4MEMA

Crystal structure of the rat usp11 dusp-ubl domains
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
212
structure length
212
Chain Sequence
AMPDLDQQWRQIGNGRERPLRAGESWFLVEKHWYKQWEAYVKGGDQDASTFPGSINNSGLFEDQISWHLRERLVEGDDYVLLPAPAWNYLVSWYGLKDDQPPIERKVIELPGIRKVEVYPIELLLVQHSDMETALTIQFSYSDSVDLVLQTAREQFLVEPQEDTRLWTKNSEGSLDRLCNTQITLLDACLETGQLVIMETRNKDGTWPSAQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 11
publication title Structure and Catalytic Regulatory Function of Ubiquitin Specific Protease 11 N-Terminal and Ubiquitin-like Domains.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hydrolase
total genus 56
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4memA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 4memA01
4MM3A 3TBLD 3WANA 2IBIB 1WX7A 2L3ZA 3PHWB 1S1QB 2CR5A 2KJRA 2L8JA 4GIVA 3VQIA 1WE6A 4DDGD 2KANA 3APDA 4JQWC 2PEAA 2O2VA 3L16A 5AZHA 2D11A 3EECA 3DBHI 2ZNVC 1F9JA 1V80A 1WM2A 3NS8A 3KVFB 1EO6A 1UBQA 2KMCA 3EC8A 4G11A 1UELA 2JVCA 5DPSA 3RCZA 3APFA 1Y8RC 2M8SA 5TR5A 2BWFA 2V4LA 2KJ6A 4G50A 3KYDD 4GDKA 3AU4A 4WJNA 1J8CA 3PRZA 1NDDA 1GUAB 4CHKA 2DZIA 1WMHA 2LRWA 2LZ6A 1E8ZA 1A5RA 3L13A 1WXAA 1L2NA 4DHZE 3HM6X 5J2RA 3QK0A 3QQ8B 4HJKA 3DVNU 2RPQA 3AU5A 4W9JA 2Y5BB 2MRPA 3A9KA 4FULA 3VTUA 3ZO5B 5LXIB 1IPGA 2ZPYA 3N30A 3ZNID 4BKTA 3Q3FA 4FADA 2LGDA 2XK5A 4KIKB 3SU8X 2AYOB 3QA8A 2MBHA 2MBOA 2ZJDA 4RMAA 2PE6B 3IVFA 3CF6E 3A4SC 2GBNA 3TIXA 3WIMA 3HM3A 1RLFA 3O65B 1G6JA 2GBRA 5CX3A 4XC2A 4W9KA 2V1YA 4ZRJA 3T8MA 4W9GA 3DOWA 2EMTA 4HXDA 4EUTA 1E8YA 3UQBA 1WJNA 2L00B 5D2MB 1D3ZA 4URKA 4GN1A 1TGZB 1VD2A 1ZKHA 4EEWA 3L0WB 1ZW7A 3N32A 4I6NB 4HPMB 1E90A 4KDIC 4MH0E 4NJ6A 4BVUC 2JWZA 2MA9B 1YIWA 3A4RA 1Q0WB 2O2VB 2MQJA 3RYTA 4EKUA 4BKSA 2HD5B 2PPHA 4YL8A 5G2NA 4HPLB 2FNJB 2R2QA 3QWZB 4K7UA 1P0RA 3WALA 4F8CB 3VTWA 2JPHA 3N3KB 2D10A 1GC6A 4GDKB 3V61A 3U8ZA 3CMMB 3T9LA 4HVBA 1QZEA 2C5LC 2KXJA 3AULA 4DK5A 2MX2A 1WMHB 3L08A 4FJVB 4MEMA 3UIPB 2C60A 5DPRA 3ECIA 5C1ZA 2KWVB 3X23A 4IM2A 1GJZA 4BFRA 2R2OA 1TBEA 1NBFC 4GXBA 3HHMA 4ANUA 2CHXA 2K6DB 4DHJD 1GG3A 1WGYA 1U4AA 2KHWB 3A9KB 2EKEC 3NY5A 1E5WA 2GBMA 2AEHA 1LM8B 2JXXA 2XK5B 2ZEQA 3NZUA 4NJ7A 5KHQA 3DVGY 2KZRA 2V3SA 4I6PA 1WGGA 1WX9A 4MGZE 3H1UA 5EDSA 2K6QA 3AI5A 1WR6E 4BKGA 2IO0B 3DPDA 4PS7A 3LJ3A 1UH6A 2BYFA 4JGHB 4WJOA 1YD8U 2CU1A 3Q3JA 5HKHA 1P9DU 2K39A 1S3SG 2BGFA 2K1FA 5CHVC 4F1SA 2J0KA 3ONSA 3OJ4B 1WH3A 2DYOA 5JZEB 1W6VA 1EF5A 1XQQA 2WWZA 3RZWC 2ASQA 2HE7A 3BINA 4M8NA 1V49A 5JHAA 4IWOA 5CHFA 2RD0A 1WJ6A 4K7WA 3RUIB 2K8CA 3AXCA 3IHPC 4FN2A 3LMNA 1R4MI 2WYQA 3ALBA 4IM3A 1V86A 2FCNA 1WZ0A 4PS8A 4IUMB 4FHKA 3HK0A 1PQSA 4E74A 2O6VD 2LRUA 3SD5A 2NBVB 1X1MA 3QIJA 2Z59B 2N7EA 4P7IA 4BOZB 2MLBA 1IYFA 2MBBB 2M0XA 4GGQA 5CTRC 4W9IA 2MSED 3ZUNA 2DAJA 3TL5A 2AWTA 3H7SA 4MELA 2B3AA 5G55A 4AOFA 4IG7B 2LXAA 3OLMD 3QCAA 3ZRCA 2IY1B 4NQLB 2Z0DB 1V5OA 4FBJB 2BKFA 2NBWB 2KC2A 5D7GA 3PT2B 5KHOA 4B9KA 3DVGX 2N4FA 4PS3A 2CKHB 4FJYA 4IW0A 4WJQA 4DHZB 2MCNB 3QARA 2OJRA 2Z0EB 4MJSA 4BBNC 2N1WA 1I35A 1WRDB 4NNJB 1EUVB 1WXMA 4OVUA 2KKCA 2ZNVB 3PREA 4LCDE 1SIFA 4K81A 3PLVA 3PRMB 2KNBA 4HCPB 4KZCA 4DBGA 2PE9A 1E8XA 3IG3A 4K7SA 2NCNA 1WGHA 2DZJA 5BO4B 2G3QB 1UBIA 4HCNB 1UD7A 3ZW3A 1Q1OA 2AL3A 2KDBA 4NAWA 4EZLA 3QX1A 2PJHA 3R3MA 1RRBA 3GZNI 4EFOA 3PZDA 3ZVVA 3A9JA 1XD3B 3VH4B 2KLGA 5E6OA 2A4ZA 3TCAA 2IY0B 2M4NA 3R7QA 5E6PA 1WY8A 1WJUA 2O6VA 2LVPA 1NI2A 3H6NA 4MGIE 3S2AA 4TQ0A 1V9JA 3HIZA 2MP2A 1E8WA 2K8BA 1WGRA 2I1KA 4HDQA 4FA6A 4MGYE 4NQKE 3NZSA 4FJZA 4NY0A 2QHOA 3JVZX 2NVUI 3UIOB 3MJWA 2DHZA 3VXWA 1RFAA 4E3CA 2KD0A 2JZ3B 4CO7A 2J0JA 4KV2A 2G45B 2KDFB 2JF5A 2MW5A 4MJSB 2LASA 4EOYA 2REXA 4AJYB 2MBEA 1YX6B 3PGEA 4GSWA 3W1SC 3VDZA 2W9NA 2N9EB 1T0YA 2IYDB 1UGMA 3ZNGC 4K1RB 2DYBA 3JW0X 4G0NB 4W9EA 4XX5A 1OEYA 3PTFC 4MDKE 3B08A 2ZCCA 3JYUA 3KUDB 3OAWA 4W9FA 4NAWB 1TTNA 3RD2A 3M62B 2IZVB 4G3XB 1AARA 2LD9A 1C1YB 3NOBA 1RAXA 2IO1B 5D6JB 1CMXB 4LDTB 4ANVA 4ANWA 1GNUA 3A9JB 1Z2MA 3L17A 3UINB 1LXDA 2ZVOA 2WX1A 3D32A 3DQVA 4MSQB 3DVNV 4II2B 4I6LB 4W9LA 3W1YA 2EMSA 4FLHA 4E71A 3GOEA 2O6VB 2GBJA 1WIAA 2KDIA 3VTVA 5GMVA 5DPWA 1V2YA 2KFKA 2LWPA 4X57B 2MP2B 2WX0A 1LQBA 3RULA 4EZKA 3A33B 3ENEA 1WJ4A 2JZZA 4IM0A 2MWSB 4PYUA 5LLIA 1SE9A 4GDLA 4II3B 3KUZA 1EF1A 2JT4B 3KYCD 3PHXB 1WXSA 3WAPA 3DBSA 2KFJA 4ZDVA 2LVQA 5DPTA 2DENB 2LGXA 5CHWA 3PRPB 3BY4B 3VVWB 3KW5B 2FIFA 5E6NA 1WE7A 4XZ4A 3PS6A 3VUYA 3QJZA 2J7QB 2ZVNA 2KTFA 1UZXB 4M8MA 3ZTCA 1WYWB 5J17A 4ZRKA 2RSUA 2I1JA 4BBNF 2FCSA 3PLUA 1GC7A 3L54A 3CSTA 2UWQA 4FHJA 2G4DB 3NHEB 1Q5WB 4ANXA 3TMPB 2D07B 2FCMA 3V6CB 3DBLI 1WZ3A 1WR1A 2CHZA 2HJ8A 3IFWB 5L83A 4KSLC 1YX5B 1P1AA 4TV3A 4BKSD 4KVGB 4MGKE 4W9HA 2LJ5A 2KFKB 2KOXA 2HTHA 4JLCA 4GOCA 1ZGUB 3U30A 2NBUA 3B0AA 5AEKB 4KSKC 1OGWA 1J19A 4GDLB 3K9OB 1OQYA 3ZLZA 2MBQA 1I42A 2ZZPB 3JSVA 1MG8A 1E7UA 1WGDA 3VUWA 1M94A 3VH3B 1HE8A 2KQ7A 4IC7B 4ZRIA 1OTRB 3LDZE 2K8HA 4LJOB 4A3PA 2YVCA 2L0TA 1H8CA 4F7ZA 1K8RB 1V81A 1P98A 3EHVA 4RM8A 2CHWA 2KJHB 2JRHA 3VFKA 3W1SA 3L10B 2L7RA 3B1LX 3V62A 2BYEA 2RGFA 3A1QA 3R66C 1V6EA 3QHTA 2L05A 4DDID 5AZGA 3ZKJC 4W9DA 2D2QA 1L7YA 4KZ0A 4GU2A 2BPSA 2KWUB 3CSFA 5L95C 3PPAA 2KK8A 3ML9A 4ASWC 5J18A 1KJTA 1WM3A 4HWIB 2GBKA 4IWPA 1SGHA 3VAWA 1BT0A 4TKNA 3ZDMC 3P2BA 4WAAA 3VHTC 2A5UA 4WJPA 4MSMB 4DHJB 4DWFA 3RT3B 3EFUA 3U7DA 4KDLB 3TJPA 5LXHA 3I3TB 2DZKA 2LUEA 3OJ3A 5D94A 4B95A 1H4RA 3KH0A 4AWJA 1KM7A 2KQSA 3DDCB 2JUOA 4HLEA 4ZYNA 2BF8B 2KN5A 2KTRA 2UYZB 2G4SA 3SDLC 3RZFA 4JIOU 2C7NB 3ZRFA 5FR6A 3WA0A 2C9WB 2KC1A 1YQBA 3ZNHB 3K9PB 5IA7A 4A3OA 3JSVB 2FAZA 2N9PC 2LXCA 2ZCBA 4AJWA 4W9CA 3C0RB 4ICVA 3ZIMA 3H9DA 3QC8B 2IO3B 3ZNZB 2JY6A 1WI0A 2GOWA 2AL6A 2M1MA 1ISNA 2LGYA 2FUHB 3MTNB 3DBRI 4WWNA 4OVVA 4EZJA 3KUCB 3V60A 1VCBA 2BKRB 3A1QB 4HK2A 3ZDTA 4GMVA 2KWCA 4AUQC 1WF9A 2C7HA 2DX5B 3PVLA 4TQ1A 1WXVA 2J0MA 1OEYJ 2FCQA 1V5TA 4J6IA 4JL9A 2N9XA 4A20A 2KX0A 3H7PA 4AP4C 2NPTA 3SHQA 2KX3A 2L0FA 5JHBA 4IWQA 5IAAC 2NR2A 2M17A 4RM9A 1WFYA 1Z5SB 2BYVE 4BOSC 2DZMA 2LVOA 4N9F4 2LI5A 2ZPNA 2KMAA 3M3JA 4LJPB 1WX8A 4TUUA 3ZTDA 2KDEB 4DXAB 3X0WA 2C7MB 2IO2B 3DCGA 3M63B 2KTRB 2KO3A 2WDTB 4ICUA 4B6WA 2L76A 3WAOA 2K25A 3UQAA 2JRIB 2GMIC 4M0WB 5C23A 3R7RA 4PYZA 1KLVA 1JRUA 3APCA 2D3GA 2FIDA 2N1VA 3PSEB 5AZFA 1IP9A 3M95A 3WAMA 2OOBB 1YJ1A 4LDTD 1E7VA 3PV1A 3V6EB 4WQOB 2BWES 2YLMA 5JH5C 2N7DA 1LFDA 2DAFA 3VUXA 4CYEA 2KVRA 4WWPA 4WWOA 4NPNA 1FXTB 2VRRB 1KOTA 4HDOA 3UGBB 2RR9A 3ML8A 2XEWA 4KIKA 2NS5A 1TZ1A 5DCNA 1J0GA 2CS4A 1XT9B 3UF8A 1R4NI 3H7PB 1C3TA 2NPTB 2XBBC 2KLCA 4GB9A 3IBEA 3MHSD 2DYMA 3QAQA 1P3QU
chains in the Genus database with same CATH superfamily
3WANA 1JMLA 2L3ZA 3PHWB 2CR5A 3ZQ4A 4DDGD 2KANA 4XE0A 4JQWC 2HDEA 5AZHA 1ZXHA 1HTOA 2WXIA 1F9JA 1V80A 3NS8A 1EO6A 3PZ8A 1Y8RC 5TR5A 4GDKA 2DZIA 2LZ6A 1XLOA 1YJIA 2H89B 1KTKA 4ZRPA 3ZO5B 3RN9C 4BKTA 4FADA 1E7PB 4KIKB 2PE6B 3IVFA 3CF6E 3E56A 2GBRA 2V1YA 4YTNB 3DOWA 1FRDA 4EUTA 4RNAA 1E10A 4EEWA 1FXIA 3N20C 3N32A 1E90A 4NJ6A 3PO0A 4BVUC 3A4RA 1YIWA 2PPHA 1EWCA 4WWMA 4IDIA 4DXFA 3WALA 1GC6A 3V61A 1B9RA 1T0SC 3CMMB 3T9LA 5G5HA 2C5LC 3AULA 3L08A 1XEEA 2IGDA 5C1ZA 1JALA 2WXJA 1GJZA 1TBEA 4ANUA 2K6DB 2WDRB 1E6EB 1WGYA 3MHZA 2PIAA 2EKEC 1LM8B 2XK5B 1RFKA 3U7ZA 5EDSA 3ZXVA 3AI5A 1WR6E 2IO0B 2LJIA 1UH6A 4C80A 1F2RC 2K39A 2K1FA 4LTUA 1QKZA 3ONSA 3OWEB 3OJ4B 1WH3A 1W6VA 2J4XA 3FILA 2RD0A 2MHJA 1WJ6A 1XF5L 2K8CA 4FN2A 4S17A 5BYQA 2WYQA 1T6BX 4FHKA 5EE9A 3BK1A 1PQSA 2LRUA 2NBVB 1X1MA 4HKZE 2DLBA 4WIPA 3HVZA 4P7IA 1MPEA 2MLBA 1IYFA 2M0XA 4GGQA 4W9IA 2MSED 2KVZA 2RDBC 3ZUNA 1STEA 3P4SB 3DWMA 5G55A 4P1CC 4IG7B 2LXAA 2GLSA 2Z0DB 2NBWB 2JYEA 2WXFA 1IGDA 1EM7A 2MH7A 4M00A 2CKHB 1SBBB 3PREA 4WH4A 4LCDE 3PLVA 1TT5B 2KNBA 1GPXA 1UD7A 3ZW3A 1Q1OA 2KDBA 2AQ3B 4ZRQA 4RGOS 5AUKA 2BVCA 1RRBA 1SXTA 1WSPA 3PZDA 3I63C 3TCAA 1JWMD 4ACFA 1QF6A 4K3CA 1TS3A 3ZGZA 1NI2A 3S2AA 4TQ0A 1NYRA 1V9JA 2MP2A 2KQ4X 1C4CA 3BYTB 4NQKE 3NZSA 2IPKD 1JWUD 4E3CA 4CO7A 1L0VB 4KV2A 1VJKA 4N59A 2MW5A 3AE3B 1FNUA 2MBEA 3SEBA 2UU7A 3VDZA 1T0YA 1UGMA 3ZNGC 4K1RB 1OEYA 4MDKE 3B08A 1DOYA 4W9FA 4DXGA 3RD2A 2ONQA 2IZVB 3M62B 1AARA 2BQQA 3NOBA 1RAXA 1Z2MA 1NEKB 3DQVA 4MSQB 3DVNV 2Y5CA 3W1YA 2LFIA 1WIAA 2LWPA 4MT5A 2RDGA 3VRAB 4II3B 4P16A 3KYCD 3PHXB 1HZ5A 3WAPA 1OQRA 5BMGA 2LGXA 1GOZA 1YMHE 3GS2A 3BY4B 2K3UA 2WXOA 1D5ZC 2QIEB 3PS6A 3N1ZC 2KTFA 1R4NB 3MFGA 4YTPB 1IUEA 2I1JA 5HFYA 3I57A 2W82A 2OHFA 3CSTA 2DWQA 3W2DA 5L83A 2HTHA 2KWDA 2D3CA 2NBUA 1XLPA 1J19A 1OQYA 2MBQA 4ZHPA 1Q10A 3AN1A 2L52A 4IC7B 2KQ7A 3N9YC 4A3PA 1P98A 3Q8CA 4ZHOA 3L10B 4REZA 3V62A 1MG4A 4RF1A 4YT0B 3QHTA 2L05A 4XDCA 4KZ0A 2KWUB 3CSFA 5EE3A 4RH6A 3PPAA 4ASWC 4JX1C 2KYWA 3DHIC 5AUIA 1N60A 3VHTC 1DYQA 3EUB2 3OJ3A 4USAA 4B95A 1NYQA 1TIFA 3DDCB 3NRZA 2PKOA 2BF8B 2G4SA 1V1PA 1MI0A 4HPPA 3LYYA 2C9WB 2K22A 3RNBC 3ZNHB 3K9PB 1K52A 1IBXB 3B2GA 1AWDA 4YSYB 5IO9A 2M1MA 2LEKA 1A70A 5G5GA 2LGYA 4OVVA 3KUCB 3CIRB 2KWCA 1FCCC 3PVLA 1MFWA 3EA6A 4JL9A 5FK9C 2KMMA 5IKCM 5JHBA 2NR2A 1C77A 1Z5SB 4US8A 1L0YB 2LVOA 2R61A 4TUUA 4DXAB 3FC4A 3M63B 5E6JA 2KTRB 2WDTB 3RNAC 2MEKA 2L76A 4B6WA 4ARCA 2JRIB 4M0WB 4ZOHC 3TEZA 5MPOA 1QOBA 1JRUA 2PMVA 2D3GA 2FIDA 3RI7C 2N1VA 5AZFA 2BTEA 4LDTD 3PV1A 1B1ZA 4OHJA 2N7DA 3U4EG 1YNTE 2KVRA 2N9LA 4BAXA 4WWPA 2VRRB 3IT4B 1N6ZA 4NJCA 3UGBB 1RWSA 4KIKA 1TZ1A 3NVZA 3H7PB 2IDYA 2XBBC 2KLCA 4FXCA 1WM3A 3QAQA 2YEPB 1MHHE 1PFDA 1S1QB 2KJRA 3E9SA 1WE6A 2M19A 3U2SC 4YSXB 3L16A 3U52E 1PGAA 3EECA 3DBHI 2VZKD 1WM2A 2LHDA 2KMCA 2JVCA 5DPSA 1TKGA 4G50A 3KYDD 1GUAB 2ICIA 4CHKA 3ETRA 1OFFA 3I9V1 5FKAC 3HM6X 1I4XA 5J2RA 4HJKA 1N5WA 5H8YE 3NVYA 1I4GA 1YJJA 2NTSA 5HI1A 4XWTA 3Q3FA 2M0AA 2XK5A 4RMAA 3EGRA 3A4SC 2GBNA 3WIMA 3HM3A 1RLFA 2D5GA 1CQVA 4MM3B 2EMTA 3ZYYX 1FCLA 2WU5B 3UQBA 5D2MB 2L00B 1D3ZA 1TGZB 2AX5A 4HPMB 4MH0E 1FD6A 2JWZA 4OZAA 4HPLB 3RNCC 4K7UA 3QWZB 4JWUC 2WXLA 3VTWA 3B2FA 2D10A 4DK5A 1WMHB 4FJVB 2C60A 1CZPA 3X23A 4BFRA 3RPFC 4A55A 2WXRA 2KHWB 3NY5A 1E5WA 1YOVB 3NZUA 2BBCA 3DVGY 2V3SA 1ZUD2 3H1UA 1V1OA 4A8XC 3DPDA 3LJ3A 5BYSA 4JGHB 2CU1A 4NAMA 4KGRA 1P9DU 1S3SG 5CHVC 3Q14C 4IOIE 1QT9A 1ROEA 5JZEB 1L4ZB 2WWZA 4M8NA 1V49A 2KACA 3LMNA 4IM3A 2FCNA 4IUMB 1YN4A 3SD5A 5IP4D 2SAKA 2WXNA 4KX6B 4LNOA 3TL5A 3H7SA 3OLMD 3QCAA 2IY1B 5I4DA 4FBJB 5D7GA 1C9FA 3NVWA 5KHOA 1L5PA 4IW0A 3QARA 2Z0EB 2N1WA 1UUPA 2KAJA 1LGRA 1YN5A 1SIFA 2Y5PA 2JU6X 1HXYD 4KZCA 2NCNA 1UBIA 1YN3A 4EZLA 2PJHA 3HVDA 1FFVA 2KLGA 1SE2A 5E6OA 3R7QA 2BW2A 1WY8A 2N7JA 1VDVA 4MGIE 1E8WA 2K8BA 2I1KA 3L4PA 1RM6C 3JVZX 2Y3AA 3UIOB 2DHZA 1WRIA 3VXWA 2KD0A 2J0JA 3WCQA 4L1BA 2FE8A 2LASA 1SSNA 3W1SC 2PTLA 1EU3A 2W9NA 2ACZB 1VLBA 3JW0X 3ZJUA 4W9EA 4XX5A 1NVID 1L4DB 2LD9A 1C1YB 1DOIA 1HQRD 2PVGC 3I5JC 1CK1A 5D6JB 4LDTB 3GP7A 4ANVA 1TKYA 1JWBD 3L17A 2X8XX 3UINB 2WX1A 3D32A 3P4QB 3W5UB 3DHGC 2CJOA 2GBJA 2KDIA 3VTVA 5DPWA 2IJ0A 3W5VB 3DHHC 2WX0A 3AE9B 3P4PB 3V05A 3A33B 3ENEA 1WJ4A 2JZZA 4IM0A 1SE9A 1WGKA 4OZCA 2WXKA 3DBSA 2KFJA 3P63A 2DENB 5CHWA 1QOAA 2FIFA 5E6NA 2N9KA 4XZ4A 3N1XC 3VUYA 2VZKB 2KN4A 2ZVNA 2WXGA 2IGHA 1ZDVA 4BBNF 2FCSA 2V3PA 1FXAA 1MHXA 1HEZE 4OW0A 2EKIA 1KLUD 2G4DB 1VR9A 1TZOA 2D07B 2FCMA 4YXDB 3DBLI 3DBHB 1YX5B 2NTTA 1SF0A 2ZW0A 4BKSD 4KVGB 2KFKB 5TSSA 4LNFA 4JLCA 4GOCA 4WQMA 2HJ1A 1N5XA 3OG5A 1OGWA 2W3RA 2K5PA 4YTMB 2ZZPB 3VR8B 1MG8A 1E7UA 2QILA 1WGDA 3BK2A 3AMZA 1HE8A 1PUTA 3LDZE 4ZRIA 2K8HA 1IBXA 1H8CA 1UNSA 1K8RB 4RM8A 2CJNA 3B1LX 3R66C 2WHIA 1V6EA 2D2QA 2V9HA 1L7YA 2BPSA 3PZ7A 1KF6B 1JROA 1SGHA 4L23A 3AE5B 1PGBA 2DNFA 1K50A 4AQ7A 2PVOD 3ZDMC 3P2BA 4DWFA 3RT3B 3TJPA 4C7ZA 2DZKA 1H4RA 1KM7A 2AQ2B 4HLEA 2QC8A 2KTRA 3SDLC 3RZFA 4JIOU 4M0WA 3ZRFA 2IGGA 1YQBA 2RMMA 3JSVB 2LXCA 4AJWA 4W9CA 3C0RB 2OJWA 3ZNZB 2KT7A 1WI0A 1PDXA 2W55A 2FUHB 2BKRB 3A1QB 3Q2AC 4GMVA 4AUQC 2C7HA 2DX5B 4TQ1A 1TKEA 2FCQA 3MC0B 3H7PA 4AP4C 2L0FA 4RM9A 2M17A 2MJEA 1JRPA 4TMAB 4BOSC 2DZMA 2KMAA 3MP9A 4N6EB 2XN9C 1I4PA 4EE2A 2KO3A 3UQAA 2M56B 4DQOC 2GMIC 3PSEB 2DBYA 2OOBB 2I38A 3V6EB 1AN8A 2BWES 5JH5C 1LFDA 1L0XB 2FBWB 4CYEA 5HG2A 4NPNA 4HDOA 1TY0A 3ML8A 2WGSA 2V4IB 5DCNA 3UF8A 3AV8A 2NPTB 3CWIA 2WLBA 1P3QU 4MM3A 1WX7A 4GIVA 1K53A 1WXQA 4L2YA 2D11A 2WNMA 2ZNVC 4WURA 3KVFB 3EC8A 3RCZA 3APFA 2B76B 4C4VB 4WJNA 3AU4A 4XWWA 3BZDB 3PRZA 1NDDA 1WMHA 2LRWA 1E8ZA 1A5RA 3L13A 1E0ZA 1WXAA 5H92C 1L2NA 4DHZE 3QK0A 3NG0A 3DVNU 3TEYA 3AU5A 4W9JA 2Y5BB 4MACA 1XXGA 3VTUA 5LXIB 3ZNID 2ZPYA 1VZ7A 2LGDA 2BYTA 2L32A 3SU8X 2AYOB 3QA8A 2MBHA 1KFYB 3KQ4A 2BT6A 3TIXA 2BS4B 1G6JA 3IAM1 5CX3A 1C79A 4XC2A 4W9KA 4ZRJA 5JXVA 4W9GA 1SB3C 4URKA 4GN1A 1VD2A 3L0WB 4KDIC 1D5XC 2MA9B 1Q0WB 2O2VB 3H8HA 4YL8A 1GAQB 5G2NA 3R8BA 1CJEA 1IGCA 2FNJB 4C00A 2JPHA 3N3KB 1C4PA 3U8ZA 1QZEA 2KXJA 2WXQA 2WU2B 1YQ3B 2D3AA 2R2OA 3RMKC 1KRHA 2MJ3A 4DHJD 1GG3A 3AEAB 1U4AA 3A9KB 2GBMA 1ZE3D 2AEHA 2JXXA 4NJ7A 2KZRA 4I6PA 4QAYA 1HA5A 1WX9A 3N1YC 4MGZE 2E3TA 1KH0A 2K6QA 4BKGA 1TS5A 4PS7A 3BVGA 2BYFA 4WJOA 4ARIA 3Q3JA 3Q8AA 4LNIA 2BGFA 2LHEA 2DYOA 4RF0A 1EF5A 1XQQA 2VH2A 3RZWC 4IWOA 4K7WA 3Q3OC 3RUIB 3IHPC 4PS8A 3C8YA 3HK0A 4E74A 1N62A 2Z59B 2N7EA 3DBLB 5IN7A 1TY2A 2MBBB 1E9MA 4LNNA 2AWTA 4K3BA 2B3AA 3AEEB 2D3BA 1F0ZA 2FUG1 4GLSC 3ZRCA 1ET9A 2SEBD 1XCQL 1XO3A 1J7AA 3AB5A 2KC2A 2JQRB 1ACCA 4FJYA 5D3IB 4DHZB 2MCNB 2OJRA 1VRAB 3R2IA 1I35A 4NNJB 1EUVB 1JWSD 1WXMA 4ZYSA 1FM0D 4ITKA 2KKCA 2ZNVB 4RGMA 4C7YA 2NMQA 2J52A 4HCPB 4DBGA 2PE9A 3IG3A 3AEBB 5BO4B 5D3DA 2G3QB 4HCNB 4B0EA 3TSSA 3R3MA 3GZNI 3ZVVA 1XD3B 2IY0B 2V0GA 3AEFB 5E6PA 5C2TB 2LGIA 2AQ1B 1WJUA 1WGRA 1QOFA 4HDQA 4FA6A 4MGYE 4FJZA 2QHOA 2G9HD 3AECB 2NVUI 3AE1B 3MJWA 1RFAA 2JZ3B 5HHDG 3NJTA 4XDDA 4MJSB 2WXMA 3URYA 4EOYA 1BXTA 4J3OD 4KKJA 1YX6B 4N58A 2L1AA 1XCTL 2N9EB 2IYDB 1FNWA 2XNAC 4G0NB 4KGTA 2ZCCA 3JYUA 3KUDB 2BS3B 4NAWB 1JCKB 2QSDA 1BUIC 2IO1B 4ANWA 1SJED 3A9JB 1LXDA 4D2KA 1VZ8A 4II2B 4BZAA 4W9LA 2EMSA 2O6VB 5GMVA 2KFKA 4X57B 1HZ6A 1N63A 4A9AA 1UF0A 3RULA 1SE3A 2MWSB 5LLIA 4P1BC 3KUZA 4XYCA 4ZDVA 5DPTA 1T3QA 3KW5B 1C78A 1WE7A 4JPSA 1UZXB 1WYWB 5J17A 1GC7A 3L54A 2UWQA 1ET6A 3AE8B 3NHEB 4ANXA 4MH8A 3V6CB 1WZ3A 2CHZA 5FR3A 2JSVX 1GB4A 4KSLC 1P1AA 1F77A 2KOXA 5BMIA 2GI9A 4JWSC 3BWUD 1N61A 1ZGUB 3U30A 3V3XA 3B0AA 4GDLB 3K9OB 1I42A 2LGSA 3JSVA 3VUWA 1M94A 3VH3B 1M4VA 1OTRB 3Q8BA 2YVCA 2L0TA 2E6XA 3W1SA 4RFBA 4OVZA 4OZBA 2BYEA 2RGFA 3A1QA 3ZKJC 4W9DA 3TEXA 2TSSA 5L95C 4KKIA 1WWTA 2W54A 5J18A 1KJTA 2GBKA 1BT0A 3C19A 4WJPA 4DHJB 4M01A 3GE3C 3EFUA 4KDLB 1LO5D 3ABVB 4AWJA 4ZYNA 2UYZB 5C3JB 2HTME 2C7NB 5FR6A 3WA0A 1F1HA 2JZPA 2KC1A 5IA7A 4A3OA 4HRSA 2ZCBA 3P42A 4ICVA 3ZIMA 1VZ6A 3QC8B 4US9A 2JY6A 1L6VA 4WAFA 2GOWA 1ISNA 3DBRI 3V60A 3FAHA 4J6IA 1V5TA 1ZXIA 2JXTA 4A20A 1AYFA 2NPTA 4IWQA 1WFYA 2BYVE 2MJDA 2QMTA 2Z8LA 2LI5A 1WX8A 3ZTDA 2K0PA 1FNVA 2KDEB 4YWGG 1UGJA 2C7MB 3IT6B 3DCGA 2JYTA 3HUIA 2YEPF 3WAOA 2K25A 4C4VA 1JW9D 5C23A 1JWAD 3APCA 1T0QC 1IP9A 3M95A 3WAMA 1R7SA 1ENFA 3VR9B 3NZ3A 1Y56A 2XEWA 1XLQA 2CS4A 1FMAD 1XT9B 3MHSD 2L83A 3TBLD 2IBIB 3SFEB 2L8JA 3VQIA 3APDA 3KWVA 2PEAA 3Q8EA 2O2VA 2INPE 1UBQA 4G11A 1UELA 2M8SA 1FRRA 2BWFA 2V4LA 2KJ6A 1J8CA 3GZNB 1XLNA 5EE0A 3TUOA 4UDUC 3QQ8B 2RPQA 3ZXRA 2MRPA 1I4HA 3A9KA 4FULA 2PLPA 1IPGA 3N30A 2ZJDA 2MBOA 1I4RA 1ZP0B 1ZDXA 2GB1A 5T8IA 2G1EA 3O65B 4H2AA 2QJLA 1TS4A 3T8MA 5LNK1 4HXDA 1E8YA 1WJNA 1ZKHA 1ZW7A 2Q5WD 4I6NB 4EKUA 3RYTA 2MQJA 3IXSA 2ZW1A 4BKSA 1D6EC 2HD5B 4RGNA 2JX5A 3RNGC 2R2QA 1P0RA 3MJ5A 4F8CB 5BYRA 4GDKB 5GXGB 4HVBA 2MX2A 4MEMA 3UIPB 5DPRA 3ECIA 4PT5A 2KWVB 4IM2A 4RGTA 4P6VF 1NBFC 4GXBA 3HHMA 2CHXA 4Q2JA 1L6UA 3NS1A 4NZLB 3J9CA 2ZEQA 5KHQA 1WGGA 3Q3NC 3AH7A 3ZJTA 2KDMA 1YD8U 5HKHA 3UI3A 3AEDB 1T0RC 1EU4A 1HTQA 4F1SA 2J0KA 4JE3B 1FIQA 3B9JA 2JWUA 2ASQA 2HE7A 3BINA 2GRIA 5JHAA 5CHFA 1MVKA 1I4QA 3AXCA 1R4MI 2LMCA 3ALBA 3LXFA 1V86A 1WZ0A 4S0RA 1PGXA 1P7EA 1ZOYB 2O6VD 4CQNA 3QIJA 4BOZB 3RNEC 1TYGB 3MC8A 5CTRC 2DAJA 4MELA 4AOFA 3EFCA 3FKYA 4NQLB 4PK1A 1V97A 1V5OA 2BKFA 4HROA 3PT2B 4B9KA 2WXPA 3DVGX 2K9XA 3VRBB 2N4FA 4PS3A 3R2TA 4WJQA 3GE8C 4MJSA 4BBNC 1QOGA 1WRDB 4KGSA 1RYJA 1J7BA 4OVUA 4A90A 4LNKA 4K81A 3FILB 1TJEA 3PRMB 1E8XA 4K7SA 1WGHA 2DZJA 1V8CA 1T5XD 3AE7B 2AL3A 4NAWA 3QX1A 2LUMA 3BIID 4EFOA 3A9JA 5EE1A 3VH4B 2J42A 2A4ZA 1SJHD 1FEHA 2M4NA 2RPVA 1NENB 2O6VA 2LVPA 3H6NA 3HIZA 2X38A 3W9CB 3T3OA 3NUHB 4NY0A 1D4BA 2QEJC 3HRDD 4HJGE 2INCC 1WYGA 2G45B 2KDFB 2W3SA 1J7CA 2JF5A 2I2YA 3DBRB 3P4RB 2REXA 4AJYB 3PGEA 4GSWA 2WP9B 2DYBA 4AS1A 1ESFA 3SFDB 3PTFC 1FO4A 3OAWA 1BMLC 1TTNA 4G3XB 1CMXB 1DOXA 1KLGD 1GNUA 2ZVOA 1AW7A 1NI3A 3P1MA 2QDFA 1DGJA 4I6LB 4LLGM 3O13A 4FLHA 3GOEA 4E71A 2CU3A 4YSZB 1V2YA 2EELA 2MP2B 1LQBA 2J53A 3IAS1 4EZKA 4PYUA 5BMHA 4GDLA 1TS2A 3ZJVA 1FPYA 4HKQA 1UWMA 1EF1A 2JT4B 1WXSA 2OEDA 2LVQA 2WDQB 3PRPB 3VVWB 3T3NA 3Q69A 3QJZA 2J7QB 2BB6A 4TSSA 4M8MA 3ZTCA 4ZRKA 2RSUA 3PLUA 4FHJA 1Q5WB 3TMPB 2WXHA 1SEBD 1WR1A 2HJ8A 3IFWB 1ZPSA 1K51A 1MJDA 1OQQA 2WS3B 4TV3A 4MGKE 4W9HA 2LJ5A 1P7FA 2V3NA 2WDVB 3AE2B 5AEKB 2N0SB 4KSKC 3SR6A 3DWGC 3ZLZA 4B0MA 3BYYB 4LJOB 4M02A 4F7ZA 1C76A 1V81A 5IOIA 1EWYC 3EHVA 2CHWA 2KJHB 2JRHA 1I7HA 3VFKA 4LK0M 3KWLA 2L7RA 3AE6B 4DDID 5AZGA 4GU2A 1YQ4B 2KK8A 3ML9A 3BVZA 4HWIB 1PYWD 4IWPA 3TEWA 3VAWA 4IKGA 3Q8FA 4TKNA 4WAAA 2A5UA 4MSMB 3U7DA 5LXHA 3I3TB 2LUEA 4XGAB 5D94A 1D5MC 3KH0A 2KQSA 3KLSX 2JUOA 3BVMA 2KN5A 1SIJA 4RCOA 2FAZA 2N9PC 2BB5A 1C4AA 2QCZA 3H9DA 4A6QA 2IO3B 3RFZB 4C56C 1SE4A 2PW9A 2AL6A 2RDHA 3MTNB 4WWNA 1GB1A 4EZJA 4HEA1 1VCBA 2BS2B 4R3DA 1F52A 4HK2A 3ZDTA 1WF9A 3RNFC 2VH1A 1WXVA 2J0MA 1OEYJ 3MC9A 3Q6BA 1QQRA 2N9XA 3AEGB 2ON8A 2KX0A 3SHQA 2KX3A 5IAAC 2WQYB 1QLBB 4N9F4 3NVVA 2ZPNA 3M3JA 4LJPB 3LB8C 3AE4B 3X0WA 2IO2B 1R4MB 4ICUA 1V1PB 2INNE 3AM9A 2INDC 3R7RA 4PYZA 1KLVA 2H88B 1F2RI 1YJ1A 1E7VA 1FFUA 4WQOB 2YLMA 4O1NA 2DAFA 3VUXA 3GB1A 4WWOA 1UWXA 1FXTB 1KOTA 2RR9A 2NS5A 3Q3MC 1J0GA 1JQ4A 1R4NI 1C3TA 4GB9A 3IBEA 2DYMA 1QILA
chains in the Genus database with same CATH topology
4MM3A 3TBLD 3WANA 2IBIB 1WX7A 2L3ZA 3PHWB 1S1QB 2CR5A 2KJRA 2L8JA 4GIVA 3VQIA 1WE6A 4DDGD 2KANA 3APDA 4JQWC 2PEAA 2O2VA 3L16A 5AZHA 2D11A 3EECA 3DBHI 2ZNVC 1F9JA 1V80A 1WM2A 3NS8A 3KVFB 1EO6A 1UBQA 2KMCA 3EC8A 4G11A 1UELA 2JVCA 5DPSA 3RCZA 3APFA 1Y8RC 2M8SA 5TR5A 2BWFA 2V4LA 2KJ6A 4G50A 3KYDD 4GDKA 3AU4A 4WJNA 1J8CA 3PRZA 1NDDA 1GUAB 4CHKA 2DZIA 1WMHA 2LRWA 2LZ6A 1E8ZA 1A5RA 3L13A 1WXAA 1L2NA 4DHZE 3HM6X 5J2RA 3QK0A 3QQ8B 4HJKA 3DVNU 2RPQA 3AU5A 4W9JA 2Y5BB 2MRPA 3A9KA 4FULA 3VTUA 3ZO5B 5LXIB 1IPGA 2ZPYA 3N30A 3ZNID 4BKTA 3Q3FA 4FADA 2LGDA 2XK5A 4KIKB 3SU8X 2AYOB 3QA8A 2MBHA 2MBOA 2ZJDA 4RMAA 2PE6B 3IVFA 3CF6E 3A4SC 2GBNA 3TIXA 3WIMA 3HM3A 1RLFA 3O65B 1G6JA 2GBRA 5CX3A 4XC2A 4W9KA 2V1YA 4ZRJA 3T8MA 4W9GA 3DOWA 2EMTA 4HXDA 4EUTA 1E8YA 3UQBA 1WJNA 2L00B 5D2MB 1D3ZA 4URKA 4GN1A 1TGZB 1VD2A 1ZKHA 4EEWA 3L0WB 1ZW7A 3N32A 4I6NB 4HPMB 1E90A 4KDIC 4MH0E 4NJ6A 4BVUC 2JWZA 2MA9B 1YIWA 3A4RA 1Q0WB 2O2VB 2MQJA 3RYTA 4EKUA 4BKSA 2HD5B 2PPHA 4YL8A 5G2NA 4HPLB 2FNJB 2R2QA 3QWZB 4K7UA 1P0RA 3WALA 4F8CB 3VTWA 2JPHA 3N3KB 2D10A 1GC6A 4GDKB 3V61A 3U8ZA 3CMMB 3T9LA 4HVBA 1QZEA 2C5LC 2KXJA 3AULA 4DK5A 2MX2A 1WMHB 3L08A 4FJVB 4MEMA 3UIPB 2C60A 5DPRA 3ECIA 5C1ZA 2KWVB 3X23A 4IM2A 1GJZA 4BFRA 2R2OA 1TBEA 1NBFC 4GXBA 3HHMA 4ANUA 2CHXA 2K6DB 4DHJD 1GG3A 1WGYA 1U4AA 2KHWB 3A9KB 2EKEC 3NY5A 1E5WA 2GBMA 2AEHA 1LM8B 2JXXA 2XK5B 2ZEQA 3NZUA 4NJ7A 5KHQA 3DVGY 2KZRA 2V3SA 4I6PA 1WGGA 1WX9A 4MGZE 3H1UA 5EDSA 2K6QA 3AI5A 1WR6E 4BKGA 2IO0B 3DPDA 4PS7A 3LJ3A 1UH6A 2BYFA 4JGHB 4WJOA 1YD8U 2CU1A 3Q3JA 5HKHA 1P9DU 2K39A 1S3SG 2BGFA 2K1FA 5CHVC 4F1SA 2J0KA 3ONSA 3OJ4B 1WH3A 2DYOA 5JZEB 1W6VA 1EF5A 1XQQA 2WWZA 3RZWC 2ASQA 2HE7A 3BINA 4M8NA 1V49A 5JHAA 4IWOA 5CHFA 2RD0A 1WJ6A 4K7WA 3RUIB 2K8CA 3AXCA 3IHPC 4FN2A 3LMNA 1R4MI 2WYQA 3ALBA 4IM3A 1V86A 2FCNA 1WZ0A 4PS8A 4IUMB 4FHKA 3HK0A 1PQSA 4E74A 2O6VD 2LRUA 3SD5A 2NBVB 1X1MA 3QIJA 2Z59B 2N7EA 4P7IA 4BOZB 2MLBA 1IYFA 2MBBB 2M0XA 4GGQA 5CTRC 4W9IA 2MSED 3ZUNA 2DAJA 3TL5A 2AWTA 3H7SA 4MELA 2B3AA 5G55A 4AOFA 4IG7B 2LXAA 3OLMD 3QCAA 3ZRCA 2IY1B 4NQLB 2Z0DB 1V5OA 4FBJB 2BKFA 2NBWB 2KC2A 5D7GA 3PT2B 5KHOA 4B9KA 3DVGX 2N4FA 4PS3A 2CKHB 4FJYA 4IW0A 4WJQA 4DHZB 2MCNB 3QARA 2OJRA 2Z0EB 4MJSA 4BBNC 2N1WA 1I35A 1WRDB 4NNJB 1EUVB 1WXMA 4OVUA 2KKCA 2ZNVB 3PREA 4LCDE 1SIFA 4K81A 3PLVA 3PRMB 2KNBA 4HCPB 4KZCA 4DBGA 2PE9A 1E8XA 3IG3A 4K7SA 2NCNA 1WGHA 2DZJA 5BO4B 2G3QB 1UBIA 4HCNB 1UD7A 3ZW3A 1Q1OA 2AL3A 2KDBA 4NAWA 4EZLA 3QX1A 2PJHA 3R3MA 1RRBA 3GZNI 4EFOA 3PZDA 3ZVVA 3A9JA 1XD3B 3VH4B 2KLGA 5E6OA 2A4ZA 3TCAA 2IY0B 2M4NA 3R7QA 5E6PA 1WY8A 1WJUA 2O6VA 2LVPA 1NI2A 3H6NA 4MGIE 3S2AA 4TQ0A 1V9JA 3HIZA 2MP2A 1E8WA 2K8BA 1WGRA 2I1KA 4HDQA 4FA6A 4MGYE 4NQKE 3NZSA 4FJZA 4NY0A 2QHOA 3JVZX 2NVUI 3UIOB 3MJWA 2DHZA 3VXWA 1RFAA 4E3CA 2KD0A 2JZ3B 4CO7A 2J0JA 4KV2A 2G45B 2KDFB 2JF5A 2MW5A 4MJSB 2LASA 4EOYA 2REXA 4AJYB 2MBEA 1YX6B 3PGEA 4GSWA 3W1SC 3VDZA 2W9NA 2N9EB 1T0YA 2IYDB 1UGMA 3ZNGC 4K1RB 2DYBA 3JW0X 4G0NB 4W9EA 4XX5A 1OEYA 3PTFC 4MDKE 3B08A 2ZCCA 3JYUA 3KUDB 3OAWA 4W9FA 4NAWB 1TTNA 3RD2A 3M62B 2IZVB 4G3XB 1AARA 2LD9A 1C1YB 3NOBA 1RAXA 2IO1B 5D6JB 1CMXB 4LDTB 4ANVA 4ANWA 1GNUA 3A9JB 1Z2MA 3L17A 3UINB 1LXDA 2ZVOA 2WX1A 3D32A 3DQVA 4MSQB 3DVNV 4II2B 4I6LB 4W9LA 3W1YA 2EMSA 4FLHA 4E71A 3GOEA 2O6VB 2GBJA 1WIAA 2KDIA 3VTVA 5GMVA 5DPWA 1V2YA 2KFKA 2LWPA 4X57B 2MP2B 2WX0A 1LQBA 3RULA 4EZKA 3A33B 3ENEA 1WJ4A 2JZZA 4IM0A 2MWSB 4PYUA 5LLIA 1SE9A 4GDLA 4II3B 3KUZA 1EF1A 2JT4B 3KYCD 3PHXB 1WXSA 3WAPA 3DBSA 2KFJA 4ZDVA 2LVQA 5DPTA 2DENB 2LGXA 5CHWA 3PRPB 3BY4B 3VVWB 3KW5B 2FIFA 5E6NA 1WE7A 4XZ4A 3PS6A 3VUYA 3QJZA 2J7QB 2ZVNA 2KTFA 1UZXB 4M8MA 3ZTCA 1WYWB 5J17A 4ZRKA 2RSUA 2I1JA 4BBNF 2FCSA 3PLUA 1GC7A 3L54A 3CSTA 2UWQA 4FHJA 2G4DB 3NHEB 1Q5WB 4ANXA 3TMPB 2D07B 2FCMA 3V6CB 3DBLI 1WZ3A 1WR1A 2CHZA 2HJ8A 3IFWB 5L83A 4KSLC 1YX5B 1P1AA 4TV3A 4BKSD 4KVGB 4MGKE 4W9HA 2LJ5A 2KFKB 2KOXA 2HTHA 4JLCA 4GOCA 1ZGUB 3U30A 2NBUA 3B0AA 5AEKB 4KSKC 1OGWA 1J19A 4GDLB 3K9OB 1OQYA 3ZLZA 2MBQA 1I42A 2ZZPB 3JSVA 1MG8A 1E7UA 1WGDA 3VUWA 1M94A 3VH3B 1HE8A 2KQ7A 4IC7B 4ZRIA 1OTRB 3LDZE 2K8HA 4LJOB 4A3PA 2YVCA 2L0TA 1H8CA 4F7ZA 1K8RB 1V81A 1P98A 3EHVA 4RM8A 2CHWA 2KJHB 2JRHA 3VFKA 3W1SA 3L10B 2L7RA 3B1LX 3V62A 2BYEA 2RGFA 3A1QA 3R66C 1V6EA 3QHTA 2L05A 4DDID 5AZGA 3ZKJC 4W9DA 2D2QA 1L7YA 4KZ0A 4GU2A 2BPSA 2KWUB 3CSFA 5L95C 3PPAA 2KK8A 3ML9A 4ASWC 5J18A 1KJTA 1WM3A 4HWIB 2GBKA 4IWPA 1SGHA 3VAWA 1BT0A 4TKNA 3ZDMC 3P2BA 4WAAA 3VHTC 2A5UA 4WJPA 4MSMB 4DHJB 4DWFA 3RT3B 3EFUA 3U7DA 4KDLB 3TJPA 5LXHA 3I3TB 2DZKA 2LUEA 3OJ3A 5D94A 4B95A 1H4RA 3KH0A 4AWJA 1KM7A 2KQSA 3DDCB 2JUOA 4HLEA 4ZYNA 2BF8B 2KN5A 2KTRA 2UYZB 2G4SA 3SDLC 3RZFA 4JIOU 2C7NB 3ZRFA 5FR6A 3WA0A 2C9WB 2KC1A 1YQBA 3ZNHB 3K9PB 5IA7A 4A3OA 3JSVB 2FAZA 2N9PC 2LXCA 2ZCBA 4AJWA 4W9CA 3C0RB 4ICVA 3ZIMA 3H9DA 3QC8B 2IO3B 3ZNZB 2JY6A 1WI0A 2GOWA 2AL6A 2M1MA 1ISNA 2LGYA 2FUHB 3MTNB 3DBRI 4WWNA 4OVVA 4EZJA 3KUCB 3V60A 1VCBA 2BKRB 3A1QB 4HK2A 3ZDTA 4GMVA 2KWCA 4AUQC 1WF9A 2C7HA 2DX5B 3PVLA 4TQ1A 1WXVA 2J0MA 1OEYJ 2FCQA 1V5TA 4J6IA 4JL9A 2N9XA 4A20A 2KX0A 3H7PA 4AP4C 2NPTA 3SHQA 2KX3A 2L0FA 5JHBA 4IWQA 5IAAC 2NR2A 2M17A 4RM9A 1WFYA 1Z5SB 2BYVE 4BOSC 2DZMA 2LVOA 4N9F4 2LI5A 2ZPNA 2KMAA 3M3JA 4LJPB 1WX8A 4TUUA 3ZTDA 2KDEB 4DXAB 3X0WA 2C7MB 2IO2B 3DCGA 3M63B 2KTRB 2KO3A 2WDTB 4ICUA 4B6WA 2L76A 3WAOA 2K25A 3UQAA 2JRIB 2GMIC 4M0WB 5C23A 3R7RA 4PYZA 1KLVA 1JRUA 3APCA 2D3GA 2FIDA 2N1VA 3PSEB 5AZFA 1IP9A 3M95A 3WAMA 2OOBB 1YJ1A 4LDTD 1E7VA 3PV1A 3V6EB 4WQOB 2BWES 2YLMA 5JH5C 2N7DA 1LFDA 2DAFA 3VUXA 4CYEA 2KVRA 4WWPA 4WWOA 4NPNA 1FXTB 2VRRB 1KOTA 4HDOA 3UGBB 2RR9A 3ML8A 2XEWA 4KIKA 2NS5A 1TZ1A 5DCNA 1J0GA 2CS4A 1XT9B 3UF8A 1R4NI 3H7PB 1C3TA 2NPTB 2XBBC 2KLCA 4GB9A 3IBEA 3MHSD 2DYMA 3QAQA 1P3QU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MM3 A;  3TBL D;  3WAN A;  2IBI B;  1WX7 A;  2L3Z A;  3PHW B;  1S1Q B;  2CR5 A;  2KJR A;  2L8J A;  4GIV A;  3VQI A;  1WE6 A;  4DDG D;  2KAN A;  3APD A;  4JQW C;  2PEA A;  2O2V A;  3L16 A;  5AZH A;  2D11 A;  3EEC A;  3DBH I;  2ZNV C;  1F9J A;  1V80 A;  1WM2 A;  3NS8 A;  3KVF B;  1EO6 A;  1UBQ A;  2KMC A;  3EC8 A;  4G11 A;  1UEL A;  2JVC A;  5DPS A;  3RCZ A;  3APF A;  1Y8R C;  2M8S A;  5TR5 A;  2BWF A;  2V4L A;  2KJ6 A;  4G50 A;  3KYD D;  4GDK A;  3AU4 A;  4WJN A;  1J8C A;  3PRZ A;  1NDD A;  1GUA B;  4CHK A;  2DZI A;  1WMH A;  2LRW A;  2LZ6 A;  1E8Z A;  1A5R A;  3L13 A;  1WXA A;  1L2N A;  4DHZ E;  3HM6 X;  5J2R A;  3QK0 A;  3QQ8 B;  4HJK A;  3DVN U;  2RPQ A;  3AU5 A;  4W9J A;  2Y5B B;  2MRP A;  3A9K A;  4FUL A;  3VTU A;  3ZO5 B;  5LXI B;  1IPG A;  2ZPY A;  3N30 A;  3ZNI D;  4BKT A;  3Q3F A;  4FAD A;  2LGD A;  2XK5 A;  4KIK B;  3SU8 X;  2AYO B;  3QA8 A;  2MBH A;  2MBO A;  2ZJD A;  4RMA A;  2PE6 B;  3IVF A;  3CF6 E;  3A4S C;  2GBN A;  3TIX A;  3WIM A;  3HM3 A;  1RLF A;  3O65 B;  1G6J A;  2GBR A;  5CX3 A;  4XC2 A;  4W9K A;  2V1Y A;  4ZRJ A;  3T8M A;  4W9G A;  3DOW A;  2EMT A;  4HXD A;  4EUT A;  1E8Y A;  3UQB A;  1WJN A;  2L00 B;  5D2M B;  1D3Z A;  4URK A;  4GN1 A;  1TGZ B;  1VD2 A;  1ZKH A;  4EEW A;  3L0W B;  1ZW7 A;  3N32 A;  4I6N B;  4HPM B;  1E90 A;  4KDI C;  4MH0 E;  4NJ6 A;  4BVU C;  2JWZ A;  2MA9 B;  1YIW A;  3A4R A;  1Q0W B;  2O2V B;  2MQJ A;  3RYT A;  4EKU A;  4BKS A;  2HD5 B;  2PPH A;  4YL8 A;  5G2N A;  4HPL B;  2FNJ B;  2R2Q A;  3QWZ B;  4K7U A;  1P0R A;  3WAL A;  4F8C B;  3VTW A;  2JPH A;  3N3K B;  2D10 A;  1GC6 A;  4GDK B;  3V61 A;  3U8Z A;  3CMM B;  3T9L A;  4HVB A;  1QZE A;  2C5L C;  2KXJ A;  3AUL A;  4DK5 A;  2MX2 A;  1WMH B;  3L08 A;  4FJV B;  4MEM A;  3UIP B;  2C60 A;  5DPR A;  3ECI A;  5C1Z A;  2KWV B;  3X23 A;  4IM2 A;  1GJZ A;  4BFR A;  2R2O A;  1TBE A;  1NBF C;  4GXB A;  3HHM A;  4ANU A;  2CHX A;  2K6D B;  4DHJ D;  1GG3 A;  1WGY A;  1U4A A;  2KHW B;  3A9K B;  2EKE C;  3NY5 A;  1E5W A;  2GBM A;  2AEH A;  1LM8 B;  2JXX A;  2XK5 B;  2ZEQ A;  3NZU A;  4NJ7 A;  5KHQ A;  3DVG Y;  2KZR A;  2V3S A;  4I6P A;  1WGG A;  1WX9 A;  4MGZ E;  3H1U A;  5EDS A;  2K6Q A;  3AI5 A;  1WR6 E;  4BKG A;  2IO0 B;  3DPD A;  4PS7 A;  3LJ3 A;  1UH6 A;  2BYF A;  4JGH B;  4WJO A;  1YD8 U;  2CU1 A;  3Q3J A;  5HKH A;  1P9D U;  2K39 A;  1S3S G;  2BGF A;  2K1F A;  5CHV C;  4F1S A;  2J0K A;  3ONS A;  3OJ4 B;  1WH3 A;  2DYO A;  5JZE B;  1W6V A;  1EF5 A;  1XQQ A;  2WWZ A;  3RZW C;  2ASQ A;  2HE7 A;  3BIN A;  4M8N A;  1V49 A;  5JHA A;  4IWO A;  5CHF A;  2RD0 A;  1WJ6 A;  4K7W A;  3RUI B;  2K8C A;  3AXC A;  3IHP C;  4FN2 A;  3LMN A;  1R4M I;  2WYQ A;  3ALB A;  4IM3 A;  1V86 A;  2FCN A;  1WZ0 A;  4PS8 A;  4IUM B;  4FHK A;  3HK0 A;  1PQS A;  4E74 A;  2O6V D;  2LRU A;  3SD5 A;  2NBV B;  1X1M A;  3QIJ A;  2Z59 B;  2N7E A;  4P7I A;  4BOZ B;  2MLB A;  1IYF A;  2MBB B;  2M0X A;  4GGQ A;  5CTR C;  4W9I A;  2MSE D;  3ZUN A;  2DAJ A;  3TL5 A;  2AWT A;  3H7S A;  4MEL A;  2B3A A;  5G55 A;  4AOF A;  4IG7 B;  2LXA A;  3OLM D;  3QCA A;  3ZRC A;  2IY1 B;  4NQL B;  2Z0D B;  1V5O A;  4FBJ B;  2BKF A;  2NBW B;  2KC2 A;  5D7G A;  3PT2 B;  5KHO A;  4B9K A;  3DVG X;  2N4F A;  4PS3 A;  2CKH B;  4FJY A;  4IW0 A;  4WJQ A;  4DHZ B;  2MCN B;  3QAR A;  2OJR A;  2Z0E B;  4MJS A;  4BBN C;  2N1W A;  1I35 A;  1WRD B;  4NNJ B;  1EUV B;  1WXM A;  4OVU A;  2KKC A;  2ZNV B;  3PRE A;  4LCD E;  1SIF A;  4K81 A;  3PLV A;  3PRM B;  2KNB A;  4HCP B;  4KZC A;  4DBG A;  2PE9 A;  1E8X A;  3IG3 A;  4K7S A;  2NCN A;  1WGH A;  2DZJ A;  5BO4 B;  2G3Q B;  1UBI A;  4HCN B;  1UD7 A;  3ZW3 A;  1Q1O A;  2AL3 A;  2KDB A;  4NAW A;  4EZL A;  3QX1 A;  2PJH A;  3R3M A;  1RRB A;  3GZN I;  4EFO A;  3PZD A;  3ZVV A;  3A9J A;  1XD3 B;  3VH4 B;  2KLG A;  5E6O A;  2A4Z A;  3TCA A;  2IY0 B;  2M4N A;  3R7Q A;  5E6P A;  1WY8 A;  1WJU A;  2O6V A;  2LVP A;  1NI2 A;  3H6N A;  4MGI E;  3S2A A;  4TQ0 A;  1V9J A;  3HIZ A;  2MP2 A;  1E8W A;  2K8B A;  1WGR A;  2I1K A;  4HDQ A;  4FA6 A;  4MGY E;  4NQK E;  3NZS A;  4FJZ A;  4NY0 A;  2QHO A;  3JVZ X;  2NVU I;  3UIO B;  3MJW A;  2DHZ A;  3VXW A;  1RFA A;  4E3C A;  2KD0 A;  2JZ3 B;  4CO7 A;  2J0J A;  4KV2 A;  2G45 B;  2KDF B;  2JF5 A;  2MW5 A;  4MJS B;  2LAS A;  4EOY A;  2REX A;  4AJY B;  2MBE A;  1YX6 B;  3PGE A;  4GSW A;  3W1S C;  3VDZ A;  2W9N A;  2N9E B;  1T0Y A;  2IYD B;  1UGM A;  3ZNG C;  4K1R B;  2DYB A;  3JW0 X;  4G0N B;  4W9E A;  4XX5 A;  1OEY A;  3PTF C;  4MDK E;  3B08 A;  2ZCC A;  3JYU A;  3KUD B;  3OAW A;  4W9F A;  4NAW B;  1TTN A;  3RD2 A;  3M62 B;  2IZV B;  4G3X B;  1AAR A;  2LD9 A;  1C1Y B;  3NOB A;  1RAX A;  2IO1 B;  5D6J B;  1CMX B;  4LDT B;  4ANV A;  4ANW A;  1GNU A;  3A9J B;  1Z2M A;  3L17 A;  3UIN B;  1LXD A;  2ZVO A;  2WX1 A;  3D32 A;  3DQV A;  4MSQ B;  3DVN V;  4II2 B;  4I6L B;  4W9L A;  3W1Y A;  2EMS A;  4FLH A;  4E71 A;  3GOE A;  2O6V B;  2GBJ A;  1WIA A;  2KDI A;  3VTV A;  5GMV A;  5DPW A;  1V2Y A;  2KFK A;  2LWP A;  4X57 B;  2MP2 B;  2WX0 A;  1LQB A;  3RUL A;  4EZK A;  3A33 B;  3ENE A;  1WJ4 A;  2JZZ A;  4IM0 A;  2MWS B;  4PYU A;  5LLI A;  1SE9 A;  4GDL A;  4II3 B;  3KUZ A;  1EF1 A;  2JT4 B;  3KYC D;  3PHX B;  1WXS A;  3WAP A;  3DBS A;  2KFJ A;  4ZDV A;  2LVQ A;  5DPT A;  2DEN B;  2LGX A;  5CHW A;  3PRP B;  3BY4 B;  3VVW B;  3KW5 B;  2FIF A;  5E6N A;  1WE7 A;  4XZ4 A;  3PS6 A;  3VUY A;  3QJZ A;  2J7Q B;  2ZVN A;  2KTF A;  1UZX B;  4M8M A;  3ZTC A;  1WYW B;  5J17 A;  4ZRK A;  2RSU A;  2I1J A;  4BBN F;  2FCS A;  3PLU A;  1GC7 A;  3L54 A;  3CST A;  2UWQ A;  4FHJ A;  2G4D B;  3NHE B;  1Q5W B;  4ANX A;  3TMP B;  2D07 B;  2FCM A;  3V6C B;  3DBL I;  1WZ3 A;  1WR1 A;  2CHZ A;  2HJ8 A;  3IFW B;  5L83 A;  4KSL C;  1YX5 B;  1P1A A;  4TV3 A;  4BKS D;  4KVG B;  4MGK E;  4W9H A;  2LJ5 A;  2KFK B;  2KOX A;  2HTH A;  4JLC A;  4GOC A;  1ZGU B;  3U30 A;  2NBU A;  3B0A A;  5AEK B;  4KSK C;  1OGW A;  1J19 A;  4GDL B;  3K9O B;  1OQY A;  3ZLZ A;  2MBQ A;  1I42 A;  2ZZP B;  3JSV A;  1MG8 A;  1E7U A;  1WGD A;  3VUW A;  1M94 A;  3VH3 B;  1HE8 A;  2KQ7 A;  4IC7 B;  4ZRI A;  1OTR B;  3LDZ E;  2K8H A;  4LJO B;  4A3P A;  2YVC A;  2L0T A;  1H8C A;  4F7Z A;  1K8R B;  1V81 A;  1P98 A;  3EHV A;  4RM8 A;  2CHW A;  2KJH B;  2JRH A;  3VFK A;  3W1S A;  3L10 B;  2L7R A;  3B1L X;  3V62 A;  2BYE A;  2RGF A;  3A1Q A;  3R66 C;  1V6E A;  3QHT A;  2L05 A;  4DDI D;  5AZG A;  3ZKJ C;  4W9D A;  2D2Q A;  1L7Y A;  4KZ0 A;  4GU2 A;  2BPS A;  2KWU B;  3CSF A;  5L95 C;  3PPA A;  2KK8 A;  3ML9 A;  4ASW C;  5J18 A;  1KJT A;  1WM3 A;  4HWI B;  2GBK A;  4IWP A;  1SGH A;  3VAW A;  1BT0 A;  4TKN A;  3ZDM C;  3P2B A;  4WAA A;  3VHT C;  2A5U A;  4WJP A;  4MSM B;  4DHJ B;  4DWF A;  3RT3 B;  3EFU A;  3U7D A;  4KDL B;  3TJP A;  5LXH A;  3I3T B;  2DZK A;  2LUE A;  3OJ3 A;  5D94 A;  4B95 A;  1H4R A;  3KH0 A;  4AWJ A;  1KM7 A;  2KQS A;  3DDC B;  2JUO A;  4HLE A;  4ZYN A;  2BF8 B;  2KN5 A;  2KTR A;  2UYZ B;  2G4S A;  3SDL C;  3RZF A;  4JIO U;  2C7N B;  3ZRF A;  5FR6 A;  3WA0 A;  2C9W B;  2KC1 A;  1YQB A;  3ZNH B;  3K9P B;  5IA7 A;  4A3O A;  3JSV B;  2FAZ A;  2N9P C;  2LXC A;  2ZCB A;  4AJW A;  4W9C A;  3C0R B;  4ICV A;  3ZIM A;  3H9D A;  3QC8 B;  2IO3 B;  3ZNZ B;  2JY6 A;  1WI0 A;  2GOW A;  2AL6 A;  2M1M A;  1ISN A;  2LGY A;  2FUH B;  3MTN B;  3DBR I;  4WWN A;  4OVV A;  4EZJ A;  3KUC B;  3V60 A;  1VCB A;  2BKR B;  3A1Q B;  4HK2 A;  3ZDT A;  4GMV A;  2KWC A;  4AUQ C;  1WF9 A;  2C7H A;  2DX5 B;  3PVL A;  4TQ1 A;  1WXV A;  2J0M A;  1OEY J;  2FCQ A;  1V5T A;  4J6I A;  4JL9 A;  2N9X A;  4A20 A;  2KX0 A;  3H7P A;  4AP4 C;  2NPT A;  3SHQ A;  2KX3 A;  2L0F A;  5JHB A;  4IWQ A;  5IAA C;  2NR2 A;  2M17 A;  4RM9 A;  1WFY A;  1Z5S B;  2BYV E;  4BOS C;  2DZM A;  2LVO A;  4N9F 4;  2LI5 A;  2ZPN A;  2KMA A;  3M3J A;  4LJP B;  1WX8 A;  4TUU A;  3ZTD A;  2KDE B;  4DXA B;  3X0W A;  2C7M B;  2IO2 B;  3DCG A;  3M63 B;  2KTR B;  2KO3 A;  2WDT B;  4ICU A;  4B6W A;  2L76 A;  3WAO A;  2K25 A;  3UQA A;  2JRI B;  2GMI C;  4M0W B;  5C23 A;  3R7R A;  4PYZ A;  1KLV A;  1JRU A;  3APC A;  2D3G A;  2FID A;  2N1V A;  3PSE B;  5AZF A;  1IP9 A;  3M95 A;  3WAM A;  2OOB B;  1YJ1 A;  4LDT D;  1E7V A;  3PV1 A;  3V6E B;  4WQO B;  2BWE S;  2YLM A;  5JH5 C;  2N7D A;  1LFD A;  2DAF A;  3VUX A;  4CYE A;  2KVR A;  4WWP A;  4WWO A;  4NPN A;  1FXT B;  2VRR B;  1KOT A;  4HDO A;  3UGB B;  2RR9 A;  3ML8 A;  2XEW A;  4KIK A;  2NS5 A;  1TZ1 A;  5DCN A;  1J0G A;  2CS4 A;  1XT9 B;  3UF8 A;  1R4N I;  3H7P B;  1C3T A;  2NPT B;  2XBB C;  2KLC A;  4GB9 A;  3IBE A;  3MHS D;  2DYM A;  3QAQ A;  1P3Q U; 
#chains in the Genus database with same CATH topology
 3WAN A;  1JML A;  2L3Z A;  3PHW B;  2CR5 A;  3ZQ4 A;  4DDG D;  2KAN A;  4XE0 A;  4JQW C;  2HDE A;  5AZH A;  1ZXH A;  1HTO A;  2WXI A;  1F9J A;  1V80 A;  3NS8 A;  1EO6 A;  3PZ8 A;  1Y8R C;  5TR5 A;  4GDK A;  2DZI A;  2LZ6 A;  1XLO A;  1YJI A;  2H89 B;  1KTK A;  4ZRP A;  3ZO5 B;  3RN9 C;  4BKT A;  4FAD A;  1E7P B;  4KIK B;  2PE6 B;  3IVF A;  3CF6 E;  3E56 A;  2GBR A;  2V1Y A;  4YTN B;  3DOW A;  1FRD A;  4EUT A;  4RNA A;  1E10 A;  4EEW A;  1FXI A;  3N20 C;  3N32 A;  1E90 A;  4NJ6 A;  3PO0 A;  4BVU C;  3A4R A;  1YIW A;  2PPH A;  1EWC A;  4WWM A;  4IDI A;  4DXF A;  3WAL A;  1GC6 A;  3V61 A;  1B9R A;  1T0S C;  3CMM B;  3T9L A;  5G5H A;  2C5L C;  3AUL A;  3L08 A;  1XEE A;  2IGD A;  5C1Z A;  1JAL A;  2WXJ A;  1GJZ A;  1TBE A;  4ANU A;  2K6D B;  2WDR B;  1E6E B;  1WGY A;  3MHZ A;  2PIA A;  2EKE C;  1LM8 B;  2XK5 B;  1RFK A;  3U7Z A;  5EDS A;  3ZXV A;  3AI5 A;  1WR6 E;  2IO0 B;  2LJI A;  1UH6 A;  4C80 A;  1F2R C;  2K39 A;  2K1F A;  4LTU A;  1QKZ A;  3ONS A;  3OWE B;  3OJ4 B;  1WH3 A;  1W6V A;  2J4X A;  3FIL A;  2RD0 A;  2MHJ A;  1WJ6 A;  1XF5 L;  2K8C A;  4FN2 A;  4S17 A;  5BYQ A;  2WYQ A;  1T6B X;  4FHK A;  5EE9 A;  3BK1 A;  1PQS A;  2LRU A;  2NBV B;  1X1M A;  4HKZ E;  2DLB A;  4WIP A;  3HVZ A;  4P7I A;  1MPE A;  2MLB A;  1IYF A;  2M0X A;  4GGQ A;  4W9I A;  2MSE D;  2KVZ A;  2RDB C;  3ZUN A;  1STE A;  3P4S B;  3DWM A;  5G55 A;  4P1C C;  4IG7 B;  2LXA A;  2GLS A;  2Z0D B;  2NBW B;  2JYE A;  2WXF A;  1IGD A;  1EM7 A;  2MH7 A;  4M00 A;  2CKH B;  1SBB B;  3PRE A;  4WH4 A;  4LCD E;  3PLV A;  1TT5 B;  2KNB A;  1GPX A;  1UD7 A;  3ZW3 A;  1Q1O A;  2KDB A;  2AQ3 B;  4ZRQ A;  4RGO S;  5AUK A;  2BVC A;  1RRB A;  1SXT A;  1WSP A;  3PZD A;  3I63 C;  3TCA A;  1JWM D;  4ACF A;  1QF6 A;  4K3C A;  1TS3 A;  3ZGZ A;  1NI2 A;  3S2A A;  4TQ0 A;  1NYR A;  1V9J A;  2MP2 A;  2KQ4 X;  1C4C A;  3BYT B;  4NQK E;  3NZS A;  2IPK D;  1JWU D;  4E3C A;  4CO7 A;  1L0V B;  4KV2 A;  1VJK A;  4N59 A;  2MW5 A;  3AE3 B;  1FNU A;  2MBE A;  3SEB A;  2UU7 A;  3VDZ A;  1T0Y A;  1UGM A;  3ZNG C;  4K1R B;  1OEY A;  4MDK E;  3B08 A;  1DOY A;  4W9F A;  4DXG A;  3RD2 A;  2ONQ A;  2IZV B;  3M62 B;  1AAR A;  2BQQ A;  3NOB A;  1RAX A;  1Z2M A;  1NEK B;  3DQV A;  4MSQ B;  3DVN V;  2Y5C A;  3W1Y A;  2LFI A;  1WIA A;  2LWP A;  4MT5 A;  2RDG A;  3VRA B;  4II3 B;  4P16 A;  3KYC D;  3PHX B;  1HZ5 A;  3WAP A;  1OQR A;  5BMG A;  2LGX A;  1GOZ A;  1YMH E;  3GS2 A;  3BY4 B;  2K3U A;  2WXO A;  1D5Z C;  2QIE B;  3PS6 A;  3N1Z C;  2KTF A;  1R4N B;  3MFG A;  4YTP B;  1IUE A;  2I1J A;  5HFY A;  3I57 A;  2W82 A;  2OHF A;  3CST A;  2DWQ A;  3W2D A;  5L83 A;  2HTH A;  2KWD A;  2D3C A;  2NBU A;  1XLP A;  1J19 A;  1OQY A;  2MBQ A;  4ZHP A;  1Q10 A;  3AN1 A;  2L52 A;  4IC7 B;  2KQ7 A;  3N9Y C;  4A3P A;  1P98 A;  3Q8C A;  4ZHO A;  3L10 B;  4REZ A;  3V62 A;  1MG4 A;  4RF1 A;  4YT0 B;  3QHT A;  2L05 A;  4XDC A;  4KZ0 A;  2KWU B;  3CSF A;  5EE3 A;  4RH6 A;  3PPA A;  4ASW C;  4JX1 C;  2KYW A;  3DHI C;  5AUI A;  1N60 A;  3VHT C;  1DYQ A;  3EUB 2;  3OJ3 A;  4USA A;  4B95 A;  1NYQ A;  1TIF A;  3DDC B;  3NRZ A;  2PKO A;  2BF8 B;  2G4S A;  1V1P A;  1MI0 A;  4HPP A;  3LYY A;  2C9W B;  2K22 A;  3RNB C;  3ZNH B;  3K9P B;  1K52 A;  1IBX B;  3B2G A;  1AWD A;  4YSY B;  5IO9 A;  2M1M A;  2LEK A;  1A70 A;  5G5G A;  2LGY A;  4OVV A;  3KUC B;  3CIR B;  2KWC A;  1FCC C;  3PVL A;  1MFW A;  3EA6 A;  4JL9 A;  5FK9 C;  2KMM A;  5IKC M;  5JHB A;  2NR2 A;  1C77 A;  1Z5S B;  4US8 A;  1L0Y B;  2LVO A;  2R61 A;  4TUU A;  4DXA B;  3FC4 A;  3M63 B;  5E6J A;  2KTR B;  2WDT B;  3RNA C;  2MEK A;  2L76 A;  4B6W A;  4ARC A;  2JRI B;  4M0W B;  4ZOH C;  3TEZ A;  5MPO A;  1QOB A;  1JRU A;  2PMV A;  2D3G A;  2FID A;  3RI7 C;  2N1V A;  5AZF A;  2BTE A;  4LDT D;  3PV1 A;  1B1Z A;  4OHJ A;  2N7D A;  3U4E G;  1YNT E;  2KVR A;  2N9L A;  4BAX A;  4WWP A;  2VRR B;  3IT4 B;  1N6Z A;  4NJC A;  3UGB B;  1RWS A;  4KIK A;  1TZ1 A;  3NVZ A;  3H7P B;  2IDY A;  2XBB C;  2KLC A;  4FXC A;  1WM3 A;  3QAQ A;  2YEP B;  1MHH E;  1PFD A;  1S1Q B;  2KJR A;  3E9S A;  1WE6 A;  2M19 A;  3U2S C;  4YSX B;  3L16 A;  3U52 E;  1PGA A;  3EEC A;  3DBH I;  2VZK D;  1WM2 A;  2LHD A;  2KMC A;  2JVC A;  5DPS A;  1TKG A;  4G50 A;  3KYD D;  1GUA B;  2ICI A;  4CHK A;  3ETR A;  1OFF A;  3I9V 1;  5FKA C;  3HM6 X;  1I4X A;  5J2R A;  4HJK A;  1N5W A;  5H8Y E;  3NVY A;  1I4G A;  1YJJ A;  2NTS A;  5HI1 A;  4XWT A;  3Q3F A;  2M0A A;  2XK5 A;  4RMA A;  3EGR A;  3A4S C;  2GBN A;  3WIM A;  3HM3 A;  1RLF A;  2D5G A;  1CQV A;  4MM3 B;  2EMT A;  3ZYY X;  1FCL A;  2WU5 B;  3UQB A;  5D2M B;  2L00 B;  1D3Z A;  1TGZ B;  2AX5 A;  4HPM B;  4MH0 E;  1FD6 A;  2JWZ A;  4OZA A;  4HPL B;  3RNC C;  4K7U A;  3QWZ B;  4JWU C;  2WXL A;  3VTW A;  3B2F A;  2D10 A;  4DK5 A;  1WMH B;  4FJV B;  2C60 A;  1CZP A;  3X23 A;  4BFR A;  3RPF C;  4A55 A;  2WXR A;  2KHW B;  3NY5 A;  1E5W A;  1YOV B;  3NZU A;  2BBC A;  3DVG Y;  2V3S A;  1ZUD 2;  3H1U A;  1V1O A;  4A8X C;  3DPD A;  3LJ3 A;  5BYS A;  4JGH B;  2CU1 A;  4NAM A;  4KGR A;  1P9D U;  1S3S G;  5CHV C;  3Q14 C;  4IOI E;  1QT9 A;  1ROE A;  5JZE B;  1L4Z B;  2WWZ A;  4M8N A;  1V49 A;  2KAC A;  3LMN A;  4IM3 A;  2FCN A;  4IUM B;  1YN4 A;  3SD5 A;  5IP4 D;  2SAK A;  2WXN A;  4KX6 B;  4LNO A;  3TL5 A;  3H7S A;  3OLM D;  3QCA A;  2IY1 B;  5I4D A;  4FBJ B;  5D7G A;  1C9F A;  3NVW A;  5KHO A;  1L5P A;  4IW0 A;  3QAR A;  2Z0E B;  2N1W A;  1UUP A;  2KAJ A;  1LGR A;  1YN5 A;  1SIF A;  2Y5P A;  2JU6 X;  1HXY D;  4KZC A;  2NCN A;  1UBI A;  1YN3 A;  4EZL A;  2PJH A;  3HVD A;  1FFV A;  2KLG A;  1SE2 A;  5E6O A;  3R7Q A;  2BW2 A;  1WY8 A;  2N7J A;  1VDV A;  4MGI E;  1E8W A;  2K8B A;  2I1K A;  3L4P A;  1RM6 C;  3JVZ X;  2Y3A A;  3UIO B;  2DHZ A;  1WRI A;  3VXW A;  2KD0 A;  2J0J A;  3WCQ A;  4L1B A;  2FE8 A;  2LAS A;  1SSN A;  3W1S C;  2PTL A;  1EU3 A;  2W9N A;  2ACZ B;  1VLB A;  3JW0 X;  3ZJU A;  4W9E A;  4XX5 A;  1NVI D;  1L4D B;  2LD9 A;  1C1Y B;  1DOI A;  1HQR D;  2PVG C;  3I5J C;  1CK1 A;  5D6J B;  4LDT B;  3GP7 A;  4ANV A;  1TKY A;  1JWB D;  3L17 A;  2X8X X;  3UIN B;  2WX1 A;  3D32 A;  3P4Q B;  3W5U B;  3DHG C;  2CJO A;  2GBJ A;  2KDI A;  3VTV A;  5DPW A;  2IJ0 A;  3W5V B;  3DHH C;  2WX0 A;  3AE9 B;  3P4P B;  3V05 A;  3A33 B;  3ENE A;  1WJ4 A;  2JZZ A;  4IM0 A;  1SE9 A;  1WGK A;  4OZC A;  2WXK A;  3DBS A;  2KFJ A;  3P63 A;  2DEN B;  5CHW A;  1QOA A;  2FIF A;  5E6N A;  2N9K A;  4XZ4 A;  3N1X C;  3VUY A;  2VZK B;  2KN4 A;  2ZVN A;  2WXG A;  2IGH A;  1ZDV A;  4BBN F;  2FCS A;  2V3P A;  1FXA A;  1MHX A;  1HEZ E;  4OW0 A;  2EKI A;  1KLU D;  2G4D B;  1VR9 A;  1TZO A;  2D07 B;  2FCM A;  4YXD B;  3DBL I;  3DBH B;  1YX5 B;  2NTT A;  1SF0 A;  2ZW0 A;  4BKS D;  4KVG B;  2KFK B;  5TSS A;  4LNF A;  4JLC A;  4GOC A;  4WQM A;  2HJ1 A;  1N5X A;  3OG5 A;  1OGW A;  2W3R A;  2K5P A;  4YTM B;  2ZZP B;  3VR8 B;  1MG8 A;  1E7U A;  2QIL A;  1WGD A;  3BK2 A;  3AMZ A;  1HE8 A;  1PUT A;  3LDZ E;  4ZRI A;  2K8H A;  1IBX A;  1H8C A;  1UNS A;  1K8R B;  4RM8 A;  2CJN A;  3B1L X;  3R66 C;  2WHI A;  1V6E A;  2D2Q A;  2V9H A;  1L7Y A;  2BPS A;  3PZ7 A;  1KF6 B;  1JRO A;  1SGH A;  4L23 A;  3AE5 B;  1PGB A;  2DNF A;  1K50 A;  4AQ7 A;  2PVO D;  3ZDM C;  3P2B A;  4DWF A;  3RT3 B;  3TJP A;  4C7Z A;  2DZK A;  1H4R A;  1KM7 A;  2AQ2 B;  4HLE A;  2QC8 A;  2KTR A;  3SDL C;  3RZF A;  4JIO U;  4M0W A;  3ZRF A;  2IGG A;  1YQB A;  2RMM A;  3JSV B;  2LXC A;  4AJW A;  4W9C A;  3C0R B;  2OJW A;  3ZNZ B;  2KT7 A;  1WI0 A;  1PDX A;  2W55 A;  2FUH B;  2BKR B;  3A1Q B;  3Q2A C;  4GMV A;  4AUQ C;  2C7H A;  2DX5 B;  4TQ1 A;  1TKE A;  2FCQ A;  3MC0 B;  3H7P A;  4AP4 C;  2L0F A;  4RM9 A;  2M17 A;  2MJE A;  1JRP A;  4TMA B;  4BOS C;  2DZM A;  2KMA A;  3MP9 A;  4N6E B;  2XN9 C;  1I4P A;  4EE2 A;  2KO3 A;  3UQA A;  2M56 B;  4DQO C;  2GMI C;  3PSE B;  2DBY A;  2OOB B;  2I38 A;  3V6E B;  1AN8 A;  2BWE S;  5JH5 C;  1LFD A;  1L0X B;  2FBW B;  4CYE A;  5HG2 A;  4NPN A;  4HDO A;  1TY0 A;  3ML8 A;  2WGS A;  2V4I B;  5DCN A;  3UF8 A;  3AV8 A;  2NPT B;  3CWI A;  2WLB A;  1P3Q U;  4MM3 A;  1WX7 A;  4GIV A;  1K53 A;  1WXQ A;  4L2Y A;  2D11 A;  2WNM A;  2ZNV C;  4WUR A;  3KVF B;  3EC8 A;  3RCZ A;  3APF A;  2B76 B;  4C4V B;  4WJN A;  3AU4 A;  4XWW A;  3BZD B;  3PRZ A;  1NDD A;  1WMH A;  2LRW A;  1E8Z A;  1A5R A;  3L13 A;  1E0Z A;  1WXA A;  5H92 C;  1L2N A;  4DHZ E;  3QK0 A;  3NG0 A;  3DVN U;  3TEY A;  3AU5 A;  4W9J A;  2Y5B B;  4MAC A;  1XXG A;  3VTU A;  5LXI B;  3ZNI D;  2ZPY A;  1VZ7 A;  2LGD A;  2BYT A;  2L32 A;  3SU8 X;  2AYO B;  3QA8 A;  2MBH A;  1KFY B;  3KQ4 A;  2BT6 A;  3TIX A;  2BS4 B;  1G6J A;  3IAM 1;  5CX3 A;  1C79 A;  4XC2 A;  4W9K A;  4ZRJ A;  5JXV A;  4W9G A;  1SB3 C;  4URK A;  4GN1 A;  1VD2 A;  3L0W B;  4KDI C;  1D5X C;  2MA9 B;  1Q0W B;  2O2V B;  3H8H A;  4YL8 A;  1GAQ B;  5G2N A;  3R8B A;  1CJE A;  1IGC A;  2FNJ B;  4C00 A;  2JPH A;  3N3K B;  1C4P A;  3U8Z A;  1QZE A;  2KXJ A;  2WXQ A;  2WU2 B;  1YQ3 B;  2D3A A;  2R2O A;  3RMK C;  1KRH A;  2MJ3 A;  4DHJ D;  1GG3 A;  3AEA B;  1U4A A;  3A9K B;  2GBM A;  1ZE3 D;  2AEH A;  2JXX A;  4NJ7 A;  2KZR A;  4I6P A;  4QAY A;  1HA5 A;  1WX9 A;  3N1Y C;  4MGZ E;  2E3T A;  1KH0 A;  2K6Q A;  4BKG A;  1TS5 A;  4PS7 A;  3BVG A;  2BYF A;  4WJO A;  4ARI A;  3Q3J A;  3Q8A A;  4LNI A;  2BGF A;  2LHE A;  2DYO A;  4RF0 A;  1EF5 A;  1XQQ A;  2VH2 A;  3RZW C;  4IWO A;  4K7W A;  3Q3O C;  3RUI B;  3IHP C;  4PS8 A;  3C8Y A;  3HK0 A;  4E74 A;  1N62 A;  2Z59 B;  2N7E A;  3DBL B;  5IN7 A;  1TY2 A;  2MBB B;  1E9M A;  4LNN A;  2AWT A;  4K3B A;  2B3A A;  3AEE B;  2D3B A;  1F0Z A;  2FUG 1;  4GLS C;  3ZRC A;  1ET9 A;  2SEB D;  1XCQ L;  1XO3 A;  1J7A A;  3AB5 A;  2KC2 A;  2JQR B;  1ACC A;  4FJY A;  5D3I B;  4DHZ B;  2MCN B;  2OJR A;  1VRA B;  3R2I A;  1I35 A;  4NNJ B;  1EUV B;  1JWS D;  1WXM A;  4ZYS A;  1FM0 D;  4ITK A;  2KKC A;  2ZNV B;  4RGM A;  4C7Y A;  2NMQ A;  2J52 A;  4HCP B;  4DBG A;  2PE9 A;  3IG3 A;  3AEB B;  5BO4 B;  5D3D A;  2G3Q B;  4HCN B;  4B0E A;  3TSS A;  3R3M A;  3GZN I;  3ZVV A;  1XD3 B;  2IY0 B;  2V0G A;  3AEF B;  5E6P A;  5C2T B;  2LGI A;  2AQ1 B;  1WJU A;  1WGR A;  1QOF A;  4HDQ A;  4FA6 A;  4MGY E;  4FJZ A;  2QHO A;  2G9H D;  3AEC B;  2NVU I;  3AE1 B;  3MJW A;  1RFA A;  2JZ3 B;  5HHD G;  3NJT A;  4XDD A;  4MJS B;  2WXM A;  3URY A;  4EOY A;  1BXT A;  4J3O D;  4KKJ A;  1YX6 B;  4N58 A;  2L1A A;  1XCT L;  2N9E B;  2IYD B;  1FNW A;  2XNA C;  4G0N B;  4KGT A;  2ZCC A;  3JYU A;  3KUD B;  2BS3 B;  4NAW B;  1JCK B;  2QSD A;  1BUI C;  2IO1 B;  4ANW A;  1SJE D;  3A9J B;  1LXD A;  4D2K A;  1VZ8 A;  4II2 B;  4BZA A;  4W9L A;  2EMS A;  2O6V B;  5GMV A;  2KFK A;  4X57 B;  1HZ6 A;  1N63 A;  4A9A A;  1UF0 A;  3RUL A;  1SE3 A;  2MWS B;  5LLI A;  4P1B C;  3KUZ A;  4XYC A;  4ZDV A;  5DPT A;  1T3Q A;  3KW5 B;  1C78 A;  1WE7 A;  4JPS A;  1UZX B;  1WYW B;  5J17 A;  1GC7 A;  3L54 A;  2UWQ A;  1ET6 A;  3AE8 B;  3NHE B;  4ANX A;  4MH8 A;  3V6C B;  1WZ3 A;  2CHZ A;  5FR3 A;  2JSV X;  1GB4 A;  4KSL C;  1P1A A;  1F77 A;  2KOX A;  5BMI A;  2GI9 A;  4JWS C;  3BWU D;  1N61 A;  1ZGU B;  3U30 A;  3V3X A;  3B0A A;  4GDL B;  3K9O B;  1I42 A;  2LGS A;  3JSV A;  3VUW A;  1M94 A;  3VH3 B;  1M4V A;  1OTR B;  3Q8B A;  2YVC A;  2L0T A;  2E6X A;  3W1S A;  4RFB A;  4OVZ A;  4OZB A;  2BYE A;  2RGF A;  3A1Q A;  3ZKJ C;  4W9D A;  3TEX A;  2TSS A;  5L95 C;  4KKI A;  1WWT A;  2W54 A;  5J18 A;  1KJT A;  2GBK A;  1BT0 A;  3C19 A;  4WJP A;  4DHJ B;  4M01 A;  3GE3 C;  3EFU A;  4KDL B;  1LO5 D;  3ABV B;  4AWJ A;  4ZYN A;  2UYZ B;  5C3J B;  2HTM E;  2C7N B;  5FR6 A;  3WA0 A;  1F1H A;  2JZP A;  2KC1 A;  5IA7 A;  4A3O A;  4HRS A;  2ZCB A;  3P42 A;  4ICV A;  3ZIM A;  1VZ6 A;  3QC8 B;  4US9 A;  2JY6 A;  1L6V A;  4WAF A;  2GOW A;  1ISN A;  3DBR I;  3V60 A;  3FAH A;  4J6I A;  1V5T A;  1ZXI A;  2JXT A;  4A20 A;  1AYF A;  2NPT A;  4IWQ A;  1WFY A;  2BYV E;  2MJD A;  2QMT A;  2Z8L A;  2LI5 A;  1WX8 A;  3ZTD A;  2K0P A;  1FNV A;  2KDE B;  4YWG G;  1UGJ A;  2C7M B;  3IT6 B;  3DCG A;  2JYT A;  3HUI A;  2YEP F;  3WAO A;  2K25 A;  4C4V A;  1JW9 D;  5C23 A;  1JWA D;  3APC A;  1T0Q C;  1IP9 A;  3M95 A;  3WAM A;  1R7S A;  1ENF A;  3VR9 B;  3NZ3 A;  1Y56 A;  2XEW A;  1XLQ A;  2CS4 A;  1FMA D;  1XT9 B;  3MHS D;  2L83 A;  3TBL D;  2IBI B;  3SFE B;  2L8J A;  3VQI A;  3APD A;  3KWV A;  2PEA A;  3Q8E A;  2O2V A;  2INP E;  1UBQ A;  4G11 A;  1UEL A;  2M8S A;  1FRR A;  2BWF A;  2V4L A;  2KJ6 A;  1J8C A;  3GZN B;  1XLN A;  5EE0 A;  3TUO A;  4UDU C;  3QQ8 B;  2RPQ A;  3ZXR A;  2MRP A;  1I4H A;  3A9K A;  4FUL A;  2PLP A;  1IPG A;  3N30 A;  2ZJD A;  2MBO A;  1I4R A;  1ZP0 B;  1ZDX A;  2GB1 A;  5T8I A;  2G1E A;  3O65 B;  4H2A A;  2QJL A;  1TS4 A;  3T8M A;  5LNK 1;  4HXD A;  1E8Y A;  1WJN A;  1ZKH A;  1ZW7 A;  2Q5W D;  4I6N B;  4EKU A;  3RYT A;  2MQJ A;  3IXS A;  2ZW1 A;  4BKS A;  1D6E C;  2HD5 B;  4RGN A;  2JX5 A;  3RNG C;  2R2Q A;  1P0R A;  3MJ5 A;  4F8C B;  5BYR A;  4GDK B;  5GXG B;  4HVB A;  2MX2 A;  4MEM A;  3UIP B;  5DPR A;  3ECI A;  4PT5 A;  2KWV B;  4IM2 A;  4RGT A;  4P6V F;  1NBF C;  4GXB A;  3HHM A;  2CHX A;  4Q2J A;  1L6U A;  3NS1 A;  4NZL B;  3J9C A;  2ZEQ A;  5KHQ A;  1WGG A;  3Q3N C;  3AH7 A;  3ZJT A;  2KDM A;  1YD8 U;  5HKH A;  3UI3 A;  3AED B;  1T0R C;  1EU4 A;  1HTQ A;  4F1S A;  2J0K A;  4JE3 B;  1FIQ A;  3B9J A;  2JWU A;  2ASQ A;  2HE7 A;  3BIN A;  2GRI A;  5JHA A;  5CHF A;  1MVK A;  1I4Q A;  3AXC A;  1R4M I;  2LMC A;  3ALB A;  3LXF A;  1V86 A;  1WZ0 A;  4S0R A;  1PGX A;  1P7E A;  1ZOY B;  2O6V D;  4CQN A;  3QIJ A;  4BOZ B;  3RNE C;  1TYG B;  3MC8 A;  5CTR C;  2DAJ A;  4MEL A;  4AOF A;  3EFC A;  3FKY A;  4NQL B;  4PK1 A;  1V97 A;  1V5O A;  2BKF A;  4HRO A;  3PT2 B;  4B9K A;  2WXP A;  3DVG X;  2K9X A;  3VRB B;  2N4F A;  4PS3 A;  3R2T A;  4WJQ A;  3GE8 C;  4MJS A;  4BBN C;  1QOG A;  1WRD B;  4KGS A;  1RYJ A;  1J7B A;  4OVU A;  4A90 A;  4LNK A;  4K81 A;  3FIL B;  1TJE A;  3PRM B;  1E8X A;  4K7S A;  1WGH A;  2DZJ A;  1V8C A;  1T5X D;  3AE7 B;  2AL3 A;  4NAW A;  3QX1 A;  2LUM A;  3BII D;  4EFO A;  3A9J A;  5EE1 A;  3VH4 B;  2J42 A;  2A4Z A;  1SJH D;  1FEH A;  2M4N A;  2RPV A;  1NEN B;  2O6V A;  2LVP A;  3H6N A;  3HIZ A;  2X38 A;  3W9C B;  3T3O A;  3NUH B;  4NY0 A;  1D4B A;  2QEJ C;  3HRD D;  4HJG E;  2INC C;  1WYG A;  2G45 B;  2KDF B;  2W3S A;  1J7C A;  2JF5 A;  2I2Y A;  3DBR B;  3P4R B;  2REX A;  4AJY B;  3PGE A;  4GSW A;  2WP9 B;  2DYB A;  4AS1 A;  1ESF A;  3SFD B;  3PTF C;  1FO4 A;  3OAW A;  1BML C;  1TTN A;  4G3X B;  1CMX B;  1DOX A;  1KLG D;  1GNU A;  2ZVO A;  1AW7 A;  1NI3 A;  3P1M A;  2QDF A;  1DGJ A;  4I6L B;  4LLG M;  3O13 A;  4FLH A;  3GOE A;  4E71 A;  2CU3 A;  4YSZ B;  1V2Y A;  2EEL A;  2MP2 B;  1LQB A;  2J53 A;  3IAS 1;  4EZK A;  4PYU A;  5BMH A;  4GDL A;  1TS2 A;  3ZJV A;  1FPY A;  4HKQ A;  1UWM A;  1EF1 A;  2JT4 B;  1WXS A;  2OED A;  2LVQ A;  2WDQ B;  3PRP B;  3VVW B;  3T3N A;  3Q69 A;  3QJZ A;  2J7Q B;  2BB6 A;  4TSS A;  4M8M A;  3ZTC A;  4ZRK A;  2RSU A;  3PLU A;  4FHJ A;  1Q5W B;  3TMP B;  2WXH A;  1SEB D;  1WR1 A;  2HJ8 A;  3IFW B;  1ZPS A;  1K51 A;  1MJD A;  1OQQ A;  2WS3 B;  4TV3 A;  4MGK E;  4W9H A;  2LJ5 A;  1P7F A;  2V3N A;  2WDV B;  3AE2 B;  5AEK B;  2N0S B;  4KSK C;  3SR6 A;  3DWG C;  3ZLZ A;  4B0M A;  3BYY B;  4LJO B;  4M02 A;  4F7Z A;  1C76 A;  1V81 A;  5IOI A;  1EWY C;  3EHV A;  2CHW A;  2KJH B;  2JRH A;  1I7H A;  3VFK A;  4LK0 M;  3KWL A;  2L7R A;  3AE6 B;  4DDI D;  5AZG A;  4GU2 A;  1YQ4 B;  2KK8 A;  3ML9 A;  3BVZ A;  4HWI B;  1PYW D;  4IWP A;  3TEW A;  3VAW A;  4IKG A;  3Q8F A;  4TKN A;  4WAA A;  2A5U A;  4MSM B;  3U7D A;  5LXH A;  3I3T B;  2LUE A;  4XGA B;  5D94 A;  1D5M C;  3KH0 A;  2KQS A;  3KLS X;  2JUO A;  3BVM A;  2KN5 A;  1SIJ A;  4RCO A;  2FAZ A;  2N9P C;  2BB5 A;  1C4A A;  2QCZ A;  3H9D A;  4A6Q A;  2IO3 B;  3RFZ B;  4C56 C;  1SE4 A;  2PW9 A;  2AL6 A;  2RDH A;  3MTN B;  4WWN A;  1GB1 A;  4EZJ A;  4HEA 1;  1VCB A;  2BS2 B;  4R3D A;  1F52 A;  4HK2 A;  3ZDT A;  1WF9 A;  3RNF C;  2VH1 A;  1WXV A;  2J0M A;  1OEY J;  3MC9 A;  3Q6B A;  1QQR A;  2N9X A;  3AEG B;  2ON8 A;  2KX0 A;  3SHQ A;  2KX3 A;  5IAA C;  2WQY B;  1QLB B;  4N9F 4;  3NVV A;  2ZPN A;  3M3J A;  4LJP B;  3LB8 C;  3AE4 B;  3X0W A;  2IO2 B;  1R4M B;  4ICU A;  1V1P B;  2INN E;  3AM9 A;  2IND C;  3R7R A;  4PYZ A;  1KLV A;  2H88 B;  1F2R I;  1YJ1 A;  1E7V A;  1FFU A;  4WQO B;  2YLM A;  4O1N A;  2DAF A;  3VUX A;  3GB1 A;  4WWO A;  1UWX A;  1FXT B;  1KOT A;  2RR9 A;  2NS5 A;  3Q3M C;  1J0G A;  1JQ4 A;  1R4N I;  1C3T A;  4GB9 A;  3IBE A;  2DYM A;  1QIL A; 
#chains in the Genus database with same CATH homology
 4MM3 A;  3TBL D;  3WAN A;  2IBI B;  1WX7 A;  2L3Z A;  3PHW B;  1S1Q B;  2CR5 A;  2KJR A;  2L8J A;  4GIV A;  3VQI A;  1WE6 A;  4DDG D;  2KAN A;  3APD A;  4JQW C;  2PEA A;  2O2V A;  3L16 A;  5AZH A;  2D11 A;  3EEC A;  3DBH I;  2ZNV C;  1F9J A;  1V80 A;  1WM2 A;  3NS8 A;  3KVF B;  1EO6 A;  1UBQ A;  2KMC A;  3EC8 A;  4G11 A;  1UEL A;  2JVC A;  5DPS A;  3RCZ A;  3APF A;  1Y8R C;  2M8S A;  5TR5 A;  2BWF A;  2V4L A;  2KJ6 A;  4G50 A;  3KYD D;  4GDK A;  3AU4 A;  4WJN A;  1J8C A;  3PRZ A;  1NDD A;  1GUA B;  4CHK A;  2DZI A;  1WMH A;  2LRW A;  2LZ6 A;  1E8Z A;  1A5R A;  3L13 A;  1WXA A;  1L2N A;  4DHZ E;  3HM6 X;  5J2R A;  3QK0 A;  3QQ8 B;  4HJK A;  3DVN U;  2RPQ A;  3AU5 A;  4W9J A;  2Y5B B;  2MRP A;  3A9K A;  4FUL A;  3VTU A;  3ZO5 B;  5LXI B;  1IPG A;  2ZPY A;  3N30 A;  3ZNI D;  4BKT A;  3Q3F A;  4FAD A;  2LGD A;  2XK5 A;  4KIK B;  3SU8 X;  2AYO B;  3QA8 A;  2MBH A;  2MBO A;  2ZJD A;  4RMA A;  2PE6 B;  3IVF A;  3CF6 E;  3A4S C;  2GBN A;  3TIX A;  3WIM A;  3HM3 A;  1RLF A;  3O65 B;  1G6J A;  2GBR A;  5CX3 A;  4XC2 A;  4W9K A;  2V1Y A;  4ZRJ A;  3T8M A;  4W9G A;  3DOW A;  2EMT A;  4HXD A;  4EUT A;  1E8Y A;  3UQB A;  1WJN A;  2L00 B;  5D2M B;  1D3Z A;  4URK A;  4GN1 A;  1TGZ B;  1VD2 A;  1ZKH A;  4EEW A;  3L0W B;  1ZW7 A;  3N32 A;  4I6N B;  4HPM B;  1E90 A;  4KDI C;  4MH0 E;  4NJ6 A;  4BVU C;  2JWZ A;  2MA9 B;  1YIW A;  3A4R A;  1Q0W B;  2O2V B;  2MQJ A;  3RYT A;  4EKU A;  4BKS A;  2HD5 B;  2PPH A;  4YL8 A;  5G2N A;  4HPL B;  2FNJ B;  2R2Q A;  3QWZ B;  4K7U A;  1P0R A;  3WAL A;  4F8C B;  3VTW A;  2JPH A;  3N3K B;  2D10 A;  1GC6 A;  4GDK B;  3V61 A;  3U8Z A;  3CMM B;  3T9L A;  4HVB A;  1QZE A;  2C5L C;  2KXJ A;  3AUL A;  4DK5 A;  2MX2 A;  1WMH B;  3L08 A;  4FJV B;  4MEM A;  3UIP B;  2C60 A;  5DPR A;  3ECI A;  5C1Z A;  2KWV B;  3X23 A;  4IM2 A;  1GJZ A;  4BFR A;  2R2O A;  1TBE A;  1NBF C;  4GXB A;  3HHM A;  4ANU A;  2CHX A;  2K6D B;  4DHJ D;  1GG3 A;  1WGY A;  1U4A A;  2KHW B;  3A9K B;  2EKE C;  3NY5 A;  1E5W A;  2GBM A;  2AEH A;  1LM8 B;  2JXX A;  2XK5 B;  2ZEQ A;  3NZU A;  4NJ7 A;  5KHQ A;  3DVG Y;  2KZR A;  2V3S A;  4I6P A;  1WGG A;  1WX9 A;  4MGZ E;  3H1U A;  5EDS A;  2K6Q A;  3AI5 A;  1WR6 E;  4BKG A;  2IO0 B;  3DPD A;  4PS7 A;  3LJ3 A;  1UH6 A;  2BYF A;  4JGH B;  4WJO A;  1YD8 U;  2CU1 A;  3Q3J A;  5HKH A;  1P9D U;  2K39 A;  1S3S G;  2BGF A;  2K1F A;  5CHV C;  4F1S A;  2J0K A;  3ONS A;  3OJ4 B;  1WH3 A;  2DYO A;  5JZE B;  1W6V A;  1EF5 A;  1XQQ A;  2WWZ A;  3RZW C;  2ASQ A;  2HE7 A;  3BIN A;  4M8N A;  1V49 A;  5JHA A;  4IWO A;  5CHF A;  2RD0 A;  1WJ6 A;  4K7W A;  3RUI B;  2K8C A;  3AXC A;  3IHP C;  4FN2 A;  3LMN A;  1R4M I;  2WYQ A;  3ALB A;  4IM3 A;  1V86 A;  2FCN A;  1WZ0 A;  4PS8 A;  4IUM B;  4FHK A;  3HK0 A;  1PQS A;  4E74 A;  2O6V D;  2LRU A;  3SD5 A;  2NBV B;  1X1M A;  3QIJ A;  2Z59 B;  2N7E A;  4P7I A;  4BOZ B;  2MLB A;  1IYF A;  2MBB B;  2M0X A;  4GGQ A;  5CTR C;  4W9I A;  2MSE D;  3ZUN A;  2DAJ A;  3TL5 A;  2AWT A;  3H7S A;  4MEL A;  2B3A A;  5G55 A;  4AOF A;  4IG7 B;  2LXA A;  3OLM D;  3QCA A;  3ZRC A;  2IY1 B;  4NQL B;  2Z0D B;  1V5O A;  4FBJ B;  2BKF A;  2NBW B;  2KC2 A;  5D7G A;  3PT2 B;  5KHO A;  4B9K A;  3DVG X;  2N4F A;  4PS3 A;  2CKH B;  4FJY A;  4IW0 A;  4WJQ A;  4DHZ B;  2MCN B;  3QAR A;  2OJR A;  2Z0E B;  4MJS A;  4BBN C;  2N1W A;  1I35 A;  1WRD B;  4NNJ B;  1EUV B;  1WXM A;  4OVU A;  2KKC A;  2ZNV B;  3PRE A;  4LCD E;  1SIF A;  4K81 A;  3PLV A;  3PRM B;  2KNB A;  4HCP B;  4KZC A;  4DBG A;  2PE9 A;  1E8X A;  3IG3 A;  4K7S A;  2NCN A;  1WGH A;  2DZJ A;  5BO4 B;  2G3Q B;  1UBI A;  4HCN B;  1UD7 A;  3ZW3 A;  1Q1O A;  2AL3 A;  2KDB A;  4NAW A;  4EZL A;  3QX1 A;  2PJH A;  3R3M A;  1RRB A;  3GZN I;  4EFO A;  3PZD A;  3ZVV A;  3A9J A;  1XD3 B;  3VH4 B;  2KLG A;  5E6O A;  2A4Z A;  3TCA A;  2IY0 B;  2M4N A;  3R7Q A;  5E6P A;  1WY8 A;  1WJU A;  2O6V A;  2LVP A;  1NI2 A;  3H6N A;  4MGI E;  3S2A A;  4TQ0 A;  1V9J A;  3HIZ A;  2MP2 A;  1E8W A;  2K8B A;  1WGR A;  2I1K A;  4HDQ A;  4FA6 A;  4MGY E;  4NQK E;  3NZS A;  4FJZ A;  4NY0 A;  2QHO A;  3JVZ X;  2NVU I;  3UIO B;  3MJW A;  2DHZ A;  3VXW A;  1RFA A;  4E3C A;  2KD0 A;  2JZ3 B;  4CO7 A;  2J0J A;  4KV2 A;  2G45 B;  2KDF B;  2JF5 A;  2MW5 A;  4MJS B;  2LAS A;  4EOY A;  2REX A;  4AJY B;  2MBE A;  1YX6 B;  3PGE A;  4GSW A;  3W1S C;  3VDZ A;  2W9N A;  2N9E B;  1T0Y A;  2IYD B;  1UGM A;  3ZNG C;  4K1R B;  2DYB A;  3JW0 X;  4G0N B;  4W9E A;  4XX5 A;  1OEY A;  3PTF C;  4MDK E;  3B08 A;  2ZCC A;  3JYU A;  3KUD B;  3OAW A;  4W9F A;  4NAW B;  1TTN A;  3RD2 A;  3M62 B;  2IZV B;  4G3X B;  1AAR A;  2LD9 A;  1C1Y B;  3NOB A;  1RAX A;  2IO1 B;  5D6J B;  1CMX B;  4LDT B;  4ANV A;  4ANW A;  1GNU A;  3A9J B;  1Z2M A;  3L17 A;  3UIN B;  1LXD A;  2ZVO A;  2WX1 A;  3D32 A;  3DQV A;  4MSQ B;  3DVN V;  4II2 B;  4I6L B;  4W9L A;  3W1Y A;  2EMS A;  4FLH A;  4E71 A;  3GOE A;  2O6V B;  2GBJ A;  1WIA A;  2KDI A;  3VTV A;  5GMV A;  5DPW A;  1V2Y A;  2KFK A;  2LWP A;  4X57 B;  2MP2 B;  2WX0 A;  1LQB A;  3RUL A;  4EZK A;  3A33 B;  3ENE A;  1WJ4 A;  2JZZ A;  4IM0 A;  2MWS B;  4PYU A;  5LLI A;  1SE9 A;  4GDL A;  4II3 B;  3KUZ A;  1EF1 A;  2JT4 B;  3KYC D;  3PHX B;  1WXS A;  3WAP A;  3DBS A;  2KFJ A;  4ZDV A;  2LVQ A;  5DPT A;  2DEN B;  2LGX A;  5CHW A;  3PRP B;  3BY4 B;  3VVW B;  3KW5 B;  2FIF A;  5E6N A;  1WE7 A;  4XZ4 A;  3PS6 A;  3VUY A;  3QJZ A;  2J7Q B;  2ZVN A;  2KTF A;  1UZX B;  4M8M A;  3ZTC A;  1WYW B;  5J17 A;  4ZRK A;  2RSU A;  2I1J A;  4BBN F;  2FCS A;  3PLU A;  1GC7 A;  3L54 A;  3CST A;  2UWQ A;  4FHJ A;  2G4D B;  3NHE B;  1Q5W B;  4ANX A;  3TMP B;  2D07 B;  2FCM A;  3V6C B;  3DBL I;  1WZ3 A;  1WR1 A;  2CHZ A;  2HJ8 A;  3IFW B;  5L83 A;  4KSL C;  1YX5 B;  1P1A A;  4TV3 A;  4BKS D;  4KVG B;  4MGK E;  4W9H A;  2LJ5 A;  2KFK B;  2KOX A;  2HTH A;  4JLC A;  4GOC A;  1ZGU B;  3U30 A;  2NBU A;  3B0A A;  5AEK B;  4KSK C;  1OGW A;  1J19 A;  4GDL B;  3K9O B;  1OQY A;  3ZLZ A;  2MBQ A;  1I42 A;  2ZZP B;  3JSV A;  1MG8 A;  1E7U A;  1WGD A;  3VUW A;  1M94 A;  3VH3 B;  1HE8 A;  2KQ7 A;  4IC7 B;  4ZRI A;  1OTR B;  3LDZ E;  2K8H A;  4LJO B;  4A3P A;  2YVC A;  2L0T A;  1H8C A;  4F7Z A;  1K8R B;  1V81 A;  1P98 A;  3EHV A;  4RM8 A;  2CHW A;  2KJH B;  2JRH A;  3VFK A;  3W1S A;  3L10 B;  2L7R A;  3B1L X;  3V62 A;  2BYE A;  2RGF A;  3A1Q A;  3R66 C;  1V6E A;  3QHT A;  2L05 A;  4DDI D;  5AZG A;  3ZKJ C;  4W9D A;  2D2Q A;  1L7Y A;  4KZ0 A;  4GU2 A;  2BPS A;  2KWU B;  3CSF A;  5L95 C;  3PPA A;  2KK8 A;  3ML9 A;  4ASW C;  5J18 A;  1KJT A;  1WM3 A;  4HWI B;  2GBK A;  4IWP A;  1SGH A;  3VAW A;  1BT0 A;  4TKN A;  3ZDM C;  3P2B A;  4WAA A;  3VHT C;  2A5U A;  4WJP A;  4MSM B;  4DHJ B;  4DWF A;  3RT3 B;  3EFU A;  3U7D A;  4KDL B;  3TJP A;  5LXH A;  3I3T B;  2DZK A;  2LUE A;  3OJ3 A;  5D94 A;  4B95 A;  1H4R A;  3KH0 A;  4AWJ A;  1KM7 A;  2KQS A;  3DDC B;  2JUO A;  4HLE A;  4ZYN A;  2BF8 B;  2KN5 A;  2KTR A;  2UYZ B;  2G4S A;  3SDL C;  3RZF A;  4JIO U;  2C7N B;  3ZRF A;  5FR6 A;  3WA0 A;  2C9W B;  2KC1 A;  1YQB A;  3ZNH B;  3K9P B;  5IA7 A;  4A3O A;  3JSV B;  2FAZ A;  2N9P C;  2LXC A;  2ZCB A;  4AJW A;  4W9C A;  3C0R B;  4ICV A;  3ZIM A;  3H9D A;  3QC8 B;  2IO3 B;  3ZNZ B;  2JY6 A;  1WI0 A;  2GOW A;  2AL6 A;  2M1M A;  1ISN A;  2LGY A;  2FUH B;  3MTN B;  3DBR I;  4WWN A;  4OVV A;  4EZJ A;  3KUC B;  3V60 A;  1VCB A;  2BKR B;  3A1Q B;  4HK2 A;  3ZDT A;  4GMV A;  2KWC A;  4AUQ C;  1WF9 A;  2C7H A;  2DX5 B;  3PVL A;  4TQ1 A;  1WXV A;  2J0M A;  1OEY J;  2FCQ A;  1V5T A;  4J6I A;  4JL9 A;  2N9X A;  4A20 A;  2KX0 A;  3H7P A;  4AP4 C;  2NPT A;  3SHQ A;  2KX3 A;  2L0F A;  5JHB A;  4IWQ A;  5IAA C;  2NR2 A;  2M17 A;  4RM9 A;  1WFY A;  1Z5S B;  2BYV E;  4BOS C;  2DZM A;  2LVO A;  4N9F 4;  2LI5 A;  2ZPN A;  2KMA A;  3M3J A;  4LJP B;  1WX8 A;  4TUU A;  3ZTD A;  2KDE B;  4DXA B;  3X0W A;  2C7M B;  2IO2 B;  3DCG A;  3M63 B;  2KTR B;  2KO3 A;  2WDT B;  4ICU A;  4B6W A;  2L76 A;  3WAO A;  2K25 A;  3UQA A;  2JRI B;  2GMI C;  4M0W B;  5C23 A;  3R7R A;  4PYZ A;  1KLV A;  1JRU A;  3APC A;  2D3G A;  2FID A;  2N1V A;  3PSE B;  5AZF A;  1IP9 A;  3M95 A;  3WAM A;  2OOB B;  1YJ1 A;  4LDT D;  1E7V A;  3PV1 A;  3V6E B;  4WQO B;  2BWE S;  2YLM A;  5JH5 C;  2N7D A;  1LFD A;  2DAF A;  3VUX A;  4CYE A;  2KVR A;  4WWP A;  4WWO A;  4NPN A;  1FXT B;  2VRR B;  1KOT A;  4HDO A;  3UGB B;  2RR9 A;  3ML8 A;  2XEW A;  4KIK A;  2NS5 A;  1TZ1 A;  5DCN A;  1J0G A;  2CS4 A;  1XT9 B;  3UF8 A;  1R4N I;  3H7P B;  1C3T A;  2NPT B;  2XBB C;  2KLC A;  4GB9 A;  3IBE A;  3MHS D;  2DYM A;  3QAQ A;  1P3Q U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...