4ME7E

Crystal structure of bacillus subtilis toxin mazf in complex with cognate antitoxin maze
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
78
structure length
78
Chain Sequence
b'ARTEMKISLPENLVAELDGVAMREKRSRNELISQAVRAYVSERTTRHNRDLMRRGYMEMAKINLNISSEAHFAECEAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords mRNA interferase EndoA
publication title Structural Basis of mRNA Recognition and Cleavage by Toxin MazF and Its Regulation by Antitoxin MazE in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Hydrolase/hydrolase inhibitor
total genus 24
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01402 RHH_1 Ribbon-helix-helix protein, copG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 4me7E00
2WVDA 3VEBA 2CPGA 3GXQA 2KELA 3VW4A 2WVCA 1PARA 2HZVA 1BDTA 1MYLA 1MYKA 2WVFA 2BNWA 2BNZA 3LGHA 2JXIA 1B01A 2JXGA 2WVBA 3FT7A 3FMTA 4ME7E 2H1OE 1NLAA 2BJ9A 2BJ8A 2GPEA 2RBFA 1U9PA 2CADA 1ARRA 1BAZA 2JXHA 1QTGA 4FXEA 2CA9A 2CAJA 2WVEA 3H87C 3VEAA 2BA3A 1ARQA 1MNTA 1B28A 4HV0A 4D8JA 1Q5VA 1EA4A 1P94A 2AY0A 2K9IA 3OD2A 2K1OA 2HZAA 1IRQA 1X93A 1BDVA 2BSQE 2K6LA 2BJ1A 2K5JA 2BJ3A 2BJ7A 3QOQA 2CAXA 2K29A
chains in the Genus database with same CATH superfamily
2CPGA 3NAIA 2KELA 3VW4A 2AN7A 1B01A 2WVBA 4ME7E 1SH2A 2RBFA 2GPEA 1BAZA 3NNEA 3VEAA 1SIWA 2KOEA 2AY0A 2K9IA 3OD2A 2K1OA 2BSQE 1X93A 3G5OA 2H3AA 2BJ7A 2CAXA 1SH3A 3GXQA 3UR0A 1Q16A 1PARA 2WVFA 4MJWA 2BNZA 2JXIA 2JXGA 1NLAA 2BJ9A 2UUWA 2CA9A 2CAJA 1MNTA 3UPFA 1OHNA 2K6LA 2BJ3A 2K29A 2WVDA 4LRVA 2HZVA 1BDTA 3QIDA 3BSOA 1MYLA 3SFUA 2ADLA 2UUTA 3BSNA 3UQSA 3H5YA 1SH0A 4LQ9A 2H1OE 1OG7A 3H5XA 2CADA 1ARRA 2JXHA 3SFGA 1QTGA 2WK4A 3H87C 2BA3A 1B28A 4HV0A 4D8JA 1Q5VA 3IR7A 1EA4A 2KKEA 4QPXA 1BDVA 2K5JA 2A2BA 3QOQA 3VEBA 2WVCA 1MYKA 2BNWA 3LGHA 4NRTA 2Q2KA 3FT7A 3FMTA 2CKWA 2BJ8A 1U9PA 4NRUA 3NO7A 4FXEA 2WVEA 4AAIA 1ARQA 3NAHA 4O4RA 4LQ3A 2JBVA 1P94A 2HZAA 1IRQA 2B43A 2BJ1A 3LJPA
chains in the Genus database with same CATH topology
2WVDA 3VEBA 2CPGA 3GXQA 2KELA 3VW4A 2WVCA 1PARA 2HZVA 1BDTA 1MYLA 1MYKA 2WVFA 2BNWA 2BNZA 3LGHA 2JXIA 1B01A 2JXGA 2WVBA 3FT7A 3FMTA 4ME7E 2H1OE 1NLAA 2BJ9A 2BJ8A 2GPEA 2RBFA 1U9PA 2CADA 1ARRA 1BAZA 2JXHA 1QTGA 4FXEA 2CA9A 2CAJA 2WVEA 3H87C 3VEAA 2BA3A 1ARQA 1MNTA 1B28A 4HV0A 4D8JA 1Q5VA 1EA4A 1P94A 2AY0A 2K9IA 3OD2A 2K1OA 2HZAA 1IRQA 1X93A 1BDVA 2BSQE 2K6LA 2BJ1A 2K5JA 2BJ3A 2BJ7A 3QOQA 2CAXA 2K29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WVD A;  3VEB A;  2CPG A;  3GXQ A;  2KEL A;  3VW4 A;  2WVC A;  1PAR A;  2HZV A;  1BDT A;  1MYL A;  1MYK A;  2WVF A;  2BNW A;  2BNZ A;  3LGH A;  2JXI A;  1B01 A;  2JXG A;  2WVB A;  3FT7 A;  3FMT A;  4ME7 E;  2H1O E;  1NLA A;  2BJ9 A;  2BJ8 A;  2GPE A;  2RBF A;  1U9P A;  2CAD A;  1ARR A;  1BAZ A;  2JXH A;  1QTG A;  4FXE A;  2CA9 A;  2CAJ A;  2WVE A;  3H87 C;  3VEA A;  2BA3 A;  1ARQ A;  1MNT A;  1B28 A;  4HV0 A;  4D8J A;  1Q5V A;  1EA4 A;  1P94 A;  2AY0 A;  2K9I A;  3OD2 A;  2K1O A;  2HZA A;  1IRQ A;  1X93 A;  1BDV A;  2BSQ E;  2K6L A;  2BJ1 A;  2K5J A;  2BJ3 A;  2BJ7 A;  3QOQ A;  2CAX A;  2K29 A; 
#chains in the Genus database with same CATH topology
 2CPG A;  3NAI A;  2KEL A;  3VW4 A;  2AN7 A;  1B01 A;  2WVB A;  4ME7 E;  1SH2 A;  2RBF A;  2GPE A;  1BAZ A;  3NNE A;  3VEA A;  1SIW A;  2KOE A;  2AY0 A;  2K9I A;  3OD2 A;  2K1O A;  2BSQ E;  1X93 A;  3G5O A;  2H3A A;  2BJ7 A;  2CAX A;  1SH3 A;  3GXQ A;  3UR0 A;  1Q16 A;  1PAR A;  2WVF A;  4MJW A;  2BNZ A;  2JXI A;  2JXG A;  1NLA A;  2BJ9 A;  2UUW A;  2CA9 A;  2CAJ A;  1MNT A;  3UPF A;  1OHN A;  2K6L A;  2BJ3 A;  2K29 A;  2WVD A;  4LRV A;  2HZV A;  1BDT A;  3QID A;  3BSO A;  1MYL A;  3SFU A;  2ADL A;  2UUT A;  3BSN A;  3UQS A;  3H5Y A;  1SH0 A;  4LQ9 A;  2H1O E;  1OG7 A;  3H5X A;  2CAD A;  1ARR A;  2JXH A;  3SFG A;  1QTG A;  2WK4 A;  3H87 C;  2BA3 A;  1B28 A;  4HV0 A;  4D8J A;  1Q5V A;  3IR7 A;  1EA4 A;  2KKE A;  4QPX A;  1BDV A;  2K5J A;  2A2B A;  3QOQ A;  3VEB A;  2WVC A;  1MYK A;  2BNW A;  3LGH A;  4NRT A;  2Q2K A;  3FT7 A;  3FMT A;  2CKW A;  2BJ8 A;  1U9P A;  4NRU A;  3NO7 A;  4FXE A;  2WVE A;  4AAI A;  1ARQ A;  3NAH A;  4O4R A;  4LQ3 A;  2JBV A;  1P94 A;  2HZA A;  1IRQ A;  2B43 A;  2BJ1 A;  3LJP A; 
#chains in the Genus database with same CATH homology
 2WVD A;  3VEB A;  2CPG A;  3GXQ A;  2KEL A;  3VW4 A;  2WVC A;  1PAR A;  2HZV A;  1BDT A;  1MYL A;  1MYK A;  2WVF A;  2BNW A;  2BNZ A;  3LGH A;  2JXI A;  1B01 A;  2JXG A;  2WVB A;  3FT7 A;  3FMT A;  4ME7 E;  2H1O E;  1NLA A;  2BJ9 A;  2BJ8 A;  2GPE A;  2RBF A;  1U9P A;  2CAD A;  1ARR A;  1BAZ A;  2JXH A;  1QTG A;  4FXE A;  2CA9 A;  2CAJ A;  2WVE A;  3H87 C;  3VEA A;  2BA3 A;  1ARQ A;  1MNT A;  1B28 A;  4HV0 A;  4D8J A;  1Q5V A;  1EA4 A;  1P94 A;  2AY0 A;  2K9I A;  3OD2 A;  2K1O A;  2HZA A;  1IRQ A;  1X93 A;  1BDV A;  2BSQ E;  2K6L A;  2BJ1 A;  2K5J A;  2BJ3 A;  2BJ7 A;  3QOQ A;  2CAX A;  2K29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...