4MEJA

Crystal structure of lactobacillus helveticus purine deoxyribosyl transferase (pdt) with the tricyclic purine 8,9-dihydro-9-oxoimidazo[2,1-b]purine (n2,3-ethenoguanine)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
167
structure length
167
Chain Sequence
MKAVVPTGKIYLGSPFYSDAQRERAAKAKELLAKNPSIAHVFFPFDDGFTDPDEKNPEIGGIRSMVWRDATYQNDLTGISNATCGVFLYDMDQLDDGSAFEIGFMRAMHKPVILVPFTEHPEKEKKMNLMIAQGVTTIIDGNTEFEKLADYNFNECPSNPVRGYGIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glycosylation of a tricyclic purine analog at alternative sites by nucleoside 2 -deoxyribosyltransferases
rcsb
source organism Lactobacillus helveticus
molecule tags Transferase/transferase inhibitor
molecule keywords Nucleoside deoxyribosyltransferase
total genus 52
structure length 167
sequence length 167
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05014 Nuc_deoxyrib_tr Nucleoside 2-deoxyribosyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.450 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mejA00
2IZ7A 4P5EA 4U1RA 1YDHA 3O8OA 2PMBA 2NX2A 2A33A 5AJUA 2F2TA 3SBXA 4LJKA 2A0KA 3MAJA 2IZ6A 2Q4DA 4FYKA 3GH1A 4MEJA 3IMKA 4FYIA 3EHDA 2F62A 4JENA 4FYHA 3F5MA 4I4IA 1S2DA 4RH3A 1S2LA 4P5DA 4I36A 2IZ5A 6PFKA 4OHBA 4I7EA 4MCJA 3O8OB 2Q4OA 2KHZA 1S3FA 1F8XA 3HNOA 1ZXXA 3OPYA 4PFKA 4JELA 1T35A 1MTOA 2F67A 3QUAA 4KXLA 2PFKA 5AJTA 1PFKA 3PFKA 4NPAA 4WL0A 1S2GA 4LJRA 4JEMA 1F8YA 3K2QA 1WEHA 1WEKA 4OHRA 3UQZA 4KXNA 2F48A 1KZHA 5ITSA 1S2IA 4LJLA 3O8LA 2KLHA 3OPYB 4KXMA 2HIGA 4A3SA 1RCUA 2F64A 3BQ9A 4HX9A 3U39A 3O8NA
chains in the Genus database with same CATH superfamily
3MWDA 4RPJA 1Q2XA 4EKNB 1I01A 2VF7A 2CXNA 4EOGA 1HKUA 5AVZA 4XLLA 3EIQA 2WKQA 1ZRSA 3UHOA 4EYEA 5H3LA 1N36B 1NXOA 3MJDA 4D80A 3UJBA 2D4AA 4LXQA 1WZIA 3O84A 5DHUA 4TMWA 4RZ2A 2G8LA 3O94A 3QJGA 4ER7A 3MCWA 4LJKA 4QPCA 3U80A 1KEWA 1M1XB 4LJAA 4D79A 4DLTA 5FPKA 1YS6A 2PLFA 3ND9A 3WYCA 3EZXA 4C7OB 3DZDA 4X60A 3OQ6A 5DYTA 4RH1A 2JPDA 4FLMA 2OFFA 1T5LA 3NVMB 4UCQA 3BL6A 3IT0A 5JNTA 3C3XA 4H3SA 1COWA 4FEAA 1TNDA 3R44A 3CNEA 3ZE6A 5KDLA 1A7UA 2VDLB 3WKDA 3ADKA 3V6LA 3AI1A 2VJBA 3IAHA 4DNOA 2NUTA 1BJRE 3OZFA 4Q02A 3NOQA 5DZSA 4LVOA 4YUYA 1ISPA 3OAAD 2Z6QA 5LZ4A 3C24A 2OZEA 3MT8A 2FWNA 1BXRB 1Q14A 3DTVA 2IU4A 4J0EA 1PD0A 5ANRB 3LX8A 3NP9A 2XMCA 3C5WP 1CZHA 2IEAA 3T3PB 4DSTA 4P4UA 3H1TA 2GNAA 1L8QA 5CYGA 4A16A 1XUOA 1OKKD 4JC8A 4UHCA 1KY3A 3SXUA 3X1WA 1RQRA 3F6SA 2ZEJA 4U6QA 3EULA 1CY4A 3ML1A 4PRZA 2XDQB 3TRHA 3JR3A 3KL2A 4TMVA 1S3IA 2E82A 3EVAA 3PUYA 5TQ2B 4Q1VA 3WXBA 5IT9A 2FKAA 1GADO 1OWMA 4HF7A 1S1MA 1IZ0A 2XBUA 1DU4A 1XNRB 4OHYA 1IPEA 4BNVA 1II8A 3PDIA 2DHCA 4K9OA 3Q2OA 2M6KA 1ZO8A 3I01A 4RVHA 1L4UA 4FT4A 1X7WB 5AM4A 4KUGA 4OM8A 5KX5A 1DAGA 3O8BA 1ST2A 2I1WA 2H1CA 4AXXA 3IOBA 4KRXA 1YL6A 4LRWA 3RRZA 2HGSA 1UJCA 2XCIA 2ZSIA 5TXGA 1FEZA 5T4EA 4KB5A 4NBRA 3WK7A 4B35A 1LBSA 4D81A 3FNBA 5AW3A 2FW7A 1AGNA 3REOA 1LWOA 2J7PA 2O48X 1UKCA 1DKNA 2P2NA 3GRCA 4KYVA 2D1TA 3SYMA 4X94A 4WBNF 1ORVA 1ST3A 2REXB 4L15A 4ZJPA 4OPMA 5JD5A 2G7MC 2FW6A 4EW2A 5CBPB 2P6PA 1OBHA 4OI2A 4PPFA 3DPUA 3UT0A 1KKMA 2XRMA 3HGTA 2C3YA 3MILA 2H6EA 3AR9A 4HXYA 4TM7A 2J07A 4YMLA 3AHJA 3NM4A 5EWJB 5FPSA 1FYXA 3UXEA 1BGXT 3LQ2A 3E18A 3ILXA 1YZNA 4KIGA 4LSWA 4NJMA 4WN9A 1JHDA 2XNCA 2ZZKA 3DUWA 1RLUA 3ESZA 3OLQA 4IQ8A 4M0KA 1DMRA 1RAEA 4RD1A 3NJ8A 4M0EA 3QWIA 4ACAA 1V11A 2JK0A 2OAP1 3GCWA 5F9HA 1GRCA 3B2QA 4BRSA 5HKAA 3IJEB 1G3QA 4FS8A 5C8YF 3FTFA 3T3IA 1K7SN 1FXUA 1W96A 2ZUVA 4W6QA 2QAGC 2OBXA 1XAHA 3REGA 4JVSB 4AM8A 3CH5A 4WLOA 1WPGA 5IKEA 3FDFA 1C3JA 1PS0A 1UXJA 1USUA 1RHJA 3RBZA 3U4MA 1E2BA 1ESMA 3A9UA 4NPHA 3PUXA 1ZM2A 1YKGA 4Q1FA 2MDTA 1E1CA 1Q0LA 3IVAA 1O58A 5KJFA 4PRYA 5KTNA 2JRLA 2BBTA 2QYOA 4ME6A 3ENKA 1XRSB 4MA4A 3B51X 1ZHHA 3QKSB 1T4CB 2FMFA 4KX5A 1IIRA 1TMOA 5BYJA 4DV5B 3N5KA 3CTPA 4C01A 1Y6QA 5F76A 4IGFA 1XP8A 3AM3A 1E1QA 3AHGA 4IVPA 1M9NA 1D2AA 1N7HA 2HFJA 2P79A 2TECE 3C3YA 2VHZA 3PR1A 2O4UX 3G5LA 2QTNA 3OFJA 1YDGA 5E95A 5LBUA 5CDHA 5I7VA 2NZWA 4O4IF 5ISMA 2WYWA 3T34A 1WLYA 1NYLA 3IAUA 2AK2A 4J0IA 4F3KA 4B0PA 4P08A 4FR5A 3EXAA 2A86A 4O33A 4QDUA 5MGBA 1NDHA 4LPSA 1UBFA 2FG7C 1Y98A 1UZLA 5JBIA 1F60A 2YS7A 3GXBA 1CUDA 1OFTA 4H7FA 1Z3IX 3I6IA 4YBRA 4I1OA 4PS1A 4CN9A 1P74A 3VOBA 4HJRA 4GI3A 2GN1A 4CTJA 3INTA 1O0CA 2Z6UA 4PGHA 4CDRA 1STOA 2WYHA 4OSPA 1TJ4A 2GBLA 1ZGJA 3QVLA 2UUOA 4UMDA 4A0SA 3Q7TA 4O4JA 1BWQA 2DETA 4HEQA 1CZNA 2WLSA 4ZAFA 1YACA 3FLAA 4OGFA 1V7PC 4MB2A 2CGEA 4QM7A 5KO2A 1IEVA 3DM5A 2P2YA 3IIKA 1WE2A 4QATA 2HMUA 4HDRB 1ULHA 4JD5A 1CIVA 3I1FA 4UBMA 1AKEA 3R7AA 5FA8A 3WLHA 1QR2A 1JWAB 3ANSA 1ZN8A 4G5GA 1KAHA 4CCSA 3ZNQA 4XRRA 4OU4A 2DWQA 4P53A 4WXEA 3S8EA 3OZWA 1LX6A 5K8CA 1SD2A 4MPRA 1WUIS 1L5MA 4MWZA 4CF7A 3DQPA 4E7OA 1GQRA 1CS4C 1KZ9A 2BRUC 2CB9A 4Q4JA 4PYMA 2ATVA 3OICA 4RZHA 2MYUA 2PXCA 2FOXA 1MC1A 3NC4A 1P29A 2CZQA 2WKSA 3T35A 1SCJA 4JBWA 4DLNA 2WF5A 2PGNA 3I45A 3KWJA 3MCVA 3C6MA 3W04A 2GBPA 2DQ4A 2PH5A 2XGSA 3GRYA 1UM9A 1OXMA 2NVUA 5DYWA 1RLJA 1TLFA 1XX6A 3HA5A 2FMUA 2JD0A 3CURA 1PR5A 1W35A 2ZIFA 1JXOA 3FMFA 2FPGB 3N86A 1J99A 3KDPA 4GQAA 3S28A 4YCSA 3LT2A 2H5LA 1YI8A 3AKYA 1VI2A 2QW0X 1NVEA 2IYSA 3B89A 1O97C 5K6AC 1OGIA 3G0DA 2QLMA 2ZWOA 3EFHA 4J0FA 3E03A 4K9DA 1P6XA 4G1EB 4WACA 2VJPA 3S40A 3ESDA 1WKVA 2UV8A 1PV4A 1GL7A 1J5PA 2AGVA 1DAOA 2LBPA 1C3VA 3SSOA 2JGNA 2R1ZA 4NDAA 4LOLA 5CUQA 1B6GA 2JFXA 2YJ3A 4IW3B 4MUHA 3MVEA 1JRLA 1RWKA 3DMTA 5I7SA 1MZVA 2EJVA 3H2YA 4L0DA 3NPAA 1O77A 3KHUA 3V8BA 3JAWB 1QIJA 3OO1A 4KR2A 1JFVA 3DW1X 3F1KA 3SQLA 3MD9A 2OV2A 2VK4A 3N39C 4U7TB 5DKFA 2VP0A 5AXCA 5HJ2A 3N76A 3RHSA 3LC0A 2P65A 2A59A 4U2BA 1Q1AA 1XKTA 1KBOA 2C88A 4EFLA 1NE7A 5JAIA 1T2CA 4KO8A 1WV1A 4GPTA 5B58T 2OTCA 3J81k 3AJ8A 3E8XA 2UVDA 5BUSA 5EWLB 4KQEA 4U63A 3H16A 4YQZA 3CUWA 2X5OA 3LQ1A 4TKUA 2G83A 3QE0A 5DX0A 3CGGA 2AVDA 2VXBA 2WG1A 4O4IA 3H6HA 3HJBA 1Y8AA 2C9OA 2R4UA 5EFZA 2CLLB 2OQVA 4XWKA 4PV7A 3SZOA 1YRHA 2OZLA 2ZG6A 3AR3A 2BLLA 5LWHA 2FP3A 2GZDA 3DO6A 3I42A 4IIXA 5AVOA 5C5IA 1SUFA 5DXJA 3JSXA 2Q3DA 3ZDCA 3NCTA 3KXKA 4AJJA 1ENPA 2HPHA 2VATA 3EVEA 3L0YA 2FZGA 1A4IA 4Z1OA 4O4JF 4JH0A 4EJMA 4HUQA 1LW7A 1RBMA 2P9CA 3D4LA 1W5EA 1G59A 3L8ZA 1B0AA 3LP5A 3MWFA 3RYHA 5TNXA 4DXHA 1K63A 1VSVA 1P5RA 2AN1A 2FEKA 2Q4OA 3N58A 2R1VA 4EY8A 1XPJA 2G3YA 3TRIA 3R0IA 4PBRA 3H0KA 4BHTA 5FIUA 3DJFA 4LF7B 3NO4A 1U3WA 3PCXA 1VJCA 4L0CA 1NQXA 5B2ZA 3T4UA 1M34B 4OMUA 4R0NA 4QDXA 2XT0A 4INZA 4PCAA 2OQRA 1X2EA 1A9XA 4N12A 4JJZA 5FUMA 1RPAA 1MDFA 4EF5A 5JNWA 3V7UA 1LI5A 2H31A 1O95C 1YA4A 1TT5B 2F90A 2BEWA 1ZPDA 3WYDA 3WQSB 4BFTA 4X5OA 4YPVA 3KOOA 2OQIA 1A8UA 4DN6A 4GI2A 1ZOSA 2Y9MB 4IEFB 1EH5A 3PVSA 2ZK7A 3CLKA 3ZV5A 1EXVA 3ER9A 4C7BA 3QWFA 5LA6A 4IQ0A 4WCDA 1I6KA 5KOJB 1PT6A 3N7TA 4OH1A 2FFHA 1OFVA 2BEUB 2A9JA 3DG9A 4GOXA 3VO8A 4XQCA 1ZRHA 4R1SA 1Z08A 4UU1A 3E1KA 1SU8A 4V1CA 4FLEA 3OTQA 1N0HA 2ZS7A 2LUOA 1E64A 4D0LB 4U7GA 2I78A 3ZW9A 1SVWA 4FXPA 1GG5A 5C31A 3P5BA 3DUFB 3WMEA 2V7GA 1AKTA 3U3XA 4ZEMA 4XH9B 1TAGA 3GJ8A 2ON6A 4FOPA 2EYQA 2OVBA 3I3OA 4RA6B 1DXQA 5CCEA 3KJZA 5AH0A 3F7TA 2AJBA 1APBA 2PRIA 4ERXA 2IX9A 3COYA 3Q8WA 2D7DA 4NABA 5JJBA 1TQ2A 1VL6A 4J90A 1XA4A 3CZCA 1C7ZA 2I4TA 4MV4A 5F52A 3ZDYB 3E61A 2FZ5A 3PC3A 1UP7A 1HF3A 2R6DA 3EC7A 5IEJA 3BOSA 2J0SA 3OECA 4C22A 5KYNA 2WWXA 1ZK0A 5IN4A 3WNBA 2GN9A 2P90A 3H13A 1Z73A 4Y1EA 3JD3A 3RTGA 3SG0A 1WHTA 4BRZA 1Y82A 1CR2A 1CQIB 1T0PA 4PC3A 3ZD6A 4B73A 2C7OA 5LJIA 4B34A 4HNHA 1R8QA 5EIWA 1JQKA 3RYHB 1DTWB 3LUAA 1BXKA 2FPIA 1U0TA 2PLAA 3EXG2 2PYDA 3FR8A 4AF7A 1F4LA 3OFNA 1BDIA 1O5IA 2OCGA 2Q6VA 3UMSA 1B8UA 2GJ8A 3O47A 4HLUA 3K70B 3S1SA 4ARZB 5BQFA 1F48A 3RKRA 1RE0A 2YV3A 3QP9A 3EXHB 2OAEA 4C21A 1JZTA 2F9LA 3KB6A 4Z51A 3NKVA 1P1BA 2BIFA 1RQ7A 4UEKA 3CU5A 2Q3FA 3D6VA 4HDMA 1FJXA 1OR8A 4D1YA 5ALVA 4ZJUA 4FMCF 1JKJA 3UB3A 4O3MA 4P0QB 3GCXA 5K6RA 5CM9C 3VPSA 2VQDA 1G8MA 4KAXA 3CW9A 3KSRA 3KJGA 2D0DA 3JXEA 3PICA 2WLTA 4OHXA 4S3MA 4M2LA 4WVFA 4ZZIA 1V3QE 2J0VA 4XX0B 1XFAA 4WY5A 3T7CA 5DGIA 1OZ0A 3PITA 4B0OA 1A2QA 1OAAA 3IIEA 1SBYA 2Y0CA 3FNIA 3M4YA 4IHJF 4PQGA 4PZZA 4QPNA 5JCOC 1Q15A 1ZK2A 3O8RA 1M5RA 3B3QA 4D26A 1I36A 1SC3A 2GBLC 5C8VA 2UVPB 1K4MA 2WOOA 3Q72A 1MGPA 2Q7XA 4P54A 3IBCA 5EHIA 3MLEA 3N6XA 5EL0A 4BLOA 1BH2A 4D44A 4RHFA 4EI9A 2XWJI 3FBGA 1QH1A 1U7TA 3ETLA 3IAM6 5AJWA 3ZE1B 1SUWA 1U11A 1WR8A 1FU8A 3KQYA 1Z2CA 2QSZA 1REQA 2ODAA 3PGKA 4JI0B 5BSKA 2X58A 4MUIA 7MDHA 3M82A 2P40A 3ZZ1A 1GZHB 3BK7A 4JJIA 2ZUFA 5L7YA 3RJMA 1J25A 2XB4A 4BQRA 2DPLA 4HNRA 3PV0A 4YJDA 4LFAB 4PPQA 2Y66A 2Q5FA 2BDUA 4L7VA 4QDJA 5JVDB 4TT8A 4Z4HA 5E7IA 3RAFC 1E1RD 1Q20A 1LLCA 2JHPA 2WR8A 4FCVA 3RT9A 4E94A 5KDDA 2JEYA 4RVNA 3H5IA 3PCTA 1Z06A 3EIWA 1DQZA 1ZESA 3H05A 3QWHA 4MKHA 4OXIA 4R0MA 1GNTA 4FC7A 3WLIA 2BFDB 3W4KA 5BV2P 3BE8A 2ACEA 2CFCA 3MMNA 4FYPA 3Q9LA 2CHVA 4RV9A 4QHYA 3WMXA 4M8NE 4JEMA 3M1LA 5DNEA 4L5IA 2X8JA 3TSAA 2BZ1A 3IAAA 3P2OA 2BD0A 1XZCA 2ZGVA 5DX8A 1I3KA 2E0IA 1Z17A 3H42B 3IOEA 3M81A 2PXHA 4MV0A 3UQZA 4BFSA 4LJ5A 5TMPA 2D5AA 1LDGA 3IQWA 3DCYA 2AZTA 4H1HA 4DLRA 4BO4A 1ZJ4A 5AWFC 4RESA 3RVKA 2XZLA 4DSZA 4WW0A 1N9ZA 4HRAA 3SKVA 1DC4A 1SEPA 1CFJA 1ZGHA 1QSGA 3TB6A 1ODTC 1Z16A 5JCXA 2HIGA 1Q1NA 2NADA 4R2MA 4IS2A 3GAZA 3JATB 2WG0A 2C4VA 3LDFA 3CZ4A 1Z7GA 1SBCA 1GPWB 4DIBA 1RDFA 1EHIA 3Q3GE 1TYCA 2X3FA 3AHDA 1JHPA 1CR6A 3GCGA 1HO3A 2W2LD 2IXAA 3MB5A 3PE3A 2PKEA 5GTDA 3B85A 4L8YA 1E1CB 4X24A 1EX9A 1ZY2A 3H5OA 2ZIGA 4I9UA 3UT5A 5K7SA 1CNMA 2IHKA 4F6LA 2W6MA 3S0JA 2CYAA 5GONA 5JSQA 3D2CA 1PZFA 4C5CA 2A5FA 2XH8A 3FXAA 1J9EA 4QOIA 2AI2A 4LMRA 2J6IA 5JG7A 3FZEA 2PYIA 3EBOA 4UBNA 2QTBA 1VCNA 2B8JA 2AS0A 2B0CA 3D4PA 4BB0A 3AILA 4PLCA 4IR7A 5JBQA 1S7GA 1BU5A 1YJBA 1OT3A 2BDTA 3OI7A 3QJ5A 4LW8A 1KC3A 1PNTA 3GZ4A 4GPEA 3IXQA 4V0QA 2ECKA 1JDJA 3H2HA 3NTQA 1J09A 2CD7A 3Q9NA 3ROQA 2BT4A 2XCOA 4MS4A 2VT2A 2OB2A 3DM9B 3NEJA 1Z13A 4P3NA 4OL0A 3TTUA 1K7YA 5FAKA 3DEJA 4LDJA 5ARCA 4KW7A 2VDPB 4KUHA 4WZAB 5AXDA 2BSQA 1KO1A 1EFPB 2BGTA 1WDMA 4CM4B 5BPHA 1AVTA 2HYDA 2P0EA 3FIUA 2O2CA 2GEBA 3LVRE 3YASA 3K0KA 4CL8A 3P96A 2FSHA 1ISMA 5TGTA 2FX2A 4NV0A 4Z86A 1T13A 2HLDD 2WYVA 1M6YA 2INGX 3NWOA 4N9QA 5LQSA 3TM5A 3CVYA 3RFVA 5IABA 2ZRHA 4WY8A 5FWXA 3VBCA 4OB6A 5EJFA 4BB5A 3G1UA 4N76A 1KJIA 1ZQ1A 2XUGA 3A3YA 1TCUA 3KL4A 4IIYA 3QF7A 3PD7A 1TK2A 2RMKA 1PT8A 4UAUA 4P5PA 3VZBA 3U4HA 2OLJA 3GB9A 1I2DA 5ERYA 2A9QA 4GMDA 4TXJA 3IP9A 2H85A 4C05A 3GPLA 3STWA 1KYXA 3DLPX 4OYLA 1GGVA 1HY3A 2E4UA 4CKCB 3HBFA 3UN1A 4P4NA 2C9BA 2N47A 3OQMA 4TVOA 1E7MA 1ULSA 2YBEA 3G1TA 3WISA 3I52A 5HDBB 3LPDA 3FOBA 5HGXA 2BI8A 4NI5A 5EQJB 3LP6A 4DMCA 4HG2A 4F2PA 1T29A 1C41A 1KK1A 1G2OA 1UBGA 4LY0A 3SJZA 4TUYB 1ZM9A 1PWXA 2VJCA 2Q2VA 3AQ4A 3NUQA 1U94A 2Q5EA 3TLXA 4IX1A 4CMAA 3WYAA 1ACMA 3HN2A 4KO1S 4NPAA 3PUJA 4V1CB 3G9QA 4Q48A 5C9ZA 4JBNA 1CETA 1G8AA 1H3FA 2WTAA 3PFWO 4Y1RB 3K32A 1H2BA 2R5WA 1UC8A 2D54A 1PZEA 1MJNA 2N0SA 3JYNA 5G4LA 1BWPA 5KCZA 3EGDB 3PWZA 3V7NA 2ODPA 5KDOA 3O1IC 4JFRA 2OK8A 3VU1A 1ADYA 1OF1A 1H9BA 2OM2A 4J1TC 4DWWA 3RS3A 4EJSC 1YHNA 2PRSA 4BV2A 2Q3EA 2IUUA 4HVCA 4O4HB 2WTNA 1H9AA 3PUHA 3FBWA 1NKSA 5EA2A 2EJBA 3SSMA 3CZMA 3FCAA 1NDQA 3L4EA 1JIKA 1V71A 2WEKA 5A0TA 1N7JA 4WKOA 3WO0A 3RROA 1ZH4A 2BFCA 2O05A 2JGDA 2X0FA 3GBPA 4CE6A 4OMDA 3AOEC 3W2GA 2UXDB 2ZDGA 1G55A 3OWHA 1L8XA 5EOVA 2OCXA 3QX3A 3GYGA 4XUGB 1A7KA 5DX1A 1GYQA 1M6WA 2WINI 5AM1A 1YZGA 1AZSC 3GI1A 3I04A 2WDZA 1ZQ9A 2XSZA 1KIMA 3P27A 3RODA 3RVLA 1CZUA 1JQEA 3IP5A 3MOGA 5G3ZA 3ZJ5A 1RABA 3UQYS 1IBMB 4WLEA 2J6CA 3LL4A 3WSWA 2YWDA 1UZMA 1Z0AA 3VR3A 4GRIA 1KAEA 2VJOA 3IH5A 1SD5A 1YR9A 5BWOA 1UXKA 3EEFA 1XZKA 2A9KA 2GJKA 3PHJA 4I9GA 2F2TA 5HS6A 1AA6A 2H18A 3ZXXA 2XMDA 2Q29A 4E2WA 2PSDA 4LXYA 4PZEA 3L1UA 2ZIXB 1ZD5A 3BSFA 3KZOA 4G0MA 4GBED 5DLEA 5ARBA 4X3PA 3TL6A 1CLUA 1OJ7A 2LNDA 4O2BA 3ZWNA 1Y3IA 1CE8A 3WGIA 3MSCA 2C7QA 2BWJA 2MYPA 1RIIA 3LHKA 3VR6D 3VTFA 1MAVA 1CUVA 2EZUA 2VTDA 3EPKA 2KM1A 1L4MA 5KSWB 5JUWA 2QVBA 2RHJA 4I3HA 3HB4X 3GDGA 3WSTA 2X9QA 2WNHA 4JLVA 1U81A 2NP6A 3E5HA 2PQ6A 2YRWA 3AETB 1S2DA 1VP3A 4GOJA 4KMMA 4CM1A 5EJ5A 3SDZA 1YCFA 2ZJOA 3TBKA 2AQIA 1TZ2A 3HVJA 2RAVA 3BC1A 2VWQA 1G8KA 2JFQA 3AR6A 3GFQA 2CZCA 4FHCA 2H2DA 1B0ZA 3F0TA 3PUWA 3QVMA 1Q44A 4OGLA 4XAQA 2ZVQX 3Q7SA 3ZXSA 4CMHA 3GJRA 3R0QA 7REQA 2JRCA 4ZOLB 3HU1A 3DLHA 4X00A 2F43B 1WW8A 4TMYA 4QFCA 4QQ8A 1RM5A 1UAGA 3R3XA 2PUDA 2E87A 2I55A 2JFOA 4X92A 1M7GA 2CDBA 4UZSA 4BFXA 5G0SA 5SY6A 3AF4A 3WZ2A 3S2SA 5BMVF 4UM8B 1DT3A 3A3NA 4M83A 4MGKR 4MDEA 1DJNA 1GFZA 2NO0A 4KJXA 4WOJA 5DI3B 4F3YA 1B41A 2GESA 3R7LA 1EG7A 2ZYHA 1GRNA 5LPNA 2OORA 1OILA 1U0BB 2E37A 3Q3EA 2JD1A 3QG5A 1R0XA 2ADOA 2FPMA 2OCPA 2PUTA 2WWGA 3AFIA 2IWRA 4A91A 1VCMA 1NFFA 5C4MA 1MAWA 5IUKC 3UWKA 1K8ZB 2HU7A 2WDPA 4LJRA 3V1KA 3LWZA 4NARA 1ECGA 3BE6A 3LXUX 1H4QA 4ZGGA 1H2RS 5B7GA 2VPQA 2QMZA 3JU3A 1DO0A 1J0AA 5L3ZA 1SBHA 4BGVA 1H2HA 1Z39A 1KFEB 1NNLA 1E58A 2HSZA 3VHQA 1JV2B 4HB0A 4E51A 1Y5LA 2ZYTX 4OSOA 1H2WA 3B9PA 3EASA 3AFMA 1RBZA 3AH8A 5KTKA 2L17A 2NUPA 2R84A 2R7MA 3HCFA 3NBMA 3OCXA 3QX7A 2PKRA 2V8OA 2V6IA 4MR9A 2R2GA 1QS0A 2RHTA 3E7WA 4PX9A 1J8VA 3I6YA 4A3SA 4JUIA 4FOOA 1AURA 1IVSA 1R6DA 3GA0A 1R4MB 3CWCA 3S1AB 2AHOA 1U9YA 2VJAA 5G0WA 1ENZA 4LTMA 4RK0A 4AJ4A 3SR4A 4LBZA 2QR3A 1YCGA 1GTSA 1LLUA 1OH8A 1VL0A 5TSDA 4P22A 4P3KA 4FB5A 3IBSA 1JTEA 1ONBA 1P2DA 1AHHA 1XF9A 2I7VA 2IZ7A 4KQJA 4LFBB 5BWBA 4ND7A 3EVBA 1V4NA 1HT1E 4HWSA 1N32B 4Y6GB 6REQA 4N5NA 3ZLBA 3FPHA 5FTKA 2Y1GA 2OYCA 2EDAA 2YOFA 3A1NA 3WL4A 3ZWAA 4DSNA 4F6CA 3NAZA 3AM1A 1CS0B 3ABRB 4Z0TA 5IH7A 1CUXA 4FNMA 2G40A 2WWWA 3FSGA 1FQJA 3NTUA 1CJBA 3PP8A 3HN7A 3TLAA 1QO0D 1KKUA 5JE8A 2CYBA 3IE0A 3AVTA 2RC5A 4R3UC 3GGGA 4HFMA 5HFAA 3T7JA 2VUTA 5C8DA 1IZ8A 1XU7A 2C3MA 2YWBA 2V58A 3L6EA 3Q0EA 4YJ3F 4TUYA 1W93A 4UTPA 5EZSA 1E9AA 2HXYA 1ZOOA 5JJIA 4KWEA 3IKJA 5KYUB 2J09A 2VT3A 1YZKA 2GJ9A 2I29A 2J4DA 3MLBA 1JS1X 3OX2A 3U7IA 2XCRB 4QOEA 4EGAA 2VF2A 1E18A 1C3OB 2DR3A 1SKYE 2V4MA 3MF4A 2JD2A 3IE2A 3AVOA 3LP8A 4KXVA 1ESCA 3VGPA 1LBIA 1QQ5A 1NATA 4URFA 3NAQA 5JT1A 1ECCA 5EE1A 5EHZA 2IE8A 4OVKA 5ESDA 5HDQA 4AX4A 2MIIA 1Q3HA 2HXSA 3V4SA 3D2LA 4JB8A 1KK3A 1DWQA 1L5SA 2OZKA 1DRUA 2WPDA 2FSPA 5EHXA 3MMXA 4BJ1A 3A32A 3U1TA 3M0EA 4JGGA 2O5VA 6LDHA 2ANBA 3I12A 5AMXA 2R1VB 4GBGA 4IXDA 3HHEA 3N3BC 5FUYA 3AV3A 2A8YA 3OKCA 1MNAA 4N6NA 4IINA 3TBHA 1P5FA 1Z4LA 3QYJA 4QREA 3KELA 5CT4A 2OPHA 4ZFNA 3ZJYA 1W47A 3LXMA 4QT4A 4TYWA 1G7RA 3TPZA 4EUHA 3CV3A 3IDQA 1WXFA 3B3AA 4BO8A 4D9FA 2QPAA 2WABA 4AG3A 3PB3A 1C8LA 2HCRA 3KETA 1RQXA 5J2TA 4EG3A 1VHDA 1LBEA 1BN6A 1PLJA 1MB0A 1WPRA 2GZHA 3C98A 2XNDD 2WVGA 4HQRA 4ND5A 3RWMB 4HH3C 4DJJA 1F8YA 1RWXA 2X22A 4M54A 1P7CA 2VWHA 3F6YA 4NRDA 1CUFA 3HYSA 3LT0A 3B9BA 2I2AA 3DS8A 3O38A 3PFBA 2W0MA 1P0IA 4FR2A 4MUGA 3CUTA 2J5BA 3THWA 4LA4A 1SQGA 1E62A 4DG8A 4KREA 1X87A 3GVCA 4RZUA 3QITA 4ZPXA 1FC0A 5CLGA 1FVOA 2WAAA 2WTXA 5LXTF 4LS3A 3RC8A 3IAEA 2VYND 5DI3A 3G9UA 3E8MA 2QR5A 3PNKA 4HC4A 1KI6B 1NKVA 4HDAA 3A0RB 5CGQB 4DBVO 2GFQA 5CA0A 3L7CA 3U5ZB 3L2OB 1FRVA 1RYFA 2F55A 2RI1A 2IEZA 3M6LA 4PLWA 1IH8A 3BIOA 4TV8A 4IVQA 1I1OA 1JEQB 4J3NA 3IUSA 1WHTB 4KTVE 2BFMA 4EHHA 4X7RA 5EZYF 1OY1A 3EFEA 4OF4A 4E88A 3RDPA 3K5WA 5IYZA 2GO1A 1OAOC 3KXIA 3DBHB 3NIGB 3OAAA 1B73A 4UASA 3U7JA 3G9TA 5KNBA 4AUKA 4OQEA 4NAUA 3VYUB 3WL8A 3D8NA 1Q83A 1ZD2P 2FX3A 2HIAA 4OLFA 1GDDA 1S4QA 3SKYA 1X9IA 1U0OC 3QU4A 1ZUIA 2XQKA 1SA0B 5KI6A 7YASA 9LDTA 3I9V1 1XZGA 3ERCA 3KHSA 3UA4A 3WLJA 2RH8A 5KNDA 2OXIA 3TEFA 3A70A 1CRLA 1JEDA 1SVUA 2D62A 5FWYA 4NS4A 5CFLA 4PEVA 1T3SA 5A0FA 2YYZA 4IOMA 3I6MA 1G5IA 3O7MA 3TW8A 1FQOA 1KMMA 3FVWA 2UVQA 3MYRA 1JQ5A 3D6AA 1PNRA 3DD1A 1T1RA 3EHDA 4YJ3A 2WVHA 2H1HA 3IIMA 2GYYA 5CT8A 2TYSB 1XU9A 3RTCA 3WWYA 5KNCA 3OA2A 4Z0HO 4CF3A 5K3BA 3ZVKA 1HC7A 3UAOA 1T4CA 1HQCA 2ZBQA 1JYEA 4S1NA 4Y98A 4JYPA 3IHWA 1VHJA 5AKGA 1I13A 1M8GA 1O9BA 3SQNA 4EGJA 5LYJF 1QRTA 1AOXA 1J07A 1FMTA 1MPXA 1CB0A 4Y9DA 2BFAA 3TAUA 3VYTB 1RMTA 2MYTA 3E23A 3CRZA 1J0BA 5J2UB 3DVAB 4C4YA 2J9ZB 3DV0B 4RZXA 2CNBA 4QYXA 2BKEA 2DM6A 3VUEA 1QH1B 1W0JA 4GLFA 2ZLBA 1GG2A 2PL5A 4V03A 3RAPR 1MD9A 1V1RB 1RXUA 2RAUA 1KF0A 3HWX1 4AZ0B 1RJ9A 4YCJA 2ZQZA 3V4PB 2VDRB 1RQLA 2MCFA 3H9CA 2P1DA 3BHNA 2XUKA 3LM8A 4INAA 2EEPA 3RAJA 4FN4A 1EJ6A 1EMDA 1W87A 3CN9A 4AF6A 3IV9A 1Z7YA 4MVJP 2XCSB 3HVRA 3CIOA 3EZ9A 4ZV9A 1NZDA 1ZM3A 2VDKB 3G5AA 3MLAA 4G9GA 2K4MA 3AW8A 3I2GA 3HBMA 4L50A 4FNGA 4O4JB 1H8EA 4GLJA 2HMYB 3PQ4A 4JB3A 1PL6A 3C39A 5T6BA 5TVGA 2DKFA 4CLOB 4CIAA 4EJFA 2CSUA 1DGQA 1AF7A 3WTBA 1EJBA 3QOWA 2QMEA 3RHZA 4ZAXA 2XF2A 3DMRA 2G4VA 1E3IA 1S2GA 2Z95A 4DQKA 4S1TA 3ZGLA 4ANFA 3Q3VA 1MO3A 4LMBA 3Q7RA 1EUDB 5KTYA 3H4VA 1JLLB 1FVHA 4Y1RA 3ZLJA 4PWYA 1FMJA 1OW3B 3QNUA 4JSRA 3UAYA 1WVMA 2ERCA 2FWBA 3TAHA 1SUSA 3P2KA 4GLOA 2XLCA 4P36A 1SBTA 1CY6A 1E0JA 1WB4A 4ND2A 4PLGA 5AK6A 3IXMA 4L3VA 4BNIA 3FPSA 4Q39A 1VSUA 1Z4PX 2CE2X 4JUDX 4YRTA 2ZRAA 4TKVB 3RASA 1MHTA 3DF7A 5FFMA 1U65A 2Y9PB 2FF7A 4EJ0A 1RAFA 5DM70 1JDBC 2DBRA 3BZWA 1V41E 3I32A 4QOHA 4WA7A 5D3QA 4DCOA 5LIPA 1FUUA 1XYGA 5T4BA 3IVMA 4TV8F 3HKDB 3OJEA 2WWHA 2WB4A 2B7LA 1NMZA 4RPHA 4RIGA 1H2YA 4FWBA 4ODIA 2D1RA 2KMLA 5HVNA 1WRBA 3I8OA 4YMVA 2HFKA 3E9QA 3UH1A 2ATEA 4PRLA 4ER3A 1MHPA 3AY0A 2A5LA 1M2EA 4TS3A 4ZI3A 4NK5A 1CCWA 3ZGXA 1DAPA 1L5HA 2ISCA 4YJ2A 1P3Y1 1T8PA 4IIEA 1IPFA 1NN1A 3FVVA 3ET5A 3LWDA 3QUTA 3D3WB 5KB3A 5HMMA 2RJNA 3UK0A 2SCUA 1QAQA 2VSQA 3SHVA 1Y7HA 1S4MA 2IHUA 2PX3A 5J59A 1RLIA 3QKIA 4EBFA 4XCQA 1UCFA 4MQLA 3T94A 4D43A 2ZIXA 5FBVB 1UXIA 4MVYA 3AUAA 1JT9A 3F78A 1XAJA 4YN3A 4C7MA 3D8SA 2WVJA 3U6BA 1FTNA 3VOSA 3PDJA 1VKOA 5JAZA 1R9MA 1W46A 2HDWA 1JZSA 3EG9B 3O2SB 4WUTA 4RF5A 3OLVA 5EQDA 2JA2A 3TQOA 4NECA 2JJ8A 2X0NA 2W70A 1I5RA 4JCCA 5JXJA 1AA9A 1D03A 4TV9A 3N2LA 3COWA 4YDQA 2JCSA 1AN0A 4H27A 1E7QA 3EXIB 3ISJA 3KYCB 2PBLA 1BE0A 4Q7JB 4G2NA 3EGOA 2ZU6A 2YVLA 3C1AA 3IDSA 1W36B 4EX7A 2Q5LA 3QA3E 3FLMA 4R69A 4D9BA 4F86A 1QYWA 3QVWA 3WJ7A 3MWLA 5B1IA 4HLNA 1K06A 2P7HA 1IZ9A 3S8MA 3U3ZA 5BVHB 3QIVA 2O52A 3PPWA 5A04A 2PWPA 4PANA 5FBWB 1BS1A 1E2FA 2F3QA 1NRIA 2XNHA 4G63A 4JN6B 5M3BA 1PHRA 2IZ1A 2YINC 3VDQA 3QUBA 4K9RA 4HJXA 2R7KA 4BV9A 2D2FA 1CULC 1G8FA 1XIVA 3CCBA 2DUWA 1UZNA 4CM8A 2ALJA 2O23A 4GVLA 4UARA 1HOXA 3K8YA 1PJ8A 1UUFA 2HWYA 2ZDHA 1NRJB 3LHDA 3T06B 1QGAA 1XD9A 3LIPA 5DNWA 4ZEXA 4EHLA 5PNTA 3VC3A 3NEPX 2XZOA 4AIRA 1L7QA 5B1YA 1A97A 3A6EA 2F9FA 3AYXB 3DR5A 2GK3A 3JQ9A 3LOPA 4FJ1A 4ETIA 1P7WA 2ZRDA 3P8ZA 3W06A 4US0R 2O6LA 2WJJA 4WOCA 5JSZA 1U8EA 2G4CA 2WYIA 3QY9A 5KQSA 4WN9B 5EVCA 1V6AA 4QJ5A 1U0FA 1LI4A 4ZVNA 1G60A 1VG8A 4ZT5A 3WJAA 1G6OA 3D3WA 2Z58A 3N2GB 2JIZA 4M87A 1F2UB 4XSGA 4MINA 1UBKS 1V8BA 1LRLA 5JLAA 2WT8A 5D6OA 5EE0A 1L6IA 1KOFA 3LT4A 1QH0A 1A8IA 1L8AA 1NNEA 1IYZA 4GVPA 3ZHYA 2PO5A 1OX6A 2E55A 3U1VA 3TFOA 4MRMB 1TRKA 4ZAVA 1PI3A 4US1R 5CLJA 2GM4A 2O3TA 4NXMB 5EUMA 1EDOA 4D56A 2YJZA 3O92A 3UWMA 4MCHA 2XE4A 2VPIA 3IKMB 4GECA 5KUTA 2YWCA 3CISA 2JAUA 2ZSHA 3ZK9A 1T43A 2YY5A 4L8VA 3QKSA 4B9AA 4UQLA 3WLSA 4R1PA 4Z9AA 4D8UA 2ZTVA 2XB8A 4ENUA 1KPGA 5D87A 3BRWD 3GHYA 3H7IA 2R6CA 3P0JA 4E5MA 3ENVA 4HNAA 4CR8A 3PU6A 4AYXA 4WDRA 4A9AA 4YMUA 5BP7A 1F8GA 4FGZA 3I34X 2ILVA 1G8HA 2VEDA 4W1SA 1O03A 2XVXA 3M5DA 5L3QA 3AZOA 3BDIA 1PQPA 4U5QA 3PXCX 1HTWA 2ZULA 1OQAA 1MBZA 1YZTA 4KKVA 3ANMA 4QWMA 5IKOA 4D3XA 1R0KA 3FCSB 4Z2AA 2QPTA 4IRUB 2UAGA 4DGSA 1EYZA 1VLJA 2XVZA 2ZTUA 3FFAA 4Q24A 1XWIA 3T1VA 4DCUA 1QX4A 4O2BB 4Q4HA 2Q4DA 4TWRA 5IDVA 3I8SA 3HKCB 4FFPA 1F12A 1NT2A 2H2IA 3L0IB 1XD2B 3OCZA 3KJNA 4JY7A 3K9BA 4M4SA 1IM5A 4MGHA 3PUKA 4RD6A 5H16A 5DBGA 1NW4A 1HA3A 3S70A 2VCEA 3ENWA 1Y34E 3IOYA 4TV9F 3DWIA 7ABPA 1JAXA 5MN4A 1Z38A 1P45A 1A88A 1RHKA 2W2MA 3DAHA 3WIEA 2ZZNA 1CVIA 3AW9A 2XVAA 4EB3A 4F91B 5JSZB 4CQLA 5AP9A 5KJ6A 1Q0QA 2H2HA 1OGJA 2HJRA 3P4XA 3OO0A 3HYLA 2GTIA 2CNNA 3P9PA 4FZRA 4LG1A 4ZAWA 4F45A 4BPBA 1JEEA 2DLDA 3KQPA 4JYBA 4WKPA 1A9ZA 4FXOA 1TQDA 3AERB 3CUUA 4E6PA 3AP3A 4F3RA 5C37A 4H7IA 4M98A 5KWVA 3ILYA 3GLIE 2EKQA 1PQYA 3HMKA 4XIGS 4K3VA 3JCZA 3EW7A 4PAOA 2BE9A 4EW3A 1K08A 1MRNA 3IKTA 5HKOA 2H4XA 4CLHA 1QGUA 2BFBA 3DFUA 4K0RA 3UCFA 1L1EA 4ZRMA 1WB5A 2GM5A 2I1VB 4O59O 3DQZA 1XPUA 3MEQA 2JKZA 2XIJA 3GT4A 5FHQA 3M6WA 3OM8A 4D8WA 2RGDA 2EERA 1NN5A 5J63A 5ITWA 2C4TA 4OJTA 2RIPA 1W4ZA 1JFFA 1EFCA 2D5LA 2V7EA 3ETNA 5FTWA 5CCBA 1BO6A 4LZLA 3TNFA 4W5OA 1RYBA 4E5UA 4OHOA 3MFYA 2CV1A 1QVAA 3PXAA 1THGA 2GAOA 1WXXA 4B4OA 3TJRA 1GILA 1HTTA 3AEKA 1NW5A 4CMIA 2W6QA 3QI2A 2XXBA 3KXPA 1X15A 3JZMA 2E5FA 3MCZA 3DOOA 3K2QA 1FMCA 5FI3A 1DOAA 4BJ5A 1Q91A 1GPUA 4I4TA 2ZRLA 1V0JA 3E9CA 3LXRA 4FX5A 4FWTA 2VQFB 4KQCA 4YLYA 2VQSA 2DCMA 2WAYA 5JZ9A 2PZGA 3A9TA 4JBHA 4R2HA 4D02A 1TYEB 4GHWA 2VF4X 1VFNA 4EJ2A 2PIDA 4TSFA 5K8VA 1SKUA 2C5BA 1GSOA 4LF9B 4Z1MD 4MWDA 5E6UA 4NY1A 1P8AA 1GZ4A 4K9NA 4DG9A 3PGMA 1XEAA 3ZK8A 5CA0B 3LKDA 1GLGA 3TXAA 1VJ0A 2ZREA 1WXQA 3BQ9A 4OJNA 1W85B 3TBFA 5CPBA 2RGRA 2C96A 4UQPA 3GEPA 3KBOA 1JBEA 5IZCA 1FRFS 3PHCA 4KNWA 2FI1A 3GLSA 4FONA 5AJHA 1V43A 4QGFA 1GV0A 3U17A 1Z4NA 4BWYA 4GUAA 1W5AA 1SOAA 1NNSA 1G0NA 4LZPA 2NU8A 3T7SA 4MWBA 5BVHA 4XVUA 4O5OA 3HNPA 3CW8X 4D41A 2F00A 4NC9A 5BQXA 4ZT7A 1YC2A 4AL4A 4K9LA 4AS1A 4U7PB 5AHOA 4J07A 3BD9A 1T5IA 4OXQA 2NUPB 2JIPA 2QQGA 3I2YX 3M6XA 1SUIA 2JFUA 3X2EA 1J2RA 3NONA 4GBJA 2F1IA 3ITNA 4IX9A 2IDMA 3OQBA 3LHIA 5CVCA 5AJZA 2W48A 1NUUA 1MVLA 2I2BA 5I7AA 5IDYA 3VKUA 1ZH8A 1FMFA 2I7DA 5A4IS 4U2DA 5CYPA 3CUYA 5GV7A 3IMKA 4ETWA 2HCTA 4CQMB 3EPLA 1YR8A 3G79A 3GP3A 1RSZA 1WB6A 2JJ2A 1RD4A 3R5HA 2L82A 2CHUA 2ZR0A 2BTEA 2ZYIA 3ND5A 4PC6A 3PWKA 4X61A 2WY2D 1MX1A 4NH4A 5BT8A 3CRVA 4BFYA 3V3TA 4DV2B 3BZBA 4QHSA 4HNAB 4RZSA 2O7NA 2NQ8A 2OR3A 3H9UA 3A1SA 4XD7D 2X0JA 2ZRIA 4D9IA 3I58A 3HXTA 3KSMA 4ARUA 2ZSAA 1NY6A 1UJ6A 3PGA1 4Q9AA 3ZCSA 6PFKA 4Y6OA 5AKXA 2IXGA 1OLSB 4V38A 2V5VA 4HLCA 4UE3S 4TVSA 1GYPA 1Z29A 5FL3A 3ZTWA 4IJVA 2X5KO 4JR0A 2OESA 4OJYA 1AMNA 1VE3A 5CPFA 3T1NA 3SBDA 1HSOA 1D1PA 1P17A 3G85A 4KIUA 5I7OA 5DHSA 4KLAA 1K5HA 3ETCA 2YIMA 3ZUPA 1VCIA 3HUEA 3NC0C 2H1IA 2PFGA 3L1VA 2ZIVB 4G0YA 3SK0A 1P9WA 2YNMD 2Z1NA 5TF0A 3DW3X 2F9MA 1DKOA 2BJWA 5C53B 4D0SA 1J8MF 3WNZA 3KVRA 3C6YA 3FSGD 5K0NA 4F71A 1IVYA 5IXYA 4B48A 2YS6A 1N5KA 3EZ6A 1TZCA 1PFKA 1GG9A 1LRKA 1A9OA 3ZVNA 1G3MA 4ZOLF 1Q1GA 5DP1A 3PUVA 4BMVA 2JASA 4QXAA 2FP4B 4P33A 2HF9A 1XTTA 1GNSA 721PA 3T3DA 1L5QA 5DM60 5CB4A 2ZSJA 2IYPA 2ZDQA 4FBGA 1VJRA 3FDZA 1VL2A 1VBKA 3MUEA 2BFFA 1TD9A 1F1JA 4U0JA 2BEVA 2QOEA 2VNIA 4FBMA 1OV4A 4B32A 4DCSA 3HB0A 4KK4A 4YONB 3E9DA 4XIIA 4R6WA 1B2RA 3FDIA 3K1YA 4IGIA 3BD6A 4D96A 3KQWA 5DLYA 1LQUA 3WV5A 3EJWA 1XMPA 2VXCA 4UXJA 3IA2A 5I4IA 1JLMA 4B7AA 4GICA 3I6QA 3FBTA 3ORFA 2NWQA 4WXRA 1Z4OA 3LZDA 1ODKA 1TUBB 1CUGA 3K6RA 3L05A 1ISIA 2M9MA 3DOFA 1F7VA 3MWYW 3OJOA 3MQFA 1WA5A 1A9YA 1AUOA 2AKEA 1NFQA 2J46A 1Z5UA 4CL3A 4ZZ1A 4QXOA 3BYZA 2AEMA 1AV7A 2Y0BA 1THTA 1JJFA 3DBHA 3Q40A 4S0ZA 2WPNA 4XM2A 5B1SA 5ALYA 4YV1A 1HK7A 2ZS8A 3PT9A 3M4JA 4MS3B 2IT1A 2ZTMA 3JQ7B 1Z74A 4GL4A 4BX2A 1Q12A 4QYMA 1FS6A 1UJ4A 3NHJA 1T6NA 2GETA 4EIWA 5M7EA 1DHRA 1H5NA 3DB2A 4F9FA 3RJTA 3VNRA 2RB4A 3CHYA 3LPMA 1N7IA 4GXTA 1RC1A 2AX3A 1O87A 1P4SA 2Q4EA 3K3PA 3GDWA 3PNVA 1N5DA 1WU7A 4QUBA 1N2XA 2QTZA 4DIOA 3ZNPA 3KCQA 1ZG3A 1EQAA 3L7BA 3RFTA 2G9ZA 2NM0A 2QMHA 3K0CC 3UM9A 4RK4A 3ESYA 4HNUA 2GASA 4HTFA 5GVRA 1YQWA 1YVDA 1FYDA 3Q9SA 5KCMA 3PUIA 1XZAA 3MWEA 4FYIA 2FLWA 3THXB 2BUBA 3G7UA 1GPJA 2I76A 3D3QA 3CEMA 4TQGA 3EY4A 2HWKA 3REQB 3N2YA 5LA6B 1XTVA 2DHDA 3M6AA 4MVXA 1ULUA 2P1ZA 2OBMA 1V7CA 2Q5CA 3EEYA 4ON9A 5CW1A 1LS1A 1O0BA 221PA 1RAAA 1MORA 1KY2A 4B31A 1DWOA 1FBNA 4Q7MB 1ZGBA 1ZU5A 1Z2DA 3DDZX 5B37A 1O8CA 2P2DA 3F71A 1I1QB 1YONA 4BNNA 4KWIA 4UTRA 2V7UA 2G76A 5DBHX 1FDUA 1JL3A 3C6QA 3JALB 2QD1A 3FGNA 3FCXA 4L9RA 4KLZA 1CUZA 1V1RA 3KTAA 4CQMD 3JY6A 3LPCA 3WV4A 3TO5A 1SIOA 2PBRA 2Q99A 8ATCA 4CMEA 4TL7A 4D0RA 1UXHA 1A5BB 4GOKA 1ENOA 2GILA 2P6OA 3HO6A 1LZKA 4C29A 1TM3E 1WZEA 4TLLB 3WDMA 4L0QA 2C0CA 3DNMA 3IRVA 3AXSA 3A04A 2VHJA 2AD1A 1E2JA 1UINA 1YHZA 4IVNA 3JARB 4LIPD 1M0WA 1QBGA 4LNHA 2AOVA 1FW8A 3D6UA 4IP0A 3Q12A 3HFSA 4ZGWA 4C08A 1TB4A 1QGED 4HQLA 1BD4A 3L8EA 1M2FA 4AZ3B 4BAZA 1RCFA 2CBGA 3VSDA 1R37A 4WNIA 5E0KB 4JL6A 4X84A 4YROA 5ED0A 1TTHA 3G9XA 3PRHA 4RVCA 5EYPA 3ZI4A 3KKEA 4PO8A 1ETUA 1H3NA 2CL7X 5FL7D 1NQ5A 1XBTA 4Z5XA 1RXYA 1ZW1A 3EH1A 4Q00A 4TTPA 3FB4A 4CV3A 2A9OA 1TUGA 3QEJA 1KFBB 4F5DA 3QBTA 1K5PA 2HM7A 4ZEWA 4QTTB 1GAJA 3ICPA 1IBLB 1C30A 1Y9JA 2ZIWB 3EGCA 3V4LA 3C8DA 4ER6A 3QPVA 4F72A 2WF6A 3MJFA 2AJDA 3E5MA 4RHCA 3DDCA 4CV2A 1PK7A 3PEEA 5IJAA 5U4QA 2ZT6A 4BOYA 4C07A 3BCRA 2G28A 2YVAA 3E0XA 3GUUA 1ID8A 1UEJA 5KMGA 4K2AA 5DPMA 2UXBB 1HNNA 5EP4A 4BUCA 4XQ0A 1D2MA 2W6NA 3U3RA 4WCVA 5KSYA 3GLGE 3UICA 4BUZA 3K72B 5NULA 2PS3A 5F1OA 4UOEA 1VE7A 5D1NA 3PX3A 3ZJVA 5FT9A 1DTSA 1E66A 5H4HA 4DXAA 3BS4A 1COWD 1HMYA 1CDOA 3JQBC 4KRGA 3QNMA 1P0PA 1Y7PA 2JFHA 2QM3A 2HRCA 3G3EA 4GNRA 4OK6A 2NPFA 3ZE2B 4E4YA 4QTYA 2QP4A 4Z4FA 1RXEA 1D0SA 4NP6A 2G36A 2WK1A 1IFXA 3O8DA 3OEEA 3WWPA 3CKMA 3N28A 4EAQA 1UPFA 1YA8A 5DISB 3ROZA 2OUIA 3LX5A 3SYKA 2QI9F 1RYHA 3UJ6A 3FUCA 1JHMA 2HQRA 1VLQA 2ZR7A 5C8ZA 3A05A 4JIGA 3D7NA 4QBTA 3ENZA 1YHYA 4GOND 2FEWB 1K3FA 3BHJA 2WSSA 3USCS 2GM9A 4ZOQI 1QB8A 3L7LA 1UPCA 3A11A 1EHYA 2WUGA 2YX1A 3BF8A 3QVSA 4JP1A 2VAMA 1ZCAA 3E7FA 4NBSA 2D6FA 1CDDA 4PG7A 3F97A 3U0VA 2WM3A 3CYFA 4CHTA 3RHTA 4BX8A 5BT9A 5F9FA 4EB8A 3SBOA 3EF3A 3DAGA 3HWSA 3AL0C 1EUZA 1PDWA 3R3ZA 4U7HA 2UZ4A 1FYVA 3GDHA 3THYA 1AUVA 4ESEA 1NM5A 3OFND 1Z0JA 2VDQB 4LRYA 3X0DA 4AD8A 4Z49A 1MQ8B 4V2IA 4W1RA 3I1YA 3DE0X 4KQHA 1LPBB 4PCLA 1ZLXA 4RZQA 2QYSA 2OXTA 2EV9A 3QVTA 2O5CA 2RSLA 4M9CA 3NWEA 1M1NA 3H9JA 2EKPA 1GTMA 3L84A 3LDGA 1L6RA 3PDWA 2BHNA 1X42A 5JHHB 1EWVA 2QB5A 4EHAA 3K1AA 4A23A 1RAHA 3AR7A 4QYSA 1JHOA 1ZMRA 3C15C 3CX4A 4DE5A 1NW9B 3JW8A 1J5XA 5BNTA 2NTEA 1Z2PX 3GPDG 4DR6B 5TVKA 2VXYA 1OX4B 1RI3A 3FHLA 5BQ5A 3SE7A 1T9DA 4ZAZA 1EVLA 5EXXA 2NSLA 3F7NA 3R7WA 4Q18A 3ZWBA 2XNKA 1RXIA 4R2WA 3EEOA 3HXPA 4OHPA 4MDHA 1EWKA 1UPXA 3RTDA 5M04A 2VZ9A 4P6VF 5J43A 2UZIR 3G8BA 4W4TA 4UD6A 2FMTA 3WB0A 4P7FA 1IY8A 1GGKA 1Z8FA 2IKSA 1J0XO 2QRPA 4G4GA 5HF9A 4AT1A 4IDNA 4J1SA 5ALDA 3VVLA 2QQFA 3I5MA 2YUIA 3EZGA 1NBEA 2J08A 4R8VA 4R9SA 1SOMA 4ZYXA 4OK3A 1BN7A 2VHWA 3FWZA 3W6OA 3UATA 5G53C 4BFUA 5DI9A 5BWLA 1D6SA 1OD6A 3G2MA 2HDNB 5HQ3B 3INNA 5AIAA 3OC0A 3OEYA 6NULA 4RMGA 4RTOA 2GYVA 5A9RA 1Z45A 3B9RA 3BGSA 1XVUA 1Z5WA 2GK4A 4FD2A 3HADA 4QPPA 4G8JA 2YHIA 2Y2UA 3KOZA 2YMQA 4N8EA 4RSHA 5IULC 4BXOA 2OILA 1M66A 1AKNA 1FTWA 1V35A 4K1XA 2YNMC 2WAXA 4GI1A 3WL5A 5FUVA 1ES9A 2EKZA 1KE1A 3RLIA 2IEIA 2MR6A 2NX2A 4EZEA 5EHGA 3BN3A 3KUXA 1OLOA 4UEWA 2Z3WA 5IFLA 3GIWA 3E3MA 2XVYA 2DU8A 1KSFX 1NFRA 3IP7A 3EMVA 4MUEA 4MEAA 5AI0A 4L78A 5FP0A 2CLDX 1LLDA 2YZNA 1N1MA 3MWEB 4LUCA 5G02A 2EIXA 3JX9A 4A1OA 1XZDA 1W0CA 3N0TA 3EVGA 4MKRA 1C1DB 2A92A 1CUBA 3NBXX 4GRAA 4LWOA 3S29A 4K6KA 3V46A 4AY4A 4B71A 5HS4A 5HNKA 3IEUA 4PIVA 2HX1A 1RPJA 4J6EA 3IC5A 2N1BA 3TS1A 4E32A 2X8LA 3R3HA 2HLHA 3CF4G 3I83A 4X71A 2E3JA 2WUVA 3CCFA 2F62A 1KERA 1GRVA 2ZSEA 2B5VA 4FFMA 1WKCA 1XZIA 5EKXA 4A2PA 1T15A 1KFKB 2XHEA 2JJQA 5IJ9A 4JP2A 1Y63A 4UHHA 3PNBA 3R0JA 1V5WA 4GX5A 4M8IA 1R6BX 2IH4A 4A10A 4UBJA 1XCLA 2UUCB 4MW2A 3DL4A 5JQWA 4RQTA 4C6TA 1K7XB 4CEHB 2C0PA 3C3AA 4MPJA 2X3YA 2PGOA 5I7HA 3OPMA 1OUMA 2VIIA 1NQVA 1XK7A 1CX9B 1YQXA 2VPPA 3FI9A 3IPLA 4RJIA 5JVDF 3GJSA 3T61A 5M34A 1SRRA 1QQTA 2QUHA 2DSTA 3WHPA 1GVHA 1CQJA 1LA2A 2CJXA 4JLAA 3Q8MA 2FFRA 4C7XA 4FJ0A 4F4UA 2P4EA 4BEWA 3LRPA 4URUR 3VTKA 1YOBA 3U7EB 3OCJA 3AI7A 3P71T 4ZCIA 2Q9AA 5F2NA 2J41A 3RO7A 2AN5A 4R7ZA 2JFNA 3MINB 4GOLD 4JEHA 5G0VA 1TCVA 2Q8PA 3SIWA 4BMYA 2QL5A 5IN5A 2JDID 4KXLA 5AFSA 2P30A 1QHEA 3HUUA 3TRDA 4F85A 2NMVA 4JLMA 4CMEC 1ILEA 2QJWA 3IL2A 3SMQA 2FOLA 5BSGA 3VZRA 5JU6A 1IY2A 1NQWA 1W9HA 1XTQA 3WK9A 4NG4A 4PW0A 4R8RA 3G88A 3OEHD 2WFMA 5SYMA 4R1LA 1O6CA 1LLQA 3ANTA 4HQFA 1D2GA 1ZH2A 1T91A 1UFOA 2CB0A 1DKPA 2I8CA 4N54A 4WLNA 3TZHA 6YASA 5KQGA 1RXVA 1M5UA 3L0DA 4KKXB 3C5CA 2XMBA 3NT5A 5TPZD 2W11A 3CLUC 1B26A 3WBKA 1H3EA 3UJDA 3KEQA 5ER6A 3R9IA 1BC5A 1E6KA 2R6R1 1R0SA 3CH7A 4B6EA 5AESA 4IQ4A 4PYKA 1W1IA 2J85A 1YB4A 1NONA 2J3QA 2PVCA 1IOLA 1UOQA 3QSGA 5FQOA 5G41A 2DJ5A 1GN9A 3M3HA 1M2OA 5CVVA 3SZUA 1DQSA 1YZHA 2PQ2A 4XFKA 1A04A 5E2IA 3I92A 4RFVA 1IMJA 2JH3A 2OKGA 3STXA 1QHNA 2FPKA 2QRQA 3K05A 4BMXA 2JGAA 4CDMA 2GRAA 3A6ZA 4NMWA 3WGKA 4GPD1 5CXSA 1KJ9A 2A9FA 2F43A 2FR1A 2MHCA 1B93A 1ZSYA 1OT5A 2C03A 2VKQA 4XGRA 5M29A 3H5TA 3I4CA 5IVHA 3X1MA 3D6HA 4O0MA 3DXZA 2GDZA 4YI3A 1QV6A 2A33A 3D7KA 5EJ4A 2WJ4A 1NVVR 4DQ0A 1H2AS 4HFRA 4WKCA 3CRNA 1CFZA 5JIBA 3B6MA 4YLEA 1U98A 2J5RA 4S2EA 2HMWA 1KWKA 3BRCA 3T8YA 3C8MA 2FYTA 1H94A 3DDHA 1YR1A 3JASA 4D9CA 3GP8A 3ZW8A 1WWKA 3ZHUA 4FVTA 3MJTA 4MZDA 2C2BA 3AVPA 4RJTA 2Z2KA 1EUDA 1GA6A 3IO3A 3MINA 1GNVA 3PGLA 3REQA 3FUXA 4ASUD 1J8YF 1RHRA 3OU7A 4GVXA 3KKOA 3ICOA 2P4UA 2UYHA 1XGKA 4GEKA 2GERA 2UZ0A 4TT3D 3HCPA 1A50B 1ISHA 4GM4A 3JV7A 4WIAA 3NMUF 1NBIA 2JARA 2YNMA 1PZGA 1U5AA 3K35A 3NAGA 5CTJA 3SF0A 5EJ8A 3KKQA 2IP1A 2QSUA 3A9CA 4H77A 1JBQA 2XOXA 1UK7A 2LKDA 4UHKA 4AZSA 3OC6A 2QRUA 4D3SA 2JI4A 4RTJA 3MAGA 3PEVA 3WBBA 4I36A 4GDFA 2O1WA 3AF2A 4LCJA 2GNOA 3C16C 1NM5C 4IDAA 3K4HA 5JVDA 3ZV3A 5U4XA 4C4XA 4IH9A 2ANCA 3W34A 5EZ6B 2OPBA 3UOWA 4RTNA 4WINA 5A9SA 4PVDA 4RTKA 3FHJA 4JJ7A 4TUYF 2XTJA 2FWPA 1Z25A 1W0KD 3HR7A 3QELB 1RM0A 2WKPA 3BE5A 1N6PA 2IS2A 1IHYA 5K8IA 1E6CA 2F8TA 3M34A 5JPDA 2GRJA 2X8JB 1FJHA 2C5FA 1NR1A 4W9NA 2GDJA 4GPBA 2XWQA 3PFCA 1Z33A 4F2HA 4A2QA 3GNQA 3SXJA 2C5LA 2QD5A 5ALUA 2CC2A 2YDYA 3KYDA 3VPHA 3W5IA 3PSHA 1MIOA 4ZYLA 1A27A 4MPTA 4EB6A 5IC4A 1AJEA 1O94A 3DXYA 5C80A 3TNYA 4QJBA 3DYVA 4B1FA 5BURA 1V5GA 1WQ1R 3Q98A 2WZCA 2PZEA 4B47A 4ECAA 3MC1A 2QTRA 5INTA 5HSGA 1BQEA 3UMCA 1JAYA 1GNPA 4RIIA 1CQPA 1KJYA 1QH8A 4DPLA 5CVJA 1SK8A 4GYJA 4XQ9A 3CG4A 1J8FA 4Y2HA 4GT1A 3ZW7A 4FR0A 2FFJA 2PD3A 3OPYB 2KW5A 1REQB 3ANYB 4OOEA 1CHDA 1TJNA 1D1TA 2XHZA 3NIFB 1WTCA 3OU2A 5FUQA 1GM5A 1NVVQ 1EK0A 1M6NA 3TQQA 2RHBA 1PG2A 3H9QA 3VO9A 2YN2A 2XTAA 3B7GA 4N5HX 4NZZA 5J2TF 1UFVA 3WIOA 2RG1A 1YB5A 1IB6A 2Q5JA 4PY2A 3CE9A 3D59A 3FYDA 2ZU0C 4JUCA 1I7NA 3QLTA 1VJ1A 4M9RA 5A9SB 2BC9A 3H18A 3M6UA 3UJ7A 1G21B 5AHKA 1BMDA 5I7RA 4D4IA 3LO8A 5AVXA 4OREX 4KPUA 1WSWA 1GAWA 2XUDA 3RAEC 4LWPA 4HRYA 4GAEA 5AKKA 5CM2Z 1HZZA 4ALNA 1DFGA 1IATA 3WADA 3DTVD 1QBKC 1KA9H 2EQAA 4RW0A 2ATIA 4DIDA 2BHTA 3RIMA 5KWJA 3KYCA 4X65B 5AM5A 5CHEA 4X6UA 1E1DA 5BSUA 2I7TA 3SZLA 1MJFA 1YXMA 4CCYA 2ZUUA 4K6CA 5CA0F 3BL8A 4RTMA 3DBVO 2ODBA 3EIHA 1UM9B 3ZEAA 3FDJA 5EJIA 4JL8A 3G2OA 1L0BA 2OY0A 3VMMA 2GAIA 2LWIA 5FDFA 5DNUA 2WF7A 3N74A 3J81A 5GJVC 2WNIA 5FFFA 3WMWA 5HRAA 3RUCA 4MH0R 1W88A 1JXMA 1GZVA 2DZDA 1O4VA 2OG1A 3HCOA 4FU0A 3NHPA 5I4CA 1PLKA 2C2MA 4TS9A 4XVQA 5DTMA 2EFDB 4KFRA 1LLFA 5IJ0A 1JIXA 5FAXA 3HVHA 5EQFA 4A73A 3E81A 3BD8A 4S35A 1EVZA 3N0VA 4R41A 1JIVA 3IDOA 4QOJA 5T7BA 5E1MA 4M49A 3FPCA 2QVCA 4RELA 4U7WA 3EZYA 1KY4A 2GF9A 2EVWX 1OXVA 1WDLA 2VUSA 2Z08A 4G8CA 4ZANA 3WZMA 3C85A 4C7VA 4EY6A 2EBFX 4J7UA 1K6IA 1R9JA 3T7AA 3RVSA 4TTVA 1DAEA 1PWEA 1PHPA 2HT6A 5IP5A 5FLXA 2CXPA 2FOIA 5CIWA 4ZXPA 3K16A 4CDGA 4XTRA 3WWEA 4QUIA 2I67A 4UM9B 2P67A 1GXSA 4KQMA 4XDZA 2VVTA 1T2UA 3VR4H 1QF6A 3SHFA 2VBGA 4JYAB 1C8KA 1GHTA 2P4HX 1JAIA 2G1KA 4DDUA 2EFHB 2IOFA 2CNLA 3FNRA 1M1YA 3E27A 4PFKA 3TX2A 5CD1A 2OORC 4AKGA 4UVHA 5IARA 4RFSA 4GPAA 3DPSA 3FAZA 3RIEA 4U2GA 1FUKA 2OXRA 4WN3A 4CNBA 3L7JA 1AH2A 1NVDA 2WC1A 3JYOA 4MROA 1EQUA 4F4DA 4W6ZA 1EFPA 5BXYA 1HDEA 1L7MA 4DL9A 3G8DA 4W5RA 3GIDA 2H54A 2FN8A 1GFIA 2WJIA 4XVHA 4CDNA 1Y6FA 1M3SA 3TQSA 4Q4DA 3S81A 2X4GA 3BG5A 3X43A 3NI2A 4H3HB 4P4LA 3ZTYA 1CEEA 2FRDA 2AKAB 4KXNA 3LSYA 1NHGA 1BMFA 3IQFA 3N0WA 3KWMA 5EESA 5K3DA 1JR6A 2PS1A 3FYUC 2HB6A 3O0DA 1NUTA 5GZ6A 4JOSA 2V1XA 2OL4A 3MK31 1ARZA 1R0WA 3TJMA 1ZJWA 1RQ2A 121PA 4IDGA 4PG4A 1JKIA 2QUJA 2PM8A 1M83A 2UKDA 1I80A 3CJTA 4OJKA 5G1PA 3UMFA 3WIBA 1N6KA 1X70A 2R751 1WBJB 1B6TA 3DA8A 4O2AB 5B6PA 3HR8A 2Z4RA 4KOAA 2Z5FA 4L9AA 5FTLA 2H57A 4L08A 3VH3A 1L5HB 4YJ2B 3B8HA 3Q8KA 1JF8A 4WZ6A 3TSZA 2ZWIA 3G7SA 4M6WA 3RSQA 3A1EA 3IJRA 4AKEA 1OH5A 2DF8A 4MW7A 3ZLTA 4ZHQA 1A3CA 4DCPA 1PR1A 4ILEA 2Z83A 3KYBA 4GMKA 4PHTA 1UXGA 1V1MB 4YJFB 3CNNA 4N5IX 3V4ZA 4RKRA 1HLPA 1XK6A 4TL9A 3DVAA 2IPLA 1KI9A 1MA3A 3P9QA 5AKYA 1OWLA 2OMKA 1J2JA 2D2VA 2YUTA 4JS0A 5I7WA 5FX2A 1YB1A 4NYJQ 4QX6A 2H9AA 4IMPA 2GN8A 3QKWA 4ROSA 2CMDA 2VPYA 4UE6A 2HHCA 5FUBA 1D4AA 1OVMA 1P2SA 3LMKA 3LQFA 1B15A 4DC0A 3ZE0B 1QM5A 2OHHA 3C97A 3ID6C 3L4BA 3EDCA 1KZGB 4KBGA 2XMRA 3IELA 3KQSA 4TKUB 4CT5A 3ZHQA 3CEHA 1K68A 1HEIA 1RQNA 2HCJB 1PIWA 3ELBA 4AMUA 4I8DA 4BN0A 4E5DA 1T2AA 3O83A 1XXHA 2BFOA 5KVQA 4JA0A 3PL1A 2HK9A 1QTQA 2HV9A 4P3OA 2XGJA 1QP4A 2ZBRA 1MOZA 1JH9A 3TLKA 1Y6ZA 4R31A 2AZ4A 4R51A 4S2UA 2P4QA 3QFCA 1DB3A 2BH9A 3DCJA 4LI3X 2HU2A 2IY8A 4UXIA 1P1CA 2JDIA 5KTOA 2B1IA 4WXYB 2YVQA 2H48A 1R8YA 1GKYA 1XTIA 2OHJA 4R8SA 2JAQA 3N7AA 3SXUB 2COKA 2EARA 3TI7A 2GA8A 1S01A 2ISQA 2OA0A 1XEWY 2AXQA 4RHXA 3SFVA 1HQYE 2ZBDA 3TOSA 2LIPA 2W00A 1B6RA 2IEYA 3T1YB 1JHQA 5HA5A 5C5DA 4P80A 1VIYA 3E7DA 3G0BA 4DNXA 4RNDB 2NU9B 2FHPA 4Q1EA 2C7GA 4B9EA 3L93A 4MJ3A 4WKNA 1D07A 1SCUA 2ID4A 3D3EA 4FIDA 4IXNA 4JLDA 4KUEA 5CIQA 2G5GX 5B58C 3ZC3A 1X7HA 2AN3A 2O3SA 3C45A 4JVMA 1V26A 3EWNA 3G2KA 1QV7A 5JI3E 1XEXA 3OPNA 4Q82A 2NW6A 4XUEA 4CM7A 3RSGA 5KOJA 3T3NA 3VNQA 2C95A 3CVJA 1A76A 1Z9BA 4J3FA 1JQLB 1Y1PA 3DONA 1P3DA 2J4CA 1E0SA 1E5XA 1NVWQ 1DCFA 4JT8A 4Q0MA 5CJ2A 4QFMA 4WGFA 3UWSA 1EGMB 5F3DA 5GQSA 3OZBA 3GMSA 1QHHB 3IVRA 3QKRB 4JLUA 5ICMA 3NIWA 4X8MA 3H1GA 1G66A 4UM7A 5CH5A 3DKVA 5DMXA 1C3EA 2I87A 4R1MA 4YTEA 2YRFA 4DTIA 5CEEA 1P9OA 2J9FB 2BOVA 1EVEA 2APJA 2JLWA 4AWBA 1CUEA 2G0AA 4KE7A 4PU0A 1XQYA 5M2QA 4LN1A 2ZT7A 4CIBA 1I24A 4WXMA 5DCWA 2H5IA 2EOAA 5ALGA 3SEZA 3RU3A 4MQEB 4P4TA 1TTQB 4TM8A 1J9GA 4L4ZA 4XCVA 3VPCA 3GT7A 3DBRA 4NH0A 5HF6A 4JP8A 5JBNA 2QZ4A 2DH5A 3OQIA 4M0DA 4M36A 4IOKA 5DULA 1QQ6A 2ID9A 2O5RA 4DT1B 1OC2A 4AP5A 5LZ9A 3EZ7A 1UKBA 3CN7A 2VSXA 3FWPA 3DL2A 4X41A 4N7JA 3R6TA 1IBRA 1TE2A 2E6UX 2QN8A 1YDHA 3ANLA 3E5RA 3L1KA 4ZT6A 3L79A 2NU7A 4QYWA 3ZVRA 5AVVA 3WLRA 5CM8B 6Q21A 4G0VA 1JG6A 4PLVA 3PFHA 1ZN7A 4M1TA 3V33A 5G40A 2Q8NA 2AG0A 3FHTA 1P2FA 4F5YA 2GRUA 1OLXB 3OHSX 2O59A 1RHMA 2OXFA 3BJRA 2GPYA 2PTHA 5DVZA 4B7XA 1KL7A 1SVSA 1AU9A 2A94A 1C7IA 1PJQA 3Q3JB 4J2TA 1P77A 1TTPB 1JDZA 2ZATA 2J3DA 4GWLA 5K0SA 4JXZA 4RHEA 4XX0A 2CLKB 1PFVA 2IH2A 2A5JA 1ZKDA 3I2KA 4HL6A 4MIEA 3LFUA 2O2EA 5J2UF 2PSSA 2A7QA 2H00A 3LL7A 1VYTA 2QKYA 1SQ6A 3KIPA 3R3WA 4MYRA 3F47A 2FW9A 5I9TA 5L6LB 1TT7A 2CUTA 3CZRA 2JW5A 2OAGA 4RD0A 5IJWA 3R9XA 1QE3A 2IQ5A 2ECFA 2XKKA 4W63A 1C9YA 5CVUA 1FDIA 1DBVO 3UUEA 4FGWA 1FFBA 3RPEA 4LJ8A 2DHRA 2WHPB 4P5DA 4RTRA 2PUFA 3W7BA 3G6WA 3MT9A 5ECDA 3FNGA 3JYPA 1JDTA 5G1OA 2WSIA 4W7SA 3E35A 3K9CA 3P32A 1GFWA 3LU1A 1GQYA 2YV2A 4D4HA 2XD4A 3ICCA 2OYSA 2V7VA 1RKUA 3RF6A 4TYYA 3K8OE 4BQEA 5AUNB 1GGNA 3CUSA 1ICIA 1EDEA 1DFHA 2H9YA 4R3NA 2JATA 3KSAC 1SVLA 1EK6A 2JGRA 2WSYB 4YA6A 4YRFA 3AEQA 5T5QA 2JJYA 1GSHA 3ROGA 2W6JA 3VHXA 1PW5A 4EAAA 2OV6A 4KQ2A 3UK7A 1EIZA 5F2OA 1T0UA 3V8PA 2WSLA 4BP1A 4RCYA 1E5QA 3ABOB 4Q6WA 1T8SA 3OX1A 3IR5A 3OY7A 1M34E 3LCVB 3TLBA 2YYYA 1K8QA 1NNUA 3F74A 3TR5A 4CM4A 3LO5A 3ZS8A 1LPAB 1UJMA 1NP3A 4EY3A 3MHTA 1ELOA 2AI1A 4IZHA 5KQRA 2GMWA 3BVPA 4WL0A 1Q7GA 1VECA 4A0HA 1ZNQO 1MC5A 1OKKA 2OGUA 4F9TA 4ER5A 1IRIA 1W4CA 1LGYA 4D3YA 5A0VA 3ED1A 2ZBFA 3R0ZA 1VQ1A 4K6OA 3EAQA 3KAQA 5KIAA 4A8TA 2C00A 2IYTA 3SJUA 3NB0A 1N5RA 3WLLA 2EFGA 2Z1MA 3L0PA 4G8BA 3ZIAD 4E15A 3IP3A 1Y4DE 3L8GA 3WLNA 1KETA 1GGEA 1PJBA 5T64A 4C3VA 1FSPA 2VDMB 1RI5A 1XRPA 5IM4F 3F9RA 1US8B 3GH3A 4ALLA 4UAJA 2CMFA 5DM1A 1NWHA 4NPCA 1ZI9A 5J23A 1CQZA 1ZR4A 4MQUA 2BGNA 2DY1A 2O3RA 3A6JA 2FKNA 2G04A 2ESRA 5AW9A 3K6SA 1I7LA 4YACA 4HYQA 1M33A 1CVRA 4I4LA 4OHZA 821PA 2Q62A 3V5NA 2NU8B 3MS2A 3Q9UA 4YR7A 4JI2B 4FHEA 2OCBA 5J1TB 3S2IA 6CHYA 3F67A 3INYA 3U39A 1WCWA 1N78A 3OEWA 3DAOA 2FJUA 4A0FA 1AGXA 3V9AA 1E2HA 2ZQYA 1WZCA 1TM5E 1DBQA 3MQ2A 2WTEA 4RM2A 5LYJA 3EPJA 4K1LA 3SF8A 1QP7A 3FDXA 3E3OA 1Y5MA 4TGLA 4QDTA 3A28A 4YFYA 4QNRA 3LA8A 1YB6A 4L02A 3VNAA 5F1KA 1PCXA 3ZTTA 4RJJA 3KSUA 2I4MA 5CH8A 4BO5A 3PA8A 2C5EA 4ZVUA 4QOGA 1WUKS 1N3LA 2P9YA 3UC9A 2Q0QA 1YRQA 5EERA 3WLOA 4YR9A 3LX6A 1A4UA 2GAJA 4G5YA 1LSUA 2NV2B 2ZTHA 3PI6A 1YZYA 3UAXA 4B33A 3QFFA 1R12A 2W90A 1E63A 4HQKA 4E5VA 1IUNA 2HSWA 1XCMA 1DRVA 3GHHA 3KKPA 3PFFA 4QDKA 4A03A 4UQOA 3N5CA 3UT6A 5EJ9A 1OSNA 4BZXA 1TFRA 3ZQUA 4NSNA 2GT1A 2QI9C 4FMCB 4OQFA 2QZJA 4RPIA 1JHYA 1XF1A 4D4JA 1OXKB 4CKCA 1QJ4A 3ZWMA 4CWAA 1QHHA 2ZJ0A 1EJ2A 4KGDA 1TM2A 4I4IA 4ARVA 1QORA 5IXSA 2IS6A 4HDSA 2VYNA 1O6BA 1XU4A 4HQ6A 4PG5A 5ESWA 3DV2A 2QQ0A 5H59A 3FGOA 4DLLA 5L7TA 3NGLA 3PHBE 5LN1A 2HW8A 1PZNA 3I9LA 3HA2A 3W77A 2IU0A 2R60A 3QVGA 2B8EA 5MFPA 1MQSA 3EIUA 1N5MA 1VDZA 1IJBA 1OXBB 2ZWPA 1ZOPA 4MCJA 3WKAA 2FUG6 1U3UA 2RGEA 4RYDA 3HNOA 3LCJA 3LBFA 4BO0A 3PNYA 1LVHA 1ODFA 1K7EB 4XIFA 3QU7A 4YIKA 4MYSA 3X1XA 3RJ9A 2GF0A 2C4HA 2IH5A 4UUNA 4P32A 2JVKA 1W85A 4MSUA 2G0NA 2H9IA 3BXOA 3WGZA 1OXUA 1NI4A 1VB5A 2OBLA 4PNHA 1UPAA 4J43A 5EC8A 1CIJA 1LVUA 5TT0A 4RQAA 2YJTD 3NVKI 4X45A 5FI5A 1SQ5A 2AC7A 1U9IC 2P3LA 4RS4A 4YH1A 1JNXX 4MW4A 5EPOA 4COOA 4CKWA 5EIBD 2XOKA 1QPZA 2IBTA 3H1FA 4HZUB 5BV0A 1DG9A 1N5LA 3DZKA 4CLRB 2R2AA 3OP1A 1N9GB 3KPJA 1HKHA 2FUKA 3DZ8A 4HAXA 5DBFA 4PZYA 3WQRA 4AIIA 2OO3A 2ZXEA 3IT1A 4QU8A 5IBQA 1B8OA 4YMTA 4IH4A 3IBTA 3L7OA 2GI4A 1VHQA 1B76A 1E3JA 3R7BA 3A6PC 1TM4E 1R3UA 4QEDA 4RY9A 4H7HA 1K92A 1CRPA 1KK2A 3N8DA 4IEIA 5EWJA 3VFDA 2NO6A 5D7BA 5SZJA 3ZCQA 3NWBA 4IM7A 1XMIA 4BMSA 1SHLA 2DX7A 4YAUA 5EMHA 2Q5IA 1HEUA 3NTOA 5A06A 4D9KA 2DSNA 3VV2A 4ITVA 3KZ1E 2E4VA 4AJLA 4HB4A 2GKSA 2IPAB 4GE0A 4CI9A 2FPWA 4QLAA 2IV3A 2QIPA 1X1BA 1XVAA 1CJTC 3L6OO 3V32A 5F35A 4K8RB 1LDYA 2P6RA 4MRVA 2G1PA 1EXNA 3GN1A 2F6RA 4AJPA 1L7AA 3GVIA 4YP6A 2JIOA 2WYUA 3MT7A 3I0MA 4F11A 4QC2A 4TLMB 1H2EA 2ORIA 3O4IA 3N1UA 4D92A 2PUGA 1NPYA 1UMBB 1D9ZA 1PKEA 4M55A 5BNZA 2BFCB 4RCVA 1OI2A 4X7PA 2VQEB 3U6KA 3NUGA 3RYIA 3FYSA 1RBYA 4HDKA 3EXFA 4DJAA 5EINA 4UZFA 3I5UA 2A4MA 1ZI6A 1XJCA 1V9LA 2CLCX 1TW2A 3JAMA 3GWGA 1BOFA 4YP5A 4IUCS 4RXUA 3I2HA 4UHEA 4TZKA 4UCFA 1WAMA 4PX3A 3NHMA 1CY2A 5K2MA 1WUTA 3QBEA 4LI0A 1MXHA 4HX2A 4UNNA 1CZLA 4KODA 4EPVA 1QOZA 1KOGA 3UJ3X 3MJVA 4ZARA 4E33A 3FTCA 3AIIA 4XB6B 3C14C 1M75A 4BVEA 5K0BA 4KSYA 3KUCA 4NYIQ 5DEOA 1DRWA 1QVVA 1CTQA 3NDBB 2HU8A 3OTWA 3V42A 1ZMBA 2OP1A 2XXJA 2QMQA 3ZIDA 4RF4A 1QDLB 2JS7A 3BDVA 3GLIB 1G0OA 2PSHA 3KYJB 4JCOA 4QPJC 2I22A 5T41A 3PZRA 4CTKA 4D0GA 3WWDA 3EJ6A 1P4AA 2M1XA 2BR5A 3IYLW 3HBLA 3R0VA 3VYVA 2JLXA 3DXFA 5GZ1A 3DEKA 1P75A 3LFHA 1A4RA 1PQUA 4K9QA 1I4DD 2ZIZA 4MV1A 4TX1A 1KQOA 4U3JB 3TIGA 4RDXA 4OQQA 4P38A 4DXDA 1VM6A 4ZT2A 1WCV1 3M3DA 2QY9A 1GTJ1 2QD4A 1HT3A 3S27A 2C5SA 3WQHA 2VWGA 3FR7A 1AQ6A 2D8MA 3A4LA 2B82A 4JP5A 4KBYA 4W8OA 1US8A 4K6MA 2NZJA 4DVJA 1IUOA 3D31A 1K7FB 3QFRA 4B80A 1YFLA 3QHAA 3TSCA 3AESA 3CNOA 2VF8A 5EMLA 1P4GA 3TQIA 1I2AA 3NEAA 1JWBB 1RFLA 2QZZA 4RIFA 1BW9A 2GX6A 3O95A 3BXEA 4ZI7F 2N3ZA 1E20A 2CE7A 1IZ7A 3LNCA 5I9LA 1LVGA 3EG9A 5KKNB 4LKOA 1XV5A 1L3BA 4FYXA 5FORA 5DW0A 3U56A 1Z0UA 4OUDB 2R8XA 3LF2A 4EHBA 4EW6A 3KKNA 1DNPA 3LDAA 3ZBTA 4LGVA 1QIKA 3R3VA 3GJTA 5P21A 5BMOA 1MT3A 1V11B 1Q7BA 1J21A 3IEPA 3LYHA 3E9NA 4G36A 1M6HA 3BWCA 1FYFA 3M2TA 1UBNA 1E1NA 4FEYA 3A37A 4WHMA 5DB4A 5DWQA 3RYCA 2XECA 4QBFA 3PIIA 2H4HA 3DJYA 3I8XA 4PQRA 1VG0B 2IF2A 1GUFA 1TADA 1NMSA 1XZ8A 1QVRA 3OHMA 2GSDA 3H17A 1WNTA 4JBYA 4ZK6A 1QANA 3K7EA 2JIZD 2XF8A 2ZVDA 2B78A 3GLHE 4J9UE 2VJDA 4PQYA 2Q3CA 5ELMA 1WM1A 3K70D 2DT8A 4QNMA 4ZALA 1P0CA 3G2PA 4QU0A 4D5GA 1YTUA 1CF4A 1N2BA 2AOXA 4FFBA 1YS9A 2I80A 2YW2A 3AVUA 1NI4B 4KXMA 1UBEA 2FSVC 2V96A 2HJHA 4YAOA 4URYR 4C1NA 1W94A 4PNPA 3B52X 3BK1A 5EQTA 1KE2A 1V9CA 3D7RA 5E3IA 1ZIPA 1AZLA 1FU4A 3AF0A 4UKDA 3TKAA 1AY0A 1IXKA 3D4OA 3QMPA 2Q7DA 3PEWA 4M0MA 4K46A 2QTTA 3LAWA 1GUZA 1J97A 3JALA 4H0FA 1U3VA 1ZM7A 2WT9A 5IEBA 3LPAA 4J0JA 3RSHA 4NYIR 3ZH9B 3IJPA 1RADA 3W90A 3FNHA 3ZWYA 2GAAA 3AR8A 5KNDH 2HY7A 5IAKA 4DKJA 1ZISA 5LL6P 3PD1A 1T4MA 5TQJA 2DXIA 3ZJTA 4AZVA 4DC1A 1GKLA 5CXXA 1ZJZA 1OPXA 3L8FA 1FTSA 3WWOA 3OJLA 4LRUA 1ATIA 3FPJA 2CVFA 3EGWA 4M76B 4F56A 3O2JA 1UJBA 3SMVA 5JSFA 4D46A 5CXQA 3HM9A 1RBQA 3F49S 4MVJF 3MTIA 1NI3A 4HZUA 3UHFA 4IO0A 5A4FS 3DT8A 4KSCA 4WK4B 2XMSA 3HP1A 2ZSFA 1U1EA 4U0KA 3AF6A 5L3SB 2CWWA 3TFQA 2FWJA 2JNWA 4YEDA 1TC2A 2HXGA 2W6IA 4LXHA 2FSFA 4MR8A 2ZTLA 4ENRA 1T36A 1FNSA 4LDZA 4MUAA 4QUDA 3JQFC 4ZQEA 3KLMX 3QYFA 3AY3A 4ZGBA 4OX9B 4YRSA 2I03A 4Z4CA 2R97A 3KZNA 4RKYA 4XM1A 1FLVA 1BS2A 1IZYA 1BYUA 1I2CA 3HU3A 3W1VA 3LYLA 4YP0A 2VG8A 4FT2A 3FUWA 4XSVA 2P3SA 4BVKA 4FDLA 2V7BA 1PG0A 2DKNA 4D6XA 2IPOA 3ZH2A 2EJWA 1JAZA 3P0IA 4LZNA 5FPQA 1J24A 2RB5A 4UZEA 1Q3KA 5CURA 2X0RA 3JWEA 4J94A 3NHSA 4KI0A 4MA5A 4PRKA 3BMNB 1PQWA 3UAGA 2Y71A 4EY5A 2GHTA 5EE3A 2C5GA 2GVNA 3CLRC 1EI9A 5BQ3A 4JK3A 3ADBA 1QO9A 4KC0A 1E0AA 4R71A 2X5JO 1DINA 2JHCA 3HJCA 4I1VA 3LS2A 1NOJA 4UU7A 4LHEA 2VDUE 3E48A 2XJ4A 4IHJB 1G4HA 3QPBA 4YC7A 4UC0A 2FK7A 3VSEA 4BYGA 1N92A 4UEJA 4OD0A 2Y1OA 2ZRBA 2AMVA 2JCVA 1E1MA 3PC8A 4I0WB 1NIJA 1H69A 3GLHB 4HAOA 1U7DA 1A8SA 1CUHA 2CJWA 2NUAA 3G89A 3RIGA 4GZ6A 2BH2A 5I6DA 2Z4TA 3MXOA 4ARCA 3K0SA 3II6X 3OEHA 2PR2A 2ZP1A 3SC2A 1ZVJA 4CM3A 3L01A 1NC1A 2CDCA 3IDFA 5T4HA 1EU1A 2HBZA 3UEOA 2ZKIA 2AG5A 3JSAA 4S1VA 1RVV1