7Y A;  4B8C A;  1EO1 A;  3OYI A;  3CC2 N;  4KBO A;  5E26 A;  3QO9 A;  4IDK A;  1ITG A;  4R5P A;  1F21 A;  3F5T A;  3KWG A;  4GVM A;  3DLG A;  1IG8 A;  1BG3 A;  5AQS A;  3VQA A;  4N56 A;  1HNX K;  4OPJ A;  4TSX A;  4F4K A;  1SKS A;  4EZ6 A;  1NMD A;  1MWK A;  4CF0 A;  3I8D A;  3SCX A;  4B9L A;  3I0R A;  4DV6 K;  3ATV A;  4LFB K;  2QXF A;  4I9L A;  3WEE A;  2D4W A;  4B1Y B;  4C1N I;  4FLT A;  4BRD A;  5HRP A;  5FRO A;  3KVG A;  3BZK A;  4CZI A;  1FW6 A;  1Z05 A;  1WBD A;  5BRD A;  3CJA A;  3MEE A;  3KLG A;  4C8K A;  4CFC A;  4AHR A;  2VGN A;  2KQ2 A;  3EL2 A;  3PIO L;  2UU9 K;  4CK1 A;  4L8R B;  3H08 A;  1WOQ A;  4IG3 A;  5FDL A;  4E89 A;  1WAF A;  1TUU A;  5HBM A;  1TAU A;  3HP6 A;  2OZM A;  3LAN A;  1NJX A;  2KTQ A;  1JCF A;  1IKW A;  4NXN K;  4ELV A;  4JD2 B;  1BI4 A;  1E4F T;  1QSS A;  2P9S A;  3D2F A;  3AO1 A;  5JS2 A;  3U4L A;  3O9R A;  1A5V A;  4DG1 A;  5BRH A;  3RRG A;  3KZB A;  3GE1 A;  3WXI A;  4CES A;  5LJV A;  1RBT A;  3THY A;  4FWM A;  3O4Q A;  3CCJ N;  1ILY A;  2GV9 A;  4FLU A;  2HNZ A;  4AM7 A;  1NGB A;  3RMB A;  4EAH D;  3MN9 A;  4W5Q A;  3V9W A;  1NGE A;  4K43 A;  1SL0 A;  2D5R A;  4E7I A;  4ZTJ A;  4F3T A;  3ZT2 A;  2P9L A;  1BIU A;  2E6L A;  4DWI A;  3SMS A;  2XRI A;  3CC7 N;  1QZ6 A;  4A59 A;  3ZX2 A;  1NOY A;  4IO9 L;  4BVP A;  4M63 C;  4BRN A;  4B9N A;  2P5G A;  4JI8 K;  3M8S A;  2BUP A;  4CEZ A;  4FJ9 A;  2XO7 A;  4Z4I A;  4C23 A;  4OPK A;  2B6A A;  2DPN A;  3E66 A;  4KHQ A;  1YIT N;  1IKX A;  3OYG A;  4CCH A;  4LF5 K;  1BDG A;  4KPY A;  1S9E A;  5I42 A;  3VGK A;  4CJR A;  5H1S Q;  4FJH A;  5DK5 A;  4JHD A;  3RR7 A;  3OYL A;  4X64 K;  4FLZ A;  3VGM A;  2W40 A;  5CR4 A;  3V1O A;  3MX5 A;  2QWQ A;  3AO4 A;  3GBT A;  1UAX A;  4DQR A;  2PY5 A;  4JRP A;  3N4Q A;  4JK9 A;  4DSL A;  2E1Y A;  1X1P A;  4DV4 K;  4JRQ A;  2IVO A;  1SKW A;  2HBJ A;  4MDA A;  3NH0 A;  4E7L A;  3SV4 A;  2ATQ A;  5AQJ A;  4A62 A;  5AQI A;  2YNF A;  1XC9 A;  3O3H A;  3TU5 A;  4DR2 K;  1Q86 O;  4B9Q A;  3O9T A;  3TAF A;  1BWF O;  4A5B A;  4HCC A;  4FLV A;  2HHW A;  4W5N A;  4CW7 B;  3PSI A;  1YTU A;  4YDU C;  4CJP A;  3M5R A;  4K25 A;  4KI6 A;  1S9G A;  1REV A;  4RW8 A;  3BP8 A;  3E9O A;  2VWK A;  2W6L A;  3NE6 A;  3ZSV A;  1HYZ A;  3MWT A;  1EQY A;  5IWA K;  3QLH A;  1D5A A;  3KHY A;  3L0Q A;  2Y1J A;  2KZZ A;  4DTS A;  5FRN A;  4DR5 K;  3VA0 A;  3P38 A;  2WUS A;  4G1Q A;  1TK8 A;  1RT6 A;  3NH2 A;  5T7B A;  3KLE A;  4AIL C;  1RT2 A;  3LDO A;  2VWJ A;  3RWU A;  1A5W A;  3U3G A;  4C8N A;  5EU7 A;  1X9W A;  3AVI A;  4CF8 A;  4KRF A;  3K5L A;  2FSJ A;  3W3D A;  3TTC A;  3U8X A;  3AAP A;  1P90 A;  5J1E A;  4CHY A;  2V51 B;  4DV5 K;  2ZE2 A;  2P9K B;  3ZSO A;  1XUP O;  2F9T A;  3C6H A;  3P1G A;  3KK7 A;  2R7Y A;  5FLX O;  4LF6 K;  4Y0W A;  3UKU B;  3CM6 A;  1ASW A;  3D2E A;  3ALY A;  2UUB K;  3ZT1 A;  4ID1 A;  5BR9 A;  1NGH A;  5FPE A;  4CFA A;  3LDS A;  1OH6 A;  1ZBI A;  4JKC A;  4IG0 A;  4RWT A;  1ZBF A;  4DB3 A;  2ZQB A;  4CZF A;  4DTO A;  1TKT A;  4X62 K;  1NWK A;  4OPA A;  1VQN N;  1RT1 A;  2OA8 A;  4BE2 A;  3T19 A;  4GW6 A;  1C6V A;  2BGG A;  4O5F A;  3TAE A;  4OX9 K;  3NFA A;  3AO2 A;  4BR2 A;  4OJR A;  4E1J A;  3WNF A;  4BR7 A;  1NGC A;  3CQ8 A;  3CIP A;  1VQ5 N;  3B6P A;  4CBU A;  4M42 A;  2VG5 A;  1OH7 A;  2IC3 A;  5J2Q A;  1KFD A;  3UB5 A;  3RRH A;  4KHP K;  2B5J A;  4DV0 K;  1BHL A;  1NGA A;  3L2W A;  4DLG A;  2Q0U A;  1G99 A;  3KLH A;  4FJG A;  1C0T A;  3MED A;  1UA1 A;  3ID8 A;  3EKS A;  3L8B A;  1E3M A;  4CIF A;  4ZTF A;  2GTD A;  1VSF A;  1LAW A;  2G8K A;  3DLR A;  1DGK N;  1Q9X A;  4BRM A;  2WOM A;  4NLC A;  4DR1 K;  1RT4 A;  1K8A O;  4F2R A;  5AZJ B;  3NVM A;  1XMO K;  2JWL A;  3R8E A;  4UY8 O;  3V6D A;  4PKH A;  4HHT A;  3S9H A;  4ILG B;  1VQM N;  2FBX A;  1NNE A;  2OPQ A;  3PV8 A;  2HND A;  4DFM A;  4IXC A;  5TKW A;  3NGI A;  3D7E O;  4B9U A;  4AH9 A;  5GAE P;  4CJW A;  4WCE L;  3AAQ A;  4I2Q A;  4AQY K;  4CJK A;  4H0X B;  1D9F A;  4EIA A;  4K0K K;  3LL3 A;  4KHY A;  3L3V A;  4KO0 A;  3NF8 A;  1Q82 O;  3ZEU A;  1IO2 A;  3FZL A;  3ZX3 A;  3K57 A;  3CJ9 A;  2IGI A;  1WNS A;  4UQG A;  1TK0 A;  4O5B A;  1ZC6 A;  3H1V X;  3AY9 A;  3VEW A;  4CGD A;  4KRE A;  3VEN A;  4M3T A;  2FLO A;  3QER A;  3ULD A;  2HHV A;  3CCR N;  3IFR A;  1KRP A;  4I7F A;  4E19 A;  5CYM A;  3A8Y A;  3VQ4 A;  1EWQ A;  4FJJ A;  4CJ5 A;  3CCL N;  3THW A;  2NRX A;  4NO7 A;  2AP1 A;  4KFB A;  2HMP A;  4KH4 A;  3OS0 A;  2O8F B;  3TPQ A;  3OS1 A;  1Z26 A;  1WSE A;  4O8K A;  1HRH A;  3ZSY A;  4LH4 A;  4GMJ B;  3ZT0 A;  4IOC L;  1N6Q A;  5JLH A;  4H0V B;  1BIZ A;  3HM9 A;  3HYF A;  1CXQ A;  2JLE A;  3HI0 A;  2HF3 A;  4R79 A;  3OYJ A;  5C24 A;  5F2R A;  4Z4H A;  4YOW A;  3F73 A;  2W6K A;  4DQS A;  4CHQ A;  1NKC A;  2P9S B;  4LF7 K;  4CVN E;  3UKR B;  4CGG A;  3NHG A;  1KAX A;  4CGJ A;  5FPM A;  3DLL L;  3NF7 A;  3PO5 A;  2Q97 A;  3AAR A;  4BRQ A;  4NLB A;  4FLX A;  3CC4 N;  3LM2 A;  3T1A A;  2QWR A;  4FWN A;  3HXM A;  3LP1 A;  3SJH A;  4W5T A;  4DR4 K;  3L2V A;  1GLC G;  3SNN A;  1TL1 A;  1YT3 A;  4RCH A;  3TTF A;  1C0M A;  2VWB A;  3AA4 A;  4FJX A;  3KKS A;  3CMA N;  2QWM A;  1FK9 A;  3ENH A;  1LWC A;  3SK3 A;  2P9L B;  3HST B;  3L2R A;  2YJF A;  3QIP A;  2QK9 A;  5F1X A;  4EHU A;  1VQ7 N;  1RTJ A;  4H5R A;  2PAV A;  3BDP A;  4CEB A;  2F9W A;  3RR8 A;  3K59 A;  3D6R A;  3SUO A;  3SJJ A;  5AQK A;  4GNI A;  4QS9 A;  4B3S K;  4KV8 A;  3PIP L;  3OVN A;  1S1U A;  2O8D B;  1NLV A;  2ASO A;  2E4L A;  1J5E K;  3G6E N;  2FC0 A;  4M45 A;  1ATR A;  4ISG A;  2VCP A;  3DLK A;  4DKW A;  5CZ2 A;  3O9U A;  2PZS A;  5B8H A;  1NU0 A;  4JI2 K;  3C6U A;  2CGL A;  3SUN A;  1OH5 A;  1X3M A;  3ZET B;  3WXJ A;  3V9X A;  3M3Z A;  4JNE A;  1K73 O;  2GWK A;  4IBN A;  3OYH A;  4FJN A;  4LH5 A;  1RT3 A;  1JJ2 M;  3KIO A;  1QZ5 A;  2XY6 A;  3OS2 A;  3EE9 A;  3ENO A;  1HUX A;  1KVC A;  3SI6 A;  4A61 A;  4CI6 A;  3CYM A;  3CCM N;  3M8Q A;  3KK3 A;  5KRT A;  3M1F A;  2HBL A;  5JLF A;  2HNY A;  1HJR A;  3M8R A;  3RMA A;  1RDD A;  4EZ9 A;  1GLL O;  3TR8 A;  3TTD A;  2HST A;  2P5O A;  3AVC A;  3ZSQ A;  2CGJ A;  4M3U A;  1U49 A;  4YOU A;  4KKO A;  2HBM A;  4HUF A;  1HKB A;  2KKZ A;  5SZT A;  3SPZ A;  1KVB A;  5A2Q O;  2O8B B;  2YKM A;  2A40 A;  4CEC A;  3AGK A;  5FPN A;  3MDQ A;  1J9A A;  3V1R A;  3L6Q A;  3OYA A;  3DOK A;  3H3O B;  3SAF A;  4BDZ A;  4IZ9 A;  3HZ6 A;  2Q31 A;  3EEQ A;  4IKF A;  5ELZ A;  1KC8 O;  4H4O A;  4NXM K;  2FF3 B;  1Y64 A;  4DHY A;  5BPL A;  5AZI B;  4H03 B;  4LD0 A;  5GIN A;  3VF2 A;  3CER A;  5JVH L;  3FLC O;  3T1Y K;  1VAZ A;  1X9M A;  1WAJ A;  2E8A A;  3VN5 A;  4B1V A;  2Z1J A;  2EX3 A;  2NZT A;  1KQS M;  1EET A;  5C0Y A;  2YCH A;  4RTF D;  1W2B M;  1FJG K;  3OYM A;  3A0I X;  3CPE A;  1TYQ B;  2BDP A;  4M3X A;  1B92 A;  4OVL A;  3V1Q A;  1HR0 K;  3AVJ A;  1ESV A;  4BE1 A;  3CHW A;  5BPM A;  3G4S N;  1WUA A;  3HTV A;  3SUP A;  4M3W A;  4H0Y B;  3B6O A;  1NK7 A;  2YI1 A;  4FSV A;  3R3L A;  1TKZ A;  1VSL A;  3VTH A;  5EY4 A;  4CK2 A;  4HCB A;  2KW4 A;  3MEC A;  4BVO A;  4CEA A;  2P9N A;  4CJV A;  1G15 A;  4J2E A;  3TAR A;  2X6N A;  1Z25 A;  1NK8 A;  5KTQ A;  2YJE A;  3T7Z A;  3O5B A;  4H4M A;  1Q18 A;  4C8M A;  1HPZ A;  4OGC A;  4B3M K;  3OW2 M;  1VQO N;  1IH7 A;  5HRO A;  3VQ6 A;  1BQM A;  3OY9 A;  3MX2 A;  2O8E B;  1CZB A;  3IS9 A;  4MQ3 A;  3IMX A;  3WT0 A;  4ILJ A;  4GY2 B;  4NCG A;  4BRG A;  4IFV A;  4YNQ A;  4CJT A;  3NBP A;  3CQY A;  2B4J A;  1RTD A;  4OO1 J;  1M90 O;  4WQ5 A;  1CZA N;  3LP2 A;  1C1A A;  4CFD A;  4O44 A;  1HNI A;  1VQK N;  1BOT O;  4PKI A;  3OYN A;  1W7A A;  4BG8 A;  1HNV A;  1J6Z A;  3QIO A;  3OJS A;  3DXM A;  4ILH A;  2OYQ A;  3FGU A;  2QEX N;  3LDL A;  2HHQ A;  1S3X A;  5AQM A;  4JS4 A;  2FBY A;  4FWS A;  3ZT3 A;  3HVR A;  3H1Q A;  3HPO A;  3GL1 A;  4CEF A;  4DV3 K;  1K8K B;  1RBU A;  2J4R A;  4DSJ A;  1WSF A;  3RVC A;  1RDW X;  4Z4C A;  4DU3 A;  2DFF A;  4CHP A;  5KQD A;  4FYD A;  4FZY A;  4E3S A;  2P9U B;  2V7Z A;  4FPB A;  4JV5 K;  1IBK K;  3DRR A;  4M41 A;  1HJO A;  1GOC A;  2FBV A;  2KHO A;  1S1T A;  1T8E A;  3I56 N;  4W5R A;  1C0F A;  1CZ9 A;  1QHT A;  1ZBS A;  5K14 A;  1SQK A;  2ZGY A;  4YOX A;  4B9T A;  4QCL A;  5AQQ A;  3LAL A;  2P1J A;  1KSP A;  4RW6 A;  3LWM A;  1L5U A;  1T05 A;  3QNO A;  1XWL A;  4DV7 K;  4OKK A;  5C12 A;  4FCY A;  4YY3 K;  1KFS A;  2YX6 A;  2YHY A;  3DOL A;  4JI7 K;  3MN5 A;  1T03 A;  1YVN A;  3CXC M;  3L4I A;  4FOE A;  2YNG A;  3BGR A;  2Q36 A;  5AQG A;  3WXM B;  1O1W A;  1LAV A;  4BRA A;  4E7K A;  4PWD A;  4E1M A;  4XH1 A;  4JKD A;  4BQZ A;  3VGL A;  1HYV A;  5CZ1 A;  1EXQ A;  3K5O A;  4KAZ A;  5M1F A;  4K41 A;  4BRP A;  3OYK A;  3OYE A;  3NCI A;  3QFP A;  2BAN A;  4FK4 A;  2HF4 A;  1QSY A;  3VTI A;  1KAY A;  3JAM O;  3HK2 A;  4KHS A;  1RTI A;  2NRT A;  2QWO A;  2YNI A;  3WNG A;  3ZSZ A;  3NDK A;  5HLF A;  3OYF A;  2QM1 A;  3WXL A;  2X6S A;  2A1R A;  3THX A;  5BN8 A;  4CZK A;  1LWE A;  2PFU A;  4E7H A;  2O8C B;  2QWN A;  1GLJ O;  1BGX T;  1WBB A;  3TAP A;  3L2Q A;  3AVN A;  4JLH A;  4YOR A;  1LW2 A;  2RN2 A;  1VQ9 N;  1MWM A;  1I94 K;  4Z0U A;  4H0P A;  3NVK A;  3J7Y P;  2KZM A;  4EP4 A;  1C0G A;  3M6G A;  3ATU A;  1B9D A;  1NK4 A;  4O55 A;  1ZXO A;  3I0S A;  4CEO A;  4I6M B;  1QSL A;  3S3M A;  5LMN K;  3TAB A;  3QEV A;  4DUY K;  4BWM A;  2QKB A;  1ZBH A;  2P9I A;  3ULE A;  4CJU A;  2WTU A;  1U45 A;  2W42 A;  2KLA A;  4JI6 K;  3FZF A;  1D4X A;  3U3Y A;  2UYT A;  3SQ4 A;  5MLC Q;  1U47 A;  4DR7 K;  4WYB A;  1VSK A;  4BE0 A;  5AQV A;  4G9Z A;  2JWK A;  1IJJ A;  2A6A A;  5AQH A;  4FJL A;  3QEP A;  4NCA A;  1NK6 A;  3HT3 A;  3CF5 L;  4BR0 A;  3WQT A;  3V9S A;  3HL8 A;  3IUC A;  3THV A;  4YOV A;  1U48 A;  3P31 A;  3BUZ B;  4U7B A;  1B9F A;  4H0O A;  4H5W A;  3BF1 A;  1JLB A;  4DLE A;  1X9S A;  5BPN A;  1V4S A;  1MDU B;  2D0B A;  4BRF A;  2HOE A;  4CJ3 A;  5J2N A;  1WB9 A;  2E20 A;  3BF3 A;  3VEV A;  3A5L C;  3WXK A;  3TSQ A;  5KQ8 A;  2IDO A;  4CGF A;  3ZSR A;  2D1K A;  3SMP A;  3RSE B;  2VQE K;  4CIG A;  2E2N A;  4JKG B;  4E7J A;  1Y97 A;  2BE2 A;  4I9Q A;  4JD2 A;  4CED A;  1R59 O;  1LW0 A;  3P5J A;  4JI5 K;  3R1X A;  1BUP A;  3VF4 A;  2F4V K;  1U2V B;  1NM1 A;  3S41 A;  3MXJ A;  5AQL A;  1KXP A;  3UIQ A;  3VQP A;  5D3G A;  4FJI A;  3OTO K;  3SAG A;  2CH5 A;  3C7N A;  3EZW A;  2Y1I A;  4F8R A;  3I8B A;  3E9P A;  3JSM A;  1DTT A;  2HHS A;  3F2K A;  1MA9 B;  5LL6 Z;  4A2A A;  5F0X A;  4OKE A;  3FR0 A;  4IWV A;  4JKH A;  1SAZ A;  4OLA A;  4M7X A;  2Q3S A;  4CZE A;  5BN9 A;  3AA5 X;  4DTR A;  1P8Z A;  3KWI A;  1HKC A;  4JYA K;  3VQ9 A;  3OBY A;  3VQ7 A;  1WSH A;  4CF2 A;  1TKX A;  1V4T A;  4GVE A;  5HRR A;  3SLC A;  4JI1 K;  4WE1 A;  1NMN A;  1NG9 A;  4FVM A;  4FWL A;  5KGW A;  3JYT A;  3EY1 A;  3LPU A;  4IJN A;  1ASU A;  1WSJ A;  2QTD A;  5AQZ A;  4DFK A;  3FFK B;  4M3Z A;  2HBK A;  3CET A;  3WEE B;  4FVU A;  1VHX A;  5LY3 A;  2DY4 A;  4WQ5 C;  1JCG A;  3VQD A;  3CFP A;  1M1K O;  2NRZ A;  4Z4F A;  4PQU A;  4KB0 A;  4FXD A;  3MCP A;  4CJ7 A;  2A42 A;  2KFZ A;  1D9D A;  2E5L K;  1DT9 A;  3TWH A;  3DMJ A;  5AQN A;  1VSI A;  3J7Z O;  4KTW A;  4YOY A;  5M1K A;  1QE1 A;  5AQP A;  3NH1 A;  4DR3 K;  3CCE N;  2GBZ A;  2VG6 A;  1GOA A;  3O1B A;  2XY8 A;  1XMQ K;  2ASM A;  4H8K A;  2ZF5 O;  4A2B A;  1RFQ A;  3GG4 A;  2PYJ A;  3QEI A;  1BI4 B;  3H45 C;  3PLA A;  2G8V A;  4N76 A;  4JK8 A;  2F7T A;  3D2F B;  5KGX A;  4KHU A;  2WFB A;  5FPD A;  4DV1 K;  1NGG A;  3AVB A;  4FWQ A;  4B8A B;  4BRE A;  3HBT A;  4EP5 A;  4ICL A;  4CF1 A;  3PSF A;  4N47 A;  4C8L A;  3THY B;  1RBR A;  4K8X A;  3CD6 N;  2G8I A;  1GLF O;  3OYC A;  4DTU A;  2ZJR L;  3MXM A;  1L3U A;  2D0C A;  3MAQ A;  1IV0 A;  4OGE A;  3O3F A;  5AFU H;  3D0P A;  1VSJ A;  1D8Y A;  4M3R A;  3ZCM A;  3ZT4 A;  3AVL A;  2OCE A;  3BEX A;  1RDC A;  1EX4 A;  3CCV N;  4BC2 A;  4KH5 A;  3N4P A;  2FBT A;  1GLB G;  3C65 A;  4WFA L;  3P4I A;  4DTX A;  1XQS C;  1Q9Y A;  1ZYQ A;  1HNW K;  1VSE A;  4DS5 A;  3DXK A;  4F2S A;  3NF9 A;  4ELT A;  2UUC K;  5C25 A;  1IKY A;  3Q7B A;  1J5O A;  3AA3 A;  2YHB A;  2D0A A;  5HL7 L;  2AA4 A;  1I39 A;  3EE8 A;  2P9P A;  3QIC A;  5GIO A;  5C15 A;  4DU1 A;  4JHD B;  2OTL N;  2P9K A;  3CJ7 A;  1YUW A;  4DFJ A;  5AQY A;  3VES A;  4DF4 A;  3O8M A;  5BRF A;  2GUP A;  5GAD P;  3UKU A;  4FM0 A;  4XH4 A;  1RIL A;  4O0I A;  5J2M A;  3MXI A;  3CM5 A;  4DSF A;  4LFC K;  4FM2 A;  5ADX H;  1WSG A;  3E9L A;  2LSN A;  3IDH A;  3T3F A;  4JKA A;  3W0L A;  4DCH A;  3PX4 A;  5E84 A;  3V4I A;  3V81 A;  4CE9 A;  1RT7 A;  1NJY A;  2ZGZ A;  1KAZ A;  5GAH P;  4BWJ A;  4GV9 A;  5C2F A;  4MO4 A;  1BA1 A;  4QAG A;  3VQB A;  2HHH K;  3DWL A;  4BRC A;  1QTM A;  4RW7 A;  1NOZ A;  4CZL A;  3DAW A;  3FZM A;  2E2O A;  4MFB A;  1QVG M;  2RKI A;  3DLE A;  5LMU K;  1XC3 A;  3AA2 A;  3C6A A;  3DYA A;  3LM9 A;  5HOO A;  5AQT A;  3PO4 A;  1YIJ N;  3C95 A;  4B3R K;  3SZ2 A;  3A5N C;  3ZYY X;  2HB5 A;  3G10 A;  4CJS A;  4CK3 A;  3QEW A;  4IJA A;  4M3Y A;  1Q7Y O;  2HW3 A;  3K5M A;  3O4W A;  3F9K A;  1LV5 A;  4E1N A;  1N32 K;  2ZD1 A;  3QB0 A;  1N36 K;  1KD1 O;  3H3N O;  3ZX0 A;  4X65 K;  1A5X A;  4NB4 A;  4AM6 A;  3QBX A;  3ZLJ A;  2H3G X;  2Z1I A;  1SKR A;  1NJI O;  4FK2 A;  4FZX C;  4PUO A;  1NGD A;  4PL7 A;  4ISE A;  3J80 O;  2IVP A;  5HP1 A;  4EFH A;  1NBW A;  3UE5 A;  5E41 A;  3SUQ A;  2GEM A;  3MMV A;  2QW9 A;  2FF6 A;  3OYD A;  4E0D A;  4WFN L;  4CBW A;  1RDB A;  2QXL A;  3D2E B;  4NYF A;  4CD3 A;  1XI1 A;  2UXC K;  1X9J A;  4JN4 A;  4B1Z A;  1LWF A;  1JKH A;  3FE1 A;  3ULE B;  1VQP N;  1U6Z A;  3CME N;  3AVK A;  1GLE G;  3DLB A;  4BR9 A;  4Q5V A;  3R6M A;  1FKO A;  2VQF K;  3TAM A;  1IBM K;  1N33 K;  3ENB A;  4BDY A;  1HQE A;  1TGO A;  2HHT A;  2X78 A;  1KTQ A;  1CLQ A;  3CCU N;  3WQU A;  1GLD G;  1VQ4 N;  5KPZ A;  3KK1 A;  1YVU A;  2HHU A;  4BDP A;  5JS1 A;  1EKE A;  3SBT A;  5DM6 L;  4JKB A;  3K5N A;  4MDB A;  3C6T A;  5C10 A;  4CHZ A;  2I7P A;  4FW1 A;  2RE2 A;  3K58 A;  3PX0 A;  4LF8 K;  4FZZ A;  2O4I A;  3C94 A;  4XIU A;  1TVR A;  4FK0 A;  2GWJ A;  5AJ3 K;  2EHG A;  3VQ5 A;  1TL3 A;  3ZSW A;  3T69 A;  4Z94 A;  5CE3 A;  1J54 A;  3MWP A;  4C8O A;  4DUZ K;  3LP3 A;  5KRS A;  1HLU A;  2O8F A;  2I5J A;  2NRH A;  3DLH A;  4JEP A;  4HWI A;  1HQU A;  4JI3 K;  4Z4E A;  1RNH A;  5CY4 A;  4DSK A;  4DR6 K;  4BG9 A;  2WC9 A;  5KI6 A;  4ISF A;  1VQL N;  1IKV A;  4BGB A;  3PX6 A;  3WNH A;  4QS7 A;  1HX1 A;  4JKF A;  4MO5 A;  3UKR A;  3IRX A;  2YV0 X;  3QET A;  3CJC A;  1FKP A;  4BR4 A;  5AQO A;  1EP4 A;  3KKR A;  1YHQ N;  5FRM A;  4NCB A;  3FFI A;  4KTQ A;  4JAX A;  4YHH K;  1U4B A;  4KH6 A;  1YXQ A;  5AR0 A;  3C7N B;  4H5V A;  2IVN A;  3LWL A;  3H6E A;  3CJB A;  3VMF B;  5SWM A;  2KFN A;  4HUE A;  5EXW A;  1NJZ A;  1IG9 A;  4BR5 A;  4JK7 A;  2NNW A;  3FZH A;  3VPZ A;  1W9H A;  2ITG A;  3PY8 A;  2A5X A;  3VQQ A;  1IBL K;  2NLX A;  4DV2 K;  4FWR A;  3ZEU B;  1W0H A;  3KD5 E;  3CCS N;  2X74 A;  1SS6 A;  2Z1G A;  1YI2 N;  2HMI A;  1MU2 A;  5TKY A;  4WF9 L;  1NKE A;  3LAM A;  4L3Q A;  2FXU A;  2E1Z A;  1QQM A;  4DU4 A;  1YJ9 N;  4V19 S;  2YHX A;  3MCA B;  4O0J A;  3S3O A;  4KI4 A;  4IOA L;  1JL1 A;  5M1N A;  2VG7 A;  4AHV A;  1L3T A;  3THW B;  4H5N A;  4OKJ A;  1X3N A;  4DTM A;  2G8W A;  1RCH A;  4HUG A;  4B08 A;  2O8D A;  2ZJP L;  4B1X B;  3SAH A;  4DS4 A;  1VQ6 N;  5CHI A;  1QHA A;  2ZJQ L;  1BIS A;  1E4G T;  4A5A A;  2DFE A;  3EN9 A;  1BCO A;  3HPH A;  4N5S A;  1SV5 A;  3KK2 A;  4I2P A;  4Q0B A;  1BCM A;  4FJ5 A;  5CYQ A;  3ZET A;  3QIN A;  5BR8 K;  1XNR K;  3KJV A;  3MN6 A;  1S1W A;  4AHT A;  4B9S A;  4BAC A;  4CHN A;  3MN7 A;  5KPR A;  3OA9 A;  4HVJ A;  1NK9 A;  4FJK A;  4AHS A;  4HTL A;  3FZK A;  1KVA A;  1HPM A;  1Q8I A;  4F9O A;  1RDA A;  2YHW A;  4WFB L;  1S6Q A;  3DRP A;  4FJM A;  3OYB A;  2PBD A;  5AFU A;  2OTJ N;  2RPI A;  4NYN A;  4YOT A;  4WQ4 A;  5AQF A;  1GOB A;  3AVH A;  4QS8 A;  3O08 A;  3LDQ A;  5EOY A;  4DQQ A;  4DQP A;  1YF5 L;  4CGH A;  2QA4 N;  4CER A;  3IG1 A;  1N8R O;  4H0T B;  1N5Y A;  1RBS A;  4KTZ A;  1OH8 A;  4IEE A;  3TI0 A;  1FXX A;  2W41 A;  3U9D A;  3ZSX A;  2O8B A;  4CEQ A;  1Z6R A;  2OAN A;  1S22 A;  4CZJ A;  4DSE A;  2A1S A;  1TAQ A;  3DXK B;  1RTH A;  1T3V A;  3G25 A;  3SV3 A;  4A57 A;  2E2Q A;  1HNZ K;  4AF1 A;  4RG8 A;  4PL8 A;  4CBX A;  3CFO A;  1YJN N;  2GEL A;  2E2P A;  2IAJ A;  1QS4 A;  4CEE A;  1N34 K;  4J2D A;  2P9P B;  3CPW M;  3A5M C;  1JLC A;  4PA1 A;  5HRN A;  2HVI A;  5DMR A;  3V9Z A;  4HTU A;  3AGR A;  3M8P A;  5AZI A;  5IT9 O;  4GKJ K;  3V9U A;  3GOI A;  3J81 O;  3CJ1 A;  3LZJ A;  3BY5 A;  4FL9 A;  4OLB A;  1QQC A;  5ADX A;  3HVT A;  3VEX A;  1BL3 A;  3EKU A;  2YNH A;  4IDH A;  2I7N A;  3NMU A;  4Y1C A;  1GLA G;  1JCE A;  3O9Q A;  4FLW A;  3VEZ A;  1OKJ A;  5JMV A;  1YAG A;  1I3A A;  2F96 A;  2G8H A;  3VA3 A;  1VSM A;  2IS3 A;  4B9M A;  4JS5 A;  1TYQ A;  3LDP A;  4CGI A;  2UUA K;  4FOI A;  3AVM A;  3KLF A;  1JXE A;  3NAE A;  3TAQ A;  3VQ8 A;  3HPG A;  3LPT A;  2NRW A;  5EVZ A;  1K9M O;  4DMN A;  5KPT A;  4PY5 A;  4FPA A;  3P39 A;  3K9J A;  1KLM A;  1O13 A;  2BTF A;  1DKG D;  4CD1 A;  3L3U A;  1QQN A;  3D45 A;  3VER A;  2DFH A;  1ATN A;  3QDK A;  3CFR A;  4CJ4 A;  3KLI A;  2QKK A;  1VRT A;  4DTP A;  1NK0 A;  3K0S A;  3HJF A;  4PKG A;  2RHK A;  4BRK A;  2NRR A;  4CZH A;  1RT5 A;  3EZ5 A;  2UXD K;  1BQN A;  5M1P A;  1UA0 A;  3HOS A;  4BRL A;  3E1Y A;  3E01 A;  3NF6 A;  1TK5 A;  3BZC A;  2O8E A;  3O3G A;  4B3O A;  2IOC A;  4DQ8 A;  4GKK K;  3ASM A;  3HM8 A;  1ZBL A;  4YFU A;  4FO0 A;  3I55 N; 
#chains in the Genus database with same CATH homology
 1WUA A;  2AA4 A;  3HTV A;  5C2D A;  4H0Y B;  4YDU C;  3M5R A;  4BRO A;  3EE8 A;  4K25 A;  2QWL A;  2P9P A;  2YI1 A;  3QIC A;  4FSV A;  5GIO A;  5C15 A;  3R3L A;  2Q1N A;  4JHD B;  2OTL N;  3VTH A;  1T6D A;  2P9K A;  3CJ7 A;  5EY4 A;  1RDU A;  3BP8 A;  1YUW A;  3E9O A;  5AQY A;  3VEY A;  3VES A;  3K9K A;  4BVO A;  2P9N A;  3O8M A;  3MWT A;  5BRF A;  1EQY A;  2QWP A;  5M1O A;  2GUP A;  5GAD P;  3QBW A;  3UKU A;  4XH4 A;  3KHY A;  1NGI A;  3L0Q A;  2YJE A;  1QQO A;  3O5B A;  3T7Z A;  1Q18 A;  5ADX H;  3E9L A;  3IKM A;  2IIR A;  3OW2 M;  1VQO N;  3IDH A;  3P38 A;  4BY9 C;  2WUS A;  3B8A X;  1NGJ A;  4BRI A;  4JKA A;  3MX2 A;  3W0L A;  4DCH A;  4OPH A;  4IFE A;  5E84 A;  3LDO A;  3IMX A;  4GV3 A;  3WT0 A;  1W97 L;  2ZGZ A;  1BA0 A;  2Q0R A;  1KAZ A;  1LCU A;  5GAH P;  4ILJ A;  4GY2 B;  4GV9 A;  3A5O C;  3VOV A;  5C2F A;  4MO4 A;  4BRG A;  1BA1 A;  5I9E B;  1QVF M;  3DWL A;  1K8K A;  2FSJ A;  3W3D A;  4BRC A;  3TTC A;  3U8X A;  3AAP A;  1P90 A;  1Q81 O;  4FWK A;  4CZL A;  3CQY A;  3DAW A;  3FZM A;  2V51 B;  2V7Y A;  2E2O A;  2P9K B;  4OO1 J;  2P9U A;  1XUP O;  2F9T A;  1M90 O;  3C6H A;  3HOT A;  1QVG M;  4WQ5 A;  1CZA N;  5AQX A;  3KK7 A;  2P9N B;  4J8F A;  4LC9 B;  3JS6 A;  4C1N K;  4Y0W A;  1BO5 O;  1VQK N;  1XC3 A;  1BOT O;  3UKU B;  3C6A A;  4BRH A;  3LM9 A;  4PKI A;  3D2E A;  5HOO A;  5AQT A;  5BR9 A;  1NGH A;  1H1V A;  4BG8 A;  1DEJ A;  1YIJ N;  5FPE A;  1J6Z A;  3A5N C;  3DXM A;  4ILH A;  4JKC A;  3ZYY X;  3O6W A;  3C0B A;  4XH5 A;  5LJW A;  4RWT A;  3FGU A;  2QEX N;  3LDL A;  4IJA A;  4DB3 A;  1Q7Y O;  4CZF A;  1S3X A;  5AQM A;  3JXU A;  3O4W A;  4FWS A;  1NWK A;  3O80 A;  3H1Q A;  4OPA A;  3QB0 A;  3WUH A;  3VEO A;  3GL1 A;  3VET A;  1VQN N;  1KD1 O;  1BU6 O;  3H3N O;  1K8K B;  2J4R A;  3ZX0 A;  4BC5 A;  3RVC A;  1RDW X;  3EO3 A;  4NB4 A;  4AM6 A;  3QBX A;  5KQD A;  4O5F A;  2H3G X;  2P9U B;  2V7Z A;  1NJI O;  1VQ8 N;  4FPB A;  1NGD A;  2ASP A;  4BR2 A;  4PL7 A;  4ISE A;  4E1J A;  2IVP A;  1ATS A;  4EFH A;  1NBW A;  5AQR A;  3UE5 A;  1HJO A;  4IOX A;  4BR7 A;  2KHO A;  2GEM A;  1NGC A;  2QW9 A;  2A3Z A;  3MMV A;  3GDQ A;  2FF6 A;  1T6C A;  3CQX A;  4WFN L;  4CBW A;  3CIP A;  3I56 N;  1VQ5 N;  4CBU A;  5BRE A;  2QXL A;  3D2E B;  4CD3 A;  1C0F A;  1X9J A;  4JN4 A;  1ZBS A;  3Q7C A;  4B1Z A;  3FE1 A;  2CH6 A;  2VYP A;  1SQK A;  2ZGY A;  4FWO A;  5M1Q A;  3UB5 A;  3ULE B;  1U6Z A;  4BGA A;  4YOX A;  3U9Z A;  1VQP N;  3CME N;  5AQQ A;  3J8A A;  3DXM B;  1NGA A;  1GLE G;  4BR9 A;  2Q0U A;  1G99 A;  3R6M A;  3HSC A;  4BC4 A;  4BC3 A;  5DM7 L;  4H5T A;  3ENB A;  5C12 A;  1HKG A;  3ID8 A;  2YX6 A;  2YHY A;  3EKS A;  3G71 N;  3MN5 A;  3CCU N;  3WQU A;  1GLD G;  3TSU A;  5KPZ A;  1VQ4 N;  1YVN A;  4GV6 A;  2GTD A;  3CXC M;  3L4I A;  4K42 A;  3OHR A;  4FOE A;  3SBT A;  4XEI A;  4B1U B;  1DGK N;  2Q36 A;  4JKB A;  5AQG A;  4MDB A;  5DM6 L;  3WXM B;  4BRM A;  4BQL A;  5C10 A;  4NLC A;  2I7P A;  3MK6 A;  4WQ4 C;  4BRA A;  5HL7 L;  5GAG P;  5JIC A;  1K8A O;  2RE2 A;  5AZJ B;  3NVM A;  3VF6 A;  4XH1 A;  2VGM A;  2JWL A;  4JKD A;  3OBW A;  3R8E A;  4UY8 O;  3LDN A;  2GWJ A;  4BQZ A;  3VGL A;  2WBN A;  4PKH A;  4ILG B;  1VQM N;  5M1F A;  2QI2 A;  4K41 A;  4BRP A;  3T69 A;  2D0O A;  4I6M A;  2E88 A;  4YDU A;  4Z94 A;  5CE3 A;  3QFP A;  4IXC A;  3MWP A;  2HF4 A;  5TKW A;  2BH1 A;  1KAY A;  3VTI A;  3D7E O;  2NRT A;  1HLU A;  2QWO A;  3H46 O;  5GAE P;  2NRH A;  2FSK A;  4WCE L;  3AAQ A;  2QM1 A;  3F9M A;  5GIP A;  4H0X B;  3WXL A;  4JEP A;  4EIA A;  3LL3 A;  5BN8 A;  4CZK A;  3L4Q A;  4HWI A;  1Q82 O;  3ZEU A;  2PFU A;  4IEI A;  2QWN A;  1GLJ O;  3FZL A;  4BG9 A;  2WC9 A;  3ZX3 A;  4ISF A;  1VQL N;  3CJ9 A;  4YOR A;  4BGB A;  4CZM A;  4QS7 A;  1VQ9 N;  1HX1 A;  1MWM A;  4JKF A;  1T44 A;  5AQU A;  4MO5 A;  1ZC6 A;  3UKR A;  1YJW N;  3H1V X;  3AY9 A;  3CJC A;  4H0P A;  3VEW A;  1TUY A;  3NVK A;  4BR4 A;  5AQO A;  5EX5 A;  5JVG L;  3VEN A;  1YHQ N;  1C0G A;  2FLO A;  2FSN A;  3M6G A;  3O9S A;  1LOT B;  4CZG A;  3IFR A;  4JAX A;  2ITM A;  3CCR N;  3ATU A;  4KH6 A;  1YXQ A;  3A8Y A;  5AR0 A;  3C7N B;  4H5V A;  1ZXO A;  3CCL N;  3ID6 A;  2ZWH A;  2IVN A;  2NRX A;  4I6M B;  1NGF A;  2AP1 A;  4MLH A;  4NO7 A;  3H6E A;  2HMP A;  3CJB A;  3VMF B;  2P9I A;  3ULE A;  4KH4 A;  5EXW A;  3O1W A;  4JKE A;  3TPQ A;  4BR5 A;  2KLA A;  2NNW A;  3FZH A;  4JK7 A;  4O8K A;  3VPZ A;  2D0P A;  4PHT X;  3FZF A;  2A5X A;  4IOC L;  1D4X A;  4U67 L;  5JLH A;  1RGI A;  4H0V B;  2GX9 A;  2NLX A;  4FWR A;  2UYT A;  3ZEU B;  4IO8 A;  5MLC Q;  2V52 B;  3CCS N;  2CGK A;  3HI0 A;  3QML A;  3RSE A;  4WYB A;  1SZ2 A;  1SS6 A;  2HF3 A;  3DJC A;  5AQV A;  1YI2 N;  4R79 A;  2NRV A;  4JKG A;  5F2R A;  3I33 A;  5TKY A;  2JWK A;  4WF9 L;  1IJJ A;  2A6A A;  4YOW A;  4G9Z A;  5AQH A;  1S72 N;  2EWS A;  2P9S B;  3CI5 A;  4B1W B;  3HRG A;  4L3Q A;  3UKR B;  1OVY A;  3CF5 L;  1KAX A;  1U2V A;  2FXU A;  5FPM A;  4EHT A;  4BR0 A;  3R9P A;  2A41 A;  3WQT A;  3DLL L;  2E1Z A;  1QQM A;  2Q97 A;  3IUC A;  4FWP A;  5AZJ A;  3AAR A;  3CCQ N;  1YJ9 N;  3TSP A;  4BRQ A;  4NLB A;  4YOV A;  3P31 A;  3BUZ B;  2YHX A;  3LM2 A;  3MCA B;  3SBG A;  4U7B A;  3CC4 N;  4IOA L;  2QWR A;  4H0O A;  4H5W A;  3BF1 A;  5M1N A;  4FWN A;  2Q2R A;  4O8U A;  1V4S A;  5BPN A;  4H5N A;  1MDU B;  1X3N A;  4MLE A;  3SJH A;  3QFU A;  4BRF A;  2HOE A;  2P9I B;  2E20 A;  1GLC G;  5AQW A;  4M7Y A;  4B1X B;  3SAH A;  3BF3 A;  2ZJP L;  4RCH A;  1VQ6 N;  3VEV A;  3TTF A;  3A5L C;  3WXK A;  5CHI A;  3CC2 N;  1QHA A;  3TSQ A;  2VWB A;  2ZJQ L;  5KQ8 A;  2D1K A;  1E4G T;  4KBO A;  5E26 A;  2QWM A;  3CMA N;  4A5A A;  3EN9 A;  3F5T A;  3KWG A;  3SMP A;  3ENH A;  1IG8 A;  1BG3 A;  3RSE B;  3SK3 A;  2P9L B;  5AQS A;  2E2N A;  4JKG B;  2YJF A;  4JD2 A;  1R59 O;  3ZET A;  5F1X A;  4EHU A;  1NMD A;  1MWK A;  3R1X A;  1BUP A;  1VQ7 N;  3VF4 A;  3MN6 A;  4H5R A;  1U2V B;  2PAV A;  1NM1 A;  3ATV A;  3S41 A;  5AQL A;  1KXP A;  3WEE A;  2F9W A;  2D4W A;  3D6R A;  3MN7 A;  3OA9 A;  4B1Y B;  5KPR A;  3SAG A;  5AQK A;  2CH5 A;  4C1N I;  4GNI A;  4HTL A;  4QS9 A;  3C7N A;  3EZW A;  3FZK A;  4BRD A;  3I8B A;  3E9P A;  1HPM A;  3PIP L;  3KVG A;  4F9O A;  2YHW A;  3F2K A;  4CZI A;  4WFB L;  1MA9 B;  1NLV A;  4A2A A;  5F0X A;  1Z05 A;  2PBD A;  3FR0 A;  5AFU A;  2ASO A;  4IWV A;  2OTJ N;  4JKH A;  3CJA A;  1SAZ A;  4YOT A;  4WQ4 A;  5AQF A;  5BRD A;  3G6E N;  1ATR A;  4QS8 A;  4ISG A;  4M7X A;  3O08 A;  2VCP A;  3LDQ A;  5EOY A;  2VGN A;  3EL2 A;  4CZE A;  4DKW A;  5BN9 A;  3PIO L;  3PLA A;  1YF5 L;  1P8Z A;  3KWI A;  1HKC A;  1WOQ A;  3OBY A;  3O9U A;  2QA4 N;  1TUU A;  5B8H A;  1V4T A;  1N8R O;  1JCF A;  4GVE A;  4H0T B;  2CGL A;  3SLC A;  1X3M A;  4JD2 B;  4IEE A;  3ZET B;  1E4F T;  3WXJ A;  4FWL A;  2P9S A;  3D2F A;  3M3Z A;  2W41 A;  4IJN A;  4JNE A;  3U4L A;  3U9D A;  1K73 O;  3O9R A;  2GWK A;  2QTD A;  1Z6R A;  2OAN A;  5AQZ A;  1S22 A;  5BRH A;  3FFK B;  4CZJ A;  2HBK A;  3CET A;  3WEE B;  4FVU A;  3DXK B;  1T3V A;  3G25 A;  3KZB A;  4WQ5 C;  1JCG A;  3GE1 A;  4A57 A;  5LY3 A;  2E2Q A;  3WXI A;  1M1K O;  2NRZ A;  1JJ2 M;  4AF1 A;  5LJV A;  1QZ5 A;  3EE9 A;  4PL8 A;  4CBX A;  3MCP A;  4FWM A;  1YJN N;  3CCJ N;  2GEL A;  3ENO A;  4CJ7 A;  1HUX A;  1ILY A;  2A42 A;  4A61 A;  2E2P A;  4CI6 A;  1DT9 A;  3CCM N;  4AM7 A;  2P9P B;  5AQN A;  3CPW M;  1NGB A;  3J7Z O;  3A5M C;  3M1F A;  4EAH D;  4YOY A;  2HBL A;  3MN9 A;  5M1K A;  5JLF A;  1NGE A;  3AGR A;  4K43 A;  5AQP A;  5AZI A;  3CCE N;  1GLL O;  3GOI A;  3CJ1 A;  4FL9 A;  3O1B A;  2HST A;  3TTD A;  5ADX A;  2CGJ A;  2ASM A;  3VEX A;  2ZF5 O;  3EKU A;  4A2B A;  4IDH A;  1RFQ A;  2P9L A;  2I7N A;  3NMU A;  3GG4 A;  1GLA G;  1JCE A;  4YOU A;  3SMS A;  2HBM A;  3O9Q A;  3VEZ A;  3CC7 N;  1HKB A;  1OKJ A;  1QZ6 A;  2KKZ A;  1YAG A;  3H45 C;  3ZX2 A;  4A59 A;  4BVP A;  5JMV A;  4JK8 A;  2F7T A;  3D2F B;  4IO9 L;  4M63 C;  4BRN A;  2A40 A;  2WFB A;  2BUP A;  3AGK A;  5FPN A;  3MDQ A;  5FPD A;  1NGG A;  1TYQ A;  3LDP A;  4FWQ A;  4C23 A;  3L6Q A;  4BRE A;  3HBT A;  4FOI A;  2DPN A;  3E66 A;  3H3O B;  3SAF A;  3CD6 N;  4IZ9 A;  1GLF O;  3HZ6 A;  1YIT N;  5EVZ A;  2Q31 A;  2NRW A;  1K9M O;  1BDG A;  5KPT A;  3VGK A;  4FPA A;  3P39 A;  3K9J A;  5ELZ A;  2ZJR L;  1O13 A;  1KC8 O;  5H1S Q;  2BTF A;  2FF3 B;  1Y64 A;  4DHY A;  4JHD A;  1DKG D;  5BPL A;  4CD1 A;  1QQN A;  3VER A;  1ATN A;  4H03 B;  5AZI B;  3VGM A;  2W40 A;  3QDK A;  5CR4 A;  3VF2 A;  5GIN A;  3CER A;  3MX5 A;  2QWQ A;  5JVH L;  3FLC O;  5AFU H;  3GBT A;  1VAZ A;  3N4Q A;  4JK9 A;  4PKG A;  2RHK A;  2E8A A;  4BRK A;  2NRR A;  4B1V A;  2E1Y A;  3BEX A;  4CZH A;  2NZT A;  3CCV N;  4BC2 A;  2IVO A;  4KH5 A;  3N4P A;  1KQS M;  5C0Y A;  2HBJ A;  2YCH A;  4MDA A;  4RTF D;  5M1P A;  3HOS A;  1GLB G;  3C65 A;  4WFA L;  3P4I A;  1W2B M;  5AQJ A;  1XQS C;  4BRL A;  3E1Y A;  4A62 A;  5AQI A;  3A0I X;  3CPE A;  3DXK A;  1TYQ B;  3TU5 A;  4DQ8 A;  1Q86 O;  4B9Q A;  3O9T A;  1BWF O;  3Q7B A;  4A5B A;  1EO1 A;  3HM8 A;  1ESV A;  4FO0 A;  3CHW A;  3I55 N;  5BPM A;  3G4S N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...