4MDRA

Crystal structure of adaptor protein complex 4 (ap-4) mu4 subunit c-terminal domain d190a mutant, in complex with a sorting peptide from the amyloid precursor protein (app)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
269
structure length
245
Chain Sequence
b'NEVFLAVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFSVGKSELRGYGPGIRVDEVSFHSSVNLDEFESHRILRLQPPQGELTVMRYQLSDDLPSPLPFRLFPSVQWDRGSGRLQVYLKLRCDLLSKSQALNVRLHLPLPRGVVSLSQELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPLGLGPASLSFELPRHTCSGLQVRFLRLAPHKWVRHLSHSDAYVIRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-4 complex subunit mu-1
molecule tags Protein transport/protein binding
source organism Homo sapiens
publication title Structural and Functional Characterization of Cargo-Binding Sites on the mu 4-Subunit of Adaptor Protein Complex 4.
pubmed doi rcsb
total genus 49
structure length 245
sequence length 269
ec nomenclature
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00928 Adap_comp_sub Adaptor complexes medium subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4mdrA01
2.60.40.1170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4mdrA02
2VGLM 1H6EA 1BXXA 1HESA 4MDRA 3H85A 2JKTM 1I31A 1BW8A 2JKRM 4IKNA 4EN2A 5FPIA 4UQIM 2PR9A 2BP5M 5C7ZA 4EMZA 3L81A
chains in the Genus database with same CATH superfamily
4ACPA 2NR6A 1NBZA 2XETA 4Z7WE 1NOFA 4YO0A 1IGJA 1AQDA 5DLLA 2DMBA 4HPHA 2OZ4H 4DFIA 1J5OL 4A7TA 3ARDB 2XVKA 4K7FB 3SKOA 3QJXA 4G6MH 4KZDH 1F18A 1NM4A 2W07A 1PDKB 4KFZC 1YN7B 4FQQA 4NXKA 3FTGA 1TQBC 2EYRB 4XVJL 1DQMH 4AW4A 5EZOL 3STZB 2BNUA 1NMCB 1JV2B 5HHNB 3Q06A 3ISYA 1BM3H 3VH8B 3GHBL 4NPKA 2X4PB 2V2XA 3LKNB 4I48B 4M1CD 1R17A 5EU6D 4G5ZH 4CSZA 3MUJA 5I6XC 2YEQA 3WE1A 2DY2A 1I1AA 2VMDA 4TNVK 1ZLWH 4APQD 4G8IB 4LOUC 3U1SH 4W6WB 1KCSL 4M3HA 4KXZI 4WI2A 5DMKB 5AKVA 1P6WA 1KXTA 1G7LA 4AYSA 3M17B 2FJGA 5CSZA 5EPMA 1F97A 3C87A 4FQHB 2D2OA 2V8LA 4OLXH 5DD1H 5F8RC 3BH8B 5TPWL 1CICA 2JFCA 3I9GH 1OAXH 4RA0C 1V3MA 2IV8A 1LO0L 4XPAH 5FO8B 1KYOK 3B2VL 4MJ2A 4K8RH 5AUMA 2Z65C 4AQEB 4Y19D 5C07A 5HYSB 1IGFH 3VXME 2M1KA 4FZ8H 3U2SA 1OKEA 2P49B 2VDPB 4JJ5A 2CIKB 2DDQL 4K5LA 2AQPA 1RZJC 1RURH 3LHAA 4WU5B 4A2EA 3FT9A 1MJ7L 1ZHNA 3TF7C 4NAQA 3I6GB 1DVFD 5A3ID 5HGAA 3ZYZA 5EORL 4G83A 2AFNA 1TTAA 3OD3A 3NABL 1JJUA 3DMMB 3UDWA 1UA3A 5LXVA 5D7IF 2OBGA 3F7RA 3HNSL 4EI0A 3W56A 4MLSA 4JW3A 5EZLA 4YAQB 5AKRA 5AW3B 3ZE2F 3DMMC 2W8CA 1CFSA 2LU7A 1QSEE 1QSVA 2WWOA 4RAUB 4H5SA 1CE6A 3UTZA 2HFTA 2ZUUA 2CO1A 2BDNL 1VZIA 1II4E 2XPYA 1NAMA 1VFUA 2F9BT 2J5LB 1COBA 2DM2A 5CBAB 3RA7H 2CRZA 1N18A 3DX6B 3FJTA 3O6FD 3BP5B 2FCBA 4G3YH 4R90L 1UJ3C 2GW5A 1I82A 3H9ZA 5IQ9A 5JHLH 1KTDA 1QLFA 1QHPA 3V0EA 3BYYA 2WP3T 5I1GL 1J9CT 4JFFD 4OM1L 4Y0GA 1GYCA 1FV1B 2VLJE 1YDPA 1T21B 5B39A 2G60H 4FQJH 3IAPA 2R56H 4W4NA 1M7IA 5ICZA 4LCIH 1B0RA 1EHAA 1R34A 3BAWA 5JA8B 3B6SB 3ET9F 2KC0A 4JRFA 1DEDA 4WGVB 3S5YA 2PYEA 3PAZA 4PV8B 3RZCC 2PTUA 4J1UB 4C56D 1GVIA 2J8HA 5TQ0L 4NUGH 4DP6X 4F8TA 1KBPA 1GZQB 1OSPH 4FI8A 4JFEB 5I1LB 2XN9B 5E00B 3RJQB 2MRYA 1G7QB 4X6FA 3KPSD 1ZAGA 1VSCA 2CXGA 4FP8L 1KIUB 5D1QE 4JCMA 4ONFH 3VU2A 3VG0L 3TLRA 4N2GA 5AAWA 2WBKA 2ZYRA 4B9CA 3CNKA 4RFNC 4BUHA 5SWQB 4XMKL 1CLOH 4ZPVA 3QWOB 3U25A 2VZVA 5INDB 4NZRH 3HG1A 4AUYA 5E6RB 5DFTA 1X9UA 3RWEA 4UM8A 3NSJA 2OTWA 5DT1H 3EGSA 1S7TA 1AIFA 2HX8A 2MTAA 5DLML 3GJEB 1VADB 3H0TA 1MDTA 2DWSA 5MERB 4S0SD 3GIVA 3M6DA 4MJJA 4DGIL 4ISVA 4YGVB 4RGNB 3QIUA 4KKCC 2F7RA 3W2DH 4JN1H 5BZWA 1N3NA 2GIXA 5K9QG 2KLRA 4P5KB 4FOMA 3DURA 3QAZB 1A8JH 3GD1C 3QUXB 2PN5A 1QI5A 4XN8A 1CFMA 4TVSa 1TYRA 1YC8A 4WUKH 5ACZB 2IG2H 2XWCA 2BSEA 2P5WD 4QO1B 1NDGB 1FIEA 5B1JC 2ENJA 4TM9A 3VXRA 1PX4A 3HZMA 3NVQA 3KPNA 4F15C 5ERWB 3JWOC 2D3NA 4QOKE 5I74B 5B39G 4DKTA 4YSRA 3VYPA 3RX8A 5FEBA 2OMZB 4IS6B 1F3RB 3WL9A 2NXYD 3LKSA 3MV9E 4X4XB 1VF5C 3GMMB 2J73A 1A6VL 1A6AB 3BP6B 5JPNC 1KBWA 1MAMH 1NCCL 4PJFA 3RGVD 2XTJE 3RY6C 4DEWA 3V0JA 3JQOB 4HKJB 1ZOXA 1O9ZA 3E2HC 4OM0L 1L9TA 2IAMB 3GKWL 5J11C 1HEZA 4XP6H 3RWFB 1PZSA 3L3HB 4KMQA 3TV3L 3PXJA 4C56E 1DDHB 4JREB 1MQKH 2F2HA 3BDYH 3F00A 3KWXA 5I71C 1F3JA 5I66B 5L2KB 4KTDH 2WVTA 1G6RB 2ZWNA 3B8SA 3WHE1 5IFAH 4A2DA 3L1EA 3TJEH 2QSCH 2NNFA 1LDPH 4YLCA 1CLVA 2VLKE 3CXHK 4HEPG 4OFIA 4P5SA 1FFRA 5C0BE 4CUCA 1AOZA 2W88A 1F1AA 3DIFA 1EXGA 2NMSA 2HB0A 2R0ZH 1TPXB 4PV9B 4UIMB 2K9UA 3G5XA 5BRQA 1JHKL 5LAXB 3CQPA 3I74A 1A9EA 4YC2B 3D39B 1C7SA 3RUGF 1IFHL 1E4KC 3EYQD 4GSUA 4LPUA 2NY3B 2ADFL 2LHAA 1S3KL 3LSOB 3H54A 4OCSL 1ETA1 3ZDZF 4MAYB 1J1PH 2VJ8A 1YUKB 4KRMB 1MNNA 4KKLD 1BPVA 2BIHA 1KCUL 2FWOB 2XN2A 3QJRB 1N2RA 1A7QH 3D3VE 3QXAA 3H7BB 2AJVH 2EDOA 3ARUA 2XZZA 3ESOA 4OZIF 1BF5A 2E9GA 3BWZA 3ZN6A 2VXTH 2Z35A 4X9IA 2V17H 2NY0C 1RJZA 3T2NL 4HCIA 3P4NB 2PWFA 1CTMA 3AB0C 3S7GA 2OXHA 1F4WH 4X6BA 3QFGA 4HLZH 1FNFA 1XXDC 1G7MA 4HFWA 3IDGA 3OLDA 1NCAH 2FX8L 3L4VA 3KD4A 3KW8A 4H8HA 2E9JA 4AQ8A 4M00A 2VLJD 1QACA 2COVD 1JP5A 2AXJA 3VDCA 4ODTH 1XL6A 4R97B 3IVKA 15C8L 3LMJL 4P2QA 4NCC2 2DMGA 1I1FA 4M7ZC 3T2PA 3TO2A 1E6JL 1B4JH 2ZAIA 1HU8A 2PW2B 4RQQB 4JZJA 3E3QE 5FM5O 3WN5C 5A7BA 4JRYB 5MEOA 4GRLB 4WW1B 2ZKXA 4BGDA 4PJFB 2G5RA 4DPAX 3BEVA 3HNVH 4Z78B 1U4FA 3PGDB 1D6EA 4JJHA 2EC8A 4LLWB 2AI0L 2GHZA 1JXGA 3UO1H 4FI7A 1P7KB 3TFKC 1A6PA 4PY7B 3VXUA 5J0BA 1GZPB 1PY0A 2QSVA 4IOFD 3K72B 1AGCA 4DEUA 2O93L 4UDTB 2YQBA 3FN0L 5CJXC 3JV5A 1IGCL 4K15A 4TUKL 5BS0E 2PWDA 3EFOA 1IBGH 4HV8A 5E8OB 5C0AA 3AT0A 5AD0A 4JHZA 2WVUA 4G9FE 3O2WL 5IHHA 4MD5A 3FCBA 3CU7A 3NSYA 4IEFA 1BG1A 4JDVA 1AQKL 4XXWA 3U7WH 1DJHA 1MHHB 1X4XA 3AM8A 5KSBA 7PCYA 4YZWA 3IDIA 3MJ9H 3MV7A 4EVNB 4D0CB 1FH2A 1TZHA 4NZFA 2V9UA 4K23H 4XO4A 4Y16D 1HNGA 1RPKA 4JE4B 4K2UH 5IB4A 3DX9B 3LKQB 3U0WL 4AG4L 4G43A 1QNZL 3OAWA 5EN3A 7FABH 4L4TD 1UGKA 4QXGL 2JELL 4BGLA 4PR5A 5ANMB 5IVXB 2C1PB 4PJ8D 1GYVA 1JWMB 1KCWA 1DLHA 4KKBC 2WUCL 2W9EH 4ES8A 1JYXA 2XWTA 2GEEA 3WS3B 2F54A 3FSWA 4YSTA 4ODWB 2MIZA 3HUJA 4MMXB 4XP9L 1M4KA 5EBLA 2QQQA 2I9TB 4ELMF 1YQVH 2B4CL 5AG9A 2UX6A 5DHEA 3ZE0B 3QAZC 4NKQB 4M8UA 3EOBA 4QHKJ 5DHVA 2VERA 4Z7NF 3LN5B 1K2DA 35C8L 3NDZE 1CXEA 1G4MA 2H1PL 3MNWB 4HD5A 1RZIB 3N85L 3D33A 1FZMA 1W16A 4JFDA 4KDWA 2X4UA 1HZHL 3GBDA 3GXTA 4PSPA 2XWJB 3KYNB 5CZXC 3WY3A 3AITA 2Y1ZA 4M5YH 4LNRA 4ZMZA 5I1HH 5AZEH 3U4BL 1F6FB 2Y07L 4F9LC 4G8GA 4BK5A 4MLIA 2NY2B 2W60A 4RISL 3H1ZA 1UCBL 1EERB 1YEJL 3OJMB 4XWGL 5FGCE 4TOYH 1I3GL 2PCFA 1OSYA 3BH9B 4X6DA 3GRBA 5LKNA 1CBVH 1E5UI 2NLJB 3TIDA 4Y9GA 3O3UN 4TMPA 5DYFA 2FIRT 4MX7A 4AXWB 5L4JA 4O4YL 2IH3B 5F9DC 5I17A 2D0GA 3QJOA 3QFDA 2YAHA 4M9PA 1BAFL 3RZCB 4KAQL 3ZKXC 2APTA 3APMA 2FHBA 4M8QA 3SY0A 3FYEB 3NCCB 1DJWA 1X5LA 3NJXA 4LPXA 3VFUA 2FGWH 3EYUH 4MWFB 2XWZA 1NIAA 3GS4A 3UPCA 3O8XB 1BJ1J 4HKBB 5DUMH 2ZE0A 3EF7A 3O3DB 1KJMB 1G9EA 4BE6A 2F7IA 2Y0SA 3FB6B 3DV4B 4WFHE 3FCTA 1VPOH 4ZW8A 3ZHKA 4ONGH 3OKEA 2IFFL 1MAKA 4D0CA 4AYFA 4AYMC 1TETH 2BIOA 2IPTL 2B14A 1AO7E 1T22A 1FVCA 2GTWB 3G6JE 4WJG3 4MAUL 3LX9A 2L8AA 4NZRL 2PO6A 2F8OA 2WAQA 1VZGA 5CUSL 4KKNA 5E94A 3BWAB 4R7DA 5FO7A 1FYHB 1J0KA 2NY6C 2WTPA 4QHLA 1F42A 1A6WH 1P7QB 3NFNB 2OV0A 35C8H 4N0UE 1Z6JT 5CZVL 4YR6B 2ZUTA 3WFBL 5EO0B 2WK2A 3QG7H 5EC2B 3CFEB 4U6XB 4R8WH 2GJRA 5FPIA 5HGHA 3MUY1 5HHPB 3B7TA 5GIRA 1JAEA 4ODSH 2IH9A 2WZPA 2Z0UA 1A3RH 2E56A 2HAZA 2R0LL 2R2CA 4PJAB 4OZIA 3MR9B 4ISVB 4XVOA 2X28A 1RZ7L 2EO1A 4NKMB 5JIKA 3QUMA 2VITB 1QHOA 2ZKHL 4OZHB 4L1TA 5IMOA 1U8HB 4OD1H 1F02I 4MRBA 2ED8A 1I1CA 3JWOH 4KXBA 2VLRE 2M83A 3ABMB 4OQTL 2X6MA 1KB5L 3MBXH 4HCRH 5LG1A 4DGVH 4NHUB 2JMRA 5EBWB 1BEYH 1FL5A 2IAND 3FC8A 1E8XA 3RUGA 4NZJA 5A40E 1K4DB 5JPNA 4HS6B 3FFCA 4J3OD 4K9EC 4PJCF 2JIXB 3L3KB 5EV7A 3V5KB 3FBQA 2CU9A 1GYAA 1UACL 3F6LA 3O0LA 2PW2A 3T8XA 3QDAA 2J20A 2CJTA 3L9BA 5FV2A 5MP6L 4PRIE 5HYFA 3QB7C 1T83C 5A2JH 2DAVA 3KNBA 4XR8C 2UWEE 2X10A 3RIFK 3D50A 3IXTA 2ITCA 3G9VA 3K74B 3SCMC 1NIFA 2O6FA 2WBWB 4UB0L 3ZUCA 3L4YA 2DMHA 5IB5A 5JW4N 3FF7A 3BP7B 4NQEA 4NIKB 1AOHA 3MRJB 2MPVA 5FCUL 3S3PA 5AW4B 3OMZA 1D5BB 3VD2A 5CLZA 3ASNB 4AQ1A 1M05A 4JL2A 4Y5VB 4IKJA 3INOA 3LRMA 1KB9K 3FU6A 3VFNA 4IDJH 4R90H 1VKXB 5JTWA 1GW6A 4JY6B 4RA3A 3G5ZA 4Z7UA 4JR9L 4MRCA 1NLBL 5FOBB 3W1ZA 1MQ8A 3L9RB 1IAKB 5FYKU 1V8HA 4LIQH 5HYJA 1ZDSA 2XZAL 3S5LA 2Q76A 5B7FA 2FJHA 4Y1SA 5F8QC 5FO8A 1A6VH 3H2PA 4I5BA 4FJZA 2ZOKB 3D2UD 2ZXBA 1DBJL 3BN9C 3MV9B 1TZIA 1XB8A 1ETJA 2FB4H 3O2VH 1NUNB 4M48H 5CJQL 5DMGC 4AMXA 5JORA 2ZD0A 3NK4A 2BC4A 3T0EC 1DLHB 3WUWG 2QGEA 1WT5A 1D5XA 4Z7QB 2CM5A 2N7SA 2P1YA 3DRQB 4JPQA 4KI5E 5GGVL 4GI6A 4NRZA 3GRWL 5MI0B 4DGWC 3V0WL 2QADD 4KTDL 4W1TA 4Q52A 3MREB 4WI3A 4HF5L 3SKJL 2R27A 3SIKA 4GB9A 1AGBA 2EICA 2OK0L 2ESVD 5BV7C 2P45B 5E1QA 4BSJA 5C0FA 1Z66A 3ZKXB 5DURB 4F7MB 2O61B 3SBQA 3RTQD 4FJYA 4X5XB 4QRRA 1U3YA 5AW8B 5GJTL 1W0WB 3WY4A 4PRHB 3FU3A 4M02A 5I5JA 4OIBA 3DX6A 2WQXA 4ZNEE 5LG6A 1D5IL 4Y4FD 3VRIB 2PP7A 4Z3IA 4DH2A 4W9EC 3ZU8A 5DXWA 4BIKA 4CVXA 1RJLB 2YR3A 3VH8G 1FV1A 5IJDC 3MMEA 4GUCA 4Z3FA 3HFML 3L45A 1O9WA 2J1XA 5TF0A 5LXGH 3BEWA 2XXGA 3MV11 4Z78A 1H5BC 4H2AA 3NCYS 3PGDA 4XNZB 5F6HJ 4DOHE 4NO0D 5K93A 4IW4C 1Y18B 3G6JB 4HWUA 4N2LA 4XVSH 1KGXA 4OZFA 2YQ2A 3N1GC 3BRFA 5IVZB 5C0CA 1BJ8A 1QPKA 3AXIA 4KRPC 2XWXA 1I9IL 1JV5B 3WTXA 1E9OB 1FFQA 1XSIA 2AV1B 2Y7LA 4NQSB 1F86A 3FTZA 2UXTA 4P3WA 2H6UA 4KMTH 3HRPA 3P54A 5ANHA 4NKDA 3HC4H 3SGDI 1CFTA 1L4IA 2NY6D 2BNRD 2Y9RT 5DS8B 4HT1H 1PAMA 5L2KD 3MJ7A 2LR4A 4PJEB 4YZFE 1KJMA 1IKNC 4EN3A 4TSBL 1UXSA 4FNTA 3N0PB 2BNQE 2WYIA 4UNUA 1XF4B 3DYOA 1F11B 1OT1A 1PJ9A 3SYPA 4V33A 3BKYH 3UBHA 4E41D 2HWZH 4IDLA 4XCYB 3KYKH 3QUYC 2WSKA 1HAWA 3RGVA 4N26A 5FC9A 1CVSC 4M7LT 3ZL4H 4F33B 1XGZA 1OVZA 4LAJH 1FSKC 1YEIL 3AXHA 3BAEH 3DKHA 32C2A 3CN3A 3UG4A 5F9JB 2WXNA 5DD3H 4XNUH 4Y5YB 4KXZH 1MCRA 5DJ6B 2HX9A 4CVUA 4YE0A 1XIWC 1YEKH 5C09D 4BUQA 2HMID 1XGUA 2DYPB 4JKPH 4F3FB 4OGXH 4XO9A 5LQBH 3PXHA 1UZ6F 5I15H 2ZOOA 4HWEL 3DO3A 1FVDB 2R0WL 1R19A 2AJSH 2BP8A 1LEIA 3NPSB 1HH6A 1KTBA 2ENQA 3G5VB 3NIFF 2R1YB 4JFDE 4NM4L 2R15A 4YBLB 3UROR 3WY1A 4O00A 5J9PB 1V7NH 2XACC 3FCUB 1AQKH 3U7WL 4DZ8A 5BXFA 1PGRB 5I19L 3K8KA 4J8RA 1X9QA 4M61A 1W0YT 2C34A 2XFGB 4LNRB 5E1HB 1UB6B 1W15A 2FRGP 2Y4SA 2VSDA 3OKLA 3T0ED 2HFEA 3BZ4B 5IB2B 2JB5L 1HHJB 5JHMA 1IM3B 3UYPB 3GSNA 1Z9MA 1OE3A 4LLMA 1WGOA 1KB5H 1NCHA 2G5BB 2R2EB 2EIJB 3UERA 3RWFA 1H3VA 2QR0B 3LS4L 5KYYB 4QYOB 5D7JA 3TZVC 4JO1L 4WF7A 3A4DA 4HU8A 2HTKD 1RLWA 1PG7H 2DEYX 3IFPB 4JM4H 3HBZA 5A2FA 3QIUD 2MWCA 2B4CH 2Y2YA 1H15A 3EYUL 3SCMA 1Z9LA 2EXWD 2E4TA 3UJIH 1SY6H 4H13C 1ZSDB 3LMJH 3RVVC 1H8OA 3KLKA 4CMMA 1KCRL 3H53A 4HOZA 4F1ZA 1I7RB 2PCPB 4NPJA 4QXTB 5C0BA 2OYPA 2ZAHA 2E6PA 3FQNA 3VFPA 1IAIH 1GIGL 3X1NA 2C7FA 1RK1B 1BFVL 3N1PC 1SXZA 2HXAA 3N42F 4YN3A 5DD5H 3EYVB 3SEPA 1MCBA 4AL8L 3B5HA 1KFAL 3C5XA 3HR6A 4WQOA 2X4PA 5DMKA 2EAEA 3F62A 3O2DA 1YMMA 3B7SA 5LBSH 1TZOA 5GGRB 3TS8A 3DHMA 3PABA 3ZHFA 1BBJA 5AVYB 3HE7D 5E1GA 3G5ZB 3F2LA 1YEKL 3T0VA 4QHNA 2DYRB 3ES6A 5CR1A 3GMLA 2RR3A 3FQTA 3MNZA 1EAPB 1X5KA 4G70B 3WFBH 4DW2L 2XPZA 2DKUA 4UZUA 1IAMA 2VC2L 2YXWA 3BWAA 5FO7B 1P4BH 3VXOA 1XB6A 3LRHA 4Z7NB 3QCUH 1S5HA 4MSWB 4BKLA 4AMKL 1WBZA 4LSDA 4JZOA 4HWBH 3VFRB 3FHAA 1J5IA 4NQDA 2H3NB 1KB9J 3FCGA 3S8FB 4HZ1A 2DTML 4CL7A 3FUNA 1RVFL 4M6ML 5ENWA 4JPIA 1H9VA 1QZNA 3AVEA 5E6IC 3VM5A 3Q8CA 1QFUL 5EWIL 2Y6SC 2OJZL 5DO2D 1LEIB 1KJ2B 4LCYB 1BQHA 3QIWA 4PJ6A 4JS7A 2K6WA 3IS0X 1Y6MR 5DJZB 3WXWL 3EJTA 5ID0A 1U8HA 3H9YA 4H1LG 4RIRB 5AZ2L 1E28B 3UAJC 3D30A 4JVWA 4EI5A 5LAPA 2Y24A 3PL6A 1QR1A 4L1LA 4NKIH 4K5NA 2IDCA 4QRBA 2NNAB 3VCLA 5GGSY 1VZHA 2OZ4A 1UB6A 3SY6A 3D3VA 5IB2A 1LD9B 5ACLA 5C71A 3C6LA 3P69A 5C86A 5L4FA 4AIEA 5CEXA 4PJ8A 3H4FA 5JXAH 5E8EA 2WTRB 3FMGL 5FYJL 1TTCA 3C60C 5ALCH 2B0SH 3IKKA 4BZ2L 4B9ZA 3DLQR 3RI5K 1E8WA 1PIFA 1H3WM 1SN5A 4GG6A 4GFXA 4FD0A 1H0DB 1P6FA 1PYWB 1HIML 4NQVB 2YAQA 5GJSL 1IM9A 3F3HA 3SJVE 2IF7A 2BJMH 4X80L 4ZUWB 5BRZD 3N40F 1TVHB 3RY6A 4FQ1H 4H8VA 3CX5K 4LKXA 4PLJC 3CC1A 2YLKA 3Q3GB 2JSFA 3HE7C 2IADA 2QVMA 2PYEE 3JWOL 3FL7A 3LNFA 4UI2A 4A55A 4LRNH 2WXGA 4FXKB 4TNWK 2O6CA 3R7QA 4LSQL 2BVPB 3MO1B 1JWUB 2ZAGA 1JPTL 4HEPA 5DK2B 2OMWB 5AAMC 2HMIC 4OF3A 3ARGB 4YHOH 4CSPA 5T3XD 3IE9A 3NCXA 3MKKA 2F54B 3PHQB 4WCYH 1W72A 2YD9A 3PXLA 4FC3E 3VFTA 2QL1A 1M3IA 1BVNP 4LHUD 4ONHB 1OO2A 1IQWL 4FNPA 4G6KL 5L88L 2VDLH 3RFZB 4XOEA 1MJUL 3EGSB 3MV9A 4XOBA 1Q94B 4TSCL 1MEXH 1L9RA 2C3WA 5I26A 3QQXA 3ME0A 2UZXA 5F9JA 4GAGH 3W37A 3CIQA 1I7ZB 4PQXA 1EHNA 4OBRA 5JOPD 1CGUA 5EZIH 1TENA 4J28A 4OLUL 1ASOA 4F7PA 1ANUA 1E27B 2ZIDA 4LSTH 3K91A 3KPLA 3WFEL 1TKWA 2X9XA 4JO4H 1H3PH 3L8QA 1C5DB 4P2OC 3CDYA 3ZKND 3ARGD 2UZYA 4QRQB 4Y16A 1UVQB 3MLRH 3WKML 2VT0A 1UWFA 1SXAA 4NWTL 4ADGA 3TJHD 4PJ7F 2AABL 5F93C 2VISB 3GHPA 1KBKA 4I77L 5K9QI 4FERA 1CC3A 5D2NA 1NGZB 3ZW3A 2BJML 3B9VA 4ZMTA 3UTSB 1EGJA 4OGQC 2N7AA 1LJMA 1QQDB 2Q9OA 4MDRA 1ZLWK 3HPJA 1I4FB 1OL0A 3SE4A 5IMMB 2Z3FA 5GS1C 4TULL 4NN5C 3CHSA 4HUWB 2D3LA 1KLFA 2V3DA 1H6EA 4GAAA 5CEZL 4OZIE 5GZNA 5MHSE 3TV8A 1HSBB 3M7FB 3L3HA 5A2KH 3FKUS 3BQUC 3FFDA 3O3EB 4OU3A 4CRPA 3GJFA 5GRVK 1IB5A 1KJ2H 1MI5A 4YHIB 4HMDA 4PS8A 2XV3A 3B9KD 4X0NA 2FEEI 1Y7VA 4MJIE 1BBDH 1TEGA 1JFHA 2H6OA 4KK9D 2CQVA 4D0DA 4H0HB 4LOEA 4EVNA 2JTDA 1RAMA 4KVNL 4CADA 2ZOWA 1DVSA 4CVZB 3MLPA 1RK1A 4WW2C 3BZEB 3Q2WA 2N1KA 1YHPA 3RDTB 3VI4F 2UY6B 3RGBA 1VFBB 5CILL 4Z7OE 3K71B 1YNTB 3BIBX 2VLLA 3SPGA 1FYTB 4W68A 3BD5A 3ROOB 3H85A 4DO6A 2EUWA 1ITCA 3GXIA 1ND0A 4WJ5B 3APCA 4JLRB 1MVUB 3WJLC 2H32A 3FPXA 5DFAA 3ZPDA 4JFOB 1WGVA 5HHPA 4Q9RL 2NXZB 4XZUB 3VSQA 4G1MB 2ZP8A 2A9MH 5KVGH 4PJFF 4NO3B 3T6WA 4IBUA 1RJYA 3GI8L 3WJJC 3GIVB 3QUZC 3WTUA 3B9KB 1KTJA 3TBSB 1E7UA 4ERSL 2R0WH 2Y5EA 4IOIB 3TU6A 4W9GC 1KYDA 2GJZB 1WP6A 5BRZA 4TL4A 1HT6A 3REWB 3PHOB 3MTXA 1MVYA 3FT3A 5I1CL 4NN7B 4JFQA 4MXVE 4LVNC 1IJ9A 4HP5A 3IWUA 5ELIA 2JB5H 1WFJA 5E6SB 2FT8A 1KZQA 4EBQL 3ARED 1CPUA 4XPGH 2FH8A 4PJDB 4Y1AE 2WYHA 3DC0A 1INDL 5C07E 3AFLA 4P4RB 1E6JH 3TURA 5KVFE 1MW2A 3KYMB 2NXYC 3T0BA 1D3CA 3OHXA 3HI5H 1JF6A 4LF3B 3FO9B 1YECL 2BHYA 3DX8B 3E7JA 4UTCA 1T1YB 3UYPA 1AD9B 4DP1X 1TTBA 4K7FA 3SKOB 3LB6C 5JW3H 3QI9A 1T6WA 3MC0A 1L9SA 2IANB 2YC1A 4JDEA 1DVZA 4MX7B 5D7JB 1TLMA 4IRSA 4BINA 1D6EB 3EYOA 3DVFA 1QI4A 2YKLH 1J8SA 3DGGB 4XC1L 5E99H 1NL0H 3PQYB 3L81A 5EUOF 1CLYH 2HLAB 5GRVL 1KCBA 2G30A 5DLMH 3K0YA 1R3KB 1FORL 1PEWA 5TF1L 3SDAC 1N5YH 1BM7A 3VFNB 1RIHL 2K70A 4L9LA 1MFMA 3E6FB 2WKGA 3Q44A 3CN1A 3SHSA 3DVIA 4BSWA 2BVOB 4X6EB 1F58L 3VWJC 2X6AA 3EYVA 2X42A 5KAQG 1RPUA 5HHXL 3S8WA 5L0QC 5BUGA 3QR0A 3BKCH 3ZDYF 4F7CA 3OKDA 1FC2D 2HSIA 2FLBT 3H56A 1M9SA 1A3ZA 3D0VB 1P4BL 2FEDC 3VTTA 2E59A 2HVJA 4KVPA 1AC0A 1CT8B 1M2VA 1IO4C 1NKOA 2F5BH 2AXFA 2CKBA 5KYWA 4PWEA 5A43C 2A0LC 1ZA6B 2PW1A 4LIQE 4N2KA 2H45A 4UMGA 1D5MA 2Q3AA 3L4XA 5FIEA 5HJBA 4NQQA 2MPAL 4WU7A 3NJJA 2RGSA 4XNXH 4BKLB 4BZ1H 4YX2H 1RZKH 2HG5A 2FQFA 1HK6A 1YPZB 4MB4A 5EU7E 3ZT7A 4HGWA 3TT1H 4AM0B 2E7DA 4BEIA 1DZBA 2VDNB 1XL4A 2HWZL 4GP4B 4QRRB 4X5XA 5D2LF 4FZEL 1MY5A 1UWXH 3QXTA 5BJTB 3CVHH 1MCPH 2C26A 1W0VA 2WBJB 3VWKC 2FQGA 2YS4A 1OB0A 5JOPE 1N3NB 2XA8H 2LU4A 2EXWC 4F57H 5F44A 3QUXA 3JV4A 1FLTX 3WTYA 5JNYA 3MRHB 5IIEB 2LABA 2V33A 2AJZB 4LU5H 4Y8DC 3NJNA 4GT7A 1JOIA 2B1HH 1SZNA 4HH9A 1A0QH 3VNZA 5CN3A 2RTTA 3DPBA 4FXTA 1X5AA 1XVSA 4LZKA 1NA8A 5GQBA 3T3ME 1T04B 4JFPB 3GHBH 1RY7B 3W82A 4GSRA 1NEZB 1PCXA 2FVNA 3GIZL 4MVBC 3MGOB 3V6FA 4NQCD 3Q0HA 3DX7A 2OULB 5D5MA 1OM3H 5F96H 5CCJA 2FR4A 2ZSWB 4J3OG 2AI0H 2OCJA 5H35B 4JRYE 4FQXA 2CGYA 3ETTA 2CDEA 4X99A 4WSKA 2WO2B 2E9WA 2WIMA 1PX8A 1JCKA 1KIUA 2G3MA 2E47A 3I3DA 4FXKC 5IOKA 2X3AA 1UJ3B 3I50H 3ARFD 4H8UA 3FN0H 25C8H 2Y7OA 4JM2F 4Y5VA 4MDIB 4X9FA 3C9NA 3O3DA 4JHAH 3MA9H 1O0VA 4PJDF 3FT4B 4MMZB 1NMBH 2J4WL 3IEAA 3MCLL 3VXSA 3SOTA 4XCFH 3IM1A 1U8IA 2D03H 2Q86A 3AMKA 2AV7A 4J2QA 5KVFH 1HQ4A 4ZFGH 5AOMA 5TE4H 2EDXA 5T5FL 1E8YA 1DQJB 4PR5B 3R06A 4V1DD 5ANMA 2P8LB 3WKNA 3QZNA 5EZJA 1CGWA 2XTSA 5C1MB 4NBZB 4YXHL 1NBYA 3CFEA 3VGHA 2VDNL 2HT2C 4MNQA 4NO0A 1I9EA 1QPPA 5EH1A 2BRRH 3S3JA 3QGVA 1NAMB 2KL6A 1SF3A 2QDWA 1HYSC 5E2VH 5HVFB 3PWLA 3IAGC 4PJAA 4TQ8A 4OZIB 4UBDD 4ZMNA 3L17A 2VUYA 3B9EA 3R1GL 5I16A 2E74C 1EAOA 2NCEA 3T08A 1WAAF 2HCZX 4X9YA 1MXGA 1PFOA 3IJSA 3KH4A 3Q2LA 2GSGA 3GMNA 2XXFA 4YPGA 1VESA 4AI7A 1UTDA 5KVGL 1JNLL 2Y1VA 1RZGA 5JHBA 5DUPH 3CBJB 4APQB 1JNNL 1I8AA 3GLZA 2UZIH 4EIGB 1JPFA 1A7PH 1OP9A 4FFTA 3QCUL 5IHZB 1KJVB 2BERA 4DSYA 3KGUA 1BEYL 3PJSA 4BYHA 2NY4D 4BCXA 2VLRD 3KL5A 5I1HL 5IEHA 5KVEL 4OJAA 1P1ZB 2ILLA 2AZAA 4ZX5A 5D1XD 4M7LL 2X4NA 3QQ4A 4YSUA 1A6ZB 2XG4A 4NI3A 1SN2A 5E5LA 5K1VA 3OGCA 2NYKA 2QKIB 1FO0L 2JI1A 3QEQA 2VISA 4N2IA 3T4AB 5JPNB 4LSUL 2K6ZA 2D73A 1P53A 2ENSA 1T0OA 1T04A 2VCOA 4PD4K 3FQRB 5KYNA 3AUWB 5C07D 3MCYA 3BKML 4I87A 4MMYA 2CHWA 5GRXG 4Z3TA 2VDLL 2IGLA 3S3SA 2I7OA 1S7UB 2WJ5A 4BFKA 4I0PC 4PJHB 4QD2E 4JREC 3OKNB 3QUKB 3V95A 5I73B 1E50A 2QVIA 1EXUB 4PJ9C 5GRUH 3MLSH 4OFQA 3WJMB 4RAUA 4IBWA 2K8MA 1HHHB 1L0XA 4ZFFA 2ERJC 4U1GC 4XAWL 1DBKH 4OCYL 2V2XB 3LKNA 1KF9B 5D1ZC 2YKLL 5DHYA 4WGWB 3S35H 5E8NB 5DT1L 3DV4A 4UIKH 2A73B 4MKTA 3AG1B 1D5BA 4Z7UB 1F8TL 4P4KB 3K72A 4H88L 1NLBH 3I3BA 3S2AA 1AIZA 5TDPB 3VD7A 5TF1H 1DSFL 1JHTB 1QLEB 1IC4L 1BWWA 3UEZA 2YZ1A 4JN1L 5IW1B 2X09A 2EXYC 3WNPA 1UWGL 3QISA 5D9SB 1JGDB 2Z64C 3FB7A 3RKDC 4ODHL 4JDTL 1I85C 1BVNT 1LK2B 1J1PL 4NO0B 1NPNA 2WQ8A 3MV8E 3T4AC 5KN5A 3AS0A 4MJ4A 2WXIA 3ULUD 5IQ7H 4XCCL 3E6HA 4XH2A 4LRIA 4PJCA 1YYLH 1RSYA 4QIRA 2NCMA 4OKDA 5D7IE 1DZ0A 3MXWH 4Z7WA 4Q2ZA 1E6OH 5F1NB 3SBRA 4E9LA 3IJHA 5I73C 4MJID 3U46A 2ORBH 3X3GL 4JJOA 4XCEB 4HF5H 3QVAA 2YAEA 4XB8A 3SKJH 5BMFL 5C0EB 3L3DB 1TYEB 2K1MA 3QHTC 1RKRA 2XWTB 4KO7A 3U30B 1C7TA 3KBHE 4FG6D 5JO5B 4KHXH 4WGKA 1AI1H 2C1OA 1SQMA 3PG2A 5AW2B 3EDDA 3L95A 5C7XL 3HS0A 2R9HD 4LEOB 2VQ1A 4PB9L 4EDXB 2EVHA 2QHRH 1RZPA 3FNKA 5CN2A 3IRCA 4P5TA 2JJTC 2FWLB 2QFPA 2O5NA 2XN0A 4PY8I 4LASH 2X4NB 3QQ4B 4WW2F 5J3HC 3PE9A 3VXMD 5LVEA 3LEYL 4OTXH 3QRFM 1BVLB 1YY8B 4KKZA 1ZT4A 4KQ4H 3L3JB 4MHHG 1GZPA 1DEEA 1IGYA 4U2YA 4ZTPL 1IBFA 1T3FB 1RZKC 3CUPB 4FHKA 4LL1A 4U6HB 3WS6C 4MNQD 4CVXB 4LCCA 5IQMA 4PRNB 1RJLA 3DTDA 1I3UA 3S97C 1EEUA 1AQ8A 2G4GA 5C0AB 5D7LB 3T6VA 3SB3A 5J6HA 1FVEA 3DUHA 4N3TA 3HCVB 3T0WA 4KX9A 3CXDH 3IRZA 3MRPA 2CUMA 4Y2NA 1KENH 2YRLA 2XN9A 3QG7L 4K9EL 4RWYH 3BP7A 1JGLL 1GA2A 3H3PH 3D18A 4J2XA 1S7VA 4PP1D 4K7PL 5D6DC 4JAMB 4P2RB 3QZLA 5JIQA 2YD5A 2X1XR 2E75C 5GSRB 2YXVA 3K6IA 4CN6A 5H37G 4U3HA 2IBGA 1EQWA 3D12B 1FCCA 4K23L 4OFPA 3VI3E 3L3OC 1GS8A 1WFNA 2H7WA 1AANA 1F3JB 3SGKC 2CK0H 4PJXF 5IGXL 3ORJA 2ADIA 1YYML 4QF1B 2EDFA 5EBLB 3RJDA 1CI3M 1AR1C 4OCWL 4FYQA 1FHGA 2NR6C 5FW7A 1BLIA 2VWEE 3AQXA 2P47B 1NFDA 4PBDA 4A6YB 4CW1B 3JWNC 4JFEE 2AKRA 4PSRA 4JFHE 3MQIA 1M2VB 1CGSH 1MY7A 3RIAK 2X1OA 1FGVL 4RFOH 4NPYA 3ZDYE 1AD0B 2CDFA 3RWJA 1YVLA 3MA7A 4Y5YC 5HGBB 1UT1A 4UT6H 1WA1X 1F6AB 1I8UA 4JKLA 1QBLL 4N2CA 1J1XH 3WMPA 2OMYB 1LQSR 1YRKA 3BGAA 3Q05A 3C09B 4N8PA 2OP4L 3HZVA 4OZHE 5I0VA 3UZEA 3ZUNC 5GGVH 3HZMB 5F1OB 4FNRA 1M57B 4GRLD 3GMPB 3LSOA 4Y7MA 1CL7L 5JLZA 2ICES 4X6CF 4LCWA 2A2QT 1EDYA 3QPQC 4OVVA 5B1AB 3QUMH 3VYNA 2VNCA 2W9DL 5C8JB 4FLQA 1BQHG 3D85B 5E0FA 1G94A 2XVLA 3KPRE 3CE1A 5KVEE 1ZLEA 5CGYD 3Q1SL 4CN1A 4NDMA 1PZ5B 2IXQA 3KPPB 2NUTB 1CLZL 2LOEA 2CE6A 5FXCH 4PRAB 4GRWF 4N2NA 2CALA 4KO5A 4GRWH 2DN7A 3DPBB 1U6AH 4HUUA 3E3QC 1R3JB 4JY4B 3VGAB 4MA7H 1U8CA 1K3ZA 3WFDH 1MCFA 1T2QH 1BX2B 4RFNB 3BUDA 2J12B 1VFMA 4LVHB 4GKNA 3GMQA 4HZLA 4P2QB 5EIIA 3H3KA 3QJQB 3AROA 4P2YA 1UJTA 3NIGE 3P3TA 4XHJC 4UOZA 3FUIA 5SV4A 1V54B 3RU8L 4EJ1C 5DD0H 1CFBA 1JG9A 4A7QA 4WI7A 5F7HA 2X1WL 3MLSL 4D3CH 3GK8H 4P2QD 3ROLB 5TTRA 1RMFL 1JYNA 2CO6A 3T2OA 1J88A 1GOGA 5TDOB 1RSFA 1UD4A 2OMXB 4OLUH 1AXSB 3V5DB 2NSMA 2IDSA 3FYIB 1QMUA 3KPRA 5ETUB 3G3LA 1NGYB 1ZLSL 4B9JA 2COQA 5LJYH 3CDFA 4M5ZH 2WYZA 4YVUA 4MXWH 4P05A 2NR6D 3LQAH 4ZQKB 3LH8A 4NO3A 1ORSB 2FX7H 2JJSA 2JWYA 3GSQB 4OVUA 1F13A 1QKZL 2FE0A 1ID5I 1BD2D 1DSFH 2N4IA 5FUOL 4K3HA 1Z5HA 4TNWF 12E8L 2Y07H 3P11L 4F7TB 1LMKA 4KXCA 4CC4C 5DJ6A 4PCSA 4PS3A 3T3MB 2JLPA 4JZOB 3VFRA 2AQTA 3HMXH 5A6MA 3U7AA 3BYTA 3HG5A 4ODBD 4YUEL 4HIIA 1S7XA 3FOMB 4TVPL 4U1KB 4ZW5A 4JG1H 1JWMA 4P2RD 2I9LA 3QC5X 4JKPL 25C8L 3SPJA 2GSGB 3B83A 3GMNB 5CJOL 3R8BB 4HPOH 1JVLA 1KELL 1S3RA 3VD1A 4HUVB 1BM3L 1EJOH 4LBAA 2Y7MA 4BWWA 1J8KA 2B7DT 1J8RA 2O5ZH 1NCTA 4KMTL 3WHE0 1LILA 2DJ4A 2DBLH 3ULUL 1MCJA 1T1YA 4X7SH 3WFDL 1LYQA 4YBQD 3TNMA 2AK1H 4UYPA 5FKPB 2HTLD 5JW4R 1QSFB 1N7MH 4IRJB 3IDJB 4ALAL 1FFNB 5HGGS 4WHYH 3RWIA 1NUGA 3QNXA 1B3JA 4GW1A 5B38G 4OBSA 5IMMA 3MCKA 3BHBB 1IT9H 2BO0A 2WCGA 2ZXCA 2JJWA 4MCZA 1OV8A 4BFFA 3PQYA 2V4LA 5HPMB 5J3HD 1P69B 3G6AA 1SHWA 3WD5L 3ZOAA 3M88A 5DD0L 3NEXA 3BISA 3GMRB 4HISA 4QGTA 3JVGA 3VGBA 43CAB 2J88H 1D2PA 1NCGA 2A83B 1M1XA 2A9NH 3IFLL 4RESB 3UMTA 2EIKB 2IWFA 2V7HB 2RQEA 1ML0A 3O4LD 5DU7A 3ZTDC 1NDMB 1DFXA 3FTSA 5E7FA 1N6QL 3E6FA 1VGKB 2YMXH 4Y1AA 3NJKA 3STZA 3T65A 2YN3A 1W72L 1EANA 5DVMA 1UM4H 4KI1A 4J3XA 2P9RA 1U8JB 3EDJA 4QRUA 5CZVH 2PLTA 2GITB 2OR8A 3TL5A 3GZQA 1L0PA 1WC7A 1QWHA 5TH2B 3KWTA 3PGFH 1NWPA 1M3JA 5IR1A 3FZUD 2AQSA 4PU2A 4B9KC 1FI8C 3MJ8B 1ET5A 4XC3H 1CDCA 4NC2B 2R69H 3QDJE 2EIZA 1ZA6A 5CO1A 3NK3A 1ZTXL 4NM8H 3PIQB 1TQWA 4HK0A 5F3BB 1Q9OB 4Z7VE 2FB4L 1R75A 4N8VB 3GSQA 5I28A 3U7YL 3MV8D 5C2BL 1BDYA 1RIVH 5GSVB 4MS6A 3B3BA 3UZQA 3DV6B 2AAVA 4IOSD 4OJCA 2PYED 5GRJL 3M8OL 4OM1H 4O2CA 3SE3A 2D03L 1ILSA 1F4YL 4H25A 3V0GA 1AYRA 3AS3A 3VFOB 5J8OA 1LEKB 3CVBA 4PCYA 2Q3XA 4YDLC 3CGTA 2IDUA 2BFVH 2I5YH 3CDCA 3VI4E 3ULAB 4ALAH 3SE4C 4HAGA 1N10A 3SODB 2AJUL 3GHEH 2VLKB 1TJMA 5KANI 1F2XK 3FOLB 3GF8A 3L3OB 4Q6IA 2DPKA 4HH9B 3ZMEA 4NWTH 3EJZD 3L95B 4ATWA 2BLFA 1T89A 4R7XA 5KW9L 1PAZA 3G08A 3K2UH 1IC4H 2CR0A 3B7YA 5DYOB 4ZUTB 2R2BA 3V6BR 5JMRA 4BFEA 4LFHG 2MCPL 5H8DA 1OAUH 4G6FB 3HMWH 4PS4H 2CMRH 4IJ3B 4AKOA 3CBKB 4IGBB 5AVUB 3N5AA 4M4RA 4N28A 4NENA 5KG9A 5KZCD 1X5ZA 3HC3H 2J8UB 1BVLA 3DVNB 3MGOA 3V6FB 3B2XA 1EH9A 4NWUL 4E5XA 3WTWA 4TOYL 4U3SB 3NCMA 4PGCB 2NT1A 2UUDH 4HUWA 4ZXBC 3NJMA 4ANUA 4DCQB 4K3DH 5J6SA 4OF8A 3U36B 1E3FA 4L4TE 1NC2B 3FF8A 4Y2OB 3EJZC 3H9HA 1SBSL 3GI9L 5DEJA 3RPIA 3ARVA 5GISL 2BVUA 3FFCB 2OA9A 2CIKA 3T65B 1FFOB 1SDDB 4FQLH 1U8IB 3V9EA 3ZVVA 3QWRD 4KROC 1RZKL 3QNFA 5F7LB 5J12C 4C56B 4WK4B 5F88B 4FRWA 5HYSG 4ZW6A 4P3DA 1A8ZA 2X44D 5HHMB 1T03L 3UZVB 1BQLL 1GMIA 2W65B 3FFCD 3KWVA 3N43F 3OM3B 1RHFA 4TUOA 1T7VA 3EFDH 4QHLB 5FKAA 4IKIA 3ABGA 2WD0A 3K71A 5JIPA 4QXTA 5F7EL 5C0BB 1EAQA 32C2B 3W0WE 1NCIA 3EUDA 3VTAA 3CX5J 1ZHKB 2HUEA 3JTTA 4O9HH 4M1DH 5D1ZI 2HJKB 1DVFB 2F8XC 4Q9RH 4L3CA 2A6JA 2FBOJ 1XGQA 3L3IA 3QW9A 4MD0A 1UOLA 4UT7H 1D5MB 1NAMH 3OKMA 3QEHA 5T33L 4UTAL 3VUAA 4EDWL 3VB9A 4EIZC 4Q97A 3DV6A 5FB8B 4KZDL 1JI1A 2NW3B 2W0FA 3N1MC 4PRBB 4S1QL 2ED9A 4YHZL 1QLFB 3PU7A 4YDKH 1M56B 1BBJB 1G7LB 1KC5H 1R5IB 4ELMB 5HPOA 2EDMA 1MWOA 4BQCA 1E90A 3ECVA 3KPSA 4KDVA 4AK1A 3MLWH 3C8KB 1O6SB 3V4VL 1EHXA 3N44F 4U1HA 5IVOA 1E40A 1JGLH 3U6RA 4GKZA 1U2HA 3IPEA 3ILDA 1FFPB 2F1EA 2OFQA 3GBLA 3HE6B 3LTVA 3MJ9L 1NKGA 3HC2A 4DQOL 4Z3GA 2Y2WA 4MSWA 1W0VB 5SWZE 1P1ZA 5H4ZA 3RNQA 2BCKB 1FL5B 3UBXB 4OD3L 3A4AA 3QEUA 5L7XL 5I2IA 1TTFA 2VZTA 4MA8L 4NYLB 4U4BA 4AZUA 1JF5A 3WFEH 4FG2A 5K1JA 4MAZA 3CDZA 3U9PL 3G08B 1ZHLB 2HT4D 1D9KD 3BAIA 3FQRA 1NWOA 2QELA 3WO4C 5DS1A 1BQHB 4MZIA 4L48A 2J4WH 3X2QB 1W8NA 1HH9B 4JFZH 3GINA 1KN2L 4N8VG 4FFVC 3ULUH 4OFVA 4AM0Q 2YPLD 1YMHB 1UATA 3TTSA 3K4DA 3NZHH 1UACH 1TIUA 4S1DC 2YK1H 5A2IH 1FNAA 2DQJH 3QEGL 4IBZA 4PPTA 4P3CH 3OXRB 5E8DL 4B41A 2X4SB 3BKYL 4XNZC 4ZOCA 3UTTD 3RU8H 2XPGB 4WWOA 3HB3D 5MENA 2A73A 1A1MB 4OGYH 1KLUB 3ECBA 4W9HC 2BZ7A 3DX2A 1INQB 2V7NB 3GBMH 1HS6A 2Z93B 1OAYH 2OMTA 3FO0L 4UOW0 4M29A 4ZW3A 5AVSB 1UWYA 5DJ8B 2CKBL 3R1GH 2RH0A 1HH6B 4E68A 2Q86B 1IAIM 1VJSA 3WNKA 1U95A 2W9DH 3R7RA 2YD4A 1F56A 4Y4HA 4YBQC 4AX3A 1C1EH 4UTAH 2YJLA 3GUTA 5GGVY 1FRGH 4GPVA 4H0GA 4ZUSA 2VLLB 1K3IA 1H3PL 1UZ8B 1NTDA 1U92A 3A67H 4NQSA 2R0KL 4BQBA 1KENL 5EDSA 3BZ4A 3DTXA 3D69B 4FXLA 1I7TB 2HJKA 4URKA 5ICYA 1V3JA 3MYJA 2V37A 4MB1A 3ARZA 5EUKA 2A77L 3QO1A 3QFJA 5C0CD 4UAHA 1DL7H 1AYOA 1QFWH 2UWEB 2XICA 3NH7L 3NCWA 2HVKA 4HDIA 4M6AA 5EC1B 3SYOA 1DBJH 2Q6WA 1RULH 1O75A 1R33A 3FU8A 2Q8BH 1IVLA 3EO0B 4K94L 1CR9L 1HQRB 3Q5YA 4D9LL 5DJXB 3BPLC 1D5ZB 1ORQB 4ESKA 5C2BH 3KLQA 2YD0A 3QIBC 4OD2A 5J1AB 1NAKH 3SYQA 4RAVA 4G71B 2CPCA 3RNQB 3UBXA 1DQTA 5D7KE 1NGWA 3UGUA 3K6DA 5IVXF 2G9HA 4MA1C 2J3SA 3OZ9H 3BVTA 4U6YA 5IBTH 3GUFA 2DQGL 3IFOA 2L7JA 3DYMA 1YNLH 1N0XL 4GW4A 3QORC 5TE6L 2DQFA 1AO7B 4LESA 2YK1L 4G72B 1FUNA 3RYMA 3QHZL 2JELH 3G9AB 3IDJA 1MELA 1M42A 1F3DJ 4GINA 4NRYB 5CFHA 2QQKL 2W60B 4XMZA 5BXFB 4C47A 3GBML 4ZK8A 3WDHA 1CQKA 3ZYIA 2B4CC 5IKCA 3P11H 4QT5B 4P5RA 3GJFH 4N6QA 1DJZA 2DQEH 3ZHLA 1RZFH 2X41A 5BZDA 1WIUA 3INUL 3GSNH 4G11A 4BCZA 4TUUA 1ZEAL 1WYJA 4NQDB 3NT0A 4F58L 1BMZA 1KLUA 2YD2A 3ECBB 4QUOA 3RGHA 1WUZA 1OP3H 4F92B 1HNFA 1QRNE 3PWVA 3IJ7A 5JYMA 1JHKH 5IF0B 2JKLA 2MEJB 4FQPA 3PDGA 3EH3B 2QQNL 1KJ2A 1YAZA 4LCYA 4RDBA 1RIHH 4PG2A 4S1RH 3AWEA 3CSTA 4FA6A 4WO4A 5GS0D 1QATA 1SLXA 1U21A 1UWXK 2AEPH 4DPBX 1ICTA 4L4VD 4X0KA 1VENA 4RIRA 1RVFH 4M6MH 4KZ0A 1FL3A 1P4UA 4Q14A 1BP3B 3W0WD 1R5VB 4RX4A 1ACYH 4RMWA 4WIQA 4XMWA 4PHZA 4AJYV 4TKWA 1HKLL 3V10A 3D0VA 1BZ8A 4MNGA 1ECZA 4QCIB 3DGDA 4OZFH 1P1VA 4FTDA 4N0YL 4PJ8B 1L7TH 3EF4A 5T3XH 4PV9A 4QXUL 5G2NA 3V0AC 5CP7B 1UYWH 3K4AA 1R5WB 2F8VA 2ZG2A 1F4YH 2B59B 3GSXB 5AWNH 2XZQL 4TQIA 1KSRA 1D6VL 1VB9A 4HHWA 2V8MA 4WEUD 4UT9H 4N22A 3UYOD 1J5OH 2H32B 2NY1D 3SDCA 3OLIA 4C83A 4DKEH 4WZ9A 2KQMA 2VIRB 3H4HA 3Q8FA 1MXDA 4FQIL 3J07A 4KKLC 4YX2L 4NUQA 4E41E 1WK0A 4APQA 5IWLA 3BUIA 1RUAL 2X6BA 4F8QA 5E0QA 4J5VA 2X4UB 4ABQA 2OX5B 3CWGA 3ETBF 5DUJA 5FUZH 4LP4A 2QMJA 1U3HB 4TTDD 1N0LB 2KZKA 4UM9D 4K5PA 4U1NB 4W6XB 3SQBB 3HN8A 1V7NL 3OZKA 1A6ZA 2XG4B 2G3ZA 3OGCB 1QFWI 3WIAA 5GGQL 2Q10A 5DGRA 1JRHL 4HUUB 5IW6B 4E9QA 5CSBA 3F8UB 4YSSA 1YO4A 4JQIA 4WFGD 1MFCL 1PZUB 2BNRE 4YUEH 4LSPH 4AQZA 3PGCB 4K5OA 4KJQD 3ZTNH 2KDYA 1VLXA 3MFGB 2EDTA 1B4TA 5GZNC 3VA6A 3NSDA 2E7MA 2YFOA 4TL5A 4PGJA 4MMYB 3ULUF 5AW7B 2D9CA 3MLTA 3D7PA 4UUJB 1FL6A 1WBXB 3I02A 3MOBH 2EVJA 5A7EA 3T9WA 4E42A 1X7QA 1HOEA 3ALXA 3QUYD 3A5VA 4JM2C 5DD6B 3VFUB 4JUSA 3CMOL 2OK0H 1A6TB 3BAJA 1UUSA 4NUPA 4P2RA 4LCWD 3RTQB 2DH3A 2BY2A 3MNWA 4LQFL 3D0AA 2BSSA 3GSVB 5KYXA 4I4WB 4YHNA 4EAEA 4WUUB 2VDPL 5EO9B 1FC1A 4X8XA 4JRXA 2YRZA 3ARQA 2J88L 4M6OL 1D9KC 3K2UL 5KOMC 3V0HA 3BMVA 2D3VA 2ZOLA 4BA0A 3MLZH 5BOJA 1Y6NR 2J5LC 5C3IA 1MKFA 2QSQA 1YQVL 4C57C 4WW2B 4KJQC 2A9ML 3MRRB 5HGDB 3CFJA 1ASPA 4LRIC 3DTXB 3TBBA 3EGDB 3RWGA 2F61A 1FP5A 4U6VL 5HYJB 3ULVL 1I9IH 5ABAA 4Q2ZB 2KH2B 1ZTXE 5BPPA 2QLYA 1U30A 3DX9A 2VR6A 3LKQA 3MLWL 5H2BA 4GXUN 3C5JB 4HJUA 5BRZE 4XN2A 3TX4A 3OLGA 2BY3A 4DAGL 2DKMA 2PCYA 2Q6WB 4O58H 4HWBL 3W38A 4N8UA 1UFUA 4MFHA 3G6DL 2EDQA 1KPRA 2YEZA 4R96B 2GAZB 3DBXA 3UADA 2VUOA 2VAJA 4L4TB 2PYFA 1FYTD 5F71A 1W8EA 2FDBP 1Q0EA 4NHUA 2QZ5A 3IBOA 5E4EB 3CZLA 1T4KB 4MBOA 5E4OA 5EUOE 3JYCA 3BHBA 4BH7B 5ICUA 1Z0NA 2J1KA 1KPUB 2P26A 3U2SB 2VSKB 1A4JA 3DGGA 2NZ9D 1FH5H 3PV6A 4AUJA 4F7MA 4MNHA 1YY8A 5DJCB 3L3JA 1GJWA 3L2MA 5F7DB 3MV8A 3PREA 4NQVA 2A6KB 4S2SA 2O5XH 1T7YA 1RJCA 2AXGB 2FWSA 1JSYA 1WEJH 5EOTA 5DA4A 2JK5B 5DJ2A 2QDVA 5HI5C 5J06A 2UZYB 4M4PA 1P9MC 3B9AA 3JV0A 1NOLA 4P2AA 3FTXA 4DUVA 4OLVL 1B4RA 1QRND 4X6CE 3W9EB 4HXBH 4L1DA 4X6EA 4AYID 1WZ1H 5IM7B 4M43H 4K3EH 2XBZA 5ESVA 2CD0A 4WDIA 3ULUE 4LQ1A 5I1AB 3GDBA 5I1IH 3W5NA 2F08A 3FS9A 4PM1A 3UAEA 1X6LA 3S88H 2OMUA 3VU1A 3PHOA 1DLFL 1PSKL 5D5MB 2IG2L 5D7IB 1AZVA 3L1GA 5IF0A 2YA1A 3T4YB 1CFNA 4UIKL 1CJYA 4RGNE 5CBEA 4J3SA 4JM2D 4XP5H 2R0KH 3BCFA 2CR6A 2QSTA 3V5HB 3O8XA 3CFNA 4HKBA 2ZJSL 3CU1A 5SX5H 2O5ZL 2Z8RA 5B3NA 2ZXQA 1KYOJ 1UEMA 4JFVA 5CU5A 3SGDH 4G6JH 1BZ9B 3FT4A 4MMZA 3MRRA 4OCNC 3OKEB 2YPLB 3OPZL 2NUPA 3TYFA 2AGJH 4ABUA 5E9DB 3DGCR 4PJ9A 5K9KB 5FO9B 5DQJA 1UD5A 2M2DA 4UT6L 3WJLA 1YYCA 2BZCA 2IH1A 1NQBA 4LVHC 1A5FL 4AE0A 5IVNA 2VXTL 4YMPA 1XDTT 4M1GH 3BCDA 1KPRB 4MNQB 3VX1A 5GRUL 1JL8A 4AL8H 2VXSH 2EEDA 2QV2A 1MH5A 4X2UA 4UDUB 2C1OB 3C08H 1U9KA 2FJFB 2F1BA 3HZKB 1WEJL 2FYVA 1T4KA 1C1EL 3AUVA 5I75B 1CG9A 1HOCA 3TO4A 2B1HL 4K94C 4PRAA 1I8KB 1F8TH 4IHBA 1Z9OA 2H2SC 2P8PB 3FHEA 1TQCB 2XY2A 4FKHA 1IFHH 5C0RH 2BY0A 2BH0A 4BJLA 4I77H 3OKDB 2WKLA 4XPBH 1U8CB 2HLFD 4J3OF 5EOTB 4AVIA 3ELAT 4HU2A 4UB0H 1RZFL 4X6DE 1FDLH 4BWTA 4YDMA 1ZTXH 5ID1B 3MX0A 3NCFB 2J7LA 4U3CA 5D7JC 2EE3A 5LBSA 5I1DB 2QR0A 2VZSA 4UTBL 2P28B 2O5YL 2IPUK 3CLWA 2DEWX 5HHVH 4N0RA 3M1CA 3BAKA 3E2HB 3K7UA 3OHXB 3W9DB 5D2NC 1PZBA 5DWUH 3V55A 3K2MC 2V17L 1D7BA 4QAWA 2A7BA 3WNOA 1DQJA 1RLBA 4KPHH 2HLEB 3D9AL 1IBYA 3DJ9A 3OAUL 4G1EB 4JHUA 3UTPD 3AXLB 3UYRL 4D9QD 1LM8V 5GHWL 2H3XC 1BVOA 3OZ9L 2ZXGA 2FECL 2SODB 1SY6A 4NNPH 3WTTA 4JO3H 4U1SA 1KPVB 3FQXA 5D93C 1OTSD 4F15B 2W81C 3FUMA 4GIOA 3DOSA 4CSSA 1AXIB 4PBVC 3QXDB 4YDJA 5C2UB 1MDAA 2A0LD 3KGSA 1URIA 4G6FD 5KS9E 1XF2A 1ADQL 1J8HA 2MNUA 4RMTA 3CVIH 3BT0A 3WEXB 2F54E 5ABZA 3L4UA 2YPLA 4IMKA 2IDFA 1LO0H 2AKRB 3IJSB 3S48A 4GRMB 1P7BA 5E9DA 5CGBA 1C12B 2GJ6B 1Q0YL 2P5PA 4JFPA 4JPWH 2VLKD 1RH8A 3DOHA 1SOKA 3VFOA 4WUKL 5DF0A 4EQ2A 1DQDL 3E1ZA 5DS2A 3X12A 5LAXA 5EU6B 3D39A 3BPLB 3BJ91 4YNYB 2OMYA 4DGUA 4F58H 4EN3D 3PJSB 1GKEA 1U8MB 4ZUUA 2XC8A 2PR9A 4NYLA 1T83A 4FYRA 3D25B 2V5YA 3KLSA 3NCJH 1R24A 1I8LA 2WYTA 1P6AB 1XT5A 4CNIB 4FS0A 1HINL 5SWSE 5HI5D 3MRCA 1PNCA 4HKXA 4NT6B 4WCYL 2VDLB 3TN0B 5K1NA 1OP3K 2F18A 3L3DA 2ZCLL 3OXSA 4JFED 4URTB 1WCQA 4M93C 4KJYA 1WICA 4R2GC 5I74C 3ZT6A 1IT9L 4Z7VF 3CVHA 4QRFA 5GS2H 5DEZA 3I6LD 4Q89A 3IRPX 2EDLA 1BYPA 2HT3C 5IB3B 4GLRH 4Y4KC 4P5TB 1UXMA 2PP8A 5AW0B 4X6BB 1KYAA 3ARBC 4GUQA 1CF1A 1KBBA 1VEOA 1NZRA 1XGPB 2Q2EB 1UASA 3H6AA 1BAFH 4JPKL 4ZX3A 2HFFA 2WLYA 2A83A 2RALA 2VXUH 2YXMA 3F01A 4FTVD 4X7TB 2AQ3A 1L9MA 4J3VA 3OJDB 2GSIA 4ADJA 1OGAB 1X7QB 4WWKD 3DUUA 3QNYA 3AY4C 3O41B 4YHZH 1FVDA 3ZMNA 4ENEC 1L9OA 2APFA 2EKSB 3K46A 3KEDA 2VXVH 4DQAA 1E9QA 2LLGA 4P3DB 1JZIA 4HJJH 3EYQC 4PRPB 1OAQH 3VQLA 4XNQB 2WXFA 4YHMH 1AJ7H 4E0RA 2XA3A 2ZT9C 4HUXB 4ZUWA 3V6ZA 4ONFL 4N24A 2GY7B 1KGIA 3OG6B 4HBCL 4ZNEA 1LK2A 4E9YA 4BHUI 1ASQA 1YAIA 4HQQL 4XC3L 4WFGE 1JXJA 2CDEB 3KZ8A 3QZOA 5EUKB 2HH0H 3OF6A 2Y5TB 4I3GA 3HRZB 5DRWB 4GRWB 4ODVH 2PPFA 3L1FA 1I3VA 2HJFA 1V3LA 3EYFB 3VYOA 3D4GA 4QYAA 3MJGX 1OK8A 4LLUA 2WXLA 2WANA 4D9RE 3QDJB 1EFXB 4LLQA 3PHAA 1RFDH 3LN4A 4JKWA 5A2LH 2BRQA 3WNLA 4AJ0A 3ARSA 1UKSA 2K45A 4DERA 5KBNC 1AC6A 1J5CA 2R1WA 4I2XA 3ARBA 3HKZA 4N90E 3S3BB 2WB1A 4ELMA 3O4OB 2DQDH 3DXAE 3EGDA 4YIQA 5ALBL 4MJ5B 2BMKB 3RWGB 1DN0B 1XH2A 3WEAA 5BUPA 5JO5A 1GH7A 1ZPLA 3ZR6A 1Q4NX 3C6LD 1JGUL 1DO6A 1MREH 4GKZB 1TU2B 2ZQKA 4JGUA 3KLHD 2F68X 3GQFA 1TVDA 4FCAA 4JHVA 1JZ3A 1LP9B 2GK2A 1AI1L 4PRID 1HDMA 4P23B 1NBYB 3BH4A 4ODTL 1GYUA 1GJUA 3FOLA 3L3OA 8FABB 1TMQA 3PCYA 1W6LA 3VXTB 4QTIL 5E95B 4A68A 3ML8A 4G82A 5JIIA 2VDKH 4O2FA 1LO4L 3PWPD 2WB7A 4RGNC 1LO5A 3BD3A 1SHMA 4XNMA 5CIPH 5IG7B 3H42L 4Q9CA 1NCOA 2VSCA 2C3VA 4BSVB 5GRZA 5I16B 1S9KC 2JCWA 3E38A 4GS7C 3EBHA 4BH7A 3SO3C 1IGFL 4X7SL 3CN0A 4DP4X 4PJIF 3KPTA 2D31B 5AAPA 5FFLA 5F3FA 1OW0C 1AHMA 1RUQL 3CVHB 4WVRA 5BZXA 1RIUH 1SJMA 3MNZB 3CSFA 4FFWD 4BD4A 1FZMB 2F1AA 1P2CA 1TSHA 1KTKE 1YA5A 4Z8FH 4X9HA 4G6KH 1J18A 3SDDC 5B3JF 4UNVA 1NC2A 4K3DL 2BSTB 3LXAA 1BA9A 3EH2A 1LWHA 2EDNA 4XPHL 1XF3B 2MJWA 4Q4IA 1Y1DA 5DSCA 4L0ZA 3UTSA 1MCSA 5GSRA 5DZAA 3NG5A 4X6DF 3GGWB 3OR6B 5IBUB 2V7NA 2VLME 4LKXB 2C3GA 2IALB 1UT9A 5JUEL 1IX2A 4HUNB 2J56A 5EZIL 2Q8BL 4YO0B 5ESVB 2W5PA 4PD4J 4PMFA 1RV6X 1ZA3A 4HIEB 1T03H 3LIZA 4UTAA 2O26U 3BI9X 4IDJL 5E9NA 1J0ZA 1AVAA 1O7SA 2TRYA 4ZUSB 3NPSC 2OYKA 1G9NL 3WNIA 5JHDE 5LCVA 4R4BA 5EZJB 3T09A 4A04A 1QABA 2EDBA 3MRKA 1EJOL 4M8QB 1AH1A 2EE2A 4GMSH 4UT7L 1S7RB 2J6EL 1IFRA 3B2PA 2AEIT 3A0OA 3ILQD 3PV7A 3TF4A 3D09A 5CJQH 1YNTA 1HAUA 4XC1H 4WNQB 5BO1H 2WXKA 3BX7C 2EH8L 1BGXL 4QHMB 4LBEB 2FJGB 3SQRA 2CWRA 3WU1A 3DJRA 4JRYD 4PP2A 4YQXH 4XZ4A 5F9OL 3ES6B 4PJBB 1FFPA 3HE6A 3AW5A 3PNWB 1RHHA 3KL0A 3BFWA 1G0DA 1KJ3L 2CDGB 3K5RA 4PHXA 1MRDH 2NYYC 5D2LA 3KM2A 1MWAH 4L3FA 2JCCA 4P5KA 4RISH 3INUH 4LARH 3ENEA 8PAZA 2QLVB 2D0HA 4XH2B 1RIUL 1Z1WA 2GBUA 1ZHLA 4MZRA 3ULVH 5T3ZL 5BW7C 5FYJH 3RG1C 3J2PA 3QDGA 3PGCA 3MO1A 3EJPA 1ZDQA 3H6JA 3K8LA 1S7XB 3FOMA 3EJUA 3FU9A 2WLLB 2RFXB 3S37H 3MOAH 1ZHNB 3CJJA 1GGBH 2FZ3B 2A9BA 1CB4A 4AV4A 1N6VA 2YUXA 3DMMA 4YL4A 1PZCA 1E28A 4YBLC 4EI5B 1QR1B 4HX1B 1XO8A 4QPEA 2D8KA 4TPRH 3VGAC 4OV5A 3OPZH 1T0NB 4IRZL 1SEQL 1S9XB 3S6CA 1CFQA 1CO1A 2VAAA 2OMBA 1LL1A 3J7HA 3JZYA 4WEBH 4AIZA 3TESA 2FAUA 1T0PB 5K9OB 2NY1C 4JFFE 2CK0L 4MZ2A 2VZ1A 2GC7C 1YQ2A 1G9NH 3F7VA 3VE0A 5FYLD 3WXWH 3PFQA 4PWKA 1OAXL 2NY1B 2XPGA 1I85A 3BN3B 3H3BC 4PRIA 1E4WH 3BW9A 3QDGE 4WHYG 4LCCB 4KPHL 4CADB 4OR1A 5I1CH 2LW3A 4Y4FA 1T22B 2GTWA 1LO2L 2EDEA 5DC4B 3P9WB 1L5GB 3QS2A 3MVSA 2J43A 3P3RA 4XO5A 3VJ6A 3QH3A 2D4DA 5IUCA 1XFPA 4OIIH 1JD9A 3THMH 4QRAA 3RDTD 2GEQA 4M5ZL 5IZ7A 5IFHH 4I1PA 2OSWA 1O6TA 3WLBA 4PRDA 5JXEA 2GT9A 1JPSL 3IN0A 4IRSD 2EYRA 1ZSHA 3BSZH 3GM8A 4JFOA 4KTYA 3TA3B 2XWBA 5D1ZA 6PCYA 3BRGC 3E1F1 4BRJA 2LTQB 1QQDA 5DHMC 3HBGA 4W4OA 3Q8BA 1WBYB 1KXTB 3WAKA 5DK2A 5DD3L 3HI6L 2F53D 5SWQA 5K9JL 3CQFA 1VCAA 2ZKHH 1CFVL 1I1AB 2GIMA 3CAFA 1EZUA 4KRPB 1M7IB 5IJVA 4MDJA 4GKLA 3KYAA 5FOBA 1AFVH 1N19A 1NM9A 1S4IA 2JKSA 3EYSH 3Q13A 4J3BA 1IRAY 1F4XH 3SSGA 3LCYA 4HLEA 1XGRB 1KWKA 4UQ3A 1FORH 4NO5B 2ZYIA 3WOVA 2AS5M 4AQEA 4L05A 4HULB 4GQQA 4JG0H 4Q6YA 5EULV 4DKFH 1AGEA 4F7EA 5CP3A 5I19H 2ADFH 3LRLA 5KTEL 2NNCA 1FIGL 2GY5A 4PRPE 1T5XA 1U2YA 3OSVA 1THAA 5F7BA 1H3TA 3ZK0A 1FJ1B 3G6AB 2J55A 1P5UA 4ZMXA 3VFSA 5KUMA 4LQFH 1NIDA 3OX8B 3VSVA 3DX8A 2DQFB 3SE8H 2C3VB 1AO7A 1FGNL 2NZ1A 1I3GH 1CBVL 5I0ZA 2QBWA 4HLJA 1NDGA 1RU9H 3P4OA 3H8NA 3BUBA 3KCPA 1PZAA 1CDJA 3QO0A 1K8DA 2ZWYA 1DVQA 2KPWA 4UOQA 1KJ2L 1CGXA 3MLTB 1CE6B 4IIQA 3HNTL 2DQEL 4EKXA 3K2IA 5E4IA 2I32A 2AP2A 3CHXA 2Z4QB 1GTNA 5I8KL 4P07A 1KT2A 3EJJX 5DC9B 2V2WA 3VWKA 2XYCA 4LOUD 5EEXA 4PJEE 3UMNA 3GEWB 4WHCA 1Q9LB 2CO3A 4DGIH 4N5UA 2R4SL 2EIZB 1SQ2N 4JFQB 4XMPH 12E8H 5ICZB 1OD9A 2OMNA 4NBYB 1GGYA 2WM0A 2Y72A 3QI9D 2HZHA 1BV8A 2FNWA 1MI5B 1JK9A 1XH3A 2WIIA 3D48R 1AGFB 1AZNA 1QSFD 4KTGA 3WLBB 1E9OA 5L9DH 2VN3A 4TULH 4P9MH 2D2CC 3OKOB 1HI6A 1ZS8B 2VR3A 4A2LA 1XCQB 3IYLW 4AV5A 2VSMB 3MLUH 1L9NA 2PABA 4YHLL 4MYPA 4PJ8C 3U2JA 1E3ZA 2CXKA 1BW8A 3W11C 2B15A 3MCKB 3V8OA 3WFHB 2CO6B 1CYXA 4OQ1A 4CBZA 2EYTB 1S9YB 1XIWD 3OHMB 1CGSL 4W81A 4OT1L 3GMRA 4O02A 3TNNA 4RSYA 5ITFB 3KS0J 4ZAKB 2E8YA 5C0DA 3RVUC 3TBWA 3LQMA 4JANB 2F6AA 2FBRA 4XCYA 3HUJE 2EIMB 2ATKA 4ZS6C 3KPQA 4YXLL 4AGMA 3O3BB 3IETB 5FHBL 1RERA 4GY4A 4PUBL 3APFA 3DO7B 5E6IA 5L8LB 4N1EA 1AS7A 3C5SB 4H8QA 4LKCA 4P46C 1Z5LB 5IW6A 5GGQH 5GGSA 2R23A 5C0GA 4PBXA 5FGSA 5AB0A 2H6PB 4ZMOA 3A3YB 1BWMA 2WJ7A 3FT3B 2C8NA 1BQKA 4JFSA 3LS5H 2R0ZL 2ALAA 2QPDB 5KANG 2WLIB 4B9YA 4DF9A 5ADPH 3QWQB 3NIDB 1TFPA 5EG6C 4BZ2H 1Y0LB 2OXGA 2IMMA 3MRMA 2OQJB 1KB3A 2YFNA 4NO2A 3BVDB 4X4ZA 2F53A 3N1FC 4ZPTA 5FLUA 1P2CB 3IMUA 1RK7A 3MOQA 4KDTA 4RRPG 5CP3H 3POHA 2OR9L 2QTVA 2B3RA 1B2YA 1ULVA 4GW5A 1X4YA 3MXVL 4IGBC 4PJIE 1ERNA 1QUPA 2H9GA 2Z4QA 4RETB 3SDYH 1QTYT 1S3KH 1FAIH 3N40P 4DK5A 4WDIB 2GTZA 4JM2B 3VVVA 4M62L 5DSCB 3S2CA 4N0FA 5D4IA 1XIWB 4UAOB 4WWNA 3U9UB 3UOAB 3ROLA 4RMUA 2Y7QA 3O6FB 3KG5A 4FL4C 4QYOA 1EEZB 2HRPL 3EOAA 1UXSB 4X8JA 5GS0L 3IDXH 3GZOA 3EGXB 4Y4FC 4ANKA 4HIEA 4AGPA 3QEQD 5KSAC 4N1HB 1A6UH 4Y4FB 1WFMA 2WQSA 2Y23A 3P0VH 5C7ZA 4JPKH 5AG8A 4UT9A 1H15B 3OPUA 2RB8A 3IB4A 4FFWC 3KLAA 5DVLA 3ZBMA 4HWBA 4K3JL 1PF3A 4RRPM 3TP4A 2ALWA 1H9DA 4OM0H 3BT2L 1YY9D 4AENB 4FQ2H 2FGWL 1W8OA 1ITBB 3KPSB 3KBEA 1W2KT 1ETZB 4IMKC 4WTXA 1G9NC 3QQNA 4AITA 1TSRA 3WUWA 1DFBL 2VN6A 4XPTH 1B0GA 5C0RL 4UIMA 1B0WA 1N9PA 3ZX1A 1PKOA 4G43B 1B6UA 1HXMA 3R0MA 4G7YH 3ZIMA 1P7QA 3NFNA 1BAGA 2VDMB 4U1LA 1GOFA 5FUOH 3RB7A 5IJCC 1JZGA 5DWPA 1K5WA 1M9WA 4GH7B 4K7PH 2P5WE 2YEZB 2FTAA 4LMQE 4FQCH 1MJ8L 3QEUB 2G2RB 3MYJB 5MENE 3CZJA 5A2BA 5EF1A 2BS9A 3H9HB 2IWEA 5F0JB 5KZCB 4J3TA 3CFMA 3V4LA 2MCG1 1EDQA 4X98A 3FPYA 2ARJQ 3GO1L 3VNYA 3BXNB 3MGTA 1CXHA 1K9TA 1BZEA 3SQOH 3UZQB 4NGHL 4E9RA 4S0TD 5HI3C 1U8KA 1HCVA 2KPNA 3IN2A 1DSWA 3NYKA 4IQHA 3CG8A 4P04A 3GBNH 1OARH 3PLYA 2NY4B 1VEPA 4K07A 4TVPD 1D5IH 3FCSB 1M6UA 1HE8A 5I8CA 5M7QA 1T1WB 3OAZK 3LEXB 5D1QA 1PG7L 1J8HD 3B3IA 1B2WH 5KTEH 1KZYA 1FIGH 2O6DA 1EX0A 3FT1A 4KUZL 2Z91B 4BHUA 2DLHA 4PI0A 3DDGA 2VUKA 1JMXA 2V2TA 2VLKA 1F4AA 1IQDB 3AZUA 3GMOA 3LV3B 5FYJE 1ACZA 4P3CL 2HN7B 2PNDA 2XXCB 5C0IA 4OFKA 4P49A 3T8XB 4B5ZA 3PRZA 3TPUB 4DGVL 4P59L 4AIZB 1QLEL 1KB5A 3DIDA 6CGTA 2VLJA 2WUCH 1MCWW 1NFDF 1BOYA 4M4RB 4RSVA 5KG9B 5CLYA 3RAJH 1BF2A 4YBHA 3TH4T 2WBJC 2BOCA 5D1XA 5IB5B 3DA0A 2IBZX 3LKOB 3FONB 3KEHA 4LNVA 3FO1A 4LT7A 2VM9A 1UB5B 3Q1SH 3FW6A 3L2NA 4WI4A 2YHGA 2ZXAA 4MB3A 3U36A 4OFDA 1JPSH 4BE5A 4ZMPA 5FYLE 1JVKA 3FQTB 5AB2A 1EO7A 1E30A 2UWEA 3IT8D 3MACL 4HDIB 4CJ1A 3B43A 1UA6L 3FK3A 4M6OH 5F6IC 4Z7OB 1NANI 2DM7A 1IZJA 1JDCA 1C8QA 2Z6FA 4BZYA 2R69L 3D07A 4JDVB 4AJWA 1XGTA 3ARFB 2AGJL 2GJ6A 2BXYA 3EDKA 5IVXE 1YNKH 3KLLA 1BIIA 5KSAA 3FQWA 2X2JA 1QRKA 4HMCA 4QF1A 3CHPA 2VDOH 1U8LA 2CGZA 2HX7A 1SYSA 2ITDB 3QIWC 3C09C 2H8PA 2E7HA 4HCGA 4G8EA 5AOIA 3VXMA 4Q58C 4YSAA 1ZJBA 3SN6N 3LQAC 4Y9BA 2A4CA 3ZE0E 5C0ND 4YOKA 4RWYL 3S96B 5EOQL 3IXAB 3NIDE 4O02B 1DBML 4L4TA 3GSOB 1UG9A 4TUJB 3QBTB 3L7FB 4AYFB 3NBNA 2NY5C 2Z93A 3PP3K 4M6NH 2X88A 1WQVT 3RQ3A 4FDWA 3ZTCC 4JKMA 3LH2H 4OIIL 2IIJA 3HAEH 4M8VA 5B3SB 1SGKA 3I2CL 3IGLA 2ZXWB 5DHVB 4UTBA 2GVYA 4WHTA 1BHGA 5F7NC 2IOMA 4PUBH 4AIOA 4Z5RB 2VDRH 3TBYB 2EYSA 4P9HL 1JS4A 5I6PA 3FSAA 3TXAA 4AQ8C 3ML9A 1WITA 3O2DH 1AR2A 2XWJA 4P4KD 4B9IA 2JI2A 2Z8SA 2KDGA 5T1MB 3EZ8A 5DJDB 3ZTJH 3OR6A 2LVEA 4YWGH 4D7BA 4LDLB 3NZUA 1OGTA 4N2MA 1NL0L 3CDZB 5KSBF 3CMGA 1SY6L 4R4FH 3GLAA 3KGRA 3TPUA 4P0DA 1JNLH 3VMOA 1MIEH 4LSVL 2EDYA 3WCYA 4XBPB 4KV5E 3T0EB 2WLKA 5KBLA 4QXVA 2BOBB 1VERA 2A9AA 2VLRB 1P84K 1IIIA 3KPSE 3EXLA 1FG9C 3NABH 5LWYH 4ZMWA 2PETA 2PYEB 5D1XB 5D8JH 1ADQA 1OCZB 2IAMD 5T1KA 3NFPB 2WC7A 1E4JA 4IBLT 5IY5B 2W80C 4NKDB 3FU7A 2DQMA 4E42B 3H2QA 4NQEB 4XRCB 1CQYA 4GUPB 5I6KA 5D70H 4ZFFB 3B37A 4AGLA 5F1IA 1NCNA 3D4ZA 3WHXB 5L88H 3LZNA 1A1MA 1R5WA 4MWFA 3TEWA 4QXWA 5KEZA 3VA2C 1OGSA 1IC7L 3IDXL 3BVXA 4PRBA 3UJTH 3QQ3A 3US1A 1SXSA 3CIAA 3ESNA 3IAQA 4JL1A 3DJZA 2H2SD 1T3FA 3CUPA 4U6HA 3PUCA 1R4XA 2BSRA 4KY2A 1MCOH 1JF1A 3TYGH 5J13B 5JQIB 3DUSB 1Q0YH 4FKKA 1IAII 3QPKA 1G4RA 2D7QA 2MPAH 4ABWA 2E4FA 3I6KB 3S34H 3DOIA 2VE6A 1YEWA 2H0JA 2APVA 4YDVB 3FB5A 4UAOC 5EEUA 4NUGL 2XTJC 4PJBF 3O9WD 4FA8A 2BNUB 4LLDB 4GG8B 3D6GA 4G8GE 3WLWC 3RHWF 4XOCA 3K6SA 5MI0C 5JW5A 4LLVA 2W9LA 4FX5A 4IJTA 2C3HA 5ISZB 3Q6GH 4UQ2B 3CTTA 1JZ7A 5CNHA 4H26A 4HJSA 3HHMA 4PH8A 1Z0MA 3E6HB 3UPRB 3PWVB 4QJ4B 1RUKL 2C9XA 4YK4B 3AM8C 3DJSA 5CKAA 1PLCA 4BFGA 1M1SA 1WA0X 2JQZA 4OLWH 5T8IA 5F1NA 2BIQA 4M03A 4XB3A 1QTPA 3AC0A 4LLYA 3O8XC 3VDBA 1YDPB 1EHLL 4LLAA 2NTFA 5HHOA 5IEKA 2NUTA 3DX1A 1I8KA 1WLHA 1I9RL 1U41A 3QJVB 1QEWA 5I0WA 3BSGA 1HHJA 1AE6H 1YN6A 3C5ZC 4GEIA 2ZUSA 3TEUA 3RUGB 1JGVL 5TFSL 1BX2A 2PR4H 2Z91A 1DYZA 4ANWA 3WS6A 4X7TA 2FD6L 4FKEA 3A21A 1MFDH 2ZKWA 3FHQA 4KOCA 3MROB 3BW9B 2HFFB 3PL6D 1U3HD 3U1SL 2J1YA 4MCZB 4KHXL 1IGYB 4PYHA 3HJ0A 5SWSD 4X8CA 4WUUA 5EO9A 4A66A 2BOBA 3Q43A 5IROA 5I1EL 1XSKA 5AB9A 1AD9A 1KY6A 4JQXA 3P4MB 3RWEB 1FVEB 2Y7QB 3O6FA 2XXMB 4G9FA 4UM8B 1JPGB 3LS4H 4F2MB 2ODHA 3MLVL 3MUGA 4X8JB 3EYOB 1AR1D 3B2VH 3HAEB 3QAQA 3U30C 1J0HA 4IBYA 4N9OB 2K6YA 3MRJA 1OIOA 5DQ9B 4I3SL 3V2AR 4W6YB 3V79C 3RTQC 5TDNA 4WTQA 4Y2DB 5T5FH 3RPKA 4Y9EA 1FNEB 2VO5A 1OY3B 3O3AA 3QDJA 1FG2A 1FRGL 4Z23A 4HC1H 1I8LC 4O02H 1A25A 4PW4A 1XF2B 3WNMA 2DQUL 4XP6L 5AVRB 1WV7T 3L9RA 3F7PC 2UY7B 3LB6D 4JRLA 1EFXA 4LLQB 3ZE1F 4X4KA 1VKXA 1NPJA 3NEEA 5BCAA 5KVEH 3KPNB 5F72S 1HC1A 2CO7A 3DROB 4YDLB 4MNGE 1G0XA 1Q90A 4E9TA 4Y5XC 4ZO9A 5KSVA 2RAMA 1JNJA 4LCCC 2ZKYA 1A1NB 4I9WE 2VJXA 3QUZB 2GI0A 5C08A 4QKTA 3QA3B 4UQBA 5CINL 4IOFC 1ZV5A 4L4VA 4X5LA 2DM4A 1DQVA 3US0A 3QJSB 2WQWA 2A6IB 2MKWA 4C4KT 1Z3GH 3VXTA 2ZG1A 1SXCA 3NZSA 4RNRA 3GZPA 1LWRA 3O4LA 5IOPA 1ZLDA 1QSFA 3MBWB 1CBJA 3KMDA 4LL4A 1HWHB 1ZIAA 4FNUA 5EHFA 2WSPA 2DTMH 1IV8A 4YFLF 5DMIL 1SEBA 4DETA 1QBAA 4PRHE 4HJIA 3O6LH 1SJXA 2Q7AA 3C2SA 4IRSB 4P06A 5D1QB 1CZ8H 5CAYB 3B4NA 4N6RA 3GS0A 5IHBA 1KCUH 1Z5YD 3CK0H 1XCTB 1ZXQA 2J57A 4LGRB 4FNSA 1CG9B 1HHGB 3KPOA 1ID2A 2QQKH 4FA7B 1BOGA 3L6FA 5CBAA 2EXYD 2BXZA 1MIML 2E46A 2GFBB 5EIIG 5F0PB 2JB6B 1E4XH 3RAJL 1MJJB 4P99A 4NRXB 4XMKH 1FZOB 4ICXA 2OZ4L 1YY9C 3MRIB 4ZAKD 3WIHH 7PAZA 3E8UL 5F0LB 4LEXH 5J9PA 2KQNA 4HLZG 1UD6A 4NQCE 2DJUA 4XBPA 3S35L 4MA8H 1H6UA 3MPCA 3GKZA 5F7MC 3B1TA 1JV5A 2FHCA 4M7JH 4MD5B 5GJTH 4KK9C 2DQUH 3GSRB 3BUPA 3OMAB 5C92A 2ZG3A 3Q3GA 2NOYA 4IK7A 4JFEA 2IADB 5I1LA 1UUNA 5F1SA 3LPOA 3GTTA 3QCTH 4JB9H 5FDWA 1RPQA 4PWIA 5FK9B 2NUPB 5TQ2H 1K5NA 3FU7B 4MYWB 4ZYKB 3TYFB 4QRSA 4Y19E 4ODXB 1E2VA 3NP3A 2XTJD 1AHWA 3TT3L 2A74A 3NSCA 2YD8A 3ILPA 4QOKD 4PTTA 4Y4KA 1XR8A 1YNKL 3V4PH 3VI3A 3WGUB 5FKAB 2VXQL 4QRPD 1O6VA 3QQ3B 4UNTA 3FQXB 1RP9A 1N4XH 4Y9FA 5L2KA 2CGRL 1DQQB 1KTLA 1VPOL 4H4NA 3ZDWA 4XI5D 1NINA 1PMYA 1SBSH 4B3VA 3GI9H 4HIJA 3UAAA 5FDWB 5B8CC 2XN9E 2OSXA 2D4FA 4DK6A 1X5IA 2ZX8A 4YDVA 3NCYP 1DBKL 4K3JH 4G42A 4OCYH 5FYKH 4F7EB 4XN5A 4NERA 1FQ9C 5D7HA 4HC1A 3T8MA 1LO3H 5K69A 4QLWA 4N9GB 3U6XA 4IRZA 1T20A 4JFDB 4ECNA 5K39A 1DFBH 3PWUA 4XPTL 1HSAB 2Y22A 4P46D 2BW5A 4H88H 2C9PA 3VMNA 3R19A 3UPAA 4XE5B 3DDFA 4PJXA 1JIBA 1Y0LA 4R8WL 3UZEC 4HCFA 3HI5L 5JR1L 1YECH 3OJ2C 4UBDC 1LEGA