4MF2A

Structure of human dna polymerase beta complexed with o6mg as the template base in a 1-nucleotide gapped dna
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
325
structure length
321
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSEPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Metal-dependent conformational activation explains highly promutagenic replication across O6-methylguanine by human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 106
structure length 321
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4mf2A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4mf2A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4mf2A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4mf2A03
3RR7A 4RQ8A 4NLNA 3C2LA 2JEIA 4ECTA 5IIIA 1L3TA 3RJEA 1S77D 3TARA 3C66A 4RU9A 4Q8FA 2ZJAA 1ZJNA 3WFQE 5BOMA 1BPXA 5HHHA 2HVIA 1S0NA 4ED6A 5HHIA 1BVSA 1ZQNA 4XA5A 3V6KA 3RRHA 3ZDCA 9ICFA 5KFLA 4QZ8A 3V6JA 3H3AA 5HP4A 1D9FA 1WOTA 4DEZA 4IR1A 1NK0A 1XWLA 4NKUA 3TFSA 4RWOA 3SV4A 1SKWA 2R8KA 4B9MA 5JUMA 4K4IA 4YQWA 4J9PA 4KN4A 4DLGA 4MFAA 4QZGA 4ED2A 2DRBA 3SV3A 2XCAA 1L3SA 2ZJ8A 4UAWA 7ICFA 4RUCA 4LT6A 2M2WA 4AT8B 4DFKA 4O3NA 1V9PA 3IHQB 3AQNA 5J0UA 5J0QA 4MFCA 4ED0A 3V7KA 3BQ1A 5BPCA 1R8BA 3V7LA 3GQCA 1S0OA 1QSYA 2ID1A 4M5DA 2V9WA 4QZ9A 1T8EA 3AU6A 1RPLA 3GILA 2ZH9A 3OVBA 1ZQLA 4DO9A 4WC2A 2VANA 3PX4A 2GWSA 5HRIA 5EWGA 3HX0A 1TK5A 3C5GA 4F5PA 1QSSA 2AU0A 4X0AA 1X9SA 1XSLA 2IA6A 1ZQCA 3C18A 5CJ7A 4RQ0A 4KLHA 3ZDEA 2ZTEA 3TAQA 3Q8RB 4MEXA 4F2RA 2O1PA 3G6XA 3ZD9A 3WFPA 2C28A 2AQ4A 2R8IA 4B9TA 3EPGA 9ICCA 4ELVA 1KLNA 2BDPA 3OJUA 4X0BA 5DBCA 1U47A 9ICOA 5DLFA 4JV1A 4I2JA 4AT7A 1TFRA 3HPOA 4UB1A 4M2YA 4ATBA 2ISPA 1TVAA 4YP3A 3PY8A 4KLDA 4KMUA 4RUAA 4RQ5A 4KTQA 4DL2A 3QEBZ 5DDYA 3RBDA 2C2DA 4FBUA 9ICUA 1UEUA 4YD1A 4KLQA 1VFGA 3JPOA 1L3VA 1QLNA 4YR2A 3M9OB 4RQ2A 3RH4A 4RQ4A 1S10A 2ZTDA 2JEJA 4C8KA 5KFVA 5J0WA 1NK7A 4WBYA 2ZHAA 5KFMA 3C23A 4UB5A 4BGDA 2W9AA 5HRHA 3FDSA 1YLQA 1XO1A 4KLUA 3M8SA 4F4WA 3RAXA 4DQPA 2BKEA 1Z00A 2R8JA 8ICRA 5DG7A 2V4QA 4J9KA 4Z6EA 3IM1A 3TQ1A 3EZ5A 4EP7A 2ZH8A 3TANA 4C8OA 1JAJA 1ZQVA 2C22A 1TAQA 3ORYA 5HMLA 3JPPA 4Z6CA 1C7YA 5DGBA 8ICVA 2RDJA 5DBBA 2KN7A 3GV5B 3G6YA 9ICXA 4KLMA 4I2GA 1ZQXA 3JPSA 5EOZA 1NJYA 4ECUA 4J9LA 8ICZA 4FHYA 3LWLA 4DWIA 2W8KA 3HWTA 4YN4A 5DB9A 4Q8EA 4DFMA 2ALZA 5J2GA 4F92B 5KT7A 5J2DA 4UQGA 2XC9A 4P4MA 9ICAA 2FLLA 2BQRA 2ASLA 8ICYA 3HT3A 2ZH6A 2NRXA 2H5XA 5KFPA 8ICNA 2KP7A 2UVRA 4WC5A 2BCSA 4B9VA 1KSPA 1U48A 4DQQA 7ICUA 8ICQA 1OU5A 5J0OA 4TQSA 4QZCA 2J6TA 7ICKA 1X2IA 4XQ8A 2F1JA 4RNNA 2J6SA 2ZUDA 1KFSA 3RRGA 4Q45A 2IHMA 1UT5A 5J0SA 3SI8A 5KG7A 2ISOA 4FHVA 7ICJA 2W9BA 2DFLA 2XCPA 3MGHA 4ECSA 4WC0A 5KT4A 2FPKA 2BCVA 1ZETA 2JEGA 2HVHA 1CEZA 2FMSA 3MABA 2XGQA 4F8RA 1SL1A 1R89A 5DECA 1BPEA 3PX0A 4X4SA 5J2CA 1T3NA 2XGPA 1ZQBA 4F4YA 1TAUA 7ICVA 5KT3A 4RNMA 4QW8A 5DB8A 1Y88A 4YR0A 4GXJA 1AROP 3MR5A 2XY5A 3PW2A 1ZQGA 8ICFA 3JZ0A 1ZQDA 1RXVA 3T5JA 4QWBA 5J0XA 4EEYA 3PV8A 3ZDBA 4B9LA 7ICNA 4XUSA 9ICSA 8ICXA 8ICIA 3PW0A 2HHSA 1VJ7A 7ICPA 2NRKA 1ZQWA 5CP2A 3BQTA 8ICMA 1ZQQA 3H38A 2A1JA 1T7PA 2LYHA 1JN3A 4BWJA 4DS5A 4X4NA 4Z6FA 4RWNA 1MC8A 1IXRA 3Q8SB 2HHQA 4E0DA 2KZMA 3V6HA 4EZ9A 5DB6A 4IRCA 2BCUA 4FBTA 4M04A 3H37A 3H39A 5IINA 1U45A 4YXJA 9ICHA 4JV2A 3PW5A 4I27A 2ZH5A 4KLIA 2NRVA 2DPJA 4ECYA 4PGXA 4ED1A 3TAPA 2C2EA 4F5OA 5J2FA 4GC6A 1ZQFA 4YMOA 9ICWA 3WFRE 3C1YA 2FMQA 2B21A 3PMLA 3PNCA 1MQ3A 2DRAA 4QZIA 4EYHB 4ECVA 3V7JA 2PFPA 1NO5A 4QZEA 4I2BA 2ZH7A 4F50A 3N4MB 1SZPA 4UD5A 4NY8A 9ICEA 5DLGA 4X4QA 2I1QA 4LZDA 4UAYA 8ICPA 9ICIA 2BCQA 4KLJA 3PO5A 4P2HA 4QWAA 2Q0ZX 9ICPA 7ICLA 4YCXA 3LK9A 3JPTA 2ZUBA 1NKEA 5F9NA 3GV7B 4RQ7A 4PHEA 5CA7A 1UA1A 1BNPA 4WC6A 5J29A 3EYZA 2BGWA 1UEVA 1S9FA 2JEFA 1XC9A 5HNKA 1FA0A 1UA0A 1TFYA 4E80A 2Y1IA 1Z3EB 4C8NA 1COOA 3HW8A 3N97B 2RDIA 2HHXA 4QWDA 4DL4A 3MFHA 4EZ6A 1KDHA 5D49A 4F5QA 4O3QA 4O3RA 2ZH2A 4RPYA 2XY6A 4ELTA 3KHLA 2OWOA 3JPNA 1F5AA 5IIOA 4ED8A 4RT2A 9ICTA 1BPYA 2HHPA 1JXLA 8ICTA 2KZZA 1SL2A 1MIWA 4DQRA 4P4PA 1NZPA 3RH5A 1TKDA 4I28A 8ICUA 4DF4A 1JX4A 3OVAA 8ICEA 3K75D 4PGYA 4DQIA 4NLZA 1PZNA 2DVIA 5F9LA 1ZQZA 2ZH3A 3Q8KA 4YFKA 4J9NA 3B0YA 1IM4A 4DLEA 3KHRA 4M6WB 4GXIA 1ZQRA 2FLPA 2PFOA 4I2HA 3KTQA 5KFTA 2PI5A 2BR0A 5J0RA 4DSEA 9ICQA 3B0XA 3MR3A 3BJYA 1HUZA 4Q43A 2UVVA 4I2EA 4QWCA 5KG6A 7ICRA 1PX5A 2AGOA 5HRBA 5KFCA 1BPDA 1NK8A 3BDPA 8ICOA 3E2EA 2W8LA 4QZFA 1ZQEA 2BE3A 8ICKA 1KNYA 9ICVA 5KFYA 1ZYQA 5J2JA 9ICRA 4WC3A 1MSWD 2DR9A 4F5NA 3RTVA 2BCRA 3RB3A 3RBEA 3OJSA 1MQ2A 7ICHA 4O3PA 5KFSA 5DKWA 4JK1A 3ISCA 5DB7A 1LB2B 4PPXA 4JWMA 4RWQA 3AQLA 4PH5A 2DR5A 1NK9A 4B9SA 4XQ7A 3JPRA 5IIKA 4TUSA 4ZH4A 4YMNA 4RQ3A 4EYIB 4NM1A 1R8CA 1UT8A 5KG1A 2IBKA 1XSPA 4M0AA 5IIMA 2MAXA 4PHAA 3RJJA 4DSIA 2M2UA 5HC9A 4KITB 3WFOA 4WC1A 4F3OA 4K4HA 4Q44A 1JXEA 2BPCA 5J2HA 5L1IA 1MIYA 1ZQYA 4QZHA 2ASDA 4R66A 3T3FA 9ICKA 4LVSA 5KFHA 1UETA 2O5AA 1S97A 5DQIA 4IRDA 3FYHA 3GIMA 2VA3A 4X5VA 2HHUA 1HUOA 4G3IA 1BPBA 2FPLA 5D4BA 2NRZA 5KFWA 3JPQA 3GDXA 3RB0A 3C1ZA 1L3UA 1ZQHA 4I2FA 2FLNA 4JWNA 4ECXA 4KLSA 5HMMA 3EWAA 3PW4A 2VA8A 3G6VA 1ZQSA 1Q79A 3SZ2A 4BWMA 3MFIA 4WCWA 4ECWA 4I2AA 4DQSA 1ZQOA 3RJHA 5HRFA 4S3NA 3ISDA 4ECZA 2PBEA 2PFNA 5DDMA 4Z6DA 1S76D 4AT9A 1DK2A 4AT9B 5EWEA 3H4BA 3GIIA 4F2SA 1NOMA 1L5UA 2HHWA 3H7IA 2I9GA 4DL3A 3THVA 5J0TA 4F4ZA 5KFGA 2W9CB 3PW7A 4IR9A 4MFFA 7ICSA 5F2VO 5KG4A 4DOBA 3ETLA 4UBCA 1RYSA 4BDPA 5CB1A 4K4GA 2HHVA 3L9DA 4M9LA 5KT2A 4FH3A 2DPIA 4J9OA 1KFDA 2Y1JA 2AGPA 4C8LA 3PR4A 4JUZA 5KG0A 4ATBB 4YG2A 2R8HA 5KFEA 4RQ6A 3H40A 1K1SA 3RB4A 1JIHA 4M47A 2ZH1A 3ISBA 4IQTA 3MR2A 5L1JA 5J0YA 3PR5B 1ZQUA 4ED7A 1DK3A 2W9MA 2M2VA 1X9MA 8ICHA 1ZQMA 4MF2A 2BPGA 4QZAA 4BXOB 1MIVA 4I2DA 4M6WA 1KEJA 4J9MA 3Q8MA 3C2KA 2KZ3A 1BPZA 4R65A 2JZBB 3QZ7A 1NJZA 4FS2A 3AQMA 4GXKA 3AU2A 3H8WA 4TURA 3AQKA 1TK8A 4GLXA 2FPMA 3JYYA 3GFKB 2FMPA 3OVSA 5KT6A 3OHBA 1D8LA 4YR3A 3PVXA 3QE9Y 3T5HA 4X4OA 4KLTA 8ICWA 4DSLA 3Q8QB 3HJ4A 4GC7A 3PO4A 2F1HA 2BQ3A 5KG5A 5DG8A 4PGQA 3RB6A 2IMWP 1NK6A 2P6RA 3RR8A 4WBZA 4DOAA 1TK0A 4TQRA 4QZBA 4UAZA 3K4GA 5HREA 4YXMA 4ED3A 2F1IA 5L1KA 4UBBA 1ZQKA 4KLGA 3OSPA 4FHPA 3QEAZ 5DQGA 4O5CA 2BPFA 4O5KA 7ICTA 3PX6A 4NM2A 4MEYA 3EPIA 3RJIA 1QTMA 4NLKA 4O3OA 3ZDAA 1A76A 3Q8PB 3BQ2A 3RJKA 4IQVA 2MUTB 5BOLA 4XRHA 1NKCA 4RQ1A 1B43A 4QW9A 4F93B 4CCHA 1KFTA 1WCNA 4DL6A 2Q66A 4E7XA 8ICCA 4I2IA 5J2EA 4DOCA 2NRTA 2XO7A 2ZTCA 2J6UA 4M9HA 2W9BB 1DOQA 5KTQA 1ZQTA 4M9GA 5KFRA 1BNOA 4NKTA 5CWRA 3NTUA 5DBAA 5HR9A 4DSFA 3OUYB 5KFDA 1RYRA 1QSLA 3MGIA 1NK5A 9ICMA 4X4UA 2WTFA 3UXPA 1X9WA 4FH5A 2V4RA 5HRKA 4DL7A 5J2KA 1JQRA 3NYBA 1CUKA 3OGUA 3NGDA 4DL5A 2XY7A 5EWFA 5KG2A 3WFSC 4R8UB 3MDCA 3UXOA 3M9NB 2R8GA 2PI4A 3RH6A 1A77A 3C5FA 4MF8A 4F91B 4O0IA 3MBYA 4EBCA 4R64A 4B9NA 1ZQIA 1KTQA 4KLEA 3GIJA 3HP6A 1N48A 5HRDA 1RXWA 4ELUA 2W9CA 3ZD8A 4RPXA 4HYKA 4E8FA 3UPSA 2AQ0A 3OV7A 4IRKA 5HRGA 3H8JA 2PXIA 2VA2A 4AT8A 5DG9A 4O3SA 2A1JB 8ICAA 2RFFA 4YVZA 5L1LA 1WCLA 3TI0A 3Q8LA 9ICBA 5KG3A 1R8AA 4EBJA 3UPQA 3UQ2A 1XSNA 5C5JA 4RNOA 4QWEA 1ZQAA 1LV5A 4M9JA 1SKSA 4DF8A 1B22A 1ZQPA 4TUPA 4EBDA 4BXOA 4J9QA 4R63A 3SYZA 3ZDDA 4F5RA 3T5LA 1RZTA 4NXZA 3BQ0A 5KFZA 2JZBA 2DR8A 1U9LA 1XS9D 4NLGA 9ICNA 2KFZA 7ICMA 4FS1A 4WC4A 2P6UA 1NKBA 5KFBA 3HJ1A 1S0VA 2ZH4A 2BHNA 4PHPA 4LZGA 4UB4A 5DGAA 5J2AA 3RAQA 4I29A 4FHWA 5KFOA 9ICGA 2DR7A 3AUOA 5KFFA 1H38A 4RZRA 1EXNA 4RPZA 4DS4A 4DSJA 4M9NA 5CHGA 2UVWA 3TFRA 4KLLA 5IIJA 1U49A 5KFIA 2ASJA 4EBKA 4P4OA 7ICQA 5KT5A 3KHHA 3LQCB 1U4BA 8ICBA 4FHXA 7ICEA 4RWPA 4KLFA 1KRPA 1Q78A 1TV9A 1SKRA 5KFQA 3QZ8A 1HJPA 5TZVA 7ICIA 5J2BA 5IILA 1NJXA 1D8YA 1SL0A 5KFKA 3RJGA 2PFQA 3UQ0A 3V72A 2HHTA 2M2TA 2KFNA 2C2RA 4KLOA 9ICJA 4X4RA 2MUTA 1TFWA 4JV0A 5CR0A 3HIYA 4I2CA 4X4TA 5KFNA 4UB2A 3M8RA 4IQUA 2AJQA 4UD4A 3C2MA 7ICOA 2IHNA 4QZDA 4J9SA 8ICGA 2ZJ5A 3LDAA 5J0PA 4F4XA 2BQUA 3H4DA 1N56A 4DFPA 4UB3A 3GIKA 3OHAA 1S0MA 4X4VA 4C8MA 4IG8A 5L9XA 4WC7A 1DGSA 1NK4A 8ICSA 1JMSA 1K1QA 1XU4A 9ICLA 4TUQA 4AT7B 5KFAA 2ATLA 4DSKA 5DQHA 3KHGA 3OUYA 4DFJA 8ICJA 3UXNA 5DEDA 3MDAA 1NJWA 4IQWA 4ECQA 2AGQA 3H8SA 3OSNA 4YMMA 1D9DA 5J2IA 4YD2A 2HW3A 8ICLA 2ZHBA 4RT3A 4ECRA 7ICGA 4R8UA 3MR6A 1T4GA 5HRLA 4J9RA 4O9MA 2P66A 4X4PA 3EW9A 3M9MB 5KFJA 4F4KA 2KTQA 2NRWA 5KFXA 1ZJMA 4PHDA 3PMNA 3GV8B 5KFUA 4EBEA 5D46A 2ZUCA 4KN7A 3RJFA 4B9UA 1V4AA 2M9NA 1Z00B 3LWMA 4FO6A 1ZQJA 1BGXT 4O5EA 3T5KA 2UVUA 3C21A
chains in the Genus database with same CATH superfamily
3RR7A 2Y0SF 5AICA 5AKIA 4RQ8A 4NLNA 2BBHA 3KKAC 5IIIA 3WKBA 3C66A 4RU9A 1DRGA 5K4LA 1N5WA 1BVSA 4XA5A 3ZDCA 9ICFA 3QU5A 1PVQA 1WOTA 4DEZA 4NKUA 1SKWA 4K4IA 1PUZA 3K1ZA 2AH5A 4DLGA 4QZGA 3OWGA 2DRBA 3SV3A 4UAWA 4RUCA 2M2WA 2PMZF 5CFSA 5J0QA 4MFCA 4LJXA 3BQ1A 5FP0A 5BPCA 5ALWA 1QSYA 3GILA 1ZQLA 4DO9A 2M0NA 2GWSA 5EWGA 3C5GA 4F5PA 2KE7A 1S5LU 2AU0A 1XSLA 2IA6A 1ZQCA 1UQVA 3ZDEA 3M1YA 2R8IA 4B9TA 4EGWA 9ICCA 1KLNA 2ZIXA 2WHEA 1U47A 9ICOA 4AT7A 3OPXA 2ISPA 4YP3A 1UPHA 3PY8A 4KMUA 4RUAA 4RQ5A 4DL2A 4KLQA 1QLNA 4YR2A 1NK7A 5KFMA 2W9AA 5CEHA 5HRHA 3QU2A 3FDSA 1Z00A 5B66U 2WB1C 5ALRA 3TQ1A 3EZ5A 3TANA 4C8OA 1ZQVA 1GO3F 3N28A 2RDJA 3GV5B 4K8VA 1ZQXA 1NJYA 5ALEA 3HWTA 2HBLA 5DB9A 4Q8EA 5KT7A 2QB1A 2BQRA 3PSTA 4WC5A 1KSPA 8ICQA 4NXXA 4RNNA 2ZUDA 2EZYA 5J0SA 3SI8A 5KG7A 3MGHA 2BCVA 2HVHA 3MCRA 5ALTA 1N62A 2FMSA 2XGQA 1R89A 4UB6U 4US9A 4C0ZA 4RNMA 4WC2A 1Y88A 4YR0A 2DR8A 1AROP 3PW2A 2NO5A 1ZQGA 4RQNA 1VLBA 1RXVA 3ZDBA 5J0XA 1B0XA 7ICPA 4WOYA 3BQTA 2HBJA 4F72A 2LYHA 1JN3A 4BWJA 4DS5A 3D6JA 4O68A 1MC8A 1IXRA 1KN5A 3V6HA 5AK3A 4M04A 3H37A 1K5OA 2E1EA 4KLIA 2NRVA 2DUYA 2KOBA 4ED1A 2C2EA 3SD7A 4JMUA 4F5OA 1ZQFA 5J8YC 9ICWA 3C1YA 2KSOB 2KMDA 2H3FA 3PNCA 1YT3A 4ECVA 1NO5A 5ALVA 4I2BA 3N4MB 5AI0A 3PO5A 4P2HA 2Q0ZX 5ALPA 3LK9A 3JPTA 5AM5A 2BBJA 4RQ7A 5CA7A 3EYZA 1ZD3A 4CF4A 5EE0A 1XC9A 5HNKA 4KX3A 5AKXA 4C8NA 3HW8A 5ALZA 5GTIU 3MFHA 2HBKA 4O3QA 2CPRA 2D8CA 5L1MA 3KHLA 4Y2VA 2OWOA 3JPNA 5IIOA 2VJ5A 2ZXIA 4P4PA 3RH5A 1TKDA 4I28A 4LEVA 5ALSA 1V85A 3K75D 2Q4TA 4DQIA 1FFUA 4NLZA 2ZH3A 2JMGA 2BR0A 4UATA 1N61A 5HRBA 4B6JA 9ICVA 5KFYA 2VJ4A 2H3IA 2DR9A 2ZIVA 1N5XA 3CP8A 4O3PA 5KFSA 3ISCA 5DB7A 4PPXA 2H3VA 4PH5A 1NK9A 4RQ3A 2IBKA 4M0AA 5IIMA 3RJJA 4DSIA 4Y2QA 1Z4OA 1P7DA 3O0FA 2BPCA 2K60A 2ASDA 4R66A 5KFHA 5F3XB 1S97A 5DQIA 4IRDA 3GIMA 2VA3A 1J2MA 1BPBA 2FPLA 2YB1A 5KFWA 3RB0A 1L3UA 4C8KA 3E0FA 2ZIUA 3NVZA 3EWAA 3PW4A 1ZQSA 3SZ2A 3BS7A 3RJHA 4Z6DA 5KAFU 3H4BA 3DV9A 2HDOA 4F2SA 1ZRMA 1L5UA 2HHWA 2WF6A 2W9CB 1RM6C 5CB1A 2QB0A 2HHVA 2EH9A 4CE6A 4M47A 5KFEA 4RQ6A 3RB4A 2G0AA 5J0YA 2DKZA 1DK3A 2W9MA 2WF7A 4UARA 4M6WA 4WJ3B 3NKUA 1WYGA 4GXKA 3AU2A 5AI9A 3NUQA 2FPMA 4YR3A 4MKPA 2DKXA 4BJQA 4X4OA 3K7DA 3PO4A 5ALDA 2BQ3A 3RB6A 3JCFA 1NK6A 4A8EA 4QZBA 3K4GA 4ED3A 5L1KA 1L7PA 3QEAZ 4O5KA 4K9BA 4NM2A 3EPIA 3RJIA 5ALHA 4IL6U 2MA1A 1B43A 4F93B 4E7XA 8ICCA 4I2IA 5AIAA 5KAIU 2J6UA 1BNOA 1ZQTA 4M9GA 5AK6A 4NKTA 5CWRA 1RQNA 5DBAA 5HR9A 4Y2XA 9ICMA 1RYRA 3MGIA 3UXPA 2KK0A 4FH5A 3B9JA 4Y2JA 4AP9A 3NYBA 3WFSC 3OGUA 3NGDA 4DL5A 4R8UB 4AT9A 9ICQA 3HJ1A 2R8GA 2DGZA 4MF8A 4B9NA 3GIJA 3HP6A 2W11A 3ZD8A 2KKVA 3QUBA 2JHDA 4IRKA 4P0QB 4QIWC 4YVZA 3TI0A 2YB4A 5KG3A 2W03A 1R8AA 3UPQA 2LKYA 1LV5A 1SKSA 2LM4A 2E8NA 4EBDA 3SYZA 1OW5A 1QCKA 3TADC 4F5RA 1RZTA 4NXZA 4QNLA 2JZBA 1XS9D 7ICMA 4FS1A 2P6UA 1NKBA 2BHNA 3ONNA 5DGAA 2CXYA 3IRUA 9ICGA 2DR7A 1H38A 5KFFA 4RZRA 2IHOA 3HKZC 4RPZA 1FEZA 5KFIA 4P4OA 3LQCB 3KHHA 7ICEA 1OUQA 1KRPA 3LVVA 2IOFK 1TV9A 4QJFB 5TZVA 5J2BA 5AIBA 1Q3UA 5KFKA 9ICJA 2MUTA 1TFWA 3HIYA 1L7NA 4N7RA 4UD4A 2YX8A 3QX7A 1KBUA 4J9SA 3LDAA 5AI6A 3VCBA 3OHAA 2P35A 1DGSA 2W43A 1XU4A 5KFAA 2ATLA 4C80A 4DSKA 1URJA 3OUYA 5DEDA 1Z19A 2KICA 4YMMA 5HR6A 5J2IA 4IS7A 4YD2A 3F2DA 7ICGA 3WK6A 3MR6A 4O9MA 3GU3A 3EW9A 2NRWA 5KFUA 4EBEA 4B9UA 4KN7A 2G08A 2YTUA 4QIWF 4NY8A 8ICPA 2MSNA 3NRWA 4ECTA 1L3TA 3RJEA 2KVCA 4Q8FA 3WFQE 5AI4A 1S0NA 5HHIA 5AM0A 1ZQNA 3RRHA 4C4TA 5AK5A 5KFLA 1ZD4A 1D9FA 4IR1A 1Z1VA 1NK0A 1XWLA 3UM9A 2FDRA 2R8KA 1B4FA 3HKZF 4KN4A 4EEKA 4K96A 7ICFA 4AT8B 3AQNA 2YN4A 2A3VA 5J0UA 3V7KA 1R8BA 3GQCA 2ID1A 2I5HA 3AU6A 1RPLA 3QXGA 5HRIA 4EV6A 3HX0A 5E79U 1QSSA 5CJ7A 4RQ0A 3VC8A 2EAMA 4LEWA 5B5EU 4MEXA 2O1PA 2HOFA 3G6XA 1FO4A 1L7OA 3OJUA 5DBCA 3BZKA 4UB1A 4NXWA 4ACOA 1TVAA 4KTQA 9ICUA 2C2DA 4YD1A 3JPOA 4DFDA 3SAGA 2ZTDA 3KD3A 5J0WA 2ZHAA 3KZIU 3M6ZA 3C23A 1YLQA 1XO1A 4DQPA 2BKEA 4Z6EA 4UB8U 5D61A 4EP7A 4XJEA 2ZH8A 1UCVA 2GAFD 3AQEA 1TAQA 5HMLA 4Z6CA 2PMZC 5CFUA 3QYPA 4KLMA 3JPSA 4PJ0U 4J9LA 2ODGA 8ICZA 3LWLA 4DWIA 3BZCA 1MN8A 4UAUA 5J2GA 4F92B 4UQGA 2XC9A 2Y9TA 9ICAA 2NRXA 2H5XA 3SAFA 5KFPA 8ICNA 2KP7A 3BS5B 3CNHA 7ICUA 1OU5A 4Y2RA 5JRTA 5J0OA 7ICKA 2F1JA 2DL0A 4J03A 2J6SA 4OAIZ 1KFSA 3RRGA 4Q45A 1QQ7A 2ISOA 3WKDA 2DFLA 2XCPA 4ECSA 5KT4A 2FPKA 2JEGA 4F8RA 5B3QA 4BUGA 5J2CA 2XGPA 1MQ3A 2UVUA 4JLZA 4Y2TA 3JZ0A 5D62A 8ICXA 1PVPA 8ICIA 1VJ7A 4XUSA 9ICSA 2NRKA 4O6AA 3OV7A 5CP2A 1ZQQA 2IOHA 3E58A 2GLEA 4K97A 4Z6FA 3Q8SB 4E0DA 2KZMA 5ALJA 4EZ9A 2L5YA 2DBYA 5IINA 1HEKA 9ICHA 2KNJA 1JALA 4I27A 2JV3A 2A1AA 4NL9A 4GC6A 3WFRE 2FMQA 3PMLA 2KJ8A 3V7JA 4PZNA 2ZH7A 1S8OA 2EWRA 2KJ9A 4X4QA 4LZDA 4UAYA 3UMGA 4QWAA 9ICPA 3F2CA 2LMRA 1UA1A 2B51A 4USAA 2E5SA 1MA7A 1TFYA 4E80A 1UHUA 2RDIA 4QWDA 5AI5A 1T3QA 5D49A 2ZH2A 4RPYA 2PKEA 2KEYA 1X9XA 2HI0A 2GA9D 1BPYA 2KZZA 1PK3A 2KIWA 1NZPA 2AHOB 8ICEA 1PZNA 3Q8KA 3B0YA 1IM4A 4OD0A 2FLPA 3KTQA 5AKEA 4CF5A 5ALQA 5J0RA 3B0XA 3BJYA 7ICRA 1PX5A 8ICOA 4NXUA 2BE3A 8ICKA 4EELA 1ZYQA 2EANA 4HX0A 4WC3A 3RTVA 2KHVA 3RB3A 3RBEA 1MQ2A 3A0HU 5ALGA 1LB2B 4RWQA 3ALRA 4B9SA 1IIPA 1R8CA 4NM1A 5JU5A 2M2UA 5HC9A 1TE2A 2DF4B 2B6GA 2KSOA 1DXSA 1JXEA 2N1RA 4NV0A 2JGAA 4X5VA 2LI6A 1HUOA 1VJ5A 5D4BA 3JPQA 1ZQHA 4I2FA 4FE3A 2FLNA 4BWMA 3MFIA 4WCWA 4I2AA 4S3NA 4ECZA 4ICAA 1S76D 1DK2A 5JTIA 1NOMA 4FFDA 2K8BB 4O3MA 2I9GA 3THVA 5F2VO 4MFFA 1SV0C 2OYYA 3ETLA 4BDPA 4K4GA 1RG6A 2ZIXB 5KT2A 1KFDA 5T14A 2R8HA 1K1SA 3ISBA 2DWQA 5TISU 3MR2A 1ZQUA 4ED7A 2JH1A 8ICHA 4K98A 4J9MA 4R65A 3QZ7A 1WWVA 4TURA 1F0MA 2W54A 4GLXA 3JYYA 4GIBA 3OHBA 3PVXA 4KLTA 2LHTA 8ICWA 4DSLA 3Q8QB 4KMOB 1Z4NA 2R18A 5DG8A 3RR8A 2IMWP 2W7OA 4DOAA 1QQ6A 4TQRA 4UBBA 3OSPA 4FHPA 1A6SA 5DQGA 2BPFA 3PX6A 3NRZA 4O3OA 1A76A 3BQ2A 3RJKA 1NKCA 2HCFA 4CCHA 3WKAA 4DL6A 3ETRA 5J2EA 1PK1A 3HILA 2XO7A 2ZTCA 4M9HA 3K1RB 5KFDA 4X4UA 1NK5A 2WTFA 4CNQA 4DL7A 5J2KA 2XY7A 5EWFA 5KG2A 3MDCA 4RWPA 5JTGA 2VIXA 2ZG6A 2W3SA 3RH6A 4F91B 3MBYA 4EBCA 4KLEA 3WK7A 1ZQIA 1KTQA 1RXWA 2W9CA 4HYKA 4OJOA 3H8JA 2PXIA 2VA2A 4O3SA 8ICAA 4U6PA 3Q8LA 9ICBA 2FJ6A 5C5JA 4M9JA 3NVVA 1ZQAA 1OXJA 4TUPA 3T5LA 4RQMA 3NASA 1X40A 5KFBA 1S0VA 4UB4A 4FHWA 4I29A 4EEBA 4LEZA 4DS4A 1RDFA 2K8AA 4KLLA 4GFJA 2ASJA 4EBKA 3QUTA 2LYBA 7ICQA 4FHXA 5D63A 4KLFA 1HJPA 2O6KA 3EUB2 1SL0A 1HIWA 3UQ0A 3WKCA 2CRXA 2C2RA 2KFNA 4X4RA 4JV0A 4X4TA 5KFNA 4UB2A 2AJQA 4IQUA 4MHVA 3C2MA 7ICOA 2IHNA 5EE3A 8ICGA 2ZJ5A 5J0PA 2BQUA 1S0MA 1N56A 4UB3A 4X4VA 4C8MA 3FAHA 3F5AA 5KNIA 3DDHA 4TUQA 5DQHA 3KHGA 4DFJA 3KKAA 3AMZA 1NJWA 4IQWA 2EAOA 2HW3A 1Q46A 8ICLA 4RT3A 4R8UA 2P66A 2E8OA 5KFJA 2OEHA 1SB3C 3UMCA 2ZUCA 1V4AA 2IUBA 2M9NA 3LWMA 4O5EA 4OJPA 4P0QA 3C21A 3PSIA 1X6JA 2JEIA 3TARA 2K8CB 2KVSA 2ZJAA 2BDUA 2HVIA 4ED6A 3V6KA 3H3AA 3WK8A 4C7YA 2AXTU 4C4RA 1KQQA 4RWOA 3SV4A 5JUMA 1KW4A 3PZPA 4J9PA 2RP5A 4I0UA 4ED2A 3ICXA 2ZJ8A 5CRXA 4LT6A 4DFKA 3HRDD 3IHQB 1ZXIA 2Z7JA 3CYMA 3V7LA 1KKXA 2VANA 3PX4A 2NO4A 1TK5A 1X9SA 4KLHA 2W55A 2H3QA 2ZTEA 3Q8RB 3ZD9A 2C28A 2AQ4A 2MRLA 4X0BA 2QB0B 5DLFA 4JV1A 4K99A 4ATBA 4NJ8A 4KLDA 5ALYA 3RBDA 3CRXA 3M9OB 3RH4A 4RQ4A 1S10A 5KFVA 4P0PA 4WBYA 3C29A 4BGDA 4JLXA 4OJLA 4KLUA 2RLTA 3OTQA 3M8SA 4F4WA 3RAXA 2ZXHA 1SWWA 2V4QA 1QQ5A 2RQ5A 3UMBA 5AKYA 2XI9A 3F2BA 3J81j 1JAJA 2C22A 3ORYA 2I6XA 3JPPA 1C7YA 5DGBA 4OO1J 3IDWA 9ICXA 4I2GA 5EOZA 2F3NA 3CK6A 1FFVA 4YN4A 4DFMA 2ALZA 5J2DA 2FLLA 2ASLA 8ICYA 2ZH6A 4FZMA 1PVRA 1SXDA 4QZCA 4CGZA 1CRXA 4AT8A 3KZXA 4C7ZA 1UT5A 2W9BA 4WC0A 4AYBC 3KBBA 1CEZA 4OJ5A 2B0CA 3WK9A 3R9KA 3MABA 1SL1A 1BPEA 4X4SA 2F8LA 3NVWA 1ZQBA 4F4YA 4QW8A 4GXJA 2XY5A 4FZNA 8ICFA 2QARA 4B9LA 3QUCA 3PW0A 2HHSA 1ZQWA 3H38A 5J8YA 2A1JA 2CN1A 2KIVA 4RWNA 2EAPA 2HHQA 4IRCA 2BCUA 4F71A 4FBTA 2HOQA 3QU9A 4G9BA 3TACB 1U45A 1JROA 4JV2A 3PW5A 2ZH5A 2HN2A 2YMQA 2DPJA 3SAHA 3F5EA 4PGXA 1KL9A 2KG5A 4YMOA 3ERCC 2B21A 1J2NA 2G07A 4EYHB 4NWIA 3MGVA 3ER9B 1F5SA 5AKLA 1SZPA 4UD5A 2I1QA 2K4IA 4KLJA 7ICLA 4YCXA 3SENA 1V97A 2K89A 2ZUBA 1NKEA 4PHEA 5HR7A 4WC6A 1VDVA 5J29A 2BGWA 1UEVA 1S9FA 2JEFA 1FA0A 3BS5A 3D2SA 2Y1IA 1COOA 4EZ6A 1KDHA 4F5QA 4O3RA 2WAQC 4OCZA 4AYBF 3SEIA 4RT2A 9ICTA 1SL2A 1MIWA 8ICUA 1JX4A 2W7PA 3OVAA 2WFAA 4OJ6A 2DVIA 4UASA 5F9LA 1ZQZA 3FM9A 4YFKA 4J9NA 1ZQRA 4I2HA 3KHRA 4GXIA 5KFTA 1YZ6A 1V38A 1HUZA 3MR3A 2UVVA 4Q43A 3NWIA 1ZD2P 4QWCA 5KG6A 5KFCA 1BPDA 2KV2A 4QZFA 1KNYA 9ICRA 1MSWD 4F5NA 7ICHA 2F77X 3CW2C 4JK1A 3AQLA 4XQ7A 4YMNA 2ESEA 1UT8A 5KG1A 1XSPA 2W3RA 3WFOA 1Z1BA 1WG8A 4K4HA 5J2HA 3F53A 9ICKA 4LVSA 1X66A 1UETA 3PSPA 3FYHA 4UW9A 2HHUA 4G3IA 2PBEA 2NRZA 3C1ZA 5AI8A 4KLSA 5HMMA 2VA8A 3G6VA 3N7PD 2GH1A 2PFNA 5DDMA 2G5HB 3GIIA 2WAQF 4DL3A 5KFGA 7ICSA 5KG4A 1RYSA 4FH3A 2HMXA 3L9DA 4M9LA 4KM5A 2DPIA 4J9OA 4C8LA 3PR4A 4JUZA 2QLTA 2B4VA 3H40A 1JIHA 2WF5A 4IQTA 5L1JA 3PR5B 1ZQMA 4MF2A 2G5IB 2BPGA 4BXOB 4I2DA 1KEJA 3Q8MA 1BPZA 2KZ3A 3IV6A 4EX7A 4FS2A 2K4EA 3H8WA 1LKYB 3AQKA 1TAMA 1TK8A 2LBOA 3OVSA 3GFKB 2FMPA 5KT6A 4HAIA 5AHXA 3HJ4A 2F1HA 4NLCA 3C28A 4BX9C 5KG5A 4WBZA 1TK0A 3QUQA 4UAZA 1FIQA 3WU2U 4KLGA 3KFUF 4O5CA 7ICTA 4NLKA 5ALUA 3SR6A 3L3FX 4IQVA 2LYAA 5G5GA 3HJEA 1WCNA 4DOCA 2XVTA 5KFRA 5ALMA 1O08A 4WH5A 2JH7A 3N7SC 1QSLA 2F44A 1JQRA 3MC1A 3M9NB 2ZIWB 2PI4A 1A77A 3C5FA 3TADA 1IV8A 4ELUA 3RF9A 4E8FA 2VKQA 1IG6A 1X6IA 1N63A 2EZZA 2RFFA 1WCLA 1ED1A 4EBJA 4O69A 4RNOA 1B22A 4DF8A 3ED5A 3U26A 1ZQPA 2JR5A 4J9QA 2EQYA 4CDGA 3ER8C 2FE9A 3BQ0A 1M6YA 1SZHA 5KFZA 9ICNA 4NLGA 4WC4A 2ZH4A 3QU4A 5J2AA 3RAQA 3AUOA 4OAGA 4M9NA 2D6FC 3I28A 4EEDA 1N2XA 5IIJA 4O67A 3WK4A 1U4BA 8ICBA 3LVWA 5KFQA 2EZXA 7ICIA 1A0PA 1D8YA 2M2TA 2OXOA 5CR0A 4I2CA 2MU2A 4DFPA 3FC4A 3GIKA 4IG8A 3S6JA 5L9XA 8ICSA 1JMSA 1K1QA 4Y2SA 9ICLA 1RQLA 4AT7B 3H8MA 8ICJA 3UXNA 4ECQA 2AGQA 5AM3A 4Y2UA 3IP4B 4ECRA 5ALNA 1T4GA 5HRLA 4J9RA 3M9MB 2A19A 5H2FU 1ZD5A 2KTQA 1ZJMA 4PHDA 3GV8B 1F44A 5D46A 3RJFA 2GOLA 1Z00B 4FO6A 1ZQJA 3IG8A 1BGXT 3C2LA 2KJ5A 4PL2A 2E8PA 1S77D 2OM6A 5EE9A 5AK4A 1ZJNA 5BOMA 1BPXA 5HHHA 1QH9A 4QZ8A 3V6JA 2JRZA 1L8OA 5HP4A 2FI1A 2LM1A 1SGGA 2WF9A 2WB1F 4US8A 3TFSA 4B9MA 4YQWA 4MFAA 2XCAA 1L3SA 4O3NA 1V9PA 5AKGA 2KHQA 2YY6A 2XIDA 4ED0A 3TKAA 2YQEA 1S0OA 5C0YA 5KL8B 4M5DA 4OAFA 2V9WA 3NVOA 4QZ9A 1T8EA 3OVBA 2ZH9A 1ECWA 5EE1A 4X0AA 4CF3A 3C18A 4CRXA 5AM1A 3TAQA 4F2RA 3WFPA 3EPGA 4ELVA 2BDPA 4I2JA 1TFRA 3HPOA 4M2YA 3NVYA 2IOFA 1NZBA 5ALKA 3I76A 5DDYA 3QEBZ 4FBUA 1VFGA 1UEUA 1L3VA 4NLBA 5AM2A 4RQ2A 2JEJA 4UB5A 2R8JA 8ICRA 5DG7A 3T79A 4J9KA 4FZLA 3IM1A 1X42A 5B3PA 1LVHA 3H0MB 8ICVA 5DBBA 2KN7A 3G6YA 4ECUA 4FHYA 2W8KA 1NI3A 4KB6A 1ZOLA 4P4MA 1GPJA 3HT3A 2K4PA 4ZOHC 2OHFA 2UVRA 2BCSA 4B9VA 1U48A 4DQQA 3GZFA 4KX5A 4TQSA 2J6TA 1X2IA 5ALIA 4XQ8A 4WQKA 1PK1B 2IHMA 5CFTA 3SQIA 4FHVA 7ICJA 1JI7A 4DCCA 5ALOA 1ZETA 3D2QA 5DECA 2KD1A 3PX0A 2ES6A 1T3NA 7ICVA 1TAUA 5KT3A 5DB8A 4X4NA 3MR5A 2FCLA 1ZQDA 3T5JA 4QWBA 4EEYA 3PV8A 7ICNA 4OAHA 2QKQA 8ICMA 1Q8KA 3KOOA 1T7PA 1ZRNA 1JUDA 2ZIVB 5DB6A 3H39A 2WF8A 2Y9UA 1D8BA 4YXJA 2E1FA 4ECYA 3TAPA 5J2FA 3L5KA 2DQNB 2DRAA 4QZIA 2PFPA 4QZEA 1L8LA 4F50A 2KKPA 2YMLA 9ICEA 5DLGA 9ICIA 3N7RC 2BCQA 4Y2PA 1XNSA 2ZIUB 5F9NA 3GV7B 3AN1A 1BNPA 4NL9C 4Y2YA 2W04A 1UA0A 3SMVA 1Z3EB 3N97B 2HN1A 5AKHA 2HHXA 4DL4A 2XY6A 4ELTA 2BZFA 1F5AA 4ED8A 2HHPA 1JXLA 8ICTA 4DQRA 5ALFA 4DF4A 3M6KA 4PGYA 4NXTA 4DLEA 4M6WB 1SXEA 2PFOA 2F2AB 2PI5A 5AM4A 4FO1A 4DSEA 4I2EA 2AGOA 1NK8A 3BDPA 3E2EA 3ZI4A 2W8LA 1ZQEA 5J2JA 2BCRA 3QU7A 3OJSA 2F76X 2NV3A 1RYUA 2RRDA 5DKWA 4JWMA 2DR5A 2YMPA 3EF2A 3JPRA 5IIKA 4TUSA 3AEVA 4ZH4A 4EYIB 1WUDA 1Q3VA 5ALLA 2MAXA 4PHAA 4KITB 4WC1A 4F3OA 4Q44A 3I1YA 5L1IA 3PSFA 2EDUA 1MIYA 1ZQYA 4QZHA 2HOIA 3T3FA 4C4SA 3AM9A 2O5AA 1SV0A 3BQ7A 3GDXA 1L7MA 4ECXA 4JWNA 2RHFA 1O03A 1Q79A 4ECWA 4DQSA 1ZQOA 5HRFA 3DEEA 3ISDA 3NS1A 4AT9B 5EWEA 3A0BU 3H7IA 1T94A 5AKZA 2F8KA 5J0TA 4F4ZA 4IR9A 3PW7A 2K4HA 4DOBA 4UBCA 2Y1JA 2AGPA 1N60A 5KG0A 2E3TA 3RFAA 2B56A 2JXJA 3D2NA 4YG2A 1COKA 4ATBB 2ZH1A 2OCEA 1SV4A 2M2VA 1X9MA 5A0LA 3IG5A 4QZAA 1MIVA 2YMMA 4U7CA 5KL1B 3WK5A 4P0PB 3C2KA 2JZBB 1NJZA 2D3DA 2LPEA 3QE9Y 1D8LA 5GTHU 5CHEA 3T5HA 4WQLA 4GC7A 5ALXA 3M7DA 4PGQA 2P6RA 2G09A 5AKKA 4IC9A 5HREA 4YXMA 2F1IA 3AQFA 1ZQKA 3H0RB 3H0LB 2NYVA 4MEYA 4K9AA 5G5HA 1QTMA 3ZDAA 3Q8PB 2MUTB 5BOLA 3AL0B 2GO7A 4JB3A 4XRHA 4EENA 4LEYA 4RQ1A 4QW9A 1KFTA 2Q66A 1XO0A 2XICA 2NRTA 3IN5A 1DGJA 2W9BB 1DOQA 5KTQA 3LYSA 3NTUA 1SWVA 4DSFA 3OUYB 1X9WA 2V4RA 1C20A 1JRPA 5HRKA 1CUKA 3UXOA 4O0IA 4R64A 2QARB 1N48A 5HRDA 4RPXA 3UPSA 2AQ0A 5HRGA 2E8MA 5DG9A 1AQ6A 2A1JB 5L1LA 2Y0SC 3WKEA 1J97A 4NXVA 3UQ2A 1XSNA 3QNMA 4QWEA 4BXOA 3PHZA 4R63A 3ZDDA 1U9LA 2KFZA 4EX6A 1LKYA 4LZGA 4PHPA 5KFOA 1EXNA 4DSJA 5CHGA 2UVWA 3TFRA 1U49A 2OH2A 5KT5A 1YZ7A 1Q78A 1SKRA 3QZ8A 2HSZA 5IILA 1NJXA 3RJGA 2PFQA 3V72A 2HHTA 4PL1A 4KLOA 4PZOA 1L6NA 3M8RA 2G06A 1ZQ1C 5AKJA 4QZDA 4F4XA 2HBMA 3AQMA 3H4DA 4WC7A 4UAVA 1NNLA 1NK4A 3MDAA 3H8SA 3OSNA 1D9DA 1WWUA 2ZHBA 1CI4A 2H3ZA 2ZIWA 1SIJA 4X4PA 3L4PA 5KFXA 3PMNA 4F4KA 3T5KA
chains in the Genus database with same CATH topology
3RR7A 4RQ8A 4NLNA 3C2LA 2JEIA 4ECTA 5IIIA 1L3TA 3RJEA 1S77D 3TARA 3C66A 4RU9A 4Q8FA 2ZJAA 1ZJNA 3WFQE 5BOMA 1BPXA 5HHHA 2HVIA 1S0NA 4ED6A 5HHIA 1BVSA 1ZQNA 4XA5A 3V6KA 3RRHA 3ZDCA 9ICFA 5KFLA 4QZ8A 3V6JA 3H3AA 5HP4A 1D9FA 1WOTA 4DEZA 4IR1A 1NK0A 1XWLA 4NKUA 3TFSA 4RWOA 3SV4A 1SKWA 2R8KA 4B9MA 5JUMA 4K4IA 4YQWA 4J9PA 4KN4A 4DLGA 4MFAA 4QZGA 4ED2A 2DRBA 3SV3A 2XCAA 1L3SA 2ZJ8A 4UAWA 7ICFA 4RUCA 4LT6A 2M2WA 4AT8B 4DFKA 4O3NA 1V9PA 3IHQB 3AQNA 5J0UA 5J0QA 4MFCA 4ED0A 3V7KA 3BQ1A 5BPCA 1R8BA 3V7LA 3GQCA 1S0OA 1QSYA 2ID1A 4M5DA 2V9WA 4QZ9A 1T8EA 3AU6A 1RPLA 3GILA 2ZH9A 3OVBA 1ZQLA 4DO9A 4WC2A 2VANA 3PX4A 2GWSA 5HRIA 5EWGA 3HX0A 1TK5A 3C5GA 4F5PA 1QSSA 2AU0A 4X0AA 1X9SA 1XSLA 2IA6A 1ZQCA 3C18A 5CJ7A 4RQ0A 4KLHA 3ZDEA 2ZTEA 3TAQA 3Q8RB 4MEXA 4F2RA 2O1PA 3G6XA 3ZD9A 3WFPA 2C28A 2AQ4A 2R8IA 4B9TA 3EPGA 9ICCA 4ELVA 1KLNA 2BDPA 3OJUA 4X0BA 5DBCA 1U47A 9ICOA 5DLFA 4JV1A 4I2JA 4AT7A 1TFRA 3HPOA 4UB1A 4M2YA 4ATBA 2ISPA 1TVAA 4YP3A 3PY8A 4KLDA 4KMUA 4RUAA 4RQ5A 4KTQA 4DL2A 3QEBZ 5DDYA 3RBDA 2C2DA 4FBUA 9ICUA 1UEUA 4YD1A 4KLQA 1VFGA 3JPOA 1L3VA 1QLNA 4YR2A 3M9OB 4RQ2A 3RH4A 4RQ4A 1S10A 2ZTDA 2JEJA 4C8KA 5KFVA 5J0WA 1NK7A 4WBYA 2ZHAA 5KFMA 3C23A 4UB5A 4BGDA 2W9AA 5HRHA 3FDSA 1YLQA 1XO1A 4KLUA 3M8SA 4F4WA 3RAXA 4DQPA 2BKEA 1Z00A 2R8JA 8ICRA 5DG7A 2V4QA 4J9KA 4Z6EA 3IM1A 3TQ1A 3EZ5A 4EP7A 2ZH8A 3TANA 4C8OA 1JAJA 1ZQVA 2C22A 1TAQA 3ORYA 5HMLA 3JPPA 4Z6CA 1C7YA 5DGBA 8ICVA 2RDJA 5DBBA 2KN7A 3GV5B 3G6YA 9ICXA 4KLMA 4I2GA 1ZQXA 3JPSA 5EOZA 1NJYA 4ECUA 4J9LA 8ICZA 4FHYA 3LWLA 4DWIA 2W8KA 3HWTA 4YN4A 5DB9A 4Q8EA 4DFMA 2ALZA 5J2GA 4F92B 5KT7A 5J2DA 4UQGA 2XC9A 4P4MA 9ICAA 2FLLA 2BQRA 2ASLA 8ICYA 3HT3A 2ZH6A 2NRXA 2H5XA 5KFPA 8ICNA 2KP7A 2UVRA 4WC5A 2BCSA 4B9VA 1KSPA 1U48A 4DQQA 7ICUA 8ICQA 1OU5A 5J0OA 4TQSA 4QZCA 2J6TA 7ICKA 1X2IA 4XQ8A 2F1JA 4RNNA 2J6SA 2ZUDA 1KFSA 3RRGA 4Q45A 2IHMA 1UT5A 5J0SA 3SI8A 5KG7A 2ISOA 4FHVA 7ICJA 2W9BA 2DFLA 2XCPA 3MGHA 4ECSA 4WC0A 5KT4A 2FPKA 2BCVA 1ZETA 2JEGA 2HVHA 1CEZA 2FMSA 3MABA 2XGQA 4F8RA 1SL1A 1R89A 5DECA 1BPEA 3PX0A 4X4SA 5J2CA 1T3NA 2XGPA 1ZQBA 4F4YA 1TAUA 7ICVA 5KT3A 4RNMA 4QW8A 5DB8A 1Y88A 4YR0A 4GXJA 1AROP 3MR5A 2XY5A 3PW2A 1ZQGA 8ICFA 3JZ0A 1ZQDA 1RXVA 3T5JA 4QWBA 5J0XA 4EEYA 3PV8A 3ZDBA 4B9LA 7ICNA 4XUSA 9ICSA 8ICXA 8ICIA 3PW0A 2HHSA 1VJ7A 7ICPA 2NRKA 1ZQWA 5CP2A 3BQTA 8ICMA 1ZQQA 3H38A 2A1JA 1T7PA 2LYHA 1JN3A 4BWJA 4DS5A 4X4NA 4Z6FA 4RWNA 1MC8A 1IXRA 3Q8SB 2HHQA 4E0DA 2KZMA 3V6HA 4EZ9A 5DB6A 4IRCA 2BCUA 4FBTA 4M04A 3H37A 3H39A 5IINA 1U45A 4YXJA 9ICHA 4JV2A 3PW5A 4I27A 2ZH5A 4KLIA 2NRVA 2DPJA 4ECYA 4PGXA 4ED1A 3TAPA 2C2EA 4F5OA 5J2FA 4GC6A 1ZQFA 4YMOA 9ICWA 3WFRE 3C1YA 2FMQA 2B21A 3PMLA 3PNCA 1MQ3A 2DRAA 4QZIA 4EYHB 4ECVA 3V7JA 2PFPA 1NO5A 4QZEA 4I2BA 2ZH7A 4F50A 3N4MB 1SZPA 4UD5A 4NY8A 9ICEA 5DLGA 4X4QA 2I1QA 4LZDA 4UAYA 8ICPA 9ICIA 2BCQA 4KLJA 3PO5A 4P2HA 4QWAA 2Q0ZX 9ICPA 7ICLA 4YCXA 3LK9A 3JPTA 2ZUBA 1NKEA 5F9NA 3GV7B 4RQ7A 4PHEA 5CA7A 1UA1A 1BNPA 4WC6A 5J29A 3EYZA 2BGWA 1UEVA 1S9FA 2JEFA 1XC9A 5HNKA 1FA0A 1UA0A 1TFYA 4E80A 2Y1IA 1Z3EB 4C8NA 1COOA 3HW8A 3N97B 2RDIA 2HHXA 4QWDA 4DL4A 3MFHA 4EZ6A 1KDHA 5D49A 4F5QA 4O3QA 4O3RA 2ZH2A 4RPYA 2XY6A 4ELTA 3KHLA 2OWOA 3JPNA 1F5AA 5IIOA 4ED8A 4RT2A 9ICTA 1BPYA 2HHPA 1JXLA 8ICTA 2KZZA 1SL2A 1MIWA 4DQRA 4P4PA 1NZPA 3RH5A 1TKDA 4I28A 8ICUA 4DF4A 1JX4A 3OVAA 8ICEA 3K75D 4PGYA 4DQIA 4NLZA 1PZNA 2DVIA 5F9LA 1ZQZA 2ZH3A 3Q8KA 4YFKA 4J9NA 3B0YA 1IM4A 4DLEA 3KHRA 4M6WB 4GXIA 1ZQRA 2FLPA 2PFOA 4I2HA 3KTQA 5KFTA 2PI5A 2BR0A 5J0RA 4DSEA 9ICQA 3B0XA 3MR3A 3BJYA 1HUZA 4Q43A 2UVVA 4I2EA 4QWCA 5KG6A 7ICRA 1PX5A 2AGOA 5HRBA 5KFCA 1BPDA 1NK8A 3BDPA 8ICOA 3E2EA 2W8LA 4QZFA 1ZQEA 2BE3A 8ICKA 1KNYA 9ICVA 5KFYA 1ZYQA 5J2JA 9ICRA 4WC3A 1MSWD 2DR9A 4F5NA 3RTVA 2BCRA 3RB3A 3RBEA 3OJSA 1MQ2A 7ICHA 4O3PA 5KFSA 5DKWA 4JK1A 3ISCA 5DB7A 1LB2B 4PPXA 4JWMA 4RWQA 3AQLA 4PH5A 2DR5A 1NK9A 4B9SA 4XQ7A 3JPRA 5IIKA 4TUSA 4ZH4A 4YMNA 4RQ3A 4EYIB 4NM1A 1R8CA 1UT8A 5KG1A 2IBKA 1XSPA 4M0AA 5IIMA 2MAXA 4PHAA 3RJJA 4DSIA 2M2UA 5HC9A 4KITB 3WFOA 4WC1A 4F3OA 4K4HA 4Q44A 1JXEA 2BPCA 5J2HA 5L1IA 1MIYA 1ZQYA 4QZHA 2ASDA 4R66A 3T3FA 9ICKA 4LVSA 5KFHA 1UETA 2O5AA 1S97A 5DQIA 4IRDA 3FYHA 3GIMA 2VA3A 4X5VA 2HHUA 1HUOA 4G3IA 1BPBA 2FPLA 5D4BA 2NRZA 5KFWA 3JPQA 3GDXA 3RB0A 3C1ZA 1L3UA 1ZQHA 4I2FA 2FLNA 4JWNA 4ECXA 4KLSA 5HMMA 3EWAA 3PW4A 2VA8A 3G6VA 1ZQSA 1Q79A 3SZ2A 4BWMA 3MFIA 4WCWA 4ECWA 4I2AA 4DQSA 1ZQOA 3RJHA 5HRFA 4S3NA 3ISDA 4ECZA 2PBEA 2PFNA 5DDMA 4Z6DA 1S76D 4AT9A 1DK2A 4AT9B 5EWEA 3H4BA 3GIIA 4F2SA 1NOMA 1L5UA 2HHWA 3H7IA 2I9GA 4DL3A 3THVA 5J0TA 4F4ZA 5KFGA 2W9CB 3PW7A 4IR9A 4MFFA 7ICSA 5F2VO 5KG4A 4DOBA 3ETLA 4UBCA 1RYSA 4BDPA 5CB1A 4K4GA 2HHVA 3L9DA 4M9LA 5KT2A 4FH3A 2DPIA 4J9OA 1KFDA 2Y1JA 2AGPA 4C8LA 3PR4A 4JUZA 5KG0A 4ATBB 4YG2A 2R8HA 5KFEA 4RQ6A 3H40A 1K1SA 3RB4A 1JIHA 4M47A 2ZH1A 3ISBA 4IQTA 3MR2A 5L1JA 5J0YA 3PR5B 1ZQUA 4ED7A 1DK3A 2W9MA 2M2VA 1X9MA 8ICHA 1ZQMA 4MF2A 2BPGA 4QZAA 4BXOB 1MIVA 4I2DA 4M6WA 1KEJA 4J9MA 3Q8MA 3C2KA 2KZ3A 1BPZA 4R65A 2JZBB 3QZ7A 1NJZA 4FS2A 3AQMA 4GXKA 3AU2A 3H8WA 4TURA 3AQKA 1TK8A 4GLXA 2FPMA 3JYYA 3GFKB 2FMPA 3OVSA 5KT6A 3OHBA 1D8LA 4YR3A 3PVXA 3QE9Y 3T5HA 4X4OA 4KLTA 8ICWA 4DSLA 3Q8QB 3HJ4A 4GC7A 3PO4A 2F1HA 2BQ3A 5KG5A 5DG8A 4PGQA 3RB6A 2IMWP 1NK6A 2P6RA 3RR8A 4WBZA 4DOAA 1TK0A 4TQRA 4QZBA 4UAZA 3K4GA 5HREA 4YXMA 4ED3A 2F1IA 5L1KA 4UBBA 1ZQKA 4KLGA 3OSPA 4FHPA 3QEAZ 5DQGA 4O5CA 2BPFA 4O5KA 7ICTA 3PX6A 4NM2A 4MEYA 3EPIA 3RJIA 1QTMA 4NLKA 4O3OA 3ZDAA 1A76A 3Q8PB 3BQ2A 3RJKA 4IQVA 2MUTB 5BOLA 4XRHA 1NKCA 4RQ1A 1B43A 4QW9A 4F93B 4CCHA 1KFTA 1WCNA 4DL6A 2Q66A 4E7XA 8ICCA 4I2IA 5J2EA 4DOCA 2NRTA 2XO7A 2ZTCA 2J6UA 4M9HA 2W9BB 1DOQA 5KTQA 1ZQTA 4M9GA 5KFRA 1BNOA 4NKTA 5CWRA 3NTUA 5DBAA 5HR9A 4DSFA 3OUYB 5KFDA 1RYRA 1QSLA 3MGIA 1NK5A 9ICMA 4X4UA 2WTFA 3UXPA 1X9WA 4FH5A 2V4RA 5HRKA 4DL7A 5J2KA 1JQRA 3NYBA 1CUKA 3OGUA 3NGDA 4DL5A 2XY7A 5EWFA 5KG2A 3WFSC 4R8UB 3MDCA 3UXOA 3M9NB 2R8GA 2PI4A 3RH6A 1A77A 3C5FA 4MF8A 4F91B 4O0IA 3MBYA 4EBCA 4R64A 4B9NA 1ZQIA 1KTQA 4KLEA 3GIJA 3HP6A 1N48A 5HRDA 1RXWA 4ELUA 2W9CA 3ZD8A 4RPXA 4HYKA 4E8FA 3UPSA 2AQ0A 3OV7A 4IRKA 5HRGA 3H8JA 2PXIA 2VA2A 4AT8A 5DG9A 4O3SA 2A1JB 8ICAA 2RFFA 4YVZA 5L1LA 1WCLA 3TI0A 3Q8LA 9ICBA 5KG3A 1R8AA 4EBJA 3UPQA 3UQ2A 1XSNA 5C5JA 4RNOA 4QWEA 1ZQAA 1LV5A 4M9JA 1SKSA 4DF8A 1B22A 1ZQPA 4TUPA 4EBDA 4BXOA 4J9QA 4R63A 3SYZA 3ZDDA 4F5RA 3T5LA 1RZTA 4NXZA 3BQ0A 5KFZA 2JZBA 2DR8A 1U9LA 1XS9D 4NLGA 9ICNA 2KFZA 7ICMA 4FS1A 4WC4A 2P6UA 1NKBA 5KFBA 3HJ1A 1S0VA 2ZH4A 2BHNA 4PHPA 4LZGA 4UB4A 5DGAA 5J2AA 3RAQA 4I29A 4FHWA 5KFOA 9ICGA 2DR7A 3AUOA 5KFFA 1H38A 4RZRA 1EXNA 4RPZA 4DS4A 4DSJA 4M9NA 5CHGA 2UVWA 3TFRA 4KLLA 5IIJA 1U49A 5KFIA 2ASJA 4EBKA 4P4OA 7ICQA 5KT5A 3KHHA 3LQCB 1U4BA 8ICBA 4FHXA 7ICEA 4RWPA 4KLFA 1KRPA 1Q78A 1TV9A 1SKRA 5KFQA 3QZ8A 1HJPA 5TZVA 7ICIA 5J2BA 5IILA 1NJXA 1D8YA 1SL0A 5KFKA 3RJGA 2PFQA 3UQ0A 3V72A 2HHTA 2M2TA 2KFNA 2C2RA 4KLOA 9ICJA 4X4RA 2MUTA 1TFWA 4JV0A 5CR0A 3HIYA 4I2CA 4X4TA 5KFNA 4UB2A 3M8RA 4IQUA 2AJQA 4UD4A 3C2MA 7ICOA 2IHNA 4QZDA 4J9SA 8ICGA 2ZJ5A 3LDAA 5J0PA 4F4XA 2BQUA 3H4DA 1N56A 4DFPA 4UB3A 3GIKA 3OHAA 1S0MA 4X4VA 4C8MA 4IG8A 5L9XA 4WC7A 1DGSA 1NK4A 8ICSA 1JMSA 1K1QA 1XU4A 9ICLA 4TUQA 4AT7B 5KFAA 2ATLA 4DSKA 5DQHA 3KHGA 3OUYA 4DFJA 8ICJA 3UXNA 5DEDA 3MDAA 1NJWA 4IQWA 4ECQA 2AGQA 3H8SA 3OSNA 4YMMA 1D9DA 5J2IA 4YD2A 2HW3A 8ICLA 2ZHBA 4RT3A 4ECRA 7ICGA 4R8UA 3MR6A 1T4GA 5HRLA 4J9RA 4O9MA 2P66A 4X4PA 3EW9A 3M9MB 5KFJA 4F4KA 2KTQA 2NRWA 5KFXA 1ZJMA 4PHDA 3PMNA 3GV8B 5KFUA 4EBEA 5D46A 2ZUCA 4KN7A 3RJFA 4B9UA 1V4AA 2M9NA 1Z00B 3LWMA 4FO6A 1ZQJA 1BGXT 4O5EA 3T5KA 2UVUA 3C21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RR7 A;  4RQ8 A;  4NLN A;  3C2L A;  2JEI A;  4ECT A;  5III A;  1L3T A;  3RJE A;  1S77 D;  3TAR A;  3C66 A;  4RU9 A;  4Q8F A;  2ZJA A;  1ZJN A;  3WFQ E;  5BOM A;  1BPX A;  5HHH A;  2HVI A;  1S0N A;  4ED6 A;  5HHI A;  1BVS A;  1ZQN A;  4XA5 A;  3V6K A;  3RRH A;  3ZDC A;  9ICF A;  5KFL A;  4QZ8 A;  3V6J A;  3H3A A;  5HP4 A;  1D9F A;  1WOT A;  4DEZ A;  4IR1 A;  1NK0 A;  1XWL A;  4NKU A;  3TFS A;  4RWO A;  3SV4 A;  1SKW A;  2R8K A;  4B9M A;  5JUM A;  4K4I A;  4YQW A;  4J9P A;  4KN4 A;  4DLG A;  4MFA A;  4QZG A;  4ED2 A;  2DRB A;  3SV3 A;  2XCA A;  1L3S A;  2ZJ8 A;  4UAW A;  7ICF A;  4RUC A;  4LT6 A;  2M2W A;  4AT8 B;  4DFK A;  4O3N A;  1V9P A;  3IHQ B;  3AQN A;  5J0U A;  5J0Q A;  4MFC A;  4ED0 A;  3V7K A;  3BQ1 A;  5BPC A;  1R8B A;  3V7L A;  3GQC A;  1S0O A;  1QSY A;  2ID1 A;  4M5D A;  2V9W A;  4QZ9 A;  1T8E A;  3AU6 A;  1RPL A;  3GIL A;  2ZH9 A;  3OVB A;  1ZQL A;  4DO9 A;  4WC2 A;  2VAN A;  3PX4 A;  2GWS A;  5HRI A;  5EWG A;  3HX0 A;  1TK5 A;  3C5G A;  4F5P A;  1QSS A;  2AU0 A;  4X0A A;  1X9S A;  1XSL A;  2IA6 A;  1ZQC A;  3C18 A;  5CJ7 A;  4RQ0 A;  4KLH A;  3ZDE A;  2ZTE A;  3TAQ A;  3Q8R B;  4MEX A;  4F2R A;  2O1P A;  3G6X A;  3ZD9 A;  3WFP A;  2C28 A;  2AQ4 A;  2R8I A;  4B9T A;  3EPG A;  9ICC A;  4ELV A;  1KLN A;  2BDP A;  3OJU A;  4X0B A;  5DBC A;  1U47 A;  9ICO A;  5DLF A;  4JV1 A;  4I2J A;  4AT7 A;  1TFR A;  3HPO A;  4UB1 A;  4M2Y A;  4ATB A;  2ISP A;  1TVA A;  4YP3 A;  3PY8 A;  4KLD A;  4KMU A;  4RUA A;  4RQ5 A;  4KTQ A;  4DL2 A;  3QEB Z;  5DDY A;  3RBD A;  2C2D A;  4FBU A;  9ICU A;  1UEU A;  4YD1 A;  4KLQ A;  1VFG A;  3JPO A;  1L3V A;  1QLN A;  4YR2 A;  3M9O B;  4RQ2 A;  3RH4 A;  4RQ4 A;  1S10 A;  2ZTD A;  2JEJ A;  4C8K A;  5KFV A;  5J0W A;  1NK7 A;  4WBY A;  2ZHA A;  5KFM A;  3C23 A;  4UB5 A;  4BGD A;  2W9A A;  5HRH A;  3FDS A;  1YLQ A;  1XO1 A;  4KLU A;  3M8S A;  4F4W A;  3RAX A;  4DQP A;  2BKE A;  1Z00 A;  2R8J A;  8ICR A;  5DG7 A;  2V4Q A;  4J9K A;  4Z6E A;  3IM1 A;  3TQ1 A;  3EZ5 A;  4EP7 A;  2ZH8 A;  3TAN A;  4C8O A;  1JAJ A;  1ZQV A;  2C22 A;  1TAQ A;  3ORY A;  5HML A;  3JPP A;  4Z6C A;  1C7Y A;  5DGB A;  8ICV A;  2RDJ A;  5DBB A;  2KN7 A;  3GV5 B;  3G6Y A;  9ICX A;  4KLM A;  4I2G A;  1ZQX A;  3JPS A;  5EOZ A;  1NJY A;  4ECU A;  4J9L A;  8ICZ A;  4FHY A;  3LWL A;  4DWI A;  2W8K A;  3HWT A;  4YN4 A;  5DB9 A;  4Q8E A;  4DFM A;  2ALZ A;  5J2G A;  4F92 B;  5KT7 A;  5J2D A;  4UQG A;  2XC9 A;  4P4M A;  9ICA A;  2FLL A;  2BQR A;  2ASL A;  8ICY A;  3HT3 A;  2ZH6 A;  2NRX A;  2H5X A;  5KFP A;  8ICN A;  2KP7 A;  2UVR A;  4WC5 A;  2BCS A;  4B9V A;  1KSP A;  1U48 A;  4DQQ A;  7ICU A;  8ICQ A;  1OU5 A;  5J0O A;  4TQS A;  4QZC A;  2J6T A;  7ICK A;  1X2I A;  4XQ8 A;  2F1J A;  4RNN A;  2J6S A;  2ZUD A;  1KFS A;  3RRG A;  4Q45 A;  2IHM A;  1UT5 A;  5J0S A;  3SI8 A;  5KG7 A;  2ISO A;  4FHV A;  7ICJ A;  2W9B A;  2DFL A;  2XCP A;  3MGH A;  4ECS A;  4WC0 A;  5KT4 A;  2FPK A;  2BCV A;  1ZET A;  2JEG A;  2HVH A;  1CEZ A;  2FMS A;  3MAB A;  2XGQ A;  4F8R A;  1SL1 A;  1R89 A;  5DEC A;  1BPE A;  3PX0 A;  4X4S A;  5J2C A;  1T3N A;  2XGP A;  1ZQB A;  4F4Y A;  1TAU A;  7ICV A;  5KT3 A;  4RNM A;  4QW8 A;  5DB8 A;  1Y88 A;  4YR0 A;  4GXJ A;  1ARO P;  3MR5 A;  2XY5 A;  3PW2 A;  1ZQG A;  8ICF A;  3JZ0 A;  1ZQD A;  1RXV A;  3T5J A;  4QWB A;  5J0X A;  4EEY A;  3PV8 A;  3ZDB A;  4B9L A;  7ICN A;  4XUS A;  9ICS A;  8ICX A;  8ICI A;  3PW0 A;  2HHS A;  1VJ7 A;  7ICP A;  2NRK A;  1ZQW A;  5CP2 A;  3BQT A;  8ICM A;  1ZQQ A;  3H38 A;  2A1J A;  1T7P A;  2LYH A;  1JN3 A;  4BWJ A;  4DS5 A;  4X4N A;  4Z6F A;  4RWN A;  1MC8 A;  1IXR A;  3Q8S B;  2HHQ A;  4E0D A;  2KZM A;  3V6H A;  4EZ9 A;  5DB6 A;  4IRC A;  2BCU A;  4FBT A;  4M04 A;  3H37 A;  3H39 A;  5IIN A;  1U45 A;  4YXJ A;  9ICH A;  4JV2 A;  3PW5 A;  4I27 A;  2ZH5 A;  4KLI A;  2NRV A;  2DPJ A;  4ECY A;  4PGX A;  4ED1 A;  3TAP A;  2C2E A;  4F5O A;  5J2F A;  4GC6 A;  1ZQF A;  4YMO A;  9ICW A;  3WFR E;  3C1Y A;  2FMQ A;  2B21 A;  3PML A;  3PNC A;  1MQ3 A;  2DRA A;  4QZI A;  4EYH B;  4ECV A;  3V7J A;  2PFP A;  1NO5 A;  4QZE A;  4I2B A;  2ZH7 A;  4F50 A;  3N4M B;  1SZP A;  4UD5 A;  4NY8 A;  9ICE A;  5DLG A;  4X4Q A;  2I1Q A;  4LZD A;  4UAY A;  8ICP A;  9ICI A;  2BCQ A;  4KLJ A;  3PO5 A;  4P2H A;  4QWA A;  2Q0Z X;  9ICP A;  7ICL A;  4YCX A;  3LK9 A;  3JPT A;  2ZUB A;  1NKE A;  5F9N A;  3GV7 B;  4RQ7 A;  4PHE A;  5CA7 A;  1UA1 A;  1BNP A;  4WC6 A;  5J29 A;  3EYZ A;  2BGW A;  1UEV A;  1S9F A;  2JEF A;  1XC9 A;  5HNK A;  1FA0 A;  1UA0 A;  1TFY A;  4E80 A;  2Y1I A;  1Z3E B;  4C8N A;  1COO A;  3HW8 A;  3N97 B;  2RDI A;  2HHX A;  4QWD A;  4DL4 A;  3MFH A;  4EZ6 A;  1KDH A;  5D49 A;  4F5Q A;  4O3Q A;  4O3R A;  2ZH2 A;  4RPY A;  2XY6 A;  4ELT A;  3KHL A;  2OWO A;  3JPN A;  1F5A A;  5IIO A;  4ED8 A;  4RT2 A;  9ICT A;  1BPY A;  2HHP A;  1JXL A;  8ICT A;  2KZZ A;  1SL2 A;  1MIW A;  4DQR A;  4P4P A;  1NZP A;  3RH5 A;  1TKD A;  4I28 A;  8ICU A;  4DF4 A;  1JX4 A;  3OVA A;  8ICE A;  3K75 D;  4PGY A;  4DQI A;  4NLZ A;  1PZN A;  2DVI A;  5F9L A;  1ZQZ A;  2ZH3 A;  3Q8K A;  4YFK A;  4J9N A;  3B0Y A;  1IM4 A;  4DLE A;  3KHR A;  4M6W B;  4GXI A;  1ZQR A;  2FLP A;  2PFO A;  4I2H A;  3KTQ A;  5KFT A;  2PI5 A;  2BR0 A;  5J0R A;  4DSE A;  9ICQ A;  3B0X A;  3MR3 A;  3BJY A;  1HUZ A;  4Q43 A;  2UVV A;  4I2E A;  4QWC A;  5KG6 A;  7ICR A;  1PX5 A;  2AGO A;  5HRB A;  5KFC A;  1BPD A;  1NK8 A;  3BDP A;  8ICO A;  3E2E A;  2W8L A;  4QZF A;  1ZQE A;  2BE3 A;  8ICK A;  1KNY A;  9ICV A;  5KFY A;  1ZYQ A;  5J2J A;  9ICR A;  4WC3 A;  1MSW D;  2DR9 A;  4F5N A;  3RTV A;  2BCR A;  3RB3 A;  3RBE A;  3OJS A;  1MQ2 A;  7ICH A;  4O3P A;  5KFS A;  5DKW A;  4JK1 A;  3ISC A;  5DB7 A;  1LB2 B;  4PPX A;  4JWM A;  4RWQ A;  3AQL A;  4PH5 A;  2DR5 A;  1NK9 A;  4B9S A;  4XQ7 A;  3JPR A;  5IIK A;  4TUS A;  4ZH4 A;  4YMN A;  4RQ3 A;  4EYI B;  4NM1 A;  1R8C A;  1UT8 A;  5KG1 A;  2IBK A;  1XSP A;  4M0A A;  5IIM A;  2MAX A;  4PHA A;  3RJJ A;  4DSI A;  2M2U A;  5HC9 A;  4KIT B;  3WFO A;  4WC1 A;  4F3O A;  4K4H A;  4Q44 A;  1JXE A;  2BPC A;  5J2H A;  5L1I A;  1MIY A;  1ZQY A;  4QZH A;  2ASD A;  4R66 A;  3T3F A;  9ICK A;  4LVS A;  5KFH A;  1UET A;  2O5A A;  1S97 A;  5DQI A;  4IRD A;  3FYH A;  3GIM A;  2VA3 A;  4X5V A;  2HHU A;  1HUO A;  4G3I A;  1BPB A;  2FPL A;  5D4B A;  2NRZ A;  5KFW A;  3JPQ A;  3GDX A;  3RB0 A;  3C1Z A;  1L3U A;  1ZQH A;  4I2F A;  2FLN A;  4JWN A;  4ECX A;  4KLS A;  5HMM A;  3EWA A;  3PW4 A;  2VA8 A;  3G6V A;  1ZQS A;  1Q79 A;  3SZ2 A;  4BWM A;  3MFI A;  4WCW A;  4ECW A;  4I2A A;  4DQS A;  1ZQO A;  3RJH A;  5HRF A;  4S3N A;  3ISD A;  4ECZ A;  2PBE A;  2PFN A;  5DDM A;  4Z6D A;  1S76 D;  4AT9 A;  1DK2 A;  4AT9 B;  5EWE A;  3H4B A;  3GII A;  4F2S A;  1NOM A;  1L5U A;  2HHW A;  3H7I A;  2I9G A;  4DL3 A;  3THV A;  5J0T A;  4F4Z A;  5KFG A;  2W9C B;  3PW7 A;  4IR9 A;  4MFF A;  7ICS A;  5F2V O;  5KG4 A;  4DOB A;  3ETL A;  4UBC A;  1RYS A;  4BDP A;  5CB1 A;  4K4G A;  2HHV A;  3L9D A;  4M9L A;  5KT2 A;  4FH3 A;  2DPI A;  4J9O A;  1KFD A;  2Y1J A;  2AGP A;  4C8L A;  3PR4 A;  4JUZ A;  5KG0 A;  4ATB B;  4YG2 A;  2R8H A;  5KFE A;  4RQ6 A;  3H40 A;  1K1S A;  3RB4 A;  1JIH A;  4M47 A;  2ZH1 A;  3ISB A;  4IQT A;  3MR2 A;  5L1J A;  5J0Y A;  3PR5 B;  1ZQU A;  4ED7 A;  1DK3 A;  2W9M A;  2M2V A;  1X9M A;  8ICH A;  1ZQM A;  4MF2 A;  2BPG A;  4QZA A;  4BXO B;  1MIV A;  4I2D A;  4M6W A;  1KEJ A;  4J9M A;  3Q8M A;  3C2K A;  2KZ3 A;  1BPZ A;  4R65 A;  2JZB B;  3QZ7 A;  1NJZ A;  4FS2 A;  3AQM A;  4GXK A;  3AU2 A;  3H8W A;  4TUR A;  3AQK A;  1TK8 A;  4GLX A;  2FPM A;  3JYY A;  3GFK B;  2FMP A;  3OVS A;  5KT6 A;  3OHB A;  1D8L A;  4YR3 A;  3PVX A;  3QE9 Y;  3T5H A;  4X4O A;  4KLT A;  8ICW A;  4DSL A;  3Q8Q B;  3HJ4 A;  4GC7 A;  3PO4 A;  2F1H A;  2BQ3 A;  5KG5 A;  5DG8 A;  4PGQ A;  3RB6 A;  2IMW P;  1NK6 A;  2P6R A;  3RR8 A;  4WBZ A;  4DOA A;  1TK0 A;  4TQR A;  4QZB A;  4UAZ A;  3K4G A;  5HRE A;  4YXM A;  4ED3 A;  2F1I A;  5L1K A;  4UBB A;  1ZQK A;  4KLG A;  3OSP A;  4FHP A;  3QEA Z;  5DQG A;  4O5C A;  2BPF A;  4O5K A;  7ICT A;  3PX6 A;  4NM2 A;  4MEY A;  3EPI A;  3RJI A;  1QTM A;  4NLK A;  4O3O A;  3ZDA A;  1A76 A;  3Q8P B;  3BQ2 A;  3RJK A;  4IQV A;  2MUT B;  5BOL A;  4XRH A;  1NKC A;  4RQ1 A;  1B43 A;  4QW9 A;  4F93 B;  4CCH A;  1KFT A;  1WCN A;  4DL6 A;  2Q66 A;  4E7X A;  8ICC A;  4I2I A;  5J2E A;  4DOC A;  2NRT A;  2XO7 A;  2ZTC A;  2J6U A;  4M9H A;  2W9B B;  1DOQ A;  5KTQ A;  1ZQT A;  4M9G A;  5KFR A;  1BNO A;  4NKT A;  5CWR A;  3NTU A;  5DBA A;  5HR9 A;  4DSF A;  3OUY B;  5KFD A;  1RYR A;  1QSL A;  3MGI A;  1NK5 A;  9ICM A;  4X4U A;  2WTF A;  3UXP A;  1X9W A;  4FH5 A;  2V4R A;  5HRK A;  4DL7 A;  5J2K A;  1JQR A;  3NYB A;  1CUK A;  3OGU A;  3NGD A;  4DL5 A;  2XY7 A;  5EWF A;  5KG2 A;  3WFS C;  4R8U B;  3MDC A;  3UXO A;  3M9N B;  2R8G A;  2PI4 A;  3RH6 A;  1A77 A;  3C5F A;  4MF8 A;  4F91 B;  4O0I A;  3MBY A;  4EBC A;  4R64 A;  4B9N A;  1ZQI A;  1KTQ A;  4KLE A;  3GIJ A;  3HP6 A;  1N48 A;  5HRD A;  1RXW A;  4ELU A;  2W9C A;  3ZD8 A;  4RPX A;  4HYK A;  4E8F A;  3UPS A;  2AQ0 A;  3OV7 A;  4IRK A;  5HRG A;  3H8J A;  2PXI A;  2VA2 A;  4AT8 A;  5DG9 A;  4O3S A;  2A1J B;  8ICA A;  2RFF A;  4YVZ A;  5L1L A;  1WCL A;  3TI0 A;  3Q8L A;  9ICB A;  5KG3 A;  1R8A A;  4EBJ A;  3UPQ A;  3UQ2 A;  1XSN A;  5C5J A;  4RNO A;  4QWE A;  1ZQA A;  1LV5 A;  4M9J A;  1SKS A;  4DF8 A;  1B22 A;  1ZQP A;  4TUP A;  4EBD A;  4BXO A;  4J9Q A;  4R63 A;  3SYZ A;  3ZDD A;  4F5R A;  3T5L A;  1RZT A;  4NXZ A;  3BQ0 A;  5KFZ A;  2JZB A;  2DR8 A;  1U9L A;  1XS9 D;  4NLG A;  9ICN A;  2KFZ A;  7ICM A;  4FS1 A;  4WC4 A;  2P6U A;  1NKB A;  5KFB A;  3HJ1 A;  1S0V A;  2ZH4 A;  2BHN A;  4PHP A;  4LZG A;  4UB4 A;  5DGA A;  5J2A A;  3RAQ A;  4I29 A;  4FHW A;  5KFO A;  9ICG A;  2DR7 A;  3AUO A;  5KFF A;  1H38 A;  4RZR A;  1EXN A;  4RPZ A;  4DS4 A;  4DSJ A;  4M9N A;  5CHG A;  2UVW A;  3TFR A;  4KLL A;  5IIJ A;  1U49 A;  5KFI A;  2ASJ A;  4EBK A;  4P4O A;  7ICQ A;  5KT5 A;  3KHH A;  3LQC B;  1U4B A;  8ICB A;  4FHX A;  7ICE A;  4RWP A;  4KLF A;  1KRP A;  1Q78 A;  1TV9 A;  1SKR A;  5KFQ A;  3QZ8 A;  1HJP A;  5TZV A;  7ICI A;  5J2B A;  5IIL A;  1NJX A;  1D8Y A;  1SL0 A;  5KFK A;  3RJG A;  2PFQ A;  3UQ0 A;  3V72 A;  2HHT A;  2M2T A;  2KFN A;  2C2R A;  4KLO A;  9ICJ A;  4X4R A;  2MUT A;  1TFW A;  4JV0 A;  5CR0 A;  3HIY A;  4I2C A;  4X4T A;  5KFN A;  4UB2 A;  3M8R A;  4IQU A;  2AJQ A;  4UD4 A;  3C2M A;  7ICO A;  2IHN A;  4QZD A;  4J9S A;  8ICG A;  2ZJ5 A;  3LDA A;  5J0P A;  4F4X A;  2BQU A;  3H4D A;  1N56 A;  4DFP A;  4UB3 A;  3GIK A;  3OHA A;  1S0M A;  4X4V A;  4C8M A;  4IG8 A;  5L9X A;  4WC7 A;  1DGS A;  1NK4 A;  8ICS A;  1JMS A;  1K1Q A;  1XU4 A;  9ICL A;  4TUQ A;  4AT7 B;  5KFA A;  2ATL A;  4DSK A;  5DQH A;  3KHG A;  3OUY A;  4DFJ A;  8ICJ A;  3UXN A;  5DED A;  3MDA A;  1NJW A;  4IQW A;  4ECQ A;  2AGQ A;  3H8S A;  3OSN A;  4YMM A;  1D9D A;  5J2I A;  4YD2 A;  2HW3 A;  8ICL A;  2ZHB A;  4RT3 A;  4ECR A;  7ICG A;  4R8U A;  3MR6 A;  1T4G A;  5HRL A;  4J9R A;  4O9M A;  2P66 A;  4X4P A;  3EW9 A;  3M9M B;  5KFJ A;  4F4K A;  2KTQ A;  2NRW A;  5KFX A;  1ZJM A;  4PHD A;  3PMN A;  3GV8 B;  5KFU A;  4EBE A;  5D46 A;  2ZUC A;  4KN7 A;  3RJF A;  4B9U A;  1V4A A;  2M9N A;  1Z00 B;  3LWM A;  4FO6 A;  1ZQJ A;  1BGX T;  4O5E A;  3T5K A;  2UVU A;  3C21 A; 
#chains in the Genus database with same CATH topology
 3RR7 A;  2Y0S F;  5AIC A;  5AKI A;  4RQ8 A;  4NLN A;  2BBH A;  3KKA C;  5III A;  3WKB A;  3C66 A;  4RU9 A;  1DRG A;  5K4L A;  1N5W A;  1BVS A;  4XA5 A;  3ZDC A;  9ICF A;  3QU5 A;  1PVQ A;  1WOT A;  4DEZ A;  4NKU A;  1SKW A;  4K4I A;  1PUZ A;  3K1Z A;  2AH5 A;  4DLG A;  4QZG A;  3OWG A;  2DRB A;  3SV3 A;  4UAW A;  4RUC A;  2M2W A;  2PMZ F;  5CFS A;  5J0Q A;  4MFC A;  4LJX A;  3BQ1 A;  5FP0 A;  5BPC A;  5ALW A;  1QSY A;  3GIL A;  1ZQL A;  4DO9 A;  2M0N A;  2GWS A;  5EWG A;  3C5G A;  4F5P A;  2KE7 A;  1S5L U;  2AU0 A;  1XSL A;  2IA6 A;  1ZQC A;  1UQV A;  3ZDE A;  3M1Y A;  2R8I A;  4B9T A;  4EGW A;  9ICC A;  1KLN A;  2ZIX A;  2WHE A;  1U47 A;  9ICO A;  4AT7 A;  3OPX A;  2ISP A;  4YP3 A;  1UPH A;  3PY8 A;  4KMU A;  4RUA A;  4RQ5 A;  4DL2 A;  4KLQ A;  1QLN A;  4YR2 A;  1NK7 A;  5KFM A;  2W9A A;  5CEH A;  5HRH A;  3QU2 A;  3FDS A;  1Z00 A;  5B66 U;  2WB1 C;  5ALR A;  3TQ1 A;  3EZ5 A;  3TAN A;  4C8O A;  1ZQV A;  1GO3 F;  3N28 A;  2RDJ A;  3GV5 B;  4K8V A;  1ZQX A;  1NJY A;  5ALE A;  3HWT A;  2HBL A;  5DB9 A;  4Q8E A;  5KT7 A;  2QB1 A;  2BQR A;  3PST A;  4WC5 A;  1KSP A;  8ICQ A;  4NXX A;  4RNN A;  2ZUD A;  2EZY A;  5J0S A;  3SI8 A;  5KG7 A;  3MGH A;  2BCV A;  2HVH A;  3MCR A;  5ALT A;  1N62 A;  2FMS A;  2XGQ A;  1R89 A;  4UB6 U;  4US9 A;  4C0Z A;  4RNM A;  4WC2 A;  1Y88 A;  4YR0 A;  2DR8 A;  1ARO P;  3PW2 A;  2NO5 A;  1ZQG A;  4RQN A;  1VLB A;  1RXV A;  3ZDB A;  5J0X A;  1B0X A;  7ICP A;  4WOY A;  3BQT A;  2HBJ A;  4F72 A;  2LYH A;  1JN3 A;  4BWJ A;  4DS5 A;  3D6J A;  4O68 A;  1MC8 A;  1IXR A;  1KN5 A;  3V6H A;  5AK3 A;  4M04 A;  3H37 A;  1K5O A;  2E1E A;  4KLI A;  2NRV A;  2DUY A;  2KOB A;  4ED1 A;  2C2E A;  3SD7 A;  4JMU A;  4F5O A;  1ZQF A;  5J8Y C;  9ICW A;  3C1Y A;  2KSO B;  2KMD A;  2H3F A;  3PNC A;  1YT3 A;  4ECV A;  1NO5 A;  5ALV A;  4I2B A;  3N4M B;  5AI0 A;  3PO5 A;  4P2H A;  2Q0Z X;  5ALP A;  3LK9 A;  3JPT A;  5AM5 A;  2BBJ A;  4RQ7 A;  5CA7 A;  3EYZ A;  1ZD3 A;  4CF4 A;  5EE0 A;  1XC9 A;  5HNK A;  4KX3 A;  5AKX A;  4C8N A;  3HW8 A;  5ALZ A;  5GTI U;  3MFH A;  2HBK A;  4O3Q A;  2CPR A;  2D8C A;  5L1M A;  3KHL A;  4Y2V A;  2OWO A;  3JPN A;  5IIO A;  2VJ5 A;  2ZXI A;  4P4P A;  3RH5 A;  1TKD A;  4I28 A;  4LEV A;  5ALS A;  1V85 A;  3K75 D;  2Q4T A;  4DQI A;  1FFU A;  4NLZ A;  2ZH3 A;  2JMG A;  2BR0 A;  4UAT A;  1N61 A;  5HRB A;  4B6J A;  9ICV A;  5KFY A;  2VJ4 A;  2H3I A;  2DR9 A;  2ZIV A;  1N5X A;  3CP8 A;  4O3P A;  5KFS A;  3ISC A;  5DB7 A;  4PPX A;  2H3V A;  4PH5 A;  1NK9 A;  4RQ3 A;  2IBK A;  4M0A A;  5IIM A;  3RJJ A;  4DSI A;  4Y2Q A;  1Z4O A;  1P7D A;  3O0F A;  2BPC A;  2K60 A;  2ASD A;  4R66 A;  5KFH A;  5F3X B;  1S97 A;  5DQI A;  4IRD A;  3GIM A;  2VA3 A;  1J2M A;  1BPB A;  2FPL A;  2YB1 A;  5KFW A;  3RB0 A;  1L3U A;  4C8K A;  3E0F A;  2ZIU A;  3NVZ A;  3EWA A;  3PW4 A;  1ZQS A;  3SZ2 A;  3BS7 A;  3RJH A;  4Z6D A;  5KAF U;  3H4B A;  3DV9 A;  2HDO A;  4F2S A;  1ZRM A;  1L5U A;  2HHW A;  2WF6 A;  2W9C B;  1RM6 C;  5CB1 A;  2QB0 A;  2HHV A;  2EH9 A;  4CE6 A;  4M47 A;  5KFE A;  4RQ6 A;  3RB4 A;  2G0A A;  5J0Y A;  2DKZ A;  1DK3 A;  2W9M A;  2WF7 A;  4UAR A;  4M6W A;  4WJ3 B;  3NKU A;  1WYG A;  4GXK A;  3AU2 A;  5AI9 A;  3NUQ A;  2FPM A;  4YR3 A;  4MKP A;  2DKX A;  4BJQ A;  4X4O A;  3K7D A;  3PO4 A;  5ALD A;  2BQ3 A;  3RB6 A;  3JCF A;  1NK6 A;  4A8E A;  4QZB A;  3K4G A;  4ED3 A;  5L1K A;  1L7P A;  3QEA Z;  4O5K A;  4K9B A;  4NM2 A;  3EPI A;  3RJI A;  5ALH A;  4IL6 U;  2MA1 A;  1B43 A;  4F93 B;  4E7X A;  8ICC A;  4I2I A;  5AIA A;  5KAI U;  2J6U A;  1BNO A;  1ZQT A;  4M9G A;  5AK6 A;  4NKT A;  5CWR A;  1RQN A;  5DBA A;  5HR9 A;  4Y2X A;  9ICM A;  1RYR A;  3MGI A;  3UXP A;  2KK0 A;  4FH5 A;  3B9J A;  4Y2J A;  4AP9 A;  3NYB A;  3WFS C;  3OGU A;  3NGD A;  4DL5 A;  4R8U B;  4AT9 A;  9ICQ A;  3HJ1 A;  2R8G A;  2DGZ A;  4MF8 A;  4B9N A;  3GIJ A;  3HP6 A;  2W11 A;  3ZD8 A;  2KKV A;  3QUB A;  2JHD A;  4IRK A;  4P0Q B;  4QIW C;  4YVZ A;  3TI0 A;  2YB4 A;  5KG3 A;  2W03 A;  1R8A A;  3UPQ A;  2LKY A;  1LV5 A;  1SKS A;  2LM4 A;  2E8N A;  4EBD A;  3SYZ A;  1OW5 A;  1QCK A;  3TAD C;  4F5R A;  1RZT A;  4NXZ A;  4QNL A;  2JZB A;  1XS9 D;  7ICM A;  4FS1 A;  2P6U A;  1NKB A;  2BHN A;  3ONN A;  5DGA A;  2CXY A;  3IRU A;  9ICG A;  2DR7 A;  1H38 A;  5KFF A;  4RZR A;  2IHO A;  3HKZ C;  4RPZ A;  1FEZ A;  5KFI A;  4P4O A;  3LQC B;  3KHH A;  7ICE A;  1OUQ A;  1KRP A;  3LVV A;  2IOF K;  1TV9 A;  4QJF B;  5TZV A;  5J2B A;  5AIB A;  1Q3U A;  5KFK A;  9ICJ A;  2MUT A;  1TFW A;  3HIY A;  1L7N A;  4N7R A;  4UD4 A;  2YX8 A;  3QX7 A;  1KBU A;  4J9S A;  3LDA A;  5AI6 A;  3VCB A;  3OHA A;  2P35 A;  1DGS A;  2W43 A;  1XU4 A;  5KFA A;  2ATL A;  4C80 A;  4DSK A;  1URJ A;  3OUY A;  5DED A;  1Z19 A;  2KIC A;  4YMM A;  5HR6 A;  5J2I A;  4IS7 A;  4YD2 A;  3F2D A;  7ICG A;  3WK6 A;  3MR6 A;  4O9M A;  3GU3 A;  3EW9 A;  2NRW A;  5KFU A;  4EBE A;  4B9U A;  4KN7 A;  2G08 A;  2YTU A;  4QIW F;  4NY8 A;  8ICP A;  2MSN A;  3NRW A;  4ECT A;  1L3T A;  3RJE A;  2KVC A;  4Q8F A;  3WFQ E;  5AI4 A;  1S0N A;  5HHI A;  5AM0 A;  1ZQN A;  3RRH A;  4C4T A;  5AK5 A;  5KFL A;  1ZD4 A;  1D9F A;  4IR1 A;  1Z1V A;  1NK0 A;  1XWL A;  3UM9 A;  2FDR A;  2R8K A;  1B4F A;  3HKZ F;  4KN4 A;  4EEK A;  4K96 A;  7ICF A;  4AT8 B;  3AQN A;  2YN4 A;  2A3V A;  5J0U A;  3V7K A;  1R8B A;  3GQC A;  2ID1 A;  2I5H A;  3AU6 A;  1RPL A;  3QXG A;  5HRI A;  4EV6 A;  3HX0 A;  5E79 U;  1QSS A;  5CJ7 A;  4RQ0 A;  3VC8 A;  2EAM A;  4LEW A;  5B5E U;  4MEX A;  2O1P A;  2HOF A;  3G6X A;  1FO4 A;  1L7O A;  3OJU A;  5DBC A;  3BZK A;  4UB1 A;  4NXW A;  4ACO A;  1TVA A;  4KTQ A;  9ICU A;  2C2D A;  4YD1 A;  3JPO A;  4DFD A;  3SAG A;  2ZTD A;  3KD3 A;  5J0W A;  2ZHA A;  3KZI U;  3M6Z A;  3C23 A;  1YLQ A;  1XO1 A;  4DQP A;  2BKE A;  4Z6E A;  4UB8 U;  5D61 A;  4EP7 A;  4XJE A;  2ZH8 A;  1UCV A;  2GAF D;  3AQE A;  1TAQ A;  5HML A;  4Z6C A;  2PMZ C;  5CFU A;  3QYP A;  4KLM A;  3JPS A;  4PJ0 U;  4J9L A;  2ODG A;  8ICZ A;  3LWL A;  4DWI A;  3BZC A;  1MN8 A;  4UAU A;  5J2G A;  4F92 B;  4UQG A;  2XC9 A;  2Y9T A;  9ICA A;  2NRX A;  2H5X A;  3SAF A;  5KFP A;  8ICN A;  2KP7 A;  3BS5 B;  3CNH A;  7ICU A;  1OU5 A;  4Y2R A;  5JRT A;  5J0O A;  7ICK A;  2F1J A;  2DL0 A;  4J03 A;  2J6S A;  4OAI Z;  1KFS A;  3RRG A;  4Q45 A;  1QQ7 A;  2ISO A;  3WKD A;  2DFL A;  2XCP A;  4ECS A;  5KT4 A;  2FPK A;  2JEG A;  4F8R A;  5B3Q A;  4BUG A;  5J2C A;  2XGP A;  1MQ3 A;  2UVU A;  4JLZ A;  4Y2T A;  3JZ0 A;  5D62 A;  8ICX A;  1PVP A;  8ICI A;  1VJ7 A;  4XUS A;  9ICS A;  2NRK A;  4O6A A;  3OV7 A;  5CP2 A;  1ZQQ A;  2IOH A;  3E58 A;  2GLE A;  4K97 A;  4Z6F A;  3Q8S B;  4E0D A;  2KZM A;  5ALJ A;  4EZ9 A;  2L5Y A;  2DBY A;  5IIN A;  1HEK A;  9ICH A;  2KNJ A;  1JAL A;  4I27 A;  2JV3 A;  2A1A A;  4NL9 A;  4GC6 A;  3WFR E;  2FMQ A;  3PML A;  2KJ8 A;  3V7J A;  4PZN A;  2ZH7 A;  1S8O A;  2EWR A;  2KJ9 A;  4X4Q A;  4LZD A;  4UAY A;  3UMG A;  4QWA A;  9ICP A;  3F2C A;  2LMR A;  1UA1 A;  2B51 A;  4USA A;  2E5S A;  1MA7 A;  1TFY A;  4E80 A;  1UHU A;  2RDI A;  4QWD A;  5AI5 A;  1T3Q A;  5D49 A;  2ZH2 A;  4RPY A;  2PKE A;  2KEY A;  1X9X A;  2HI0 A;  2GA9 D;  1BPY A;  2KZZ A;  1PK3 A;  2KIW A;  1NZP A;  2AHO B;  8ICE A;  1PZN A;  3Q8K A;  3B0Y A;  1IM4 A;  4OD0 A;  2FLP A;  3KTQ A;  5AKE A;  4CF5 A;  5ALQ A;  5J0R A;  3B0X A;  3BJY A;  7ICR A;  1PX5 A;  8ICO A;  4NXU A;  2BE3 A;  8ICK A;  4EEL A;  1ZYQ A;  2EAN A;  4HX0 A;  4WC3 A;  3RTV A;  2KHV A;  3RB3 A;  3RBE A;  1MQ2 A;  3A0H U;  5ALG A;  1LB2 B;  4RWQ A;  3ALR A;  4B9S A;  1IIP A;  1R8C A;  4NM1 A;  5JU5 A;  2M2U A;  5HC9 A;  1TE2 A;  2DF4 B;  2B6G A;  2KSO A;  1DXS A;  1JXE A;  2N1R A;  4NV0 A;  2JGA A;  4X5V A;  2LI6 A;  1HUO A;  1VJ5 A;  5D4B A;  3JPQ A;  1ZQH A;  4I2F A;  4FE3 A;  2FLN A;  4BWM A;  3MFI A;  4WCW A;  4I2A A;  4S3N A;  4ECZ A;  4ICA A;  1S76 D;  1DK2 A;  5JTI A;  1NOM A;  4FFD A;  2K8B B;  4O3M A;  2I9G A;  3THV A;  5F2V O;  4MFF A;  1SV0 C;  2OYY A;  3ETL A;  4BDP A;  4K4G A;  1RG6 A;  2ZIX B;  5KT2 A;  1KFD A;  5T14 A;  2R8H A;  1K1S A;  3ISB A;  2DWQ A;  5TIS U;  3MR2 A;  1ZQU A;  4ED7 A;  2JH1 A;  8ICH A;  4K98 A;  4J9M A;  4R65 A;  3QZ7 A;  1WWV A;  4TUR A;  1F0M A;  2W54 A;  4GLX A;  3JYY A;  4GIB A;  3OHB A;  3PVX A;  4KLT A;  2LHT A;  8ICW A;  4DSL A;  3Q8Q B;  4KMO B;  1Z4N A;  2R18 A;  5DG8 A;  3RR8 A;  2IMW P;  2W7O A;  4DOA A;  1QQ6 A;  4TQR A;  4UBB A;  3OSP A;  4FHP A;  1A6S A;  5DQG A;  2BPF A;  3PX6 A;  3NRZ A;  4O3O A;  1A76 A;  3BQ2 A;  3RJK A;  1NKC A;  2HCF A;  4CCH A;  3WKA A;  4DL6 A;  3ETR A;  5J2E A;  1PK1 A;  3HIL A;  2XO7 A;  2ZTC A;  4M9H A;  3K1R B;  5KFD A;  4X4U A;  1NK5 A;  2WTF A;  4CNQ A;  4DL7 A;  5J2K A;  2XY7 A;  5EWF A;  5KG2 A;  3MDC A;  4RWP A;  5JTG A;  2VIX A;  2ZG6 A;  2W3S A;  3RH6 A;  4F91 B;  3MBY A;  4EBC A;  4KLE A;  3WK7 A;  1ZQI A;  1KTQ A;  1RXW A;  2W9C A;  4HYK A;  4OJO A;  3H8J A;  2PXI A;  2VA2 A;  4O3S A;  8ICA A;  4U6P A;  3Q8L A;  9ICB A;  2FJ6 A;  5C5J A;  4M9J A;  3NVV A;  1ZQA A;  1OXJ A;  4TUP A;  3T5L A;  4RQM A;  3NAS A;  1X40 A;  5KFB A;  1S0V A;  4UB4 A;  4FHW A;  4I29 A;  4EEB A;  4LEZ A;  4DS4 A;  1RDF A;  2K8A A;  4KLL A;  4GFJ A;  2ASJ A;  4EBK A;  3QUT A;  2LYB A;  7ICQ A;  4FHX A;  5D63 A;  4KLF A;  1HJP A;  2O6K A;  3EUB 2;  1SL0 A;  1HIW A;  3UQ0 A;  3WKC A;  2CRX A;  2C2R A;  2KFN A;  4X4R A;  4JV0 A;  4X4T A;  5KFN A;  4UB2 A;  2AJQ A;  4IQU A;  4MHV A;  3C2M A;  7ICO A;  2IHN A;  5EE3 A;  8ICG A;  2ZJ5 A;  5J0P A;  2BQU A;  1S0M A;  1N56 A;  4UB3 A;  4X4V A;  4C8M A;  3FAH A;  3F5A A;  5KNI A;  3DDH A;  4TUQ A;  5DQH A;  3KHG A;  4DFJ A;  3KKA A;  3AMZ A;  1NJW A;  4IQW A;  2EAO A;  2HW3 A;  1Q46 A;  8ICL A;  4RT3 A;  4R8U A;  2P66 A;  2E8O A;  5KFJ A;  2OEH A;  1SB3 C;  3UMC A;  2ZUC A;  1V4A A;  2IUB A;  2M9N A;  3LWM A;  4O5E A;  4OJP A;  4P0Q A;  3C21 A;  3PSI A;  1X6J A;  2JEI A;  3TAR A;  2K8C B;  2KVS A;  2ZJA A;  2BDU A;  2HVI A;  4ED6 A;  3V6K A;  3H3A A;  3WK8 A;  4C7Y A;  2AXT U;  4C4R A;  1KQQ A;  4RWO A;  3SV4 A;  5JUM A;  1KW4 A;  3PZP A;  4J9P A;  2RP5 A;  4I0U A;  4ED2 A;  3ICX A;  2ZJ8 A;  5CRX A;  4LT6 A;  4DFK A;  3HRD D;  3IHQ B;  1ZXI A;  2Z7J A;  3CYM A;  3V7L A;  1KKX A;  2VAN A;  3PX4 A;  2NO4 A;  1TK5 A;  1X9S A;  4KLH A;  2W55 A;  2H3Q A;  2ZTE A;  3Q8R B;  3ZD9 A;  2C28 A;  2AQ4 A;  2MRL A;  4X0B A;  2QB0 B;  5DLF A;  4JV1 A;  4K99 A;  4ATB A;  4NJ8 A;  4KLD A;  5ALY A;  3RBD A;  3CRX A;  3M9O B;  3RH4 A;  4RQ4 A;  1S10 A;  5KFV A;  4P0P A;  4WBY A;  3C29 A;  4BGD A;  4JLX A;  4OJL A;  4KLU A;  2RLT A;  3OTQ A;  3M8S A;  4F4W A;  3RAX A;  2ZXH A;  1SWW A;  2V4Q A;  1QQ5 A;  2RQ5 A;  3UMB A;  5AKY A;  2XI9 A;  3F2B A;  3J81 j;  1JAJ A;  2C22 A;  3ORY A;  2I6X A;  3JPP A;  1C7Y A;  5DGB A;  4OO1 J;  3IDW A;  9ICX A;  4I2G A;  5EOZ A;  2F3N A;  3CK6 A;  1FFV A;  4YN4 A;  4DFM A;  2ALZ A;  5J2D A;  2FLL A;  2ASL A;  8ICY A;  2ZH6 A;  4FZM A;  1PVR A;  1SXD A;  4QZC A;  4CGZ A;  1CRX A;  4AT8 A;  3KZX A;  4C7Z A;  1UT5 A;  2W9B A;  4WC0 A;  4AYB C;  3KBB A;  1CEZ A;  4OJ5 A;  2B0C A;  3WK9 A;  3R9K A;  3MAB A;  1SL1 A;  1BPE A;  4X4S A;  2F8L A;  3NVW A;  1ZQB A;  4F4Y A;  4QW8 A;  4GXJ A;  2XY5 A;  4FZN A;  8ICF A;  2QAR A;  4B9L A;  3QUC A;  3PW0 A;  2HHS A;  1ZQW A;  3H38 A;  5J8Y A;  2A1J A;  2CN1 A;  2KIV A;  4RWN A;  2EAP A;  2HHQ A;  4IRC A;  2BCU A;  4F71 A;  4FBT A;  2HOQ A;  3QU9 A;  4G9B A;  3TAC B;  1U45 A;  1JRO A;  4JV2 A;  3PW5 A;  2ZH5 A;  2HN2 A;  2YMQ A;  2DPJ A;  3SAH A;  3F5E A;  4PGX A;  1KL9 A;  2KG5 A;  4YMO A;  3ERC C;  2B21 A;  1J2N A;  2G07 A;  4EYH B;  4NWI A;  3MGV A;  3ER9 B;  1F5S A;  5AKL A;  1SZP A;  4UD5 A;  2I1Q A;  2K4I A;  4KLJ A;  7ICL A;  4YCX A;  3SEN A;  1V97 A;  2K89 A;  2ZUB A;  1NKE A;  4PHE A;  5HR7 A;  4WC6 A;  1VDV A;  5J29 A;  2BGW A;  1UEV A;  1S9F A;  2JEF A;  1FA0 A;  3BS5 A;  3D2S A;  2Y1I A;  1COO A;  4EZ6 A;  1KDH A;  4F5Q A;  4O3R A;  2WAQ C;  4OCZ A;  4AYB F;  3SEI A;  4RT2 A;  9ICT A;  1SL2 A;  1MIW A;  8ICU A;  1JX4 A;  2W7P A;  3OVA A;  2WFA A;  4OJ6 A;  2DVI A;  4UAS A;  5F9L A;  1ZQZ A;  3FM9 A;  4YFK A;  4J9N A;  1ZQR A;  4I2H A;  3KHR A;  4GXI A;  5KFT A;  1YZ6 A;  1V38 A;  1HUZ A;  3MR3 A;  2UVV A;  4Q43 A;  3NWI A;  1ZD2 P;  4QWC A;  5KG6 A;  5KFC A;  1BPD A;  2KV2 A;  4QZF A;  1KNY A;  9ICR A;  1MSW D;  4F5N A;  7ICH A;  2F77 X;  3CW2 C;  4JK1 A;  3AQL A;  4XQ7 A;  4YMN A;  2ESE A;  1UT8 A;  5KG1 A;  1XSP A;  2W3R A;  3WFO A;  1Z1B A;  1WG8 A;  4K4H A;  5J2H A;  3F53 A;  9ICK A;  4LVS A;  1X66 A;  1UET A;  3PSP A;  3FYH A;  4UW9 A;  2HHU A;  4G3I A;  2PBE A;  2NRZ A;  3C1Z A;  5AI8 A;  4KLS A;  5HMM A;  2VA8 A;  3G6V A;  3N7P D;  2GH1 A;  2PFN A;  5DDM A;  2G5H B;  3GII A;  2WAQ F;  4DL3 A;  5KFG A;  7ICS A;  5KG4 A;  1RYS A;  4FH3 A;  2HMX A;  3L9D A;  4M9L A;  4KM5 A;  2DPI A;  4J9O A;  4C8L A;  3PR4 A;  4JUZ A;  2QLT A;  2B4V A;  3H40 A;  1JIH A;  2WF5 A;  4IQT A;  5L1J A;  3PR5 B;  1ZQM A;  4MF2 A;  2G5I B;  2BPG A;  4BXO B;  4I2D A;  1KEJ A;  3Q8M A;  1BPZ A;  2KZ3 A;  3IV6 A;  4EX7 A;  4FS2 A;  2K4E A;  3H8W A;  1LKY B;  3AQK A;  1TAM A;  1TK8 A;  2LBO A;  3OVS A;  3GFK B;  2FMP A;  5KT6 A;  4HAI A;  5AHX A;  3HJ4 A;  2F1H A;  4NLC A;  3C28 A;  4BX9 C;  5KG5 A;  4WBZ A;  1TK0 A;  3QUQ A;  4UAZ A;  1FIQ A;  3WU2 U;  4KLG A;  3KFU F;  4O5C A;  7ICT A;  4NLK A;  5ALU A;  3SR6 A;  3L3F X;  4IQV A;  2LYA A;  5G5G A;  3HJE A;  1WCN A;  4DOC A;  2XVT A;  5KFR A;  5ALM A;  1O08 A;  4WH5 A;  2JH7 A;  3N7S C;  1QSL A;  2F44 A;  1JQR A;  3MC1 A;  3M9N B;  2ZIW B;  2PI4 A;  1A77 A;  3C5F A;  3TAD A;  1IV8 A;  4ELU A;  3RF9 A;  4E8F A;  2VKQ A;  1IG6 A;  1X6I A;  1N63 A;  2EZZ A;  2RFF A;  1WCL A;  1ED1 A;  4EBJ A;  4O69 A;  4RNO A;  1B22 A;  4DF8 A;  3ED5 A;  3U26 A;  1ZQP A;  2JR5 A;  4J9Q A;  2EQY A;  4CDG A;  3ER8 C;  2FE9 A;  3BQ0 A;  1M6Y A;  1SZH A;  5KFZ A;  9ICN A;  4NLG A;  4WC4 A;  2ZH4 A;  3QU4 A;  5J2A A;  3RAQ A;  3AUO A;  4OAG A;  4M9N A;  2D6F C;  3I28 A;  4EED A;  1N2X A;  5IIJ A;  4O67 A;  3WK4 A;  1U4B A;  8ICB A;  3LVW A;  5KFQ A;  2EZX A;  7ICI A;  1A0P A;  1D8Y A;  2M2T A;  2OXO A;  5CR0 A;  4I2C A;  2MU2 A;  4DFP A;  3FC4 A;  3GIK A;  4IG8 A;  3S6J A;  5L9X A;  8ICS A;  1JMS A;  1K1Q A;  4Y2S A;  9ICL A;  1RQL A;  4AT7 B;  3H8M A;  8ICJ A;  3UXN A;  4ECQ A;  2AGQ A;  5AM3 A;  4Y2U A;  3IP4 B;  4ECR A;  5ALN A;  1T4G A;  5HRL A;  4J9R A;  3M9M B;  2A19 A;  5H2F U;  1ZD5 A;  2KTQ A;  1ZJM A;  4PHD A;  3GV8 B;  1F44 A;  5D46 A;  3RJF A;  2GOL A;  1Z00 B;  4FO6 A;  1ZQJ A;  3IG8 A;  1BGX T;  3C2L A;  2KJ5 A;  4PL2 A;  2E8P A;  1S77 D;  2OM6 A;  5EE9 A;  5AK4 A;  1ZJN A;  5BOM A;  1BPX A;  5HHH A;  1QH9 A;  4QZ8 A;  3V6J A;  2JRZ A;  1L8O A;  5HP4 A;  2FI1 A;  2LM1 A;  1SGG A;  2WF9 A;  2WB1 F;  4US8 A;  3TFS A;  4B9M A;  4YQW A;  4MFA A;  2XCA A;  1L3S A;  4O3N A;  1V9P A;  5AKG A;  2KHQ A;  2YY6 A;  2XID A;  4ED0 A;  3TKA A;  2YQE A;  1S0O A;  5C0Y A;  5KL8 B;  4M5D A;  4OAF A;  2V9W A;  3NVO A;  4QZ9 A;  1T8E A;  3OVB A;  2ZH9 A;  1ECW A;  5EE1 A;  4X0A A;  4CF3 A;  3C18 A;  4CRX A;  5AM1 A;  3TAQ A;  4F2R A;  3WFP A;  3EPG A;  4ELV A;  2BDP A;  4I2J A;  1TFR A;  3HPO A;  4M2Y A;  3NVY A;  2IOF A;  1NZB A;  5ALK A;  3I76 A;  5DDY A;  3QEB Z;  4FBU A;  1VFG A;  1UEU A;  1L3V A;  4NLB A;  5AM2 A;  4RQ2 A;  2JEJ A;  4UB5 A;  2R8J A;  8ICR A;  5DG7 A;  3T79 A;  4J9K A;  4FZL A;  3IM1 A;  1X42 A;  5B3P A;  1LVH A;  3H0M B;  8ICV A;  5DBB A;  2KN7 A;  3G6Y A;  4ECU A;  4FHY A;  2W8K A;  1NI3 A;  4KB6 A;  1ZOL A;  4P4M A;  1GPJ A;  3HT3 A;  2K4P A;  4ZOH C;  2OHF A;  2UVR A;  2BCS A;  4B9V A;  1U48 A;  4DQQ A;  3GZF A;  4KX5 A;  4TQS A;  2J6T A;  1X2I A;  5ALI A;  4XQ8 A;  4WQK A;  1PK1 B;  2IHM A;  5CFT A;  3SQI A;  4FHV A;  7ICJ A;  1JI7 A;  4DCC A;  5ALO A;  1ZET A;  3D2Q A;  5DEC A;  2KD1 A;  3PX0 A;  2ES6 A;  1T3N A;  7ICV A;  1TAU A;  5KT3 A;  5DB8 A;  4X4N A;  3MR5 A;  2FCL A;  1ZQD A;  3T5J A;  4QWB A;  4EEY A;  3PV8 A;  7ICN A;  4OAH A;  2QKQ A;  8ICM A;  1Q8K A;  3KOO A;  1T7P A;  1ZRN A;  1JUD A;  2ZIV B;  5DB6 A;  3H39 A;  2WF8 A;  2Y9U A;  1D8B A;  4YXJ A;  2E1F A;  4ECY A;  3TAP A;  5J2F A;  3L5K A;  2DQN B;  2DRA A;  4QZI A;  2PFP A;  4QZE A;  1L8L A;  4F50 A;  2KKP A;  2YML A;  9ICE A;  5DLG A;  9ICI A;  3N7R C;  2BCQ A;  4Y2P A;  1XNS A;  2ZIU B;  5F9N A;  3GV7 B;  3AN1 A;  1BNP A;  4NL9 C;  4Y2Y A;  2W04 A;  1UA0 A;  3SMV A;  1Z3E B;  3N97 B;  2HN1 A;  5AKH A;  2HHX A;  4DL4 A;  2XY6 A;  4ELT A;  2BZF A;  1F5A A;  4ED8 A;  2HHP A;  1JXL A;  8ICT A;  4DQR A;  5ALF A;  4DF4 A;  3M6K A;  4PGY A;  4NXT A;  4DLE A;  4M6W B;  1SXE A;  2PFO A;  2F2A B;  2PI5 A;  5AM4 A;  4FO1 A;  4DSE A;  4I2E A;  2AGO A;  1NK8 A;  3BDP A;  3E2E A;  3ZI4 A;  2W8L A;  1ZQE A;  5J2J A;  2BCR A;  3QU7 A;  3OJS A;  2F76 X;  2NV3 A;  1RYU A;  2RRD A;  5DKW A;  4JWM A;  2DR5 A;  2YMP A;  3EF2 A;  3JPR A;  5IIK A;  4TUS A;  3AEV A;  4ZH4 A;  4EYI B;  1WUD A;  1Q3V A;  5ALL A;  2MAX A;  4PHA A;  4KIT B;  4WC1 A;  4F3O A;  4Q44 A;  3I1Y A;  5L1I A;  3PSF A;  2EDU A;  1MIY A;  1ZQY A;  4QZH A;  2HOI A;  3T3F A;  4C4S A;  3AM9 A;  2O5A A;  1SV0 A;  3BQ7 A;  3GDX A;  1L7M A;  4ECX A;  4JWN A;  2RHF A;  1O03 A;  1Q79 A;  4ECW A;  4DQS A;  1ZQO A;  5HRF A;  3DEE A;  3ISD A;  3NS1 A;  4AT9 B;  5EWE A;  3A0B U;  3H7I A;  1T94 A;  5AKZ A;  2F8K A;  5J0T A;  4F4Z A;  4IR9 A;  3PW7 A;  2K4H A;  4DOB A;  4UBC A;  2Y1J A;  2AGP A;  1N60 A;  5KG0 A;  2E3T A;  3RFA A;  2B56 A;  2JXJ A;  3D2N A;  4YG2 A;  1COK A;  4ATB B;  2ZH1 A;  2OCE A;  1SV4 A;  2M2V A;  1X9M A;  5A0L A;  3IG5 A;  4QZA A;  1MIV A;  2YMM A;  4U7C A;  5KL1 B;  3WK5 A;  4P0P B;  3C2K A;  2JZB B;  1NJZ A;  2D3D A;  2LPE A;  3QE9 Y;  1D8L A;  5GTH U;  5CHE A;  3T5H A;  4WQL A;  4GC7 A;  5ALX A;  3M7D A;  4PGQ A;  2P6R A;  2G09 A;  5AKK A;  4IC9 A;  5HRE A;  4YXM A;  2F1I A;  3AQF A;  1ZQK A;  3H0R B;  3H0L B;  2NYV A;  4MEY A;  4K9A A;  5G5H A;  1QTM A;  3ZDA A;  3Q8P B;  2MUT B;  5BOL A;  3AL0 B;  2GO7 A;  4JB3 A;  4XRH A;  4EEN A;  4LEY A;  4RQ1 A;  4QW9 A;  1KFT A;  2Q66 A;  1XO0 A;  2XIC A;  2NRT A;  3IN5 A;  1DGJ A;  2W9B B;  1DOQ A;  5KTQ A;  3LYS A;  3NTU A;  1SWV A;  4DSF A;  3OUY B;  1X9W A;  2V4R A;  1C20 A;  1JRP A;  5HRK A;  1CUK A;  3UXO A;  4O0I A;  4R64 A;  2QAR B;  1N48 A;  5HRD A;  4RPX A;  3UPS A;  2AQ0 A;  5HRG A;  2E8M A;  5DG9 A;  1AQ6 A;  2A1J B;  5L1L A;  2Y0S C;  3WKE A;  1J97 A;  4NXV A;  3UQ2 A;  1XSN A;  3QNM A;  4QWE A;  4BXO A;  3PHZ A;  4R63 A;  3ZDD A;  1U9L A;  2KFZ A;  4EX6 A;  1LKY A;  4LZG A;  4PHP A;  5KFO A;  1EXN A;  4DSJ A;  5CHG A;  2UVW A;  3TFR A;  1U49 A;  2OH2 A;  5KT5 A;  1YZ7 A;  1Q78 A;  1SKR A;  3QZ8 A;  2HSZ A;  5IIL A;  1NJX A;  3RJG A;  2PFQ A;  3V72 A;  2HHT A;  4PL1 A;  4KLO A;  4PZO A;  1L6N A;  3M8R A;  2G06 A;  1ZQ1 C;  5AKJ A;  4QZD A;  4F4X A;  2HBM A;  3AQM A;  3H4D A;  4WC7 A;  4UAV A;  1NNL A;  1NK4 A;  3MDA A;  3H8S A;  3OSN A;  1D9D A;  1WWU A;  2ZHB A;  1CI4 A;  2H3Z A;  2ZIW A;  1SIJ A;  4X4P A;  3L4P A;  5KFX A;  3PMN A;  4F4K A;  3T5K A; 
#chains in the Genus database with same CATH homology
 3RR7 A;  4RQ8 A;  4NLN A;  3C2L A;  2JEI A;  4ECT A;  5III A;  1L3T A;  3RJE A;  1S77 D;  3TAR A;  3C66 A;  4RU9 A;  4Q8F A;  2ZJA A;  1ZJN A;  3WFQ E;  5BOM A;  1BPX A;  5HHH A;  2HVI A;  1S0N A;  4ED6 A;  5HHI A;  1BVS A;  1ZQN A;  4XA5 A;  3V6K A;  3RRH A;  3ZDC A;  9ICF A;  5KFL A;  4QZ8 A;  3V6J A;  3H3A A;  5HP4 A;  1D9F A;  1WOT A;  4DEZ A;  4IR1 A;  1NK0 A;  1XWL A;  4NKU A;  3TFS A;  4RWO A;  3SV4 A;  1SKW A;  2R8K A;  4B9M A;  5JUM A;  4K4I A;  4YQW A;  4J9P A;  4KN4 A;  4DLG A;  4MFA A;  4QZG A;  4ED2 A;  2DRB A;  3SV3 A;  2XCA A;  1L3S A;  2ZJ8 A;  4UAW A;  7ICF A;  4RUC A;  4LT6 A;  2M2W A;  4AT8 B;  4DFK A;  4O3N A;  1V9P A;  3IHQ B;  3AQN A;  5J0U A;  5J0Q A;  4MFC A;  4ED0 A;  3V7K A;  3BQ1 A;  5BPC A;  1R8B A;  3V7L A;  3GQC A;  1S0O A;  1QSY A;  2ID1 A;  4M5D A;  2V9W A;  4QZ9 A;  1T8E A;  3AU6 A;  1RPL A;  3GIL A;  2ZH9 A;  3OVB A;  1ZQL A;  4DO9 A;  4WC2 A;  2VAN A;  3PX4 A;  2GWS A;  5HRI A;  5EWG A;  3HX0 A;  1TK5 A;  3C5G A;  4F5P A;  1QSS A;  2AU0 A;  4X0A A;  1X9S A;  1XSL A;  2IA6 A;  1ZQC A;  3C18 A;  5CJ7 A;  4RQ0 A;  4KLH A;  3ZDE A;  2ZTE A;  3TAQ A;  3Q8R B;  4MEX A;  4F2R A;  2O1P A;  3G6X A;  3ZD9 A;  3WFP A;  2C28 A;  2AQ4 A;  2R8I A;  4B9T A;  3EPG A;  9ICC A;  4ELV A;  1KLN A;  2BDP A;  3OJU A;  4X0B A;  5DBC A;  1U47 A;  9ICO A;  5DLF A;  4JV1 A;  4I2J A;  4AT7 A;  1TFR A;  3HPO A;  4UB1 A;  4M2Y A;  4ATB A;  2ISP A;  1TVA A;  4YP3 A;  3PY8 A;  4KLD A;  4KMU A;  4RUA A;  4RQ5 A;  4KTQ A;  4DL2 A;  3QEB Z;  5DDY A;  3RBD A;  2C2D A;  4FBU A;  9ICU A;  1UEU A;  4YD1 A;  4KLQ A;  1VFG A;  3JPO A;  1L3V A;  1QLN A;  4YR2 A;  3M9O B;  4RQ2 A;  3RH4 A;  4RQ4 A;  1S10 A;  2ZTD A;  2JEJ A;  4C8K A;  5KFV A;  5J0W A;  1NK7 A;  4WBY A;  2ZHA A;  5KFM A;  3C23 A;  4UB5 A;  4BGD A;  2W9A A;  5HRH A;  3FDS A;  1YLQ A;  1XO1 A;  4KLU A;  3M8S A;  4F4W A;  3RAX A;  4DQP A;  2BKE A;  1Z00 A;  2R8J A;  8ICR A;  5DG7 A;  2V4Q A;  4J9K A;  4Z6E A;  3IM1 A;  3TQ1 A;  3EZ5 A;  4EP7 A;  2ZH8 A;  3TAN A;  4C8O A;  1JAJ A;  1ZQV A;  2C22 A;  1TAQ A;  3ORY A;  5HML A;  3JPP A;  4Z6C A;  1C7Y A;  5DGB A;  8ICV A;  2RDJ A;  5DBB A;  2KN7 A;  3GV5 B;  3G6Y A;  9ICX A;  4KLM A;  4I2G A;  1ZQX A;  3JPS A;  5EOZ A;  1NJY A;  4ECU A;  4J9L A;  8ICZ A;  4FHY A;  3LWL A;  4DWI A;  2W8K A;  3HWT A;  4YN4 A;  5DB9 A;  4Q8E A;  4DFM A;  2ALZ A;  5J2G A;  4F92 B;  5KT7 A;  5J2D A;  4UQG A;  2XC9 A;  4P4M A;  9ICA A;  2FLL A;  2BQR A;  2ASL A;  8ICY A;  3HT3 A;  2ZH6 A;  2NRX A;  2H5X A;  5KFP A;  8ICN A;  2KP7 A;  2UVR A;  4WC5 A;  2BCS A;  4B9V A;  1KSP A;  1U48 A;  4DQQ A;  7ICU A;  8ICQ A;  1OU5 A;  5J0O A;  4TQS A;  4QZC A;  2J6T A;  7ICK A;  1X2I A;  4XQ8 A;  2F1J A;  4RNN A;  2J6S A;  2ZUD A;  1KFS A;  3RRG A;  4Q45 A;  2IHM A;  1UT5 A;  5J0S A;  3SI8 A;  5KG7 A;  2ISO A;  4FHV A;  7ICJ A;  2W9B A;  2DFL A;  2XCP A;  3MGH A;  4ECS A;  4WC0 A;  5KT4 A;  2FPK A;  2BCV A;  1ZET A;  2JEG A;  2HVH A;  1CEZ A;  2FMS A;  3MAB A;  2XGQ A;  4F8R A;  1SL1 A;  1R89 A;  5DEC A;  1BPE A;  3PX0 A;  4X4S A;  5J2C A;  1T3N A;  2XGP A;  1ZQB A;  4F4Y A;  1TAU A;  7ICV A;  5KT3 A;  4RNM A;  4QW8 A;  5DB8 A;  1Y88 A;  4YR0 A;  4GXJ A;  1ARO P;  3MR5 A;  2XY5 A;  3PW2 A;  1ZQG A;  8ICF A;  3JZ0 A;  1ZQD A;  1RXV A;  3T5J A;  4QWB A;  5J0X A;  4EEY A;  3PV8 A;  3ZDB A;  4B9L A;  7ICN A;  4XUS A;  9ICS A;  8ICX A;  8ICI A;  3PW0 A;  2HHS A;  1VJ7 A;  7ICP A;  2NRK A;  1ZQW A;  5CP2 A;  3BQT A;  8ICM A;  1ZQQ A;  3H38 A;  2A1J A;  1T7P A;  2LYH A;  1JN3 A;  4BWJ A;  4DS5 A;  4X4N A;  4Z6F A;  4RWN A;  1MC8 A;  1IXR A;  3Q8S B;  2HHQ A;  4E0D A;  2KZM A;  3V6H A;  4EZ9 A;  5DB6 A;  4IRC A;  2BCU A;  4FBT A;  4M04 A;  3H37 A;  3H39 A;  5IIN A;  1U45 A;  4YXJ A;  9ICH A;  4JV2 A;  3PW5 A;  4I27 A;  2ZH5 A;  4KLI A;  2NRV A;  2DPJ A;  4ECY A;  4PGX A;  4ED1 A;  3TAP A;  2C2E A;  4F5O A;  5J2F A;  4GC6 A;  1ZQF A;  4YMO A;  9ICW A;  3WFR E;  3C1Y A;  2FMQ A;  2B21 A;  3PML A;  3PNC A;  1MQ3 A;  2DRA A;  4QZI A;  4EYH B;  4ECV A;  3V7J A;  2PFP A;  1NO5 A;  4QZE A;  4I2B A;  2ZH7 A;  4F50 A;  3N4M B;  1SZP A;  4UD5 A;  4NY8 A;  9ICE A;  5DLG A;  4X4Q A;  2I1Q A;  4LZD A;  4UAY A;  8ICP A;  9ICI A;  2BCQ A;  4KLJ A;  3PO5 A;  4P2H A;  4QWA A;  2Q0Z X;  9ICP A;  7ICL A;  4YCX A;  3LK9 A;  3JPT A;  2ZUB A;  1NKE A;  5F9N A;  3GV7 B;  4RQ7 A;  4PHE A;  5CA7 A;  1UA1 A;  1BNP A;  4WC6 A;  5J29 A;  3EYZ A;  2BGW A;  1UEV A;  1S9F A;  2JEF A;  1XC9 A;  5HNK A;  1FA0 A;  1UA0 A;  1TFY A;  4E80 A;  2Y1I A;  1Z3E B;  4C8N A;  1COO A;  3HW8 A;  3N97 B;  2RDI A;  2HHX A;  4QWD A;  4DL4 A;  3MFH A;  4EZ6 A;  1KDH A;  5D49 A;  4F5Q A;  4O3Q A;  4O3R A;  2ZH2 A;  4RPY A;  2XY6 A;  4ELT A;  3KHL A;  2OWO A;  3JPN A;  1F5A A;  5IIO A;  4ED8 A;  4RT2 A;  9ICT A;  1BPY A;  2HHP A;  1JXL A;  8ICT A;  2KZZ A;  1SL2 A;  1MIW A;  4DQR A;  4P4P A;  1NZP A;  3RH5 A;  1TKD A;  4I28 A;  8ICU A;  4DF4 A;  1JX4 A;  3OVA A;  8ICE A;  3K75 D;  4PGY A;  4DQI A;  4NLZ A;  1PZN A;  2DVI A;  5F9L A;  1ZQZ A;  2ZH3 A;  3Q8K A;  4YFK A;  4J9N A;  3B0Y A;  1IM4 A;  4DLE A;  3KHR A;  4M6W B;  4GXI A;  1ZQR A;  2FLP A;  2PFO A;  4I2H A;  3KTQ A;  5KFT A;  2PI5 A;  2BR0 A;  5J0R A;  4DSE A;  9ICQ A;  3B0X A;  3MR3 A;  3BJY A;  1HUZ A;  4Q43 A;  2UVV A;  4I2E A;  4QWC A;  5KG6 A;  7ICR A;  1PX5 A;  2AGO A;  5HRB A;  5KFC A;  1BPD A;  1NK8 A;  3BDP A;  8ICO A;  3E2E A;  2W8L A;  4QZF A;  1ZQE A;  2BE3 A;  8ICK A;  1KNY A;  9ICV A;  5KFY A;  1ZYQ A;  5J2J A;  9ICR A;  4WC3 A;  1MSW D;  2DR9 A;  4F5N A;  3RTV A;  2BCR A;  3RB3 A;  3RBE A;  3OJS A;  1MQ2 A;  7ICH A;  4O3P A;  5KFS A;  5DKW A;  4JK1 A;  3ISC A;  5DB7 A;  1LB2 B;  4PPX A;  4JWM A;  4RWQ A;  3AQL A;  4PH5 A;  2DR5 A;  1NK9 A;  4B9S A;  4XQ7 A;  3JPR A;  5IIK A;  4TUS A;  4ZH4 A;  4YMN A;  4RQ3 A;  4EYI B;  4NM1 A;  1R8C A;  1UT8 A;  5KG1 A;  2IBK A;  1XSP A;  4M0A A;  5IIM A;  2MAX A;  4PHA A;  3RJJ A;  4DSI A;  2M2U A;  5HC9 A;  4KIT B;  3WFO A;  4WC1 A;  4F3O A;  4K4H A;  4Q44 A;  1JXE A;  2BPC A;  5J2H A;  5L1I A;  1MIY A;  1ZQY A;  4QZH A;  2ASD A;  4R66 A;  3T3F A;  9ICK A;  4LVS A;  5KFH A;  1UET A;  2O5A A;  1S97 A;  5DQI A;  4IRD A;  3FYH A;  3GIM A;  2VA3 A;  4X5V A;  2HHU A;  1HUO A;  4G3I A;  1BPB A;  2FPL A;  5D4B A;  2NRZ A;  5KFW A;  3JPQ A;  3GDX A;  3RB0 A;  3C1Z A;  1L3U A;  1ZQH A;  4I2F A;  2FLN A;  4JWN A;  4ECX A;  4KLS A;  5HMM A;  3EWA A;  3PW4 A;  2VA8 A;  3G6V A;  1ZQS A;  1Q79 A;  3SZ2 A;  4BWM A;  3MFI A;  4WCW A;  4ECW A;  4I2A A;  4DQS A;  1ZQO A;  3RJH A;  5HRF A;  4S3N A;  3ISD A;  4ECZ A;  2PBE A;  2PFN A;  5DDM A;  4Z6D A;  1S76 D;  4AT9 A;  1DK2 A;  4AT9 B;  5EWE A;  3H4B A;  3GII A;  4F2S A;  1NOM A;  1L5U A;  2HHW A;  3H7I A;  2I9G A;  4DL3 A;  3THV A;  5J0T A;  4F4Z A;  5KFG A;  2W9C B;  3PW7 A;  4IR9 A;  4MFF A;  7ICS A;  5F2V O;  5KG4 A;  4DOB A;  3ETL A;  4UBC A;  1RYS A;  4BDP A;  5CB1 A;  4K4G A;  2HHV A;  3L9D A;  4M9L A;  5KT2 A;  4FH3 A;  2DPI A;  4J9O A;  1KFD A;  2Y1J A;  2AGP A;  4C8L A;  3PR4 A;  4JUZ A;  5KG0 A;  4ATB B;  4YG2 A;  2R8H A;  5KFE A;  4RQ6 A;  3H40 A;  1K1S A;  3RB4 A;  1JIH A;  4M47 A;  2ZH1 A;  3ISB A;  4IQT A;  3MR2 A;  5L1J A;  5J0Y A;  3PR5 B;  1ZQU A;  4ED7 A;  1DK3 A;  2W9M A;  2M2V A;  1X9M A;  8ICH A;  1ZQM A;  4MF2 A;  2BPG A;  4QZA A;  4BXO B;  1MIV A;  4I2D A;  4M6W A;  1KEJ A;  4J9M A;  3Q8M A;  3C2K A;  2KZ3 A;  1BPZ A;  4R65 A;  2JZB B;  3QZ7 A;  1NJZ A;  4FS2 A;  3AQM A;  4GXK A;  3AU2 A;  3H8W A;  4TUR A;  3AQK A;  1TK8 A;  4GLX A;  2FPM A;  3JYY A;  3GFK B;  2FMP A;  3OVS A;  5KT6 A;  3OHB A;  1D8L A;  4YR3 A;  3PVX A;  3QE9 Y;  3T5H A;  4X4O A;  4KLT A;  8ICW A;  4DSL A;  3Q8Q B;  3HJ4 A;  4GC7 A;  3PO4 A;  2F1H A;  2BQ3 A;  5KG5 A;  5DG8 A;  4PGQ A;  3RB6 A;  2IMW P;  1NK6 A;  2P6R A;  3RR8 A;  4WBZ A;  4DOA A;  1TK0 A;  4TQR A;  4QZB A;  4UAZ A;  3K4G A;  5HRE A;  4YXM A;  4ED3 A;  2F1I A;  5L1K A;  4UBB A;  1ZQK A;  4KLG A;  3OSP A;  4FHP A;  3QEA Z;  5DQG A;  4O5C A;  2BPF A;  4O5K A;  7ICT A;  3PX6 A;  4NM2 A;  4MEY A;  3EPI A;  3RJI A;  1QTM A;  4NLK A;  4O3O A;  3ZDA A;  1A76 A;  3Q8P B;  3BQ2 A;  3RJK A;  4IQV A;  2MUT B;  5BOL A;  4XRH A;  1NKC A;  4RQ1 A;  1B43 A;  4QW9 A;  4F93 B;  4CCH A;  1KFT A;  1WCN A;  4DL6 A;  2Q66 A;  4E7X A;  8ICC A;  4I2I A;  5J2E A;  4DOC A;  2NRT A;  2XO7 A;  2ZTC A;  2J6U A;  4M9H A;  2W9B B;  1DOQ A;  5KTQ A;  1ZQT A;  4M9G A;  5KFR A;  1BNO A;  4NKT A;  5CWR A;  3NTU A;  5DBA A;  5HR9 A;  4DSF A;  3OUY B;  5KFD A;  1RYR A;  1QSL A;  3MGI A;  1NK5 A;  9ICM A;  4X4U A;  2WTF A;  3UXP A;  1X9W A;  4FH5 A;  2V4R A;  5HRK A;  4DL7 A;  5J2K A;  1JQR A;  3NYB A;  1CUK A;  3OGU A;  3NGD A;  4DL5 A;  2XY7 A;  5EWF A;  5KG2 A;  3WFS C;  4R8U B;  3MDC A;  3UXO A;  3M9N B;  2R8G A;  2PI4 A;  3RH6 A;  1A77 A;  3C5F A;  4MF8 A;  4F91 B;  4O0I A;  3MBY A;  4EBC A;  4R64 A;  4B9N A;  1ZQI A;  1KTQ A;  4KLE A;  3GIJ A;  3HP6 A;  1N48 A;  5HRD A;  1RXW A;  4ELU A;  2W9C A;  3ZD8 A;  4RPX A;  4HYK A;  4E8F A;  3UPS A;  2AQ0 A;  3OV7 A;  4IRK A;  5HRG A;  3H8J A;  2PXI A;  2VA2 A;  4AT8 A;  5DG9 A;  4O3S A;  2A1J B;  8ICA A;  2RFF A;  4YVZ A;  5L1L A;  1WCL A;  3TI0 A;  3Q8L A;  9ICB A;  5KG3 A;  1R8A A;  4EBJ A;  3UPQ A;  3UQ2 A;  1XSN A;  5C5J A;  4RNO A;  4QWE A;  1ZQA A;  1LV5 A;  4M9J A;  1SKS A;  4DF8 A;  1B22 A;  1ZQP A;  4TUP A;  4EBD A;  4BXO A;  4J9Q A;  4R63 A;  3SYZ A;  3ZDD A;  4F5R A;  3T5L A;  1RZT A;  4NXZ A;  3BQ0 A;  5KFZ A;  2JZB A;  2DR8 A;  1U9L A;  1XS9 D;  4NLG A;  9ICN A;  2KFZ A;  7ICM A;  4FS1 A;  4WC4 A;  2P6U A;  1NKB A;  5KFB A;  3HJ1 A;  1S0V A;  2ZH4 A;  2BHN A;  4PHP A;  4LZG A;  4UB4 A;  5DGA A;  5J2A A;  3RAQ A;  4I29 A;  4FHW A;  5KFO A;  9ICG A;  2DR7 A;  3AUO A;  5KFF A;  1H38 A;  4RZR A;  1EXN A;  4RPZ A;  4DS4 A;  4DSJ A;  4M9N A;  5CHG A;  2UVW A;  3TFR A;  4KLL A;  5IIJ A;  1U49 A;  5KFI A;  2ASJ A;  4EBK A;  4P4O A;  7ICQ A;  5KT5 A;  3KHH A;  3LQC B;  1U4B A;  8ICB A;  4FHX A;  7ICE A;  4RWP A;  4KLF A;  1KRP A;  1Q78 A;  1TV9 A;  1SKR A;  5KFQ A;  3QZ8 A;  1HJP A;  5TZV A;  7ICI A;  5J2B A;  5IIL A;  1NJX A;  1D8Y A;  1SL0 A;  5KFK A;  3RJG A;  2PFQ A;  3UQ0 A;  3V72 A;  2HHT A;  2M2T A;  2KFN A;  2C2R A;  4KLO A;  9ICJ A;  4X4R A;  2MUT A;  1TFW A;  4JV0 A;  5CR0 A;  3HIY A;  4I2C A;  4X4T A;  5KFN A;  4UB2 A;  3M8R A;  4IQU A;  2AJQ A;  4UD4 A;  3C2M A;  7ICO A;  2IHN A;  4QZD A;  4J9S A;  8ICG A;  2ZJ5 A;  3LDA A;  5J0P A;  4F4X A;  2BQU A;  3H4D A;  1N56 A;  4DFP A;  4UB3 A;  3GIK A;  3OHA A;  1S0M A;  4X4V A;  4C8M A;  4IG8 A;  5L9X A;  4WC7 A;  1DGS A;  1NK4 A;  8ICS A;  1JMS A;  1K1Q A;  1XU4 A;  9ICL A;  4TUQ A;  4AT7 B;  5KFA A;  2ATL A;  4DSK A;  5DQH A;  3KHG A;  3OUY A;  4DFJ A;  8ICJ A;  3UXN A;  5DED A;  3MDA A;  1NJW A;  4IQW A;  4ECQ A;  2AGQ A;  3H8S A;  3OSN A;  4YMM A;  1D9D A;  5J2I A;  4YD2 A;  2HW3 A;  8ICL A;  2ZHB A;  4RT3 A;  4ECR A;  7ICG A;  4R8U A;  3MR6 A;  1T4G A;  5HRL A;  4J9R A;  4O9M A;  2P66 A;  4X4P A;  3EW9 A;  3M9M B;  5KFJ A;  4F4K A;  2KTQ A;  2NRW A;  5KFX A;  1ZJM A;  4PHD A;  3PMN A;  3GV8 B;  5KFU A;  4EBE A;  5D46 A;  2ZUC A;  4KN7 A;  3RJF A;  4B9U A;  1V4A A;  2M9N A;  1Z00 B;  3LWM A;  4FO6 A;  1ZQJ A;  1BGX T;  4O5E A;  3T5K A;  2UVU A;  3C21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...