4ME7E

Crystal structure of bacillus subtilis toxin mazf in complex with cognate antitoxin maze
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
ARTEMKISLPENLVAELDGVAMREKRSRNELISQAVRAYVSERTTRHNRDLMRRGYMEMAKINLNISSEAHFAECEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of mRNA Recognition and Cleavage by Toxin MazF and Its Regulation by Antitoxin MazE in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords mRNA interferase EndoA
total genus 24
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01402 RHH_1 Ribbon-helix-helix protein, copG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 4me7E00
1U9PA 2WVDA 1Q5VA 3VEBA 4FXEA 4HV0A 1B28A 2K29A 2H1OE 2WVEA 2WVCA 3VW4A 2GPEA 2BJ1A 1BAZA 2BJ8A 2BNWA 2BJ9A 1ARQA 1B01A 3FT7A 2CADA 2JXGA 2BSQE 1BDVA 2RBFA 1NLAA 2BJ7A 3GXQA 2WVFA 4D8JA 2CAJA 2HZVA 2CA9A 1MYKA 1P94A 2BA3A 2CPGA 2JXHA 2K1OA 3LGHA 3FMTA 1X93A 3H87C 3QOQA 4ME7E 1MNTA 2BJ3A 1MYLA 2KELA 3VEAA 2AY0A 1EA4A 2WVBA 1QTGA 1PARA 2HZAA 2CAXA 2K6LA 3OD2A 1BDTA 2K9IA 2JXIA 1ARRA 2K5JA 1IRQA 2BNZA
chains in the Genus database with same CATH superfamily
2WVDA 4HV0A 2UUWA 2K29A 1B28A 2WVEA 4MJWA 2UUTA 4AAIA 3H5XA 3FT7A 2JXGA 2JBVA 2BSQE 3NAHA 3GXQA 2WVFA 3UR0A 3NNEA 2JXHA 1X93A 4LQ9A 4ME7E 3NAIA 4LQ3A 2HZAA 2WK4A 1BDTA 2KOEA 1Q16A 3UQSA 4O4RA 2WVCA 4LRVA 2BJ1A 2BNWA 3SFGA 2RBFA 4D8JA 2CAJA 3QIDA 1P94A 3LGHA 3UPFA 1OG7A 1SH2A 1MNTA 2H3AA 2AY0A 2K6LA 2Q2KA 3NO7A 2A2BA 2K5JA 1IRQA 2BNZA 2H1OE 3VW4A 2KKEA 1BAZA 2BJ8A 1SH0A 2BJ9A 2CKWA 3IR7A 3BSNA 1NLAA 2AN7A 2CA9A 2CPGA 3FMTA 3H87C 1MYLA 2WVBA 1SH3A 2CAXA 1OHNA 3BSOA 4NRUA 1U9PA 1Q5VA 3VEBA 4FXEA 2GPEA 3H5YA 1ARQA 1B01A 3G5OA 2CADA 1BDVA 2BJ7A 2HZVA 1SIWA 1MYKA 2BA3A 2K1OA 3QOQA 3LJPA 3SFUA 4NRTA 2B43A 2BJ3A 3VEAA 2KELA 2ADLA 1EA4A 1PARA 1QTGA 3OD2A 2K9IA 2JXIA 1ARRA 4QPXA
chains in the Genus database with same CATH topology
1U9PA 2WVDA 1Q5VA 3VEBA 4FXEA 4HV0A 1B28A 2K29A 2H1OE 2WVEA 2WVCA 3VW4A 2GPEA 2BJ1A 1BAZA 2BJ8A 2BNWA 2BJ9A 1ARQA 1B01A 3FT7A 2CADA 2JXGA 2BSQE 1BDVA 2RBFA 1NLAA 2BJ7A 3GXQA 2WVFA 4D8JA 2CAJA 2HZVA 2CA9A 1MYKA 1P94A 2BA3A 2CPGA 2JXHA 2K1OA 3LGHA 3FMTA 1X93A 3H87C 3QOQA 4ME7E 1MNTA 2BJ3A 1MYLA 2KELA 3VEAA 2AY0A 1EA4A 2WVBA 1QTGA 1PARA 2HZAA 2CAXA 2K6LA 3OD2A 1BDTA 2K9IA 2JXIA 1ARRA 2K5JA 1IRQA 2BNZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9P A;  2WVD A;  1Q5V A;  3VEB A;  4FXE A;  4HV0 A;  1B28 A;  2K29 A;  2H1O E;  2WVE A;  2WVC A;  3VW4 A;  2GPE A;  2BJ1 A;  1BAZ A;  2BJ8 A;  2BNW A;  2BJ9 A;  1ARQ A;  1B01 A;  3FT7 A;  2CAD A;  2JXG A;  2BSQ E;  1BDV A;  2RBF A;  1NLA A;  2BJ7 A;  3GXQ A;  2WVF A;  4D8J A;  2CAJ A;  2HZV A;  2CA9 A;  1MYK A;  1P94 A;  2BA3 A;  2CPG A;  2JXH A;  2K1O A;  3LGH A;  3FMT A;  1X93 A;  3H87 C;  3QOQ A;  4ME7 E;  1MNT A;  2BJ3 A;  1MYL A;  2KEL A;  3VEA A;  2AY0 A;  1EA4 A;  2WVB A;  1QTG A;  1PAR A;  2HZA A;  2CAX A;  2K6L A;  3OD2 A;  1BDT A;  2K9I A;  2JXI A;  1ARR A;  2K5J A;  1IRQ A;  2BNZ A; 
#chains in the Genus database with same CATH topology
 2WVD A;  4HV0 A;  2UUW A;  2K29 A;  1B28 A;  2WVE A;  4MJW A;  2UUT A;  4AAI A;  3H5X A;  3FT7 A;  2JXG A;  2JBV A;  2BSQ E;  3NAH A;  3GXQ A;  2WVF A;  3UR0 A;  3NNE A;  2JXH A;  1X93 A;  4LQ9 A;  4ME7 E;  3NAI A;  4LQ3 A;  2HZA A;  2WK4 A;  1BDT A;  2KOE A;  1Q16 A;  3UQS A;  4O4R A;  2WVC A;  4LRV A;  2BJ1 A;  2BNW A;  3SFG A;  2RBF A;  4D8J A;  2CAJ A;  3QID A;  1P94 A;  3LGH A;  3UPF A;  1OG7 A;  1SH2 A;  1MNT A;  2H3A A;  2AY0 A;  2K6L A;  2Q2K A;  3NO7 A;  2A2B A;  2K5J A;  1IRQ A;  2BNZ A;  2H1O E;  3VW4 A;  2KKE A;  1BAZ A;  2BJ8 A;  1SH0 A;  2BJ9 A;  2CKW A;  3IR7 A;  3BSN A;  1NLA A;  2AN7 A;  2CA9 A;  2CPG A;  3FMT A;  3H87 C;  1MYL A;  2WVB A;  1SH3 A;  2CAX A;  1OHN A;  3BSO A;  4NRU A;  1U9P A;  1Q5V A;  3VEB A;  4FXE A;  2GPE A;  3H5Y A;  1ARQ A;  1B01 A;  3G5O A;  2CAD A;  1BDV A;  2BJ7 A;  2HZV A;  1SIW A;  1MYK A;  2BA3 A;  2K1O A;  3QOQ A;  3LJP A;  3SFU A;  4NRT A;  2B43 A;  2BJ3 A;  3VEA A;  2KEL A;  2ADL A;  1EA4 A;  1PAR A;  1QTG A;  3OD2 A;  2K9I A;  2JXI A;  1ARR A;  4QPX A; 
#chains in the Genus database with same CATH homology
 1U9P A;  2WVD A;  1Q5V A;  3VEB A;  4FXE A;  4HV0 A;  1B28 A;  2K29 A;  2H1O E;  2WVE A;  2WVC A;  3VW4 A;  2GPE A;  2BJ1 A;  1BAZ A;  2BJ8 A;  2BNW A;  2BJ9 A;  1ARQ A;  1B01 A;  3FT7 A;  2CAD A;  2JXG A;  2BSQ E;  1BDV A;  2RBF A;  1NLA A;  2BJ7 A;  3GXQ A;  2WVF A;  4D8J A;  2CAJ A;  2HZV A;  2CA9 A;  1MYK A;  1P94 A;  2BA3 A;  2CPG A;  2JXH A;  2K1O A;  3LGH A;  3FMT A;  1X93 A;  3H87 C;  3QOQ A;  4ME7 E;  1MNT A;  2BJ3 A;  1MYL A;  2KEL A;  3VEA A;  2AY0 A;  1EA4 A;  2WVB A;  1QTG A;  1PAR A;  2HZA A;  2CAX A;  2K6L A;  3OD2 A;  1BDT A;  2K9I A;  2JXI A;  1ARR A;  2K5J A;  1IRQ A;  2BNZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...