4MDRA

Crystal structure of adaptor protein complex 4 (ap-4) mu4 subunit c-terminal domain d190a mutant, in complex with a sorting peptide from the amyloid precursor protein (app)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
269
structure length
245
Chain Sequence
NEVFLAVVERLSVLIASNGSLLKVDVQGEIRLKSFLPSGSEMRIGLTEEFSVGKSELRGYGPGIRVDEVSFHSSVNLDEFESHRILRLQPPQGELTVMRYQLSDDLPSPLPFRLFPSVQWDRGSGRLQVYLKLRCDLLSKSQALNVRLHLPLPRGVVSLSQELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPLGLGPASLSFELPRHTCSGLQVRFLRLAPHKWVRHLSHSDAYVIRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AP-4 complex subunit mu-1
publication title Structural and Functional Characterization of Cargo-Binding Sites on the mu 4-Subunit of Adaptor Protein Complex 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport/protein binding
total genus 49
structure length 245
sequence length 269
ec nomenclature
pdb deposition date 2013-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00928 Adap_comp_sub Adaptor complexes medium subunit family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4mdrA01
2.60.40.1170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4mdrA02
4EMZA 2PR9A 4MDRA 3H85A 2BP5M 1HESA 2JKTM 2JKRM 1I31A 4EN2A 5C7ZA 5FPIA 1H6EA 3L81A 1BXXA 4UQIM 1BW8A 2VGLM 4IKNA
chains in the Genus database with same CATH superfamily
1U8PA 2VLRA 5I5RA 2EO1A 5EUOA 1ZA3A 3ZKXC 1CZ8H 1OLLA 5D7EA 4D9RD 5E51A 3U9WA 1Y18B 2BJMH 3FQNA 2O61A 5FOJA 2QPUA 5DTFB 4L1SA 5ITFB 4ZUUB 5T3ZL 4LSTH 3SGJC 1DJWA 2WB7A 2WNXA 2ISDA 1DBBL 3O6LH 3O41B 1OM9A 4HGMA 4ZD3H 2GJ6B 3HS0A 3W11D 2X4PA 3RVTC 2HRPH 3SCMD 3NIGF 3KHQA 3MLWH 3K8LA 4V2BA 3MU3A 3BKJL 1FA4A 4FTVE 4DQAA 2BIOA 1RJLA 4IOSA 3QG7H 1E4WH 4LCCB 1PZDA 2IQAA 2MOQA 2VISB 4L1LA 1ZXQA 5J3HC 4ELDA 4OLWH 4FNUA 4OCYH 4WJKB 3RHWK 1MKFA 1SGKA 2HVJB 2W60B 1C5BL 1NANH 1MIMH 2E3VA 5C6TH 3KLLA 3HW7A 2EVGA 3U0PB 1PBYA 1I9IH 2H1LM 4PY7A 1I85A 4M7LT 3QIUD 4H8PA 3TASA 2HT3C 1FO0A 3OLEA 4F8LA 5LCVH 2YWZA 3HI1B 2WGXA 2YD9A 5CILL 5F89A 1JPSL 2J1KA 3ML9A 4MCZB 3AQXA 3GTTA 1RPUA 2YEZA 5DUPL 2E59A 2VZ1A 5TQ0H 5IQ9B 2DYPA 2AEOA 3DSFH 4Y2DD 3GUTB 5IVZA 4K3EL 5T1KA 4ONGL 5E6ID 1VACA 1JGLL 2IH1B 4Q58C 4TLUA 1KN2H 4PJCA 2EDBA 3L5XH 3QXVA 5GISH 5I1IL 2FATH 1N70A 5I6MA 1F02I 5IT2H 4N2LA 4FNLH 3FAWA 3L4WA 3V0AC 3K71B 1WZ1H 2CUAA 1N7ML 4WQOA 4JN2A 3QHFH 4WW2A 2NY4B 2WSPA 4CSPA 4YHZH 3SGKA 2NXYC 1HSBB 4UV7L 4EOWL 1CPUA 4DPRA 3X13A 2E74C 2OMYA 3O3BA 1E6OH 1HVXA 5KTEH 2FD6H 5EU6E 3QQ9C 3RVXC 1GJUA 5C92A 3ETBF 4OFQA 2F6AA 1NUFA 2NY2B 4KRNA 4XN7A 3BHBB 1PG7W 1Z5LA 1A65A 1OHQA 4YHNA 5DD5L 1EJFA 1SOSA 2E76C 2X4OB 4BK8A 4OAWA 1F1GA 2LHAA 1A7QH 3D4GA 1CBVL 3BN9C 4UQ9A 4Z95H 1D7DA 3DHJA 3NACL 3O4LD 1FNHA 1T7WA 3S96A 4CNIA 2OTWB 4LOUD 1QQDA 1EH9A 5DHVA 5BOPA 1J5IA 3UTQA 4BQBA 3FO2B 2BNRE 4X6FA 3K6NA 2XY1A 2QGBA 4OCRH 4PJDF 5B1JA 2W65A 4BGDA 4U6TA 1ICTA 3VGAB 2DQCH 2I32A 4RGMC 5C2BL 1DQLH 5ENWA 1OCOB 4R3SA 3HNVL 3T6VA 3TIDB 3V5KA 5J7CC 1SOQA 4KI1A 2PW1B 3HG1E 4JHAL 3P1VA 2BIIA 5HGHB 2FEEI 5E5RB 3S98A 2WWMD 3VI3E 1SMAA 5IEKA 1MWOA 4R4FL 3HI6L 4LVNB 1I1AD 1ADQL 4OGYH 2A4ZA 4XNZB 1IBBA 1O5DT 2RD0A 4ODXB 4ZYKA 2I9LB 3BKCH 4J1UA 4WU5B 3F8UB 3DVIA 4PW3A 3SB3A 1P6FA 4K5NA 3SZKC 1M1XB 2ZF9A 1Q9LB 3UTOA 2L8AA 3TA3D 2PCXA 5BVJB 2DPKA 3I9PA 2B4CC 3P11L 2YMTA 1L9OA 2OMWA 1A7OL 4AXWB 5B39A 1DBMH 5F7FA 1FL5A 1UG9A 3RY6C 2QBWA 3U1QA 2YZ1A 5HHMD 1HEZA 2X9YA 3V6FA 5JW4N 2A4EA 2R2HA 2JKSA 3NJLA 3DVNA 5EZOL 2D7MA 2UUDK 3TFKD 4X4XB 3P9LA 2R15A 3GLEA 4WK0B 4UTAH 3ARSA 4XWGH 4JO2L 2Q9OA 5I1AB 4K5MA 1JGEA 3NK3A 1V7NH 4FXLA 5C9KA 3VD2A 1MRCH 1R6VA 3HZMA 3H4FA 3QZLA 2P5WE 2XUWA 3F3HA 1LMIA 1XF3B 3LXUX 1WO2A 4H1LA 2JELL 3QO1A 5CN2A 3NOIA 3MRCB 3TVMC 4UQCA 2APFA 2WXFA 5CINH 3KAAA 4F1SA 1ZT1B 3B7TA 3P3SA 4HH9B 4K9EC 2DMGA 5FW7A 4F57H 3PRZA 1OV8A 4HFUH 4WEBH 2CK0H 3US0A 1U8IB 3SEPA 4KKLC 5JPMA 3MGTA 3OMIB 4MD4B 3X1BA 4GMSH 4CA4A 3KJ4B 4RQQB 1NCWH 4H5SB 3C5JA 2IAAC 3BZEA 3VXRD 1R75A 1DN0B 1MH5B 4XNXL 4Q89A 1B2WL 1CLYL 2AMGA 2J5WA 4DAGL 1LTXA 2VRKA 1PZBA 3INUL 1B4RA 1E67A 1DN2A 1M2VA 1OARH 1WITA 3U9UA 4MDIB 5KSAC 5EU4B 3M8OL 1QP1A 4MAZA 4DPBX 4FTVA 2YAMA 4OM0H 1ZHBB 3EF4A 1KYDA 2FJFB 2XQBL 4JB9H 7CGTA 1RZKH 2FYVA 1ZV5A 4IM8A 3ET9F 1FYTB 1X5FA 3AB0C 1AJ7H 4L18A 3FF7A 1BJ8A 5DJ6A 3OZ9H 2WD0A 3AG1B 5KSBF 4HQQL 2YD6A 1OSPL 2HJKB 3H9SB 4GKOA 3Q1EA 4RGNB 2MCPL 5DF0A 4LIQE 1Z9MA 2IALA 1MQKH 2XVLA 1UZ6F 1EANA 4HBCL 2ZOUA 1OZUA 3QDME 3CMGA 5F1SA 1PU0A 4HKJB 1EEYB 2D3LA 3BSGA 3KL3A 2X3BA 3SQBA 4E9VA 3OPUA 3MRPB 4NRXB 2AK1H 4DEPB 2HT2C 3GXMA 1FN4A 4IRSA 3A6CL 2X87A 2P80A 3UTSA 4ANWA 4BUHA 4HIXH 2ZP9A 5AW7B 4FC3E 4PBVC 2FNBA 3STZA 4JRXA 4N2MA 5LBSA 2TAAA 1E43A 3MRMA 4PMFA 1DDTA 3K3QA 1FGNL 1ZSHA 1OE1A 3ARPA 2OR9L 1TQCC 4AGNA 1NDGA 4MJID 3PIQA 4PI2A 4AQEA 1RVFL 3TBBA 2Z31D 1ZPUA 4FQIL 5HDQL 1X5LA 3UC2A 1TJXA 1BF8A 3MBED 5AB1A 3F7YA 1A8ZA 4PJIF 4IRZL 3VXSD 2A83A 1G7QB 5GZOD 3U2SB 1MW2A 3E0GA 1F3DJ 3E8UH 2VLJB 1GS8A 1HHIA 1NBCA 3OKLB 3ZDZB 3GSNA 4L4VE 3TWCH 2WXPA 4OQTH 1IEBB 3O8XA 2X70A 4OB5L 4LSSH 4U1IA 4AGOA 2UVEA 2EYTB 4L37B 4U7KA 5L8JB 4JZNB 4QHMB 4R90L 4BEIA 3BWAB 3VWKD 4POZC 5EU6A 3WLWC 3MCLH 4K7PH 3ARFC 3IJ8A 2DLIA 3DX3A 5FX3A 1KJ2H 1SJMA 4EDWL 3EJZC 3VDBA 4L1BA 4Z7UE 4MDJA 3SDDB 2BNQE 4MJ4A 5FC9A 3OHXB 1FVCB 2EDJA 3C2AL 1JWUA 1OOAA 1UXSB 2FH6A 3QJUB 2PCPA 2CO4A 1JXDA 1SJEA 4M6OH 5TK4A 3ZUNC 4Y1AB 1MDAA 1S7WB 1QSEE 3DK2A 4N26A 1HCFX 3NJFA 3GGWB 5C7ZA 1A6AA 3C75A 5GSVB 5DVOA 5FDYA 1WJ3A 1PNDA 4XNQA 2BNRA 1MEXL 3NFSL 5E0FA 3FTYA 5JW3H 2XTJD 2NUTB 2VQUA 4FXKC 1CDHA 2AEIT 2RACA 4ODUA 2Z7YA 3IMUA 3IXTA 3IWVA 4BWUA 1EEQA 1BD2E 1OAXL 4JKPL 4NYLB 3ZLQC 3VI3A 4OLUL 4APQA 1LEIA 4JE0A 4PWHA 4PJFA 3UO8B 4H8WH 4U6VL 5KG9A 1HU8A 2VDKH 1KBKA 5A2FA 4CC0A 1QSVA 4W6XB 4WSKA 4KVPA 3H0TB 3CUPA 4L4TD 1IC5L 1FNEA 5FO9B 5I1GL 2E7HA 4TULL 1RERA 1U2CA 3PL6D 1W0VA 4DGUA 2VIRA 2F2HA 1V27A 3UFIA 1AD0A 5I74C 1FNAA 1PEZA 3I02A 4KK6C 4LDLB 4WFFD 4BRVA 3VE0B 2WP3O 5FB8B 4K8RL 1T0NA 5F93C 1FO0L 1Q72H 1RXLA 2NXYB 3J8F7 4IQHA 4JAMA 3ULAB 1O75A 4KK9C 4ODTL 3GI8L 4NQCE 1BG1A 1J8HD 2OTUB 5C1MB 5D7JC 5IJDC 4X7DC 2X28A 3NJMA 5ESVA 5F1NA 3OKEB 1F6LL 4LO9A 2G4GA 2FL5B 3GMMB 4KK5C 4MAYB 2WKGA 4ORZC 3UTTE 1WCBB 2BRQA 4GSUA 4I3GA 3RG1C 2GSIB 4XBEL 1BXXA 3MRRA 5ACZA 5DA4A 1U58A 3QNYA 1MW3A 3IVKA 2CO2A 4OQ1A 3K2UL 1DQQB 3IETB 5I73C 5IHUL 4PG9A 5C08B 4CJ1A 4RMWA 5CFHA 1X4XA 1WS8A 3O9WB 5HDBE 2YAHA 5F7AA 1F42A 5IBUB 5D5MB 4IHOA 4GS7B 2WQRA 3U0TA 2F7RA 4RNRB 3QDJD 2YFOA 5CP3A 2Q3ZA 5AW9B 3ROLB 5J12B 2EXTA 3FT3B 1F0LA 1MXGA 1MZYA 3F7LA 2AXFA 2EXWC 4G9FD 2GCYA 2OMXA 3B37A 4WWKA 3RWJB 3BP7A 5F9AC 1KGJA 3EJJX 1MCDA 3C6SB 1XGQA 3OG6B 2IPUG 3KPPA 3LZFL 2G75A 4B97A 2IDTA 4XN4A 4JFZL 1E5YA 1OK8A 5DS2A 2AABL 4D8PA 3RGVA 5DZNA 5LKNA 35C8H 1PJ9A 1OAYH 1K9TA 2VH5L 2M83A 3HB3D 4ICXA 2WWKT 3IFPA 4B60A 4ZI8A 1S9VB 2LABA 1EV2E 2NQCA 3MRGB 3VSVA 2Q20A 5I1CH 3LN5A 1KTKE 2W0FB 1VCBC 5DJDB 4CU6A 4M6MH 1D9KA 1FZKA 2J1WA 1G7MA 4HLJA 2B77A 2CDEB 4YDNA 1L9TA 1SVCP 4ENZA 4U1LB 4CBPA 3PJSA 1QUNB 3ZRCC 3FZUD 4N1EA 1ID2A 4NSKA 3AGVA 2PO6C 3DGDA 3LIZH 4ZX6A 2Q0ZX 3LZPA 4G8AC 4LMQI 1XZ0B 3MV11 5EORL 1A1NB 1UB6A 1P4UA 1SBBA 3CC5B 4XVTL 1IFGA 2XHNA 2AK4A 2H7WA 5AL8A 1W9XA 3BLPX 1W72A 4N90E 2HAZA 3SKMB 3PF2A 1UQSB 4L4VA 4Q6IA 2FWOB 1KJ3L 3DOSA 4MHHG 5D71L 2LU3A 3EJYC 3LEXB 4N6RB 3IPBA 4GSDH 4N4YB 5D1XB 2ETWA 1ETA1 1KPRB 2XWBB 2ZCHH 2VR5A 1O6SB 2K9UA 4RFOL 2C8NA 2NX5E 2QFPA 5CEZE 2YGPA 2IBZY 4Z7UA 1KCRL 1OF2A 2BNQA 4G43A 1LO2L 1S7RA 3MJWA 4K5PA 3GXIA 4NNXB 2IQ9H 3EH3B 4NKMA 3L4YA 4OJEH 2VZTA 5TDOA 4KKAC 3RDTD 2F8IA 4FRWA 3RJQB 2MH4A 5EOTA 1KCUL 3WN6A 1G9NL 1RULL 1UJ3B 2CQVA 5HHOA 4F92B 1ZKAA 2GIXA 1CE6B 5E99H 1QSEA 2DQHL 3ARUA 3ESOA 5CS7A 3HFFA 1QVOB 3EXLA 3G5XB 1JNHA 1OW0C 5H8DA 2AXWA 3L3IA 3PCYA 4XCEA 1AP2A 2WLJA 1IFRA 3RWEA 5IK3A 3CZFA 1TF4A 1ITCA 1F2XK 2YFNA 2CHNA 5B8CA 3SE8H 3UMNA 4BGLA 1ZLWH 4J4PC 4TMPA 3U6RB 1RMFL 4GQRA 4LSUL 1MREH 5D7SL 3C5ZC 3AREC 5I18L 1BD2A 4P2RD 3IGFA 5B7FA 4X5RA 2ESVE 1KGCE 3KNBA 1DP0A 1L6PA 1CDJA 3O2WH 3IM1A 1J8RA 2IBGA 4OZHF 3WDJA 5GS2H 1U0QA 4U3CA 5DRXB 1A7PH 3GJFA 5EOCL 3Q2NA 3IU4L 3FUKA 1JGIA 1FGVL 3TBSB 2ZWYA 3CDCA 4Y19E 5C0GB 3L1FA 4HXAH 5FV2A 3VYPA 3QRLA 4ZNEE 3F00A 3BSZA 5EO9A 1NFIB 1P4IL 4Y7OC 1M7UA 1R3HA 3D0VB 5FUCE 2DQ6A 4AX3A 2F7IA 1GH7A 5L4IA 2KUTA 5KAQF 3FN0L 1OAQH 3WTUA 1WK0A 3DETD 1OB0A 1TEGA 3MACH 3KPOB 3MV9A 3ZKND 4Z7WF 5CLWA 1FJ1B 4HHWA 1FP5A 3QUYD 3GJEB 4XCFL 1JFQH 1P9MC 2WK2A 4I3RL 4P05A 3FUFA 3GSXB 4NNYA 4OF6A 4A7QA 5MENB 5DSCA 1DTUA 2EQDA 3PP3H 1M6OA 3UTTA 1ZLVK 3HS0C 2V7NB 1G7PB 1I9RH 1SYSB 1H5BA 3CQPA 3DJZA 5E9DA 5CSZB 1OY3B 5LBSL 1HWHB 4N22A 4X8JB 2DD8L 1TUPA 1AZNA 1GPOH 3UCQA 2QKIB 1CFSB 3IKCA 1L9QA 3M07A 4WO0A 4AQ1B 5IVNA 1SZNA 2CRYA 2ZKHL 5GZND 1CYWA 2JF1A 3CX2A 4O51A 1J05B 3BT0A 3ARTA 2O26U 1E8ZA 4MA1C 4X6DB 3RTQD 1OALA 3VWJA 4YX2H 3C6LA 3KPSD 3K72B 3LQZB 4JVWA 4L29A 4TSAH 3WFBH 1TOXA 4XWOC 4ZDHB 4PJHF 3VB8A 4WW1A 4EDXA 4PJBB 1NGYB 3B5GA 1RUPL 1A02N 4NQXA 1K72A 3T1WA 4TSBH 4K8RC 1LD9A 2WHVA 2CGRL 4QRPA 2DB8A 1TQBB 2XKUA 3C12A 3CN1A 5DFVC 4KXZI 1AR1C 1QTPA 1AI1H 1U4EA 1EK3A 4XN5A 1E28B 4XMLL 5A2BA 3FFDB 2XN1A 1FFTB 1SXNA 1UM5H 2YMOA 3FULA 4YBQC 2BSRB 3LS4H 1BVKB 1V7ML 3PJLA 1E6JH 4NRYA 2EXYC 3P77B 1GY2A 5I30L 3O6FA 4JN1L 1MHEA 5J8OA 5L2KB 3E3QC 2JIXD 4LPUA 4L3AA 1PEWA 1IAKA 1P5VA 2YD7A 3RP1A 4IBWA 1IV8A 2Z7ZA 2BS71 5EN2A 5CIPH 1DL7L 4FQXA 3UZEC 3H7BA 2CHWA 2MHAA 5L7XL 1M05B 4L0ZA 3OKMA 3H2WA 2WJ5A 4KDTA 3PJNA 4B3EA 1MIEH 3A4FA 1NGPH 2WLLB 2ZSWB 5F2FA 5IG7B 2VLME 1RJYB 2EEFA 2EICA 4WW2C 3LSOA 4IU2A 3RB7A 4O2EA 5I74B 4HG4K 5CEXB 3SGKC 2YK1H 4Z7VE 2Q10A 5GS2D 1KLGB 3ECUA 3IGAB 3QA3A 4YFLF 5DGQA 1REIA 3CZUB 2A99A 4X50A 1VFOA 4EIZC 2H5UA 4HS6A 2VR6A 3TIEB 5ICYA 1M71B 5D7LB 4XBMA 4HJ1A 2I85A 3ABGA 2WVUA 1HXMA 3VJ6A 3GRBA 5B38A 5FYKD 1F8TL 3FQ2A 5IHZB 4QT5A 3CHQA 4L9LA 4UTCA 1C7TA 4E9WA 1L9SA 2WTRA 4JQVA 3S5YA 3MRFA 3G08B 1VEPA 5HHNA 3IAQA 3PWPB 3QISA 5T1LD 2BMKA 5I5MA 4KJPC 3WJJA 5D7IF 5M94B 2AQNA 2O6EA 3EOBB 5GS0L 1E3FA 2Y7NA 3RPBA 3ZKMC 1CQKA 4OCXL 5DS8A 4JJ5B 1NC2A 2NX5A 1FDLH 2TRYA 1DFXA 3NIFF 1AZBA 1WT5A 1JWSB 4EUPB 3TH2T 3VW3H 4KTDL 5JDJA 1KCLA 2C3VB 1RU9L 4RESB 4L8CB 3NDYE 2YSSB 3AJ7A 2J1XA 3V4VH 2D3JA 5DT1H 4UIKL 4JREC 4XNMB 4HIJB 3WXVH 5ESQB 3N42F 1EWHA 3VRIB 1RKRA 2QQNH 2EVFA 3DO4A 1TTGA 5TFSL 1SDYA 3FOMA 3N1FC 4GKZA 5FK9B 4NLHA 4BFEA 4PH8A 3D0AA 1J9CT 4QRSA 2P7TA 2IOOA 3KXFD 4FGMA 1J86A 3VB9A 2UZYA 4Y4HC 3V7AG 4WFGE 1ZHNA 1TPXB 3SQOL 1CIUA 4NIYE 5IHLB 1A7NH 3GZOA 3WBDA 3UBXG 5IB3A 1I9JL 3SCMA 1GGUA 3PREA 2AQ1A 1ZT4B 4GUCA 3WO4C 1X6LA 4F58H 3LKOB 1NEUA 4J3UA 2XRAL 1MHCA 2DBJA 3NZHH 1CK0H 4NGHL 4ZNEA 1OTSD 4TNWF 3WIAA 4BK4A 1WAEA 3VDAA 5CJXA 2I26N 3BLKA 3REWB 2YN3A 2C9QA 3QIUA 1CGSH 1NAMH 5MEND 4U0QB 5LJYH 5AKTA 2VN5A 5JPMC 4HDIA 2M1KA 5EO0B 3VXMD 3WV0A 5IBTH 3V0WL 5D2LE 1J9RA 1JGUH 2V2XB 3RPIB 4JUTA 3MMEB 3O2VH 4FD0A 4PS4L 3WIHH 1B3JA 4PJ5D 5LWYH 4IIQB 1BZ7A 2EILB 1JNNL 1NGQH 5JHBA 4U2YA 4NO5A 2ITCB 4Y2DA 2XBTA 3UZVB 4JPVL 2DDQL 1BVNP 2APTA 4ZAKD 4NZUL 1JUFB 4HHAA 1CD8A 3OKNB 5LGHH 3QARA 1YC8A 4DQOH 1BFVH 2KZKA 4NAMA 4UNVA 4XVOA 1ZLSL 3V9CA 1YNTF 3G5ZA 2NT1A 4DERA 1MCOL 2J4WL 3P40A 3RWIB 4G8IA 3T5WA 1MN4A 4YE4H 3WY2A 1L3WA 3II1A 2ATPB 3H53A 3N04A 5HI5C 4MWFB 4UAHA 1MG2C 4CAGA 1W72L 5EN3A 4P59H 3VXUE 5AWNL 1DVXA 1BM7A 4XC3H 5F9OL 1WYJA 4WHDA 5DQJB 4BQ9A 4I18C 3VCLA 3RKDC 2IADB 3VTMA 5LQBL 4U1SA 2V9QA 3FT1A 2NYKA 3L3GA 5JA9A 4L8BB 2NY3B 3RWDB 3U4EB 3QCUH 4P0DA 4HS8L 5KYYB 3SKUD 2E7DA 4L0YA 4KROC 4O2CB 5KANG 1XL6A 4JDVA 5BV7B 3G9AB 3LOWA 4R84A 1DEEA 2BM3A 4EQ3A 3K6OA 4WV1C 1BQ5A 2VQTA 4UV4H 4LLVB 5DJYB 2XIBA 4FYQA 1MOEA 2N3JA 3ZHDA 4A7GA 1QW8A 2WUBH 5FO7A 2VLRB 1IAII 4KKBD 3RWGB 3ZZ1A 1YEFH 1Y7VA 2O5YH 1T20A 5EUOB 4NT6A 3VX1A 3N1MC 4LQFH 1VFMA 1Q9KB 1ZA3B 1MQ8A 4FFWD 4Z7VA 3O8XC 4YXHH 2XQYG 5HI3D 1ZGLP 1B0RA 3KG5A 5C0IB 2O61B 4I2XB 4LDEB 5I6XC 5CF3A 4LLMB 2MNUA 1QYGL 3BP5A 4HAGA 4LASH 4Y4KA 3TEXA 5A2CA 4CADA 5B1BB 5F96L 4F24A 1S5IL 4LNRA 1I1AA 5HI4D 2R23A 2X4PB 2VXTL 2A9NH 2AERT 1JHTB 3W0WD 5JIHA 2IPTL 1NCBL 4JZJC 3V7AE 3VD5A 2YMXL 1IM9B 1PKQA 1IO4C 2WLMA 1RJLB 1AQDB 4FYTA 1T22A 1YA5A 2MWCA 4JM0A 9PCYA 4ZS6D 4S0HA 3CPLA 3TA3A 3KYNA 1JL8A 1SY6H 2EE3A 1O5PA 2X4SB 3BSZL 2R0LH 2UZXA 3EBIA 5F7WC 2Q7AA 2KC0A 4KDVA 3FT0A 2QVMA 3BRFA 4YAQB 4JO1L 4PY7B 3FCSA 5DZPA 4KITB 1KBGL 4OD3H 2BVOA 2V8MA 2BOCA 4A6YB 4MB5A 5IROA 1UB5A 4KKZA 1E8XA 2FHBA 3OSKA 1KIUB 3ARDB 4EI5D 4PRHD 4MXVF 1DVUA 1NMCB 4UDUB 5F89B 2H0FA 3MRLA 4FABL 5EIIA 1R3LA 3HC2A 5E8DH 4ECNA 5KBKA 1SQMA 3RA7H 5I6LA 2OI9C 1QATA 3RKPA 2UX7A 3DV6A 1EBPA 3US9A 3D25A 2JJTA 5D93C 4APQC 1UOLA 5J9PA 4FOMA 5A40E 4WK4B 4YDZA 3O3AA 4Y5YC 1WZLA 4Z3IA 4G7SB 5IMKB 2EDYA 3CVHB 4JFFE 2NR6C 4EI6B 3GZKA 4K4KA 2WSKA 2HT4D 4D0DA 2GBUA 3CSFA 5F6HI 2V2WA 1M6UA 2R0ZL 1TMQA 4ZFGH 1NQBA 1RIHL 4PMEA 4OKVA 3BD4A 2FT7A 3GHEL 3HE6B 3VXRA 4ETQA 2VUOA 4CSSA 2GY5A 1UD3A 5SWQA 4W9HC 1TKWB 1CURA 1R3JA 3KYOB 3S8GB 1KCVL 3EO9H 4DN4L 5C7XL 4X0KA 1KGXA 2RCSL 5CHNA 5DC4B 2LTQC 1O6VA 1QFWM 2PPFA 4DO4A 5TTRA 1PIFA 5FGBC 2Y5EA 3X13B 3QUZD 2LR4A 3MV8E 2BHZA 2OMYB 2BVEA 2DW5A 4BZ2A 4UTBH 2WC7A 1UYWH 2Z1KA 5IFAL 1SPDA 5BUAA 5DJCB 4A7VA 4F8NA 4BHUI 3KLHC 2H2SC 1U3JA 3SODB 1R0AH 3ESMA 3EUDA 3DUHA 4ZBJA 1D6EA 3LQAC 2HCZX 1EO8H 2DAVA 4M61B 1MNUH 4PRPD 4F7EB 2W9DH 4KI5C 5F1IA 4YMPA 3A3YB 4Z77B 4Z0BL 3S96B 4CNIB 2BP3A 1RUKH 3LYRA 4FQJL 4PGBA 4YDJB 4PUBH 4DW2H 1WQVT 1YEDB 4PM1A 2HG0A 4X6FB 1MCPH 1UACL 3LRKA 3G04A 3T3ME 2Q1EA 3Q8FA 2QDVA 4HZLB 4WWKC 4IIZA 3HUJF 4YDLC 5JOFA 2PTUA 3FT2A 3JV6B 4R3SB 1BAWA 4MJIA 2XKNA 3MLUH 4N8CH 2Z31A 4LCIL 3VMOA 4Z7QB 1ZK9A 4NQEB 2BS8A 3KPRD 3MBEA 3HAEA 1EGJH 1JVKA 3VXSA 4BYHA 2BSCA 2NY1B 4TYUA 4QHPA 3RGVC 4W9LC 4PJDA 4MQ7B 5GZOA 2EIDA 1T1YA 5AB0A 2FAUA 1W16A 1E5BA 3N41F 3QQ4A 2FBJH 1YN6B 3MKGA 4JQIH 5FIEA 4J1UB 4PJXE 3LXAA 2PETA 3GZPA 5ANHA 4UTAA 1KEGH 4JO8A 4FQ1L 2X1PA 4P23A 5CZXD 1X5GA 1SFDA 3O11B 1D9KC 4TN9A 1RIUH 1C8PA 2ADIB 5B39B 3QVAA 3VWKA 3NJIA 1ACYH 3ZZSA 3EZ8A 3QI9C 1PCXA 1AGEA 2C1PB 1HEZB 1OP3H 3FTZA 4KNUA 4C54A 1KZYA 2CLRA 5F9WB 3DVNB 4XI5C 3B9DA 4ERSL 3BUPA 4UQ3A 5C9JB 1NL0L 3R1GH 3L9RA 3RLSA 5J6GA 2VW6A 3QIBD 1FHGA 3ECBA 3HZMB 5H35A 4NM4H 4UZUA 3L5HA 3QO1B 5SWZD 4WU7A 4Y9GA 4ODSH 1SFHA 4HX1B 4R26L 4ZSOB 3M17B 3C60B 4ZFFA 1YY8B 1F45A 1S9WB 2ZWKA 4XP9L 4U7MA 4YWGL 3GBMH 1XGTA 3NG5A 3NVQA 2F54E 4O00A 2D0FA 1XSIA 2NSMA 3BXNA 1K2DA 3ARXA 3MGTB 1IFHL 4OCNC 3UZQA 2AVFA 3C5JB 2WP3T 3BZEB 3HBQA 4Z3TA 2FEJA 3ZDXB 3I3DA 2VWEE 3GIZH 4QTIH 2ICEC 4NENB 3WJLC 1BIHA 2IAND 4XH2A 4PI0A 1N0XH 1M2VB 3U9UB 4LHUD 3LY6A 4BM7A 4HUCA 4B9YA 4NM8L 3MA7B 4FTVB 1RZQA 3GO1H 3KVQA 4EVNA 3FRPA 3TEWA 1I7UB 1AAJA 3CDZB 4QXGL 2V2TA 1QI4A 4L4TA 4NLAA 2HTKD 3IDYC 3KPQA 3SYOA 4F2ME 1EFXD 1TDQA 3PL6A 1Q9WA 5GRXG 2B8OT 1AE6L 2R0KH 2VCOA 1F3RB 1WF5A 2IALB 4IEFA 2QV2A 1HYSD 1H9VA 4E9QA 5B8CC 2YR3A 3WTXA 4P4KA 3NCXA 4A67A 4H8UA 3SQBB 1PG7X 1U9KA 5C0FA 1XZWA 1FH5L 5B1CA 2RBLA 4OD2B 1FN4B 2VR3A 1QFUH 3D87B 4IRSB 3IXAB 2OPCA 1JHLL 4NC2B 1J7VR 1T7YA 4F37K 5I1EL 4M1GH 1FC1A 2V5RA 1SXCA 1AHWC 4FMKA 2HFEA 2NY7H 3OF6D 4MBRA 4JFQA 4WO4D 2VZUA 2ODIA 2ZOKA 1BEYH 4Q4EA 4AL8L 4D7PA 1VERA 1UOVA 1NDGB 5IW6A 5LXGL 4AQAA 3BGAA 1S9XA 3O0RL 4X0NA 3TT1L 4U0RC 4R5VA 5KS9F 2ZAGA 3NN8A 1A5FH 1H3GA 1F58L 1R5WA 2CR6A 3F7YB 1FFNA 3DHUA 3FU7B 2A83B 1C7SA 4NKIL 4XCCL 4E9XA 1I7RB 1DQJA 3SOBH 2EUXA 3QDJA 5HDRA 4TUJB 3BPCB 3FCGA 3HPLA 1AD9B 1GGYA 2JKWA 1KJ2A 4MS8C 3GSNB 2RA1A 4G9FA 1C8QA 4JR9H 5C0AE 5I0XA 1CF8H 1MHPL 8CGTA 2AEQH 2ED9A 1DVFA 3FHQA 2PP9A 4U1IB 3EXJA 1RK7A 2AZAA 4PJIA 3QNZA 2E56A 1YDPA 2V9UA 3TV8A 5IQ7L 1U21A 4UAOC 5FUOL 5EU6B 3WD5L 4IMKA 3BGFB 4K94L 3Q0HA 4EF3A 1H5BC 1RFDL 2VTFA 3VD1A 2DI7A 2FT8A 3I2CL 5A2LH 1E2ZA 2W07B 1F6FB 3BDXA 1NBYA 2HX8A 1YJDL 1JWUB 4Y9FA 1JZHA 2LVCA 2R56L 1CZ8L 3MTRA 3VWJC 2BJML 3BP4B 3IU3B 3C6LC 4WRLA 5INCA 4E42A 4LSTL 3VH8B 1TTBA 1AGCA 4F7PA 2YPKA 1A6AB 4YDMA 3ULUH 2EUVA 2Z4QA 3HR5A 2WUCH 4MQXD 4XNQB 2BNRB 3KM2A 3QORD 5JHLA 2J6EA 2HRPL 2CCLA 4QHUA 3MLWL 4CGUB 4ODUB 2VSDA 3LKNA 1R3KA 3ARGB 2W94A 2Q3AA 3QG7L 5EIQA 3SGDI 4WCYL 1JI2A 3HG1B 4Z76A 5AUMA 3VI3B 3UX9B 5HPMA 2OI9B 4OCYL 1UD2A 2XQYA 4MMXB 4ZO8A 3T2NH 1J1PH 1LEIB 4Y9EA 1T6WA 3PUCA 5KG9B 3O6FC 3I3EA 2QQKL 1I1YA 4N9OB 3QQ3A 2D8KA 2NY5C 4G7RB 4U6XB 1ZTXH 2QHRH 5AQ0A 3ULSB 4FQXC 3AGWA 3H42L 4A7UA 1DJIA 3ABZA 3B9VA 1JPFA 5ID1A 1CR9L 3AMLA 4FZ8H 4QXUL 4PCTA 1P5UC 1T04B 1W0VB 2WNGA 2ZWLT 2VIRB 3AU1B 5CLXA 5E2VH 1HHHB 4X8CA 5HVWA 4KZEL 3B2XA 3AC0A 4ORGB 1FZMB 1BQHG 3NCYS 3QXDA 1WZMA 2ZSVB 3DSFL 3ES6A 2RTTA 2LFGA 3OZKA 5HDWA 2WGNB 4ZMOA 2A74A 1ANUA 3MLPA 3QJTB 2I25N 3SGEH 2NZ9D 4BUGA 2P5WB 2VO5A 3MSPA 1JPGA 1G6VK 1IQDA 4G70B 5B3NA 1IVLA 1QACA 4OFYD 5T5NG 3X1NA 2FATL 2C5DC 1JZ3A 3PABA 1UZGA 3BPOC 2J20A 3OM3B 3IJEA 4NO3A 1QLRA 1WZ1L 2YD5A 3MRRB 5SWSE 5JYLA 1AIZA 2J12B 1SBSH 3OG4B 1U58B 3QNYB 4L9LC 4LL4A 5DRNB 5CP7A 3QHFL 4JQVC 4FQHA 4PG9B 1GVIA 3MNVA 5LN4A 4JLRA 4YR6B 4MNQE 2NNAB 4YHZL 5KJ7E 3F62A 2BSED 4PG2A 3A0OA 4S1QH 3S3PA 5I1DB 4P2RA 1OSZA 3WJJC 4B9PA 1XGZA 1E6OL 1QFPA 5EV7A 4TTDD 4F1ZA 2FD6L 3C8KA 2ZUSA 3EGXA 3R0NA 3WDHA 1EFQA 1T3FA 2XFXA 4MS6A 1MJ8L 3HG3A 2GCYB 2OMXB 2PXYD 3N44B 3BP7B 3CSYA 4HA1A 3EYVA 1XGQB 3HLKA 3KPPB 3QE5A 4Y16B 1V54B 2FZ3B 1A7QL 4QCIA 4BZ2L 1K8IA 5D6DA 4XXCC 1S7SB 3SE4A 4F2MA 1LWJA 3RGVB 3V95A 4PSPA 2YJQA 2HZHA 3BKMH 3S4SG 2C3WA 4KTGA 4YZFF 2CBMA 4U3HA 2Q8AH 3QDMB 2R69H 3CTTA 4YHLH 3QUYA 3RX9A 4KXCA 2LU5A 1JZ4A 3PGDB 4M8RA 1AIFB 1DQLL 2QDWA 3LN5B 4TOYL 5AKVA 5KVGH 2H1XA 2VYRE 4DO5A 3I75B 1CXIA 1QAWA 1G7MB 3QUMA 2IDUA 4NPYA 3LRSB 3QULA 3DSNA 3PJSB 3W11C 3WFEH 2W38A 3W9EB 4GG6F 3SCMC 4GPVA 1G5GA 5F6HJ 3QDGD 1AR2A 1JD7A 1VADA 1B88A 2PPDA 4GG8A 3JXAA 1BGXH 1DQKA 1T2QH 3S3CB 3UP1A 4DZBA 4FHKA 1RPKA 4NUQA 1MRFH 4X6CF 2Q76B 4YPGA 1UB6B 5I17A 3RTQA 1LM8V 3KPSA 4TQ8A 2FYYB 4N5ED 5FOBA 3VMPA 5CJXC 3UDWA 1DBML 1N5AB 2JKNA 4NQDE 1V8HA 3NZUA 4UINH 3RGBA 3QIUC 2DEYX 5JMOC 1MNNA 2LU4A 1LEKA 3MLXH 4L4VB 3FB5B 4HEMA 4Q6IB 2P9RA 5CJQH 3DOSB 4BFIA 4PJ9B 5K59E 4UTAL 4U31A 1KTJA 1XB6A 2W95A 1YUHA 4IBZA 2Z8SA 4G7VH 3OKYA 5JOEA 3D2UA 1WSST 1MRCL 2A9BA 5F9DC 3FSVA 2BNUA 4LSQH 4X8GA 3QUXA 5IHHA 1MFVA 4ZPVA 1JK9A 3K2MC 4Y2DC 1OPGL 4Z7UB 4AL8C 2VR8A 1OF2B 2BNQB 4P07A 4G43B 5EF1A 5E6IC 5GGSY 4FADA 3W5NA 5LDUA 2X4UB 5TDOB 3ILQD 3QJVB 1QX1A 1TNMA 3KR3L 2JIXA 3BPNC 5EOTB 5T1MA 3ATBA 2RFXA 15C8H 3KLKA 2VXUH 2WYIA 4YO0A 3UG3A 4QJ5B 1QSEB 5MEPB 1FLTX 3BVXA 3MUGA 1A64A 3L3IB 1HXYA 1AP2B 5ISZE 4Z7AA 3RWEB 1BF2A 2BC4A 2UY6B 4ZG1A 5DURD 3D6GA 4K3JH 5I71B 2BZDA 4OTXL 5KZCB 3BEWA 4LK4A 3WEXA 4LEBA 1FAIH 4P9HL 4JHVA 4PVNA 3V4PH 3V0VB 1BD2B 1HOCA 4JB9L 1RZKL 2HKFL 3J7HA 4K94C 4A63A 3NBNA 1J8KA 1AJ7L 4K2UL 4ILDA 3QPKA 4LVOB 1OAZL 1JRHH 1OP4A 4AV5A 3DPBB 3RIKA 1YJDC 2XA3A 4ONHA 3W0WE 4F3FA 3OJDA 4OLXH 3RAJL 4PP1D 3GJFB 3W5MA 2RB8A 4ALAC 1MQKL 4ZOCA 3ZQWA 1JDCA 1BZ9A 3K8KA 3MNWA 2ZXBA 3QK0A 4UIMA 5T1LA 4LOUC 4K71B 3RL2B 2B14A 1U8JB 5DDHB 2VKXA 1ORSB 1AQ8A 1R3HB 3DRQB 4E9TA 2EKSA 1FNSL 3AXLA 4DPCX 3E2HC 3RX7A 1HJCA 4A2FA 4NZTL 3AG3B 3CDGA 1Z66A 2DBLH 2XA8H 4M02A 4ES9A 3KPLA 5BXFA 1ORQB 2WY3B 5EFIA 4JFHE 4NNYB 4NQCB 4P99A 1SDDA 5I82A 3AT8A 1FH2A 1LK3L 2WWMC 4B9IA 5DSCB 2VM9A 3UTTB 3P4OA 1I1AC 2CD0A 2VN6A 1GAFH 1T2JA 4P3DA 5E4AA 1A0QH 1XCQA 4YZWA 5I1LA 4ZODA 1QRND 4IGBA 3N1QC 1FAKT 3IPFA 5F44A 3RL1A 4KMLB 4MNQA 3TA3C 5HDBB 2EDFA 4LSSL 1SF3A 2W59A 4ZZKA 2IBBA 4L29B 2FQGA 1JZ7A 4KO6A 4YHPA 3MCLL 2XWJA 4Y4FA 3IMWA 3QZOA 4BBWA 4QKXB 4NQXB 4OZGE 4C58B 3TFKC 3CFTA 4GI6A 1LD9B 1VZHA 4ODBD 4ZMLA 5JO5A 4M5ZH 1LJMA 4FX5A 4GUOA 3ARBA 3MOBL 2WAHA 5DO8A 3QYCA 3PXJA 5I9QC 2PNDA 2ZX6A 3VXTA 4TPRL 3EAKA 2X4NB 4DVBB 5CIPA 1N9PA 3OGOE 4OIAA 3US1A 2VDOB 2GTZA 1OPOA 2JJTC 2QSCH 4PJHA 3QQDA 2C9VA 4HUWA 1H3UA 1KFAH 4KHXH 4R7VA 3M1OA 1B4TA 4HIQA 4UOZA 5SX4H 1FZJA 1TJHL 3PDGA 4QJ3B 2R8SL 3NJGA 2BDNH 2P45B 3QFJE 2B1HH 3BJLA 3UC0H 5BRQA 3VXMA 1KLUA 3QPXL 4G6JH 5EN2B 3TNNB 3VFVB 1QNIA 3H7BB 2MHAB 1A1MA 4HWEH 1UHVA 5MHSD 4YSAA 2H2PD 1CLOL 1AO7E 2Y7SA 4N0UE 1KBBA 3D39E 3K0YA 4X6EA 3HJEA 3ROOA 2W0KA 1U8QA 3UTZB 4F7KA 2H3NA 3LSOB 4IU2B 4PJ7E 4DZ8A 1EZSA 4HC1H 5JHLL 3Q1SL 1U6AH 3MDJA 3HOGA 4HYTB 4H8WL 1D6VH 2J6EL 4NCC1 1NBZA 1QEWB 2FWUA 1QOKA 3M1BB 4GKNA 2GJ6D 3TURA 3V6ZB 2EO7A 4HS6B 3SJVE 5ICYB 2GBTA 1S3KL 2EACA 4W9EC 3S6CA 2CG9X 3B8SA 3VJ6B 3V0DA 1VIWA 4GRWH 4NQDA 2EINB 3VG9B 5FWRA 3T1FA 2FRGP 2VM4A 3IDXL 5GGQH 3A23A 4GAGL 2DI8A 3GBNH 3T8XA 1I8LA 2E9GA 3BW9A 3ZHLA 4E68A 2KZ1B 4M93B 1XGUA 3MRFB 3A67H 5EZPA 4HIEA 1NDTA 3N0AA 3V4VA 5A6IA 2OS7A 4YS4A 5AAPA 1TZAA 2B3RA 2CUHA 5ADPL 5DS8B 2NX5B 4AE1A 1GSMA 1KT2A 1QWUA 3QAZB 2PYFB 3CD4A 2Z31C 3E6FA 3MUY1 3CPUA 4NDMB 3LS5H 2B20A 1JAEA 1G7LB 4L3FA 3F84A 4UM8A 3BUIA 3RFRA 3T0ED 1BQHA 4JANA 3MBEC 4NP4L 3PFUA 2IH3A 1BPVA 4KRPB 3K46A 5GZOC 3WTVA 2G4EA 2AITA 3S2AA 2XV6B 4RIRA 1G6RB 2ZUYA 5B21A 3ZRFC 1VJSA 2ZKXA 4GKZB 4EN3C 4WFHE 2FUQA 4YHYC 5IBLD 1IGFH 2C26A 3L3KA 3MBWA 4QRSB 1Q8MA 5C0BE 5EBLA 2QPDB 3UJIL 4Z7NE 1DUYB 4M1CD 4PLKD 2NY4D 4HCRH 4KX8A 2UZYB 4OW6A 3VWKC 1MFEH 4EKXA 2OMZA 4Y5VA 4NBZB 1N6UA 2ESVB 3SBWA 1XFPA 4PN6A 1MJUH 3TT3H 4E0RA 2WIIA 2YGQA 3W0WA 3M1CA 4KAQH 3T65A 3S9DB 4XP5L 4R7DA 3NJKA 3T77A 3WN5A 3BVWA 2NY2D 3VU2A 4M00A 4Y19B 1MHCB 3NGBB 2CUMA 4BZ1H 2D4FA 5I1CL 2NNRA 1YMHB 5EU7C 5EF0A 1GC1L 1MJJB 3BVUA 3MRQB 1UA6L 1A6VH 2ICWJ 2XTJC 4O58L 4EZKA 4HJUA 4L4JA 4HDIB 4P9HC 4WFEE 3PWNA 5JIDA 1HJBC 5LN8A 4PRHA 2OMVA 1CBJA 1K4DA 1O7DE 3BWUF 2TSAA 4I87A 3S4SA 3VACA 3OKDB 3Q48A 1BW8A 2WLIB 5GGSA 3CAFA 3ZDZF 3O2DA 4LSVH 1C08A 3Q9PA 3QUML 4NUJA 4NAQA 3IJ9A 3FK3A 5I15H 3MO1A 4GMTL 4MJ2A 4WGWB 1BZ7B 4MLSA 1CVSC 3FRUA 5L9DL 1UEMA 2EH7L 5B3JE 4NO5B 3FCBA 5IUSA 3CU7A 3FPYA 4QHKJ 4YEFA 1A3RL 3LZOA 4MJ5B 3EG9A 5JXEA 1E2WA 1YNLH 1XT5A 1CL7H 4J28A 5FO2A 1E4JA 5LNGA 5EEYA 2I60L 2WBWB 1MFCH 3MJ8B 5PCYA 1RK0B 3B2VH 2F7PA 4LBEB 5MI0B 3UCRA 2KDYA 3OAUL 1TJIH 5AD0A 4HJGB 2P8MB 1PLGL 3DRTB 4UBDD 3QJXA 4DCQA 3PL6C 5J6HA 4UUJA 4P46A 1DQVA 5IF0B 3O3DA 3VD9A 4OF3A 2F58H 3A6BH 4QOKE 3EADA 1YEEL 2ENPA 4WDIA 3QZBA 1KIRB 5T3XH 1KPVA 2VDLL 3TZVA 3CN3A 3BIAX 7PAZA 2UYLB 4KV5F 1QBBA 3HIZA 1OT2A 1AGFA 3QUZA 3VCLB 2X41A 1XH0A 1F3JB 1QFWL 1D5RA 1FG2B 3G5WA 4X4MA 1FYHB 3K0WA 5EBWB 4P3WA 3FTXA 5IB1A 4F27A 3TCLA 3QXTA 1KB5A 2D0HA 3L3OA 4I1NB 1BOGA 3ULVH 4QYOA 4F7MB 5FV1L 3ZYIA 5I8KH 4LARH 5F1OB 4R97C 1N3NA 1DEEB 2V7HA 3TN0A 5DO2D 5C0JB 1SJXA 2NNCA 1SEBA 3MXWH 1LP9E 4HAFA 2X2JA 4IOIA 1WTGT 5FO7B 1UGKA 4M9OA 3V6BR 2J8UA 1FWXA 4CVUA 5CFAA 4PJ7A 3H9ZA 3QG6B 1T20B 2WO4A 3HRZA 3O2WL 2OL3H 2ZJSH 4Z7VB 2Y7OA 3SDYL 5JR1H 2L7UA 5EH1A 1B0RB 4QD2E 3AAZA 5L88L 4XRCB 1BFOB 2P46B 3AWEA 4Y4KB 4H2AA 1OXYA 3KPRA 4U6YA 3ZL2A 4HXAL 1SY6A 2WCGA 4CADB 4Z3FA 2YEVB 4LKXA 3SOTA 4LNRB 3B34A 1DANT 5FYKL 1FYTD 1F5WA 5DUML 1OF0A 1S3RA 2N59A 3HB3C 3L4VA 5DQDL 2XWEA 3ARQA 4MD0A 5E8NB 5IFHL 5AZEL 1EAOA 4ELME 2XSKA 1Z3RA 2QEJA 4YSQA 3H9SD 1BQLL 2UWEE 4RGND 4UZSA 4AEFA 3CPLB 3RJDA 3T4AA 5K9JL 4HS3B 3KYNB 4YBLC 4XP4H 2ZXCA 4WI9A 2GB2A 1K4CA 5I8EA 5J1SC 1EEZA 1C16A 43CAA 2VR7A 3P69A 1WLHA 4R7LA 1Z2KA 3FZUC 5INDA 1WHPA 1PX8A 1JGVL 2BVOB 3D08A 4XX5A 2WXNA 3U82B 1LE9B 1JNLL 4QF1B 3FHEA 4FI7A 4N20A 4U3SA 4U4BA 1FE8H 5D5MF 1GPOL 3X11A 4B9KC 4YUEH 4IKIA 4IBSA 4AYID 5EIIB 3H9YA 5E5LA 5AVYB 1B3IA 2F19H 5SWZA 3S5LG 3WFDH 5E94A 5AW3B 2Q2LA 1UWXK 5J9PB 3CHOA 4XPTH 1ZGLM 1TJMA 5GGRB 1IBFA 5E6RB 5GRYA 1INEH 2VDNL 1G1OA 4MYPA 5KW9L 2ZYRA 4TSBL 3NA9L 5HYQA 2C9PA 4ODHL 3H3BC 3X14A 2VLJD 3VFWB 4ZMPA 3UABA 4RDQF 1MAKA 4OKVB 3BZ4A 3AG4B 1ASOA 3QCVL 1DJSA 4JFVA 5SWQB 1AI1L 1L9NA 1BVOA 2EYRA 5B1KA 1VESA 2IANA 2NYYD 3NTCH 4D94A 3KBHE 3ZZQA 4X0KB 4BH7B 5AFAA 4QRFA 1T89A 2A74C 3RDTC 4FXGA 1E6JL 5BRPA 1KN4H 2EDDA 2YKLH 3AQDA 3B56A 2V33A 4NUGL 2QSQA 5E6YA 4U49A 4LHQB 3L17A 2GIMA 4P9MH 4NRZB 3ULUE 5KYNA 1WBZA 1R3IH 4CSTA 1NGPL 4Y1AD 3CIAA 4NZRL 5CCHE 3SY0A 3MYJA 3HN8A 4NQTA 3OJMB 2Q5BA 1NCGA 5TD4A 2E86A 2E4FA 1OD9A 3C08L 4DIXA 3LEVH 5D2LB 3PNWA 4RETB 1YLBB 3CFDB 4PGBB 3DROA 4G1MB 2CIKB 2IAMB 3NPZB 1TQUA 1OGAE 3G04B 4F7CA 2DQTH 2R1YB 5B7MA 4YK4C 5F3BA 1AGDA 1BZQK 4JQIA 3NRQA 3SO5A 5JOFB 3FT2B 1KNOA 1YAZA 5CLYA 4ZMVA 1ZTXE 4I3SH 1C9SA 4O4YH 1QD0A 1GC1C 2PCYA 5D1QE 1L0XA 2VXVH 5D6DC 4ZW7A 3SE4C 3X1GA 4H44C 1T1YB 1USQA 4XNUH 4LRNH 4BUQA 1Z0NA 4LCWE 4CILA 2WVTA 4ZNCD 3HUJA 4QOKA 1H8NA 3DETC 4FNSA 1KXVA 3ZKNC 2F61A 3MJGX 5KVDL 4RISL 4W4NA 1SMOA 3JYCA 4PWFA 3FQUB 3KYKH 3QUYC 3VXUB 2AV7A 2XNAA 4O5LL 2ZCLL 4BE5A 4P23B 5CXPA 1YEGH 4KO7A 3VW3L 2JB5L 2EC9T 3BGMA 1B0GB 4KKQA 4I9WE 1EZVY 5E4EC 3M46A 5E1HB 3V4VL 2BX5A 4W93A 4XN1A 3TPUB 2RIKA 5FGCE 3KJ6H 2C9RA 1FNGA 1NEZG 3BAEH 4O9HH 3QEGH 1SF5A 3G6DH 3CH1A 1JVOA 1IC7H 2VXQH 5KVFH 4MAYD 4UQ3B 4MA8H 3IJHB 2X0VA 4RBPH 4DGYH 3L9RB 5GZNC 5J6GB 1UXLA 3RWFA 3RTQC 2G3XA 3BUYB 4WU7B 2FJGA 2P1YA 2CGZA 3KH3A 2CALA 3DXAE 5C08D 1B9KA 1F3DH 4J3SA 1C5DB 4U1KA 3O9WD 4XNDA 3QORA 4XO5A 1JWMA 3L95A 2QSVA 3JWDH 1K2DB 2HPOA 2OULB 3CHPA 4YGAB 4XPAH 1AKJB 1ZSDA 3UG5A 4HOZA 2O30A 1Q0EA 1IE5A 1B6DA 4F58L 3IB4A 3UROR 5MERA 5EMYA 4NJAL 4JO3H 1CK0L 3HNTH 2Y36H 5K1NA 1MSPA 2NPLX 1JTPA 1P84J 2PWDA 4ANKA 5BVPH 1BBDL 2JJWA 3TXAA 4ELMA 4TL5A 5GGTH 4GAJL 1RQ5A 4G80A 3UBXB 2CH8A 2V2TB 5IBTL 4X2UA 4GOSA 4L4TB 5KVGE 4NBXB 2X2YA 1ETZB 3CFBB 3KPQB 3O2VL 1Q9WB 5TQ2H 2VMDA 4Q2ZA 3AXIA 5F72S 2DMCA 4UF7C 5LWYL 3LH9A 4IEFB 4L3EE 5I8CB 5D70H 4X6DF 3GMLA 1OCZB 4P4KB 1T0MB 4PRBA 3FF8A 1EDQA 5LGHL 1KOAA 2HUHA 4IMLB 2EDHA 1I7ZA 5H37A 3MUHL 4DQOL 4NKOB 4PV8B 4HXBH 1ZVHA 4PJBF 2Q86B 3MR9A 1NPNA 3O2DL 2UZIL 2XKSA 3SIKA 3FB6A 1OIOA 2JCCE 1GIGH 2Y2TA 5ECJE 1JPEA 3CHXA 5DVMA 4YE4L 2Z7UA 5I75C 4JFFB 4BDVA 4RFNB 3KLDA 1YYLH 4ZO9A 3HG2A 2GTWA 5IW6B 2PPCA 1GY1A 1RZIA 4AQAB 2Z4TA 1S9XB 4L1DA 2I07A 5HTSA 3JV4A 4QXTA 4XC3L 1QTSA 4HK0A 5D7HA 1FIEA 2BSEA 2XZCL 1R5WB 4M7KL 5GSRA 2ZWZA 3H85A 5DEZA 3CXDL 5HDOA 3TJHD 1MCEA 1JBJA 2CJSA 1EHLH 2FJHA 1E4XH 2FHFA 5JXAH 2YSTA 3HPLB 1U8LB 1VSCA 3ZSTA 1F4HA 1KJ2B 1KPUA 3QCUL 5D1XD 1E9PB 5GHWL 1DSWA 4G9FB 2VDQH 5E2UH 2UZPA 4DN3H 1V3MA 1M7DA 1DVFB 2MEJB 5FCUH 3CLEH 5DA0B 3MV8B 4UV4L 4YLQT 3VFMB 3SO3B 4YHIA 3UMTA 4CC4C 1MF2L 5IOPB 1CDGA 2VAJA 4K9JA 1N5YH 2YPLD 4JG9A 2A73A 1KB5L 5KYXB 1YVLA 1TJGH 5CGMA 4W9GC 2FX9L 4XOCA 1NBYB 4G3YL 4LQFL 3IDJA 3C9NA 5D96B 4N68A 3D4CA 3VI4E 4AEIH 1U95A 1FSKC 4X6BB 1N0LA 5INCB 1Y6KR 4LASL 4NIKB 4EEEA 2YPKB 2CHXA 4DFHA 2WOYA 4NI6A 2ZPKH 3RB5A 1U8NB 2E7MA 2CR0A 3T3MB 4NN5B 3UAFA 2CO3A 1A6UH 1P7KB 4YSSA 2A9NL 5TF0A 1YN7A 2YRLA 3VFSA 2B15A 3HVDA 4IKJA 2CXGA 4QHUB 4FQCH 5DLMH 2VDKB 4Z5RB 1XDTT 3MV7E 5JPNB 1R3KB 2ZXAA 1VGKB 1GZHA 1QHOA 2GI7A 4DNLA 4Z76B 4PJAE 5AUMB 2P8PA 1OTSC 3Q44A 4KOBA 5D1QA 1BXAA 1SY6L 1QO3A 5EOCJ 3RIAF 2R0LL 1J0IA 2WVVA 5HJBA 2MIZA 1GYCA 3SPHA 1TU2A 3T09A 5E5MA 3AS2A 3UPRB 5C07E 5CU9A 1I1YB 4M9PA 3QQ3B 4OD3L 1KTDA 1NGZA 4A37A 3T04D 3T0BA 2WYZA 1J5OL 4I85A 3BKYH 1A4KA 2DIBA 4M56A 2C7UA 1JDDA 4W6YB 1L9MA 5SV3A 3CLFH 1GHFH 1WH0A 1ODUA 4Z9KB 3FNKA 3RA7L 2XYCA 4DTGH 1D5BA 5FYJH 1TEYA 4P2OD 4ZAKC 4S1RL 2OJ1A 3ZSSA 5EF3A 1HHKA 4XMKH 4FN0A 4EZMA 1OQXA 3WFHA 1H9DA 3FTGA 4LF3A 1IGMH 5DUBA 4N0FA 1KDIA 1NPJA 4JFTA 4HIPA 1H19A 4AG4H 3PABB 3SKJH 2YS4A 5GPRA 1P4BH 3VMNA 4P48A 2GABA 2PP8A 3EO9L 4D0BA 4TTGA 4PYHA 3S5LA 5CP7B 5IQMA 4XAWH 2IGFL 2R4SH 9CGTA 2FIKB 4R8WL 1PMYA 4JLRB 3ZHKA 4MVBD 4GNKB 4R5XA 4OI9A 1Z9PA 1LWRA 5AW1B 3BUDA 1G7JA 4XPFL 1OSZB 2J8HA 4HKBB 2OXHA 2EO9A 3UYPA 4B50A 1RZ7L 5CD5D 3T0WA 1R0AL 2K4AA 4FEIA 1BF5A 3CX5J 4YK4B 5IQLA 4Q0XH 1H6FA 4N0RA 2DN7A 3IWUA 2NYZA 4K23H 3TX4A 5D72H 3EJSA 4OJAA 3CSYB 1EO8L 2R69A 2VZ3A 4KGLA 5KOVC 2YC1A 3FBKA 3GRGA 1MNUL 3QZWG 3AMKA 3BFQG 1G7HB 3MLSH 4W6WB 5L2KD 1H6EA 1NA8A 3F58L 4IBQA 3BH4A 4F2MB 3HHMA 4UT6H 1B2YA 4XODA 4KKBC 4DW2L 1ASQA 1MCPL 2VQ1B 4L3EA 4FFWC 4JKLA 1QWNA 4RMUA 4FA7B 5HI3C 4L48A 4WKZA 2H26A 3W9DA 3RIAK 3MLUL 4N8CL 3W39B 3DV4A 3VFUA 2VW4A 4F2FA 7FABH 3ZO9A 3QULB 3Q5TA 3A21A 4DGIL 1CU4H 2JCCA 1HCYA 3PWJB 3DIFA 4U7SA 4G7YH 1FIGH 2A6JB 2YPVA 4GRWE 4GG8B 5E1AA 1NCCH 5D7LD 4X99A 2FBJL 4JQIL 3LN9A 1ZGLA 1QRNA 1S8DA 3WN5C 5IWLA 4ZS6C 3QDAA 3OWEA 5C3LD 3W38A 3MFFB 1KEGL 2YN5A 1PX4A 2H47C 5H4ZA 2PCFB 2Y1YA 4C4KO 3TLRA 1RIUL 2BSSB 1MVFA 3LEYH 3QJFA 3N55A 1R24B 5TH2A 3BAJA 1B0IA 5ILTL 4R2GB 1AXIB 1B0WA 4RRPG 1JHKH 2AXJA 4OLZL 3DBXB 4BFIB 4EI5C 4X6CA 4HMCA 3R1GL 5ANME 1YUHB 3D2UB 5IIEA 3S35X 3EYUH 1L0QA 1OCCB 2QKSA 2VXSH 4U1JB 2C3GA 3D69A 3QUXB 5EUOF 3FUNA 4XN8A 4ODSL 1JK9B 3RI5K 5I16A 3P0VH 1MFDL 4U1HB 1T4KB 1QKZL 5DJ0A 5EU5A 1HE8A 5BO1H 4WUUE 2HT4C 1IUZA 3UTPD 5TK2A 1IKNA 1CXLA 4X5XA 2VDPH 2N7BA 5T1MB 1NEZA 4FQLH 4KVCH 1ERNA 3ASNB 2RFXB 4N2NA 5I6KA 3QXWA 3V4PA 2E9IA 3DURA 4YO0B 1Q0YL 1KIQB 2LT9A 2R39A 2DS4A 2EP6A 3MUGB 4QTIL 1H6UA 3VVWA 1Y18A 2ZUVA 2BC4B 4ZUUA 5E9NA 3MRNA 4KOCA 5CN3A 2B5IB 2CR3A 4B96A 3BEWB 1KYUA 3WEXB 5I66A 1T6BX 3KL5A 4Z8FH 1CD1A 1D5IH 2GJ6A 1T83C 3MV7A 3QUZC 4U1NB 1Z3GH 4X9YA 1IAOA 2A4CA 2E9JA 3DGGB 4P5MB 1A2YB 5ESAB 3AXHA 1GGIH 3CVCA 1VGEL 3UEZA 1DJXA 3ATAA 3I6LE 1PF3A 4LCCA 1QW9A 3L3OC 3LVTA 2VISA 3UYOD 4YXKL 5CM1A 4JFOB 2KBGA 4ONHB 2WQVA 2BY2A 1I4FA 2R2CA 4QNPF 4AW7A 5F0LB 1ACXA 1QBLH 6CGTA 5C6WH 3P2DA 3U0PA 4ZTEA 2YD2A 3N3EA 1BZ9B 3MNWB 4UIMB 3OAYK 4JDTH 4MNHB 3RBGA 4MXWH 2F5BH 3F7RA 4Q8BA 2Z3FA 1CFMA 2EKSB 4M1GL 3HRZC 5F7UA 2BP0B 3CDGB 4R6UA 3SKNB 2B2XH 3KPLB 5IQ9A 3T2QA 5BXFB 5EFIB 4OF0A 1X3DA 1SDDB 3GUTA 1MCRA 4YH6A 4G6FB 3T0EA 3EDKA 4Z78B 3F12B 2D7TH 2IH1A 1MVUA 3X3GL 4HW6A 5B22A 3HE7B 1IGIH 4ODWA 3LH2H 3H55A 2VOTA 4P3DB 3SOBL 5GJTH 4ZMXA 1DQTA 5GS3A 3K71A 4WIQA 5A16B 4K7FB 5T3XE 4IGBB 4BA8A 4JR9L 1CF8L 4MNQB 1QTYT 5CZXC 3WENA 2Z7WA 1NDMA 2X7LA 3CCHA 2DQFB 3VD0A 4PJ8B 4X98B 2WWOA 1NIDA 1FF5A 2LU7A 2RALA 3DVGA 1HSBA 4Y4FB 1NANI 4DH2A 1XIWA 3ULVE 2CKNA 1NUDA 1CMOA 3WE6A 3V8CA 2DWYA 1CO1A 4MB4A 5DU7A 5ABAA 1SQ2N 3ARBB 2NY3D 3QIBC 3VXTB 3VD3A 3BHBA 5CIPB 4W9DC 5DD6A 4WGVB 1F2QA 1F4XH 4KJQD 5D1ZB 3MGOA 4EI0A 3QQDB 3GTNA 3IBEA 1CFTA 4HJJL 2CO7B 3GKWL 4ZJ9A 3H3KA 1HIMH 1DYZA 2OTWA 4Z7QF 3PQYE 1AQMA 4NO2A 5G4MA 1NJ9A 2KZBA 3ZDWA 2VLRD 1KLUB 4BD4A 3FO2A 2G2RA 5KYWB 1Q0XH 2D3NA 5IVXE 4ZFZB 3GXDA 3VXPA 4OSUH 5FM8A 3ROOB 2EZ0D 3ETTA 4FCHA 4KRLB 1RJZA 2PW1A 2H3NB 2XTLA 3T2NL 4DZ8B 2YD1A 4RA0C 1S7TB 1M3IA 1D5ZB 5HGHA 3S8FB 3SDCA 4H0IA 1NBZB 4GKNB 2AANA 4PRNA 3EFDL 4JFDE 5DXWA 4DP6X 5J13B 3EOYG 1ZTXL 3IDNA 2I9LA 2EC9U 2QHRL 5IFJB 4WU5A 1IM9D 3VNYA 2HTKC 3CZLA 4J6RL 2ZAIA 5BRZE 4FZ8L 1Q9LA 2G60H 4NQDB 3D33A 5JUEH 3R7RA 5E2VL 3T1FB 4ADJA 1G5AA 3MA9H 3R19A 5BVJA 1BJMA 1HYSC 4AZ8A 4AXWA 3T8XB 2H9GA 2YKKA 5K9QI 3RVUD 1G1CA 3MCG1 3T3PE 2R29H 3OVUB 4HIEB 4LB8A 5DI8A 2V17H 3VFTB 4G1EB 5C2UB 5KJRH 1PD6A 1QBMH 5JOPE 2KLTA 5I1AA 3ARDD 4YHOL 3NZSA 1EO7A 1F6AA 1O9WA 2H6OA 4S1SH 3Q8EA 4WO4C 2DQDH 5FXCH 1BLNB 3MUZ1 4AMKH 2F53E 3B4NA 3ZDXF 2WWNA 2DKUA 1URZA 1VPOH 4HH9A 3E6FB 4OGAD 2XY2A 3FQ4A 2UX6A 4UM8B 1FFQA 1BQHB 4QAMB 1I3UA 1U8IA 1KYOK 5FDWB 1GCYA 3B1UA 4HCRA 4IU3A 4UMGA 3PAYA 3DX6A 1GYVA 2VLKE 3OC8A 1YY9D 5ISZB 4H5SA 3K81A 4RIRB 1ROCA 4KRMB 1KXVC 3HE6D 4NZFA 4YNYB 2WXIA 1Q94B 2K8QA 4I48A 3AROA 3DO3A 3MBWB 3F6LA 3QCTH 3CFQA 3NAAH 4HPOH 5HBBA 4KH9A 1HWGB 1CTNA 5DJ8B 2H8PB 5DUJA 2OMZB 1DQIA 3V4UH 4Y5VB 2P8LB 4BZ1A 2FJFA 3FMGL 1A66A 3U83A 4E0RB 1UWGL 2WIIB 1FYTA 3W0WB 4GRLD 1NCAH 4N9GB 1IGYA 3T65B 1NAMB 3ILPB 2VERA 4UI2A 2HJKA 2HPTA 3P3YA 2R69L 2FT6A 4YHLL 4ZUWA 1OB1A 5GS1B 1WA1X 1JPTH 2JFCA 3Q3GA 4HKJA 4NHUA 4MQXC 2MQ0A 4J3OF 3MXVH 3QZWA 3MRPA 3QORC 1H3VA 1NZRA 1Z7JA 2HFTA 3WFEL 5I1HH 5T5FA 3UJTL 3U36B 2VDRH 2JKTM 4XBPA 4Z3HA 4N2OA 3ELAT 3PWNB 5JHMA 2LVEA 4TQEL 1BGXL 1K4DB 4XVJL 1J0JA 4IJ3B 3S4SB 2X2HA 3G6AB 1PAMA 3MREB 1C08B 3FC8A 4NUJB 2J3SA 4UDTA 5FW8A 1WTLA 4KUZH 1WG3A 3DX1A 2CJTA 3DDFA 3A5VA 1URIA 1NC4A 1NFDE 3FRUB 4LGRB 2OSWA 1WWCA 2YPVL 1XTLA 4P5RA 3LV3B 1B4JL 1JXGA 4NQED 1NCNA 1LEGA 2A9ML 3EG9B 4FE9A 5JDSB 2CJUL 1JIBA 2NY1D 3KWXA 5EWIH 1XR8B 2XZQH 2A1WL 1XD0A 5KVEL 2IXQB 5B1AB 2VLJA 1NPUA 5AD0B 3OKLA 3P3UA 1D2OA 1CN4A 3CGTA 4OZIE 2ZG2A 4WNJA 4AY0A 2K1MA 4G7VL 5J6HB 4UUJB 4P46B 1IEBA 3D9AH 2QGCA 4HV8B 1IGCH 2BSDA 3O3DB 4AGLA 4CGTA 4LSQL 3VXOA 2EYTA 3ARZA 4L37A 4QRRE 4JZNA 3ZE1E 4OZGB 1ZHLB 4WDIB 4XAKD 3EH1A 5HVHB 3BWAA 2WMPA 1E0OB 3PDDA 1KPVB 3PGFL 2KQNA 3STLB 2J5LC 5KVFE 3TZVB 4AKPA 1OCWH 3BX7C 3LB6D 2NZ9C 1AGFB 4ES8A 1IEHA 1PZ2A 4JPWH 3OHXA 1CF1A 2E46A 3CFCH 3GMPA 4BFGA 5KJ4A 2FIRT 3BPLB 1F1AA 1TVBA 1ZE3C 4YXLL 2PYEE 1CGXA 2AVGA 4QYOB 5C97A 1PZ3A 5DZVA 4DPAX 1S7WA 5FLUA 1QPKA 2V7HB 4ZMWA 3TN0B 3PQYA 3C60D 3HLAB 1QMUA 3AW5A 5C0CE 4K3JL 1BQUA 5GSVA 3VI3F 2CZNA 1FPTH 1FAIL 4ADIA 3FUJA 3MRBA 4R4BB 3V4PL 4WF7A 5IVXA 3GKZA 3TF7C 2CXKA 1AO7B 5C70A 4N0UB 4TTDC 3D39B 4XPHH 2BWQA 2J8UB 4JM2A 2Y5TA 2NCEA 4PJ7B 3FU8A 3ZXAC 1BSIA 1WIOA 3B7SA 2B0SH 2PXYC 3TBYB 3FO9A 1EUTA 2YBRA 2N7SA 1RIVH 1FCGA 3NH7H 4RA3A 5KBDA 4L9DA 4FLRA 3SJVB 4FTVD 2OAAA 3W1ZA 5BW7A 4ISVA 3X2QB 1ODAA 5D7IE 4OIIL 1CD9B 3UO1L 5FF6A 4YDIH 3HJ0A 3H0TA 4NNPH 3Q2LA 3EO0A 5AYQA 4Z7OE 3OAWA 4GXUN 3OL2A 2Y06L 1RUML 4BKLA 1A1OB 2DBLL 2FB4H 2XA8L 3ARVA 3T4AB 4JY4B 1HHJB 4A04A 4N2CA 4YHKL 1RV6X 1S7VB 3D51A 1M2OA 1K4CB 3CX5K 5C3IA 1EEZB 1C16B 4NOFA 4QRUB 5INDB 5HI4C 2NXZB 2HKHL 2BSBA 3LDBC 4IRSD 4CVXA 4OLVL 4J2XA 1HK6A 3OKEA 4MAYA 3X11B 3GMMA 2FL5A 2DIAA 1PNCA 4BWTA 3HKZA 3MRDB 1KXTB 1L7TH 4ZO7A 1N68A 4JFUA 1XMEB 3NFNA 5HHQB 5SWZB 3BESR 3HZYB 3SN6N 2SEBA 1PIGA 4J3OD 3MCKA 1DQQA 1OTUD 1X9UA 3E8VA 3IETA 4N5EC 4P5SA 4H20L 5C08A 1QR1B 1EAPA 2EEBA 3IDGB 3N44F 1IRAY 3WIFA 3MRJA 1EZUA 2BXZA 5JHDE 3ZT7A 3OX8B 4XO3A 4KXZH 5KBMA 5J4MA 4M5YL 4JG1H 3WNMA 3L7EA 2DQEH 2Y9RT 3L9YA 5HYQB 4RNRA 3X14B 1DQMH 4ZZFA 5FAAA 4WI6A 3WI9A 5DD0L 1ZTMA 3OHMB 3ROLA 4Z7NB 5IKCA 1N8ZB 1WA0X 3FT3A 5I2IA 2KLRA 3WGVB 1TSHA 2EYRB 3RWJA 3HMXA 3C6SA 1C5CL 1ET8A 3VUAA 3KM1A 3E7JA 4LU5H 4KHXL 5EU6D 3ILQC 3LD8C 3MRHB 3NYKA 4FXGB 4Y2OB 2Q6WB 4XN2A 3SE9H 2B1HL 1CI5A 2PN5A 3UC0L 3ZUCA 2W0LA 2CMRH 2YRZA 4G6JL 1GRWA 3LZLA 3ATFA 3K6FA 3B2MA 3TBVB 1IKFL 2VDMH 1LO4H 1PX3A 1WBZB 4NO0D 2OK0H 4ONFH 3K6SA 3QZPA 5B3SB 2EIKB 1U6AL 5JQ6H 2R59A 4U1LA 4LIQH 1D6VL 4XXWC 1NCOA 3DA0A 4QGTA 1N59A 1XSKA 2G2NA 4PW9A 1CT8A 2DMKA 3PNWB 1J9QA 4EN2A 2FWSA 1WFJA 4I0CC 4UNIA 4PB0L 1YQVL 3ARGD 1L6XA 2FLMA 4PSRA 4OIFA 3H7LA 1DO5A 1XZ0A 3HG1D 4F7CB 1A1NA 4PP1C 4M6AA 1AGDB 4DKEL 1JFHA 2EIEA 1KNOB 1ZEAH 2P5EE 2X6AA 5C0RH 4RCAA 1MG3C 3D1MC 1E27A 3GHBL 3VTAA 4EKJA 1CLZH 3BT2H 1KULA 3SKMA 4Z7UF 2HP4A 1J1OH 2VSKB 2WBJB 3GLDA 4ZMNA 3B2DC 2W1NA 4KMTL 1WFTA 1NWOA 5DZJA 1N6QH 4N6RA 4NXKA 4QRRA 4QOKB 5FYJE 1M3JA 5D1XA 3DECA 5D4JA 4OJDH 1GYWA 1KPRA 2IC2A 3U46B 5L6YL 3BUTA 1AGBA 2AV7B 2XNAB 1O6SA 5E7FA 5AYUL 3TTSA 4CN4A 4R0LB 1HZHL 5SX5K 4LCYB 5BO0D 3V9EA 1W15A 2BRRH 4JHZA 2Z65C 3K4ZA 2D7OA 4A55A 4P3CH 2W9LA 1DLFH 3B2UD 3JZYA 2YPLA 2CBPA 1FNGB 2O5ZH 1ILSA 2PYEA 4NUMA 2P5WD 2A9AA 3CH1B 1NM4A 5KSUB 4ICWA 3BAXA 4NQQA 3BIBX 5SV4A 4ZPTB 5EU3A 4PVLA 5C0CA 3RWFB 4M3KB 3U1SL 3IFOA 4G6KL 2EDEA 4HU2A 2B1OA 3KS0J 1LP9B 3OMAB 4GQ9H 3U9PH 2FJGB 3WELA 1PKOA 3WNOA 1E3ZA 1MFEL 1UH4A 3JSSA 3F5WA 3BVNA 5KWYC 4V1DD 5E5UB 1JWMB 1MJUL 1PL3A 1XHHA 2HH0H 1MFAH 5DMIH 2NUPB 3V6OA 3W56A 4KAQL 1ZSDB 3I6SA 5AALA 3WFCL 4NC1C 3KDMA 4YSRA 5E2TH 5MERB 3QP3A 4NP9A 4CBZA 1M7XA 1F4WH 2JLPA 4MJJA 4V33A 4BZ1L 1KJMA 1RSFA 4FI8A 1MAMH 3S8WA 2Y6SD 2A6DB 3TBSA 4Y16D 3ATDA 4HWZA 1A6VL 2EH8L 1M4KA 1YYCA 3QZNA 5L4JA 1IC0A 3C8HA 3FPXA 2DV6A 1NFIA 4P2YA 1IKNC 1QUPA 1XH1A 4XNYH 4ELMB 3D0VA 4ZOAA 1U2YA 2JJUA 2RHEA 2UWEB 4G80B 5I23A 4MXVE 4IDLA 3CHSA 4N2KA 4N2IA 1QFWI 2OJZH 2OTPA 2H2PC 3KPOA 4IK6A 3MQIA 4UT9H 3VVVA 3D5OF 3QDMD 2HFFB 1KEMH 3GJEA 4LL9A 3I6KB 1BQRA 4Q2ZB 2GK0A 1UUSA 4JM4H 2W9EH 2BS9A 3F6JA 3W2DH 4P2OA 5HDBF 2HB0A 2F0CA 5T5FL 3QB7C 3GMLB 4FFZH 3FOLA 4PRBB 4GW4B 2V7NA 4UQIM 1G7PA 1CL7L 4Y5XB 1I7ZB 3ETBJ 5CSZA 1MFCL 3B2VL 4FA6A 3MR9B 1CFSA 1TJIL 5JQIB 2ICCA 2DLFH 4XVSH 4LCCC 3A4DA 1ZCRA 4UNUA 3NSCA 1FVEA 1J05A 1U3NA 4KY2A 2M26A 3WUZA 1SNRA 1XVSA 4GUQA 2VJ0A 5JHDA 4BDVB 3VDCA 2F58L 1M42A 3K72A 3LQZA 2GTWB 3H6JA 1HILB 1RZIB 1HINH 3APFA 5T3XL 3MJ7A 5F7EH 2Y69B 4PJBA 4QXTB 5LAXB 4WI7A 4GEIA 4HK0B 2K3TA 1MRDH 5GSRB 3DX0A 4L4VD 2QQLH 4PJ9D 2FJHB 4XHJD 5KOMC 2D2OA 1JV5B 1YYMH 1KPUB 4OT1H 4WTWA 2WXLA 1OGPA 1GMIA 1HCVA 1E28A 1AXTL 1FRGH 1U8HB 3L5JA 5I8KL 3WHXB 3FFDA 1I31A 2BSRA 2Y1AA 4YSPA 4RSVA 1BVKA 3GJFK 3T0EC 2BNQD 1IAIH 3U7YH 1HQ4A 4HMDA 4A7TA 5L2KA 2CUIA 2PW2B 3GSWB 2A73B 2EIBA 4RAHA 3HA0A 3L7FA 5JW5A 5I0DA 3FT9A 4PTTB 1QSED 1P4LB 3GK8H 5IBLC 4L8DA 2VLLB 4TUUA 4MDRA 5IG7A 2ZSWA 2ZP0T 3C9NB 4A2HA 4I1PA 2EADA 4PLKC 2NY4C 1TEFA 1KSRA 3KEHA 4Z0XA 3LNGA 1SVBA 4MAUH 4P5TA 1AS8A 1G0XA 1KLGA 5ID0A 4AENA 4JY5H 4KJYA 1OGAB 5FYLH 1BD2D 3L1OH 3TIEA 3VFSB 1YN7B 5D7LA 3SD5A 4FTDA 2YEQA 1SXAA 3ZDYE 2NY2C 3K80A 5JIPA 3CK0H 3MI6A 3U7WH 5IHZA 2BZ7A 2P8PB 4AJYV 2R4RH 3G5YB 3KCPA 4KFZC 2ORBH 5D1QB 4YVNA 4Z6AT 2ZG3A 5DVNA 4A2DA 4HFWB 4XP4L 1QO3B 1AMYA 1KXHA 2WVVB 2XXFA 5AYTA 1TU2B 4LCWB 5E5MB 5C71A 1QLEH 4FQQA 4W70A 1XCTA 5IV2B 4JO4H 2JKJA 5A1AA 1BAFH 3GS0A 4AH2B 3T08A 1LQSR 1SJHB 3FB8A 2EE6A 3LQMA 1FE8L 2R1XB 2X4RA 3LAFA 3SPJA 4F8OA 2XIIA 1Z6JT 2XPYA 2ZCKH 4LOEA 1T5XB 2XACC 1HXKA 3D85B 2B39A 2C3VA 3WFDL 1D5BB 4N8VG 4L8CA 4PB9L 3O4OB 2Y5QA 4NQCD 3S37H 1N2RB 1AQKH 3DOHA 4HD5A 3QFDA 5FM5O 3UTTD 1HHKB 4LVNC 2B9AA 4XNZC 1YRKA 6TAAA 3VRIA 1G4RA 5K5YA 2J2ZA 4UBDC 5DUBB 1H15A 1JGDA 2O5NA 4N0FB 3S36X 4FZEH 3DXAB 4B7IA 1A7RH 2HMID 3SQRA 2ZWSA 4UNTA 2X2IA 4GXVH 4XO4A 3NTCL 4D0BB 5I19H 3S5LB 2VSCA 1VCAA 2WLNA 2G9HA 1BEXA 3B3BA 4L5FH 4TLTA 4ETYA 3CG8A 2YKLL 3NCJL 2FGZA 4DUVA 4ZX4A 2AI0H 4PV9B 2I69A 2IFFH 3LRHA 1MCQA 3MV01 1ZT4A 2OXHB 3WAKA 2AEPH 3HMXL 4PEEA 2EIZB 2PTTB 1V3LA 4EIUA 2Q7YA 4UU9B 4JKMA 3RY5A 4YFLI 5BQ7B 2BCKA 3ZTNL 5DO2C 2FNWA 3DWTA 3IE9A 1JZ8A 3HVNA 3BUQA 2YC1B 1UT2A 3Q6GL 5AOJA 1R47A 3CXFA 2NRDA 3EUUA 4KXAA 2VR4A 1TITA 2WINA 3P9MB 3FU6A 4FQ2H 4X9IA 5ABZA 5IMOB 3KJ4C 4JL1A 2QHLA 2Z9TA 4LPYA 3AY4A 2V2XA 3D07A 4OUUA 4WY7H 2DM7A 4L3EB 2WXRA 3PU7A 4WNQA 2IGLA 3BVTA 5IESH 4WKZB 1UM6H 3W9DB 4TS6A 1G84A 3VX0A 2OKMA 4XB3A 3DV4B 1WBXB 3ZE0E 4EIGB 2ID5A 4I3SL 1TVHB 4DEUA 4HUVB 4O4YL 1JUFA 3OKNA 4CRPA 4CC1A 2JCCB 1MCLA 5HHXH 1C1EH 2CKBH 4FL4B 5E1AB 4LRNL 3L4XA 4X99B 2F5AL 1ZGLB 1VENA 4N85A 3RWIA 4OFVA 3MLTB 1LLAA 2O5XH 3TEZA 4RGNC 3KYKL 3AU0A 3LHAA 3V7MA 8FABA 2F8VA 4M43L 5DLLA 4N90D 4NKQB 4DJMA 5AVXB 2RGSA 3Q43A 4N0YH 3F04A 5HGBB 3OB8A 3QJFB 3TNMA 1SOKA 3AT0A 1U2HA 4DEPC 3P3TA 4YLBA 3KJ6L 4PCKA 3BAEL 4OM1H 3K7UA 3QEGL 4OFDA 5EUKB 3VGFA 1Q9OB 1FLRH 3G6DL 1PFCA 2G5BB 2MTPA 1IC7L 5H2BA 2B4CH 2WPGA 5DFWH 4AYGA 2NX5D 5CEZD 5IIEB 4O2CA 5L4FA 1LNUB 1R5VB 3PFQA 1IEAA 4HJEA 3CSPA 1AOHA 2ZUTA 4FJYA 3ZGIA 5HYFA 2K8MA 5I16B 4Z7VF 1MCNA 3UGXA 1GSKA 2HLAB 4PHXA 1DVZA 1GTNA 5CLTA 4YGVA 1OM3L 2PMZA 4R7NB 3QEQE 3N50A 3BWUC 2E75C 2JJSC 2QQQA 1T80A 3L5WB 1NEZB 3QQXA 2KPNA 3RWGA 4XPAL 3VI4B 3V4PB 3DURB 4K9EH 2BFGA 5I9QB 1Q9KA 3BP6A 2N56A 4AIXA 1FORH 4MBOA 2NYYC 5C0IA 4JO3L 4I2XA 1T5KA 3X3FL 1QFOA 2Y36L 4LLMA 3UAJA 3PP4H 1RZFH 3MRNB 4ZQKB 2ESVD 2NDGA 2Q3XA 5BVPL 5I66B 1KGCD 1U3YA 1CD1B 1IZKA 3MV7B 4HF5H 3SDDC 5FWQA 1JHTA 3OHXC 5IHBA 2JVUA 1IAOB 4PJAB 4Q9RL 3GLAA 1IM9A 3HZ3A 4IKNA 3CZSA 4PIBA 4F80A 1AQDA 2JTYA 4EZLA 3EBHA 2YD3A 3F05A 3ZU8A 5AB2A 4Y19D 2Z6FA 5TQ2L 2X1XR 2X4SA 2YRBA 3CZGA 5C07B 1I4FB 3OKOB 3OB0H 1CFVH 2X4QA 4M29A 4YAQA 1RP9A 2H6PA 4HWUA 4HWBH 1MHHB 1KGIA 5FKAA 3EJPA 1HOEA 3DTUB 4FJZA 4A6YA 5DFTA 1KIUA 3ARDA 4PGEA 1AOZA 4XOBA 4RWHA 4UDUA 5C8JA 2OXGA 3BFWA 2DQUL 3S36L 4LPVA 6PCYA 5T3ZH 3P3RA 2EEDA 2XG5A 3MOAL 1XH3A 4RMRA 4XZUB 3VSTA 3L2LA 1YYLL 1XCXA 4PWKA 4A2LA 5IMKA 3T0EB 3CVHA 3GNMH 4EI6A 2FX8H 5G5DA 4KNSA 5BW7C 1MVUB 1UTDA 4L1TA 3LKRB 3UACA 2CJ3A 5F21B 4K15A 4ODWB 5EC2B 2X38A 5DC9B 4PV1C 4N2DA 5DMGD 5JXAL 1JOIA 3HE6A 4JNXA 1IJ9A 4A2MA 3CZEA 3DMMB 5E0QA 1Z9SA 4D8OA 5D9SA 3EZJB 1TKWA 1WAAE 2VDQL 3MAWA 2IFGA 3KYOA 5D8JL 4DN3L 4F33A 5IJKA 5FCUL 3CLEL 1NDMB 2X7LB 1MI5E 3CCHB 1LYQA 3FQWB 1KXQA 3RE0A 4LP4A 4IBUA 2GTQA 3M88A 3DVGB 1INQB 2CRZA 1E9QA 3KZ8A 1XIWB 3GBDA 1WDAA 1N5YL 3WE6B 4GRLA 4XNBA 1JPSH 5D2LF 4MAYC 4AKQA 2W88A 5DJCA 1TJGL 5HGDB 3WMQA 2CO6A 4DKFL 1RK1B 3QWOA 5A6MA 4IDJL 5DRWA 4H88H 1M9WA 3KGRA 5DD6B 2K0RA 2DWDA 3MGOB 4M61A 4ZS7H 1JGLH 2WZPA 2AW2A 4F7EA 3O9WC 4K73A 3WNJA 1CFTB 2X5PA 4FHBD 1GZQA 4GS7C 4Z77A 2ZPKL 3SGDH 5I1IH 4YDJA 1TG8A 4NO2B 1A6UL 1NJ9B 1YQ2A 1GGCH 1YEDA 5I1JH 1KELH 2G2RB 4JFPB 2VLMD 4FQCL 5J12C 2YQ2A 1N7MH 1EVTC 5C09E 5T1DH 4HZLA 4KZCA 1I7TB 4J39A 3ZE2B 1UD6A 3VXPB 3JV6A 4B41A 3B7RL 5KSAD 3VAEA 4D3CH 2B1AL 5D2NE 1RJZB 2XWRA 4GRWB 4LNVA 4Y4KD 3OGCB 1Y6MR 3V10A 3BE1L 3SDCB 4NQEA 4FKEA 3THMH 2UXVA 1MFBH 2X1QA 4P5KB 3QH3A 2GAZA 2OX5B 3WY4A 1F97A 2HYMA 4MQ7A 1I3RB 4PRNB 3LNIA 5FA4A 2R29A 3IDNB 1YN6A 1HAWA 1KV7A 4TQHA 5TE6L 3S5ZA 3IJSA 2IG2L 3PWLA 5DD5H 5DD3L 3CLFL 3GI9L 1GHFL 3AS1A 1QSZA 1E40A 3DYPA 3O11A 4DTGL 1GW6A 1DBKH 1CBVH 4JFYA 4AZ8B 2ADIA 3NACH 4MQSB 2H9GB 4E9LA 4EBQH 4QRQA 2BPBA 2QLYA 2ZX5A 1Y1UA 2C1PA 4Q7DA 3B6SA 4HISA 1HFUA 4XMKL 5ANMB 4HJIA 5DI8B 4AIEA 3ZYZA 2YAPA 3QJSB 4PLJC 5IROD 1IGML 1X44A 2HTLD 5C9JA 2OP4H 5ICZB 3F2LA 2CBTA 1F6AB 5C2BH 1LQBC 4AG4L 3IFLL 1A6TB 1OCRB 2ZNWA 3OR7B 4HG4J 2AJUL 1P4BL 4ZSOA 3EFFB 4HX1A 3M17A 4GAFB 4LRIA 3U1PA 3C60A 1OGTA 1YY8A 4XAWL 4N8VA 1KENL 1S9WA 2X12A 5F7DB 4D7BA 1UKTA 4J7RA 2Y7QA 4CVWA 3TJHC 4ZTPH 4IU3B 3DX6B 2BVPA 3QJQB 4GINA 4V1DE 1DBJH 3DK0A 4X5PA 3F7VB 3GB7A 3AM8A 5D1XC 3CZKA 4WFGD 5HJ3B 3P11H 1OEZW 4NENA 4I48B 4APXA 4RGOH 5F7LB 1A7OH 2FGWH 1IAIM 5ABDE 4Q0XL 2NLJA 4LSPH 5D72L 5E9