4ME8A

Crystal structure of a signal peptidase i (ef3073) from enterococcus faecalis v583 at 2.27 a resolution
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
117
structure length
117
Chain Sequence
SIKKPQRFDIIAFPSPRNGQRVAKRLIGLPGETVEYRDDTLYINGVSLSEDYLASAKRNVSKNENYTQDFTLETLEATQSLTVPEGMYFVLGDNRPRSDDSRYFGFVKQASVEGVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a signal peptidase I (EF3073) from Enterococcus faecalis V583 at 2.27 A resolution
rcsb
source organism Enterococcus faecalis
molecule tags Hydrolase
molecule keywords Signal peptidase I
total genus 27
structure length 117
sequence length 117
ec nomenclature ec 3.4.21.89: Signal peptidase I.
pdb deposition date 2013-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 4me8A00
3JSOA 1JHFA 1UMUA 3IIQA 3JSPA 2FJRA 1JHCA 2HO0A 1AY9A 2FKDA 3BDNA 1KCAA 1JHHA 4NV4A 2HNFA 1I4VA 1F39A 4ME8A 4K8WA 1T7DA 1JHEA 3S04A 1B12A 3K2ZA 1KN9A 4N31A
chains in the Genus database with same CATH superfamily
3JSOA 1JHFA 1UMUA 3IIQA 3JSPA 2FJRA 1JHCA 2HO0A 1AY9A 2FKDA 3BDNA 1KCAA 1JHHA 4NV4A 2HNFA 1I4VA 1F39A 4ME8A 4K8WA 1T7DA 1JHEA 3S04A 1B12A 3K2ZA 1KN9A 4N31A
chains in the Genus database with same CATH topology
3JSOA 1JHFA 1UMUA 3IIQA 3JSPA 2FJRA 1JHCA 2HO0A 1AY9A 2FKDA 3BDNA 1KCAA 1JHHA 4NV4A 2HNFA 1I4VA 1F39A 4ME8A 4K8WA 1T7DA 1JHEA 3S04A 1B12A 3K2ZA 1KN9A 4N31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JSO A;  1JHF A;  1UMU A;  3IIQ A;  3JSP A;  2FJR A;  1JHC A;  2HO0 A;  1AY9 A;  2FKD A;  3BDN A;  1KCA A;  1JHH A;  4NV4 A;  2HNF A;  1I4V A;  1F39 A;  4ME8 A;  4K8W A;  1T7D A;  1JHE A;  3S04 A;  1B12 A;  3K2Z A;  1KN9 A;  4N31 A; 
#chains in the Genus database with same CATH topology
 3JSO A;  1JHF A;  1UMU A;  3IIQ A;  3JSP A;  2FJR A;  1JHC A;  2HO0 A;  1AY9 A;  2FKD A;  3BDN A;  1KCA A;  1JHH A;  4NV4 A;  2HNF A;  1I4V A;  1F39 A;  4ME8 A;  4K8W A;  1T7D A;  1JHE A;  3S04 A;  1B12 A;  3K2Z A;  1KN9 A;  4N31 A; 
#chains in the Genus database with same CATH homology
 3JSO A;  1JHF A;  1UMU A;  3IIQ A;  3JSP A;  2FJR A;  1JHC A;  2HO0 A;  1AY9 A;  2FKD A;  3BDN A;  1KCA A;  1JHH A;  4NV4 A;  2HNF A;  1I4V A;  1F39 A;  4ME8 A;  4K8W A;  1T7D A;  1JHE A;  3S04 A;  1B12 A;  3K2Z A;  1KN9 A;  4N31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...