4MF2A

Structure of human dna polymerase beta complexed with o6mg as the template base in a 1-nucleotide gapped dna
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
325
structure length
321
Chain Sequence
LNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSEPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Metal-dependent conformational activation explains highly promutagenic replication across O6-methylguanine by human DNA polymerase beta.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 106
structure length 321
sequence length 325
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4mf2A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4mf2A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4mf2A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4mf2A03
2IBKA 4WBYA 4RNOA 3C18A 2FPKA 4DQSA 3JPSA 8ICXA 1MC8A 2ZH2A 3BQ2A 4QZ9A 2J6TA 1RZTA 5KFLA 9ICHA 3V7JA 2HHWA 4HYKA 1S0OA 3EWAA 5KFYA 2C22A 5KFXA 2W9BA 4LZGA 5J0SA 1MIYA 1NKEA 4O3OA 5IIJA 5J0QA 7ICPA 3M8SA 4I29A 3EW9A 2P6UA 2V4QA 5KFFA 3WFSC 4GXKA 4F8RA 4I2EA 2ZTDA 3PO4A 2BQUA 4RQ6A 3HT3A 9ICXA 4I2FA 4R63A 2KFNA 4KLLA 2KZ3A 3UQ2A 2KZMA 4FHXA 3PY8A 3AQMA 4FH3A 5J2KA 4NY8A 1SL1A 3M9MB 3K75D 4KLFA 4F92B 8ICNA 5KFQA 5DBBA 4DSFA 2H5XA 5HP4A 1QTMA 4X4OA 4PHDA 7ICIA 3QEBZ 4PHAA 4I2HA 4NXZA 3UQ0A 1U9LA 4LVSA 2HHPA 3JZ0A 3JPQA 1JIHA 1MQ3A 5HRKA 2W8LA 4JWMA 4KTQA 1IXRA 4AT8B 4TUSA 3AQKA 3HP6A 4QZGA 3KHGA 7ICGA 4WC0A 4DSEA 5D49A 5KG2A 2ZUCA 4TURA 5DDYA 4UB3A 3ZDAA 2M9NA 1QSYA 4YXJA 2ZTCA 3MFHA 1VFGA 4KN4A 4I2JA 1JN3A 4UAWA 2BR0A 2HVIA 1R89A 4R8UA 4DL2A 1S97A 4J9SA 1JXEA 3H7IA 4PHEA 1BPZA 1S0VA 4YR3A 8ICAA 1ZQQA 7ICKA 2B21A 4I2IA 3LWMA 2JEIA 4P2HA 2ID1A 4Q43A 2BDPA 4K4GA 2ZH4A 5DKWA 1UA1A 2FMPA 5HREA 1V4AA 4MF2A 8ICJA 2Q0ZX 4GLXA 4FO6A 1ZQHA 1NK6A 1XSNA 3H40A 3PX4A 4F5PA 4JV2A 5KG5A 4NM2A 4F2RA 4RZRA 5J0YA 4C8NA 4DWIA 4Q8EA 1R8CA 1UEVA 4RWNA 3BQTA 1COOA 1ZQNA 3RJHA 4DOAA 4X4RA 2OWOA 4WC6A 2DR9A 3T5HA 4B9TA 4Z6FA 3B0XA 4C8LA 4NLGA 9ICUA 1A77A 1CUKA 4EBKA 4MFCA 3NTUA 1BPDA 2W8KA 4X5VA 2BQ3A 1JX4A 2DR7A 4ED1A 1Z00B 3QEAZ 4JV1A 4R64A 3M9NB 2RDIA 5J2EA 1JQRA 3RBEA 1R8AA 3V6KA 1TFYA 2ALZA 4PH5A 1SL0A 3ZDBA 1L3VA 4Q45A 4F50A 8ICYA 4DFKA 4J9KA 4EBDA 1BPXA 4M9JA 4F2SA 3JYYA 1UT8A 4QZDA 2BGWA 5J0PA 2ATLA 8ICSA 5CB1A 3AU6A 3WFPA 1S76D 4UB5A 1UT5A 2PFOA 1KTQA 4DSKA 4M9GA 5L1JA 1ZQLA 1TK8A 4X4UA 4AT8A 4X4NA 4RPZA 3MR6A 3UXOA 4F5RA 3ISDA 7ICRA 5J2FA 1ZQTA 2ZH6A 4NKUA 1BGXT 1ZQMA 4XA5A 3GV7B 1KLNA 3H8WA 3C2LA 9ICOA 2NRWA 4RQ3A 5CWRA 3OHBA 2DRBA 4IR1A 4FHWA 4YP3A 3QZ8A 1D9DA 4IR9A 5DLFA 2W9AA 3M8RA 3OVAA 3H4BA 3JPPA 2J6UA 5KFGA 2BPCA 3PX6A 4X4SA 3OHAA 5KFSA 1HUZA 2DR5A 5DBCA 9ICVA 5KFVA 1AROP 4I2BA 4RQ2A 4JWNA 3GIKA 3GFKB 3Q8MA 4ATBA 1XSLA 4KLQA 2AGOA 5L1KA 1DK2A 2ZH3A 4DL4A 1ZQYA 2FPLA 2NRZA 4DEZA 4FBTA 3H37A 4RT2A 4RQ4A 1X9SA 5KFUA 3BJYA 4MFFA 2UVVA 5EWEA 3ZDDA 4ECYA 2ZJAA 2IA6A 3TAQA 3RJGA 1NK8A 4EYIB 1BPEA 1Z00A 3ZD8A 2R8IA 4KLSA 4YMMA 1ZQWA 4Q44A 4DO9A 4DQQA 3T3FA 5L9XA 2C28A 1NJZA 1ZJNA 4Z6CA 3JPRA 4ELVA 4P4MA 1SKRA 5F2VO 4R65A 3C1ZA 2FPMA 2ZUDA 3AU2A 1LB2B 4ED0A 3Q8QB 3LQCB 4UAZA 3THVA 1DOQA 2NRVA 5KFZA 4UB4A 4M04A 4QWEA 4XQ7A 4QZEA 5KG7A 5KFAA 1ZQJA 3SZ2A 3HX0A 4UBBA 4X4VA 3IHQB 4RUCA 3RRHA 2M2UA 4KLGA 4BXOB 4O3SA 1NOMA 4QWBA 8ICQA 9ICKA 4X4TA 9ICCA 4ELUA 1N48A 4AT9B 3MR2A 1N56A 1PZNA 2ASLA 2KFZA 4M6WB 4QZ8A 4DQPA 8ICTA 4X4QA 1HUOA 3SYZA 1TFWA 5DG8A 2DRAA 2DFLA 3C21A 3OSNA 1RXWA 2UVWA 4PPXA 1UA0A 1TKDA 3MBYA 5CA7A 9ICNA 5HRDA 1DK3A 5EOZA 4FH5A 4JV0A 4DSJA 2R8GA 3HPOA 2HHTA 4FHYA 1TVAA 4F4XA 2ZH5A 2PI5A 3JPNA 2RFFA 3C2MA 5IIKA 4FBUA 5KFCA 1S9FA 8ICKA 1NO5A 2NRKA 5J0XA 2P66A 2ZHAA 4UB2A 2UVUA 3AQLA 8ICOA 4EEYA 5J2CA 3PW7A 1F5AA 3UXNA 3PW2A 5DECA 2AJQA 8ICHA 5KT3A 3Q8SB 4YD2A 5KG4A 4EBCA 4RWPA 4MEXA 1XU4A 4KN7A 4J9QA 2FLPA 3H3AA 5J2GA 1TV9A 2DR8A 4J9RA 1L3SA 3FYHA 1L3TA 4FS2A 4YR0A 4ECZA 7ICHA 4IRCA 3GILA 4F4WA 3HW8A 1SL2A 3C1YA 4KLDA 4ECRA 2KTQA 5HRGA 2M2TA 2ISPA 3TFRA 4ED7A 4QW8A 1ZYQA 5KFNA 2FLLA 4QWAA 3Q8KA 5F9NA 7ICLA 4EBJA 4TQSA 3RB3A 4O3RA 4FHPA 2HHVA 2MUTB 4ED2A 4F93B 4DQIA 5F9LA 2Y1JA 5TZVA 3LWLA 5J2IA 5J0UA 2DPJA 3GIJA 4GXJA 3TAPA 2BQRA 1ZQAA 2JZBB 3RJIA 2XY6A 2W9MA 1HJPA 4IQUA 3GIMA 4J9MA 1L3UA 4NLZA 5HNKA 5DGAA 4F5NA 1ZQFA 4B9UA 5DLGA 4BXOA 4KLIA 5HRHA 2Y1IA 3IM1A 4YQWA 4UBCA 4QZCA 1RYRA 4AT9A 3MDAA 4M6WA 5KFWA 5CHGA 4TUQA 3PNCA 3T5LA 4NLNA 3OSPA 5J2DA 2C2DA 1S0NA 4BGDA 4RNMA 3ZDCA 4DLGA 4K4IA 4MF8A 2HW3A 5KFHA 3NYBA 3HJ4A 1NK9A 4O3NA 3KTQA 3SI8A 2ZH7A 4QWCA 4J9NA 3SV4A 3PW5A 4YG2A 2R8HA 1ZQZA 4Z6DA 4F91B 4BDPA 9ICGA 5KFTA 2O1PA 4DLEA 4O5CA 3EPGA 1Q79A 8ICZA 8ICFA 3C2KA 3WFQE 4J9OA 4ECWA 3OVBA 4YVZA 4X0BA 4O0IA 4QW9A 2WTFA 4UD4A 2UVRA 7ICJA 5JUMA 3G6XA 2PFNA 4BWMA 4TUPA 4DQRA 1VJ7A 3OVSA 2PI4A 3KHLA 4BWJA 5KFEA 3C5GA 4YCXA 3MR3A 4M2YA 4E0DA 2ZUBA 4O5EA 5J2JA 2F1IA 5KT2A 1NJYA 4NM1A 1OU5A 2XC9A 1A76A 1ZQUA 3B0YA 3RB0A 1L5UA 4EZ6A 2FMQA 5KFIA 2MAXA 1TAUA 4PGXA 3G6YA 5KG6A 2IHMA 3ETLA 2C2EA 4F4KA 3PR5B 1WOTA 4DS4A 5IIIA 3L9DA 4F3OA 3OUYB 1SZPA 4J9LA 3ISBA 5C5JA 4KLTA 1NJWA 5HR9A 3K4GA 3T5JA 4ATBB 4YFKA 2MUTA 8ICVA 4ECXA 5EWFA 1XS9D 4QWDA 3PO5A 3RRGA 4MFAA 1TK0A 3PR4A 1K1QA 1ZQDA 1MIWA 4LT6A 3EPIA 2W9CB 3FDSA 5IILA 2I9GA 5DGBA 7ICNA 2JZBA 4DFMA 5J29A 3V72A 1TAQA 4X0AA 5KG3A 5HHHA 2JEJA 1B43A 3UPQA 2FMSA 1B22A 3MGHA 2PBEA 3JPTA 4DOCA 4PGQA 4F4ZA 4DSLA 1JAJA 3OV7A 3RH6A 4RUAA 3HWTA 1ZQRA 3ORYA 5KG0A 1S0MA 4IG8A 1ZQIA 1D8LA 3TANA 9ICPA 4WC5A 4WC7A 8ICIA 2RDJA 4B9MA 2ZHBA 2DVIA 5HMMA 4XUSA 9ICFA 4IQTA 2F1JA 4GXIA 1QSSA 5KFPA 3E2EA 7ICOA 1MIVA 7ICMA 2HHQA 1X9WA 1SKSA 8ICGA 5HHIA 1NJXA 4RPXA 4I2GA 1NZPA 2V9WA 2XY5A 5CR0A 5IINA 9ICJA 5HRFA 1BNPA 2ZJ8A 4F5OA 2LYHA 4E8FA 3EZ5A 3PW4A 4DL5A 4J9PA 4YN4A 4E7XA 3RH5A 4M0AA 1KFTA 1ZQSA 1KSPA 2ZTEA 2KZZA 2M2VA 5HRLA 4PGYA 4DOBA 1EXNA 4TQRA 1QLNA 1IM4A 3V7KA 3MFIA 1RYSA 3RR7A 4YMNA 4WC4A 4QZHA 2GWSA 1DGSA 4B9NA 4ECUA 5D4BA 2AQ0A 1ZQKA 7ICUA 2V4RA 1QSLA 3RJEA 5HMLA 4IQWA 1H38A 3Q8LA 3OUYA 4JUZA 9ICAA 1PX5A 1T3NA 4RQ8A 3ZDEA 5J0TA 1BPYA 3V6HA 2BCSA 3C5FA 5J2HA 4KLOA 9ICBA 1Y88A 4WCWA 4P4PA 1KEJA 5IIOA 4R66A 3V6JA 1NKCA 1KFSA 4B9LA 3UPSA 2VA8A 5CP2A 9ICWA 5KFKA 2I1QA 3BQ1A 1FA0A 2PFQA 4ELTA 4M9NA 5HRIA 1K1SA 4QZBA 3PVXA 1D8YA 4C8OA 2W9CA 1S77D 2NRXA 3MR5A 9ICLA 5DG9A 1LV5A 7ICVA 1U45A 2AGPA 7ICFA 2BCVA 3GIIA 3RB4A 4O3QA 3GDXA 1T8EA 4RPYA 3C23A 8ICEA 4M9LA 4KLEA 4DL6A 2AGQA 3UXPA 3PV8A 3LK9A 1KRPA 8ICCA 2FLNA 4DF4A 1WCLA 1YLQA 4P4OA 4GC7A 4ZH4A 1NK7A 4JK1A 4S3NA 4RQ7A 5L1IA 4YXMA 3TI0A 2VA3A 4DSIA 4NKTA 4QZAA 1X2IA 4K4HA 4UD5A 4KITB 5CJ7A 2R8KA 1RPLA 4B9SA 2F1HA 2XCPA 3NGDA 1XO1A 8ICBA 2XGPA 4M5DA 9ICTA 5KFJA 3KHRA 4ECQA 3RJKA 4RT3A 2ZJ5A 1ZQBA 4WC2A 4EYHB 3RTVA 4UB1A 1S10A 2J6SA 5DQHA 1BVSA 5KFMA 3OJSA 5J0WA 1NKBA 2HHUA 1MSWD 2KP7A 4C8MA 7ICEA 2ZH8A 3WFOA 4ECTA 4DS5A 4DFJA 3MABA 2AQ4A 4WBZA 1XWLA 3N97B 5HRBA 3H4DA 4I2AA 1ZQEA 2Q66A 3RAXA 3HIYA 4DL7A 1RXVA 2ISOA 1BPBA 1ZJMA 4EBEA 4O5KA 5J2BA 4RQ5A 3OGUA 5DQIA 1XC9A 5L1LA 4AT7B 4E80A 3RR8A 4KLJA 8ICMA 9ICEA 2BE3A 2DPIA 3QE9Y 5KT6A 4M9HA 8ICWA 5BOLA 4IRKA 5EWGA 2BCUA 2NRTA 4IQVA 5J0OA 2IMWP 4YR2A 5DB8A 2BPFA 9ICIA 3H8SA 2AU0A 3H8JA 2VA2A 5KT5A 2R8JA 4RQ1A 2P6RA 1CEZA 4RNNA 4UQGA 7ICTA 4DL3A 3G6VA 8ICPA 4RWQA 4XRHA 1T4GA 3ZD9A 1KDHA 1ZETA 5KT7A 4KLMA 1XSPA 4QZIA 5KG1A 4DFPA 2BPGA 9ICMA 1NK5A 4F5QA 3RH4A 3BDPA 3C66A 5DDMA 3RAQA 2KN7A 5DG7A 1ZQVA 1ZQOA 4CCHA 1JXLA 2A1JB 4I27A 4RQ0A 9ICQA 2XCAA 4UAYA 4FS1A 2JEFA 4I28A 3V7LA 3EYZA 2IHNA 1X9MA 2XY7A 4YD1A 2PFPA 3RJFA 5DEDA 3OJUA 5KFDA 4YMOA 1NK4A 3PX0A 2BCQA 1D9FA 4I2CA 2BKEA 4Q8FA 3BQ0A 5DB6A 2W9BB 1U4BA 3TQ1A 4FHVA 1Z3EB 1UETA 5BPCA 2ASJA 3PMNA 4IRDA 1TK5A 3LDAA 4B9VA 3TFSA 2BHNA 2XGQA 5DBAA 4NLKA 2HHSA 1Q78A 3T5KA 2ZH1A 2O5AA 8ICLA 1U48A 8ICUA 3RJJA 4EP7A 4MEYA 3WFRE 3RB6A 4M47A 1T7PA 1UEUA 4RU9A 4I2DA 4O3PA 5DB9A 4QZFA 3Q8PB 3ISCA 4GC6A 1KNYA 1R8BA 1ZQXA 4DF8A 4KLHA 5KFRA 4ECVA 4KMUA 5KT4A 3MDCA 5HC9A 3JPOA 2C2RA 1U49A 2PXIA 2HHXA 2M2WA 1C7YA 4LZDA 3GV8B 4WC1A 4AT7A 4ECSA 5DQGA 1BNOA 3MGIA 5DB7A 3GV5B 5KFBA 3HJ1A 1NK0A 4RWOA 1U47A 2HVHA 3N4MB 3M9OB 5BOMA 3TARA 1JMSA 4Z6EA 4ED3A 5IIMA 2JEGA 3QZ7A 3KHHA 3AUOA 1KFDA 3RBDA 5KFOA 4C8KA 1ZQCA 4ED6A 4EZ9A 7ICQA 4WC3A 3GQCA 3SV3A 9ICSA 2ZH9A 4KLUA 2VANA 1WCNA 1TFRA 1ZQGA 3AQNA 4ED8A 5KTQA 2BCRA 2XO7A 4R8UB 1ZQPA 3H39A 1SKWA 5J2AA 4G3IA 1MQ2A 5D46A 3H38A 1V9PA 5J0RA 4X4PA 4F4YA 8ICRA 3PW0A 9ICRA 7ICSA 4O9MA 2A1JA 4PHPA 2ASDA 4XQ8A 3Q8RB 3PMLA
chains in the Genus database with same CATH superfamily
1ZD5A 1L7OA 4WBYA 2DKXA 4DQSA 4QZ9A 4HYKA 1S0OA 4O69A 5GTHU 5J0SA 5ALUA 1WYGA 3KZXA 1NKEA 3D2NA 4I29A 4GXKA 3HT3A 2KJ5A 4IL6U 5C0YA 3AQMA 4JMUA 2EANA 3K75D 4KLFA 4X4OA 4PHDA 4NXZA 2ZIXA 3IG5A 4QNLA 4EELA 1ZRMA 2H3VA 3NKUA 4KTQA 1IXRA 3QU5A 4TUSA 1PK1A 3HP6A 3KHGA 7ICGA 4WC0A 5D49A 1CI4A 2KKPA 2ZUCA 5DDYA 1X40A 4UB3A 1QSYA 1N2XA 4AP9A 3A0HU 2BR0A 1L7PA 3H7IA 3OPXA 1BPZA 1WUDA 2B21A 3LWMA 4NV0A 1V4AA 2F77X 2KK0A 4FO6A 1ZQHA 5CFUA 1XSNA 4JV2A 3M6ZA 3BZKA 4Q8EA 1QCKA 4RWNA 1COOA 3HKZC 2HOQA 3B0XA 3DDHA 2ZIVA 3IG8A 3PHZA 4JV1A 3QEAZ 1JQRA 3RBEA 1X9XA 3WKEA 2ALZA 3ZDBA 5JU5A 4OD0A 4QZDA 5CB1A 3NRWA 1UT5A 2PFOA 1KTQA 4C4SA 4DSKA 2WAQF 1X66A 1UHUA 5AM2A 3WK9A 3UXOA 3MR6A 3ISDA 7ICRA 1WWVA 1KLNA 3C2LA 3SAGA 4MKPA 5CWRA 3OHBA 3QZ8A 2HCFA 5DLFA 2W9AA 3H4BA 3JPPA 2J6UA 1QQ6A 2BPCA 3PX6A 5KFSA 4O67A 4RQ2A 3ER8C 3GFKB 1XSLA 2E8MA 2ZH3A 4FBTA 3H37A 1X9SA 1PVPA 2UVVA 2DKZA 3SR6A 1SWVA 1NK8A 4EYIB 1Z00A 3ZD8A 4KLSA 5AK6A 1ZQWA 2C28A 5L9XA 1ZJNA 4ELVA 4CRXA 1SKRA 5ALWA 3RFAA 4FZNA 1PVRA 3AU2A 3ETRA 2K4IA 3LQCB 4UAZA 2F44A 2QARB 4OJOA 4M04A 2E3TA 4XQ7A 4QZEA 4QIWC 3OWGA 3HX0A 4UBBA 4X4VA 3IHQB 4RUCA 3SENA 3RRHA 4BXOB 2VJ4A 9ICKA 3T79A 1N56A 3UMGA 5AIAA 2K4PA 3MBYA 1YT3A 4FFDA 9ICNA 3HPOA 1TVAA 4FO1A 4U6PA 2ZH5A 2RFFA 3C2MA 1N5XA 5KFCA 1N63A 2ESEA 4EX7A 2G06A 4EEYA 2CRXA 1F5AA 3PW2A 2AJQA 3ALRA 2DF4B 4C0ZA 2YN4A 5KT3A 4UAUA 5KG4A 4EBCA 1C20A 5EE9A 4Y2VA 4J9QA 2FLPA 3H3AA 2DR8A 1L3SA 3FYHA 4ECZA 3GILA 3KZIU 3QUBA 4F4WA 3HW8A 2KTQA 5HRGA 3C29A 4ED7A 1SV0A 5KFNA 4OAGA 2BDUA 4TQSA 4O6AA 4ED2A 4F93B 5F9LA 5TZVA 5J2IA 5J0UA 2DPJA 1D8BA 3EUB2 3TAPA 2JZBB 2XY6A 4NLZA 1ZQFA 4F5NA 5ALOA 4AT9A 1RYRA 4M6WA 3C28A 1N61A 4RNMA 2E8PA 4K4IA 3HJ4A 1NK9A 3PSIA 2ZH7A 3SV4A 4YG2A 4K97A 3SAHA 4DLEA 3EPGA 2JGAA 3ED5A 2LBOA 4X0BA 4QW9A 2UVRA 3FAHA 3G6XA 5AM5A 1VJ7A 2Y0SF 2XVTA 4NM1A 3G6YA 2C2EA 4F4KA 4ICAA 3FC4A 3F2BA 3O0FA 5C5JA 4YFKA 2WF8A 3RRGA 4QWDA 1ZQDA 1MIWA 4IC9A 3EPIA 5IILA 7ICNA 4DFMA 3V72A 2KSOB 4RQNA 3H8MA 5HHHA 3UPQA 4EGWA 3MGHA 3JPTA 1FFVA 3RH6A 2K89A 1F5SA 5CHEA 1S0MA 1ZQIA 5KNIA 1O03A 9ICPA 4FE3A 8ICIA 2DVIA 3F53A 1JI7A 4K99A 4XUSA 9ICFA 4GXIA 7ICOA 5ALNA 2HHQA 1NJXA 4I2GA 1IIPA 2EZZA 9ICJA 2FDRA 2ZJ8A 4F5OA 4E8FA 4EV6A 3PW4A 3QU9A 2BZFA 4J9PA 2EAOA 4E7XA 3RH5A 4M0AA 1ZQSA 2ZTEA 5ALFA 1QLNA 4TQRA 1IM4A 4YMNA 3UMBA 2KVSA 3NUQA 2AH5A 4ECUA 5D4BA 2AQ0A 2V4RA 3RJEA 3Q8LA 3NS1A 3R9KA 5J0TA 4ATBA 4KLOA 3V6JA 1KEJA 2DL0A 5IIOA 1RM6C 2OCEA 4FZMA 1FA0A 1S77D 3KKAA 2H3IA 1MN8A 3QXGA 3N7SC 4C4RA 2FLNA 1YLQA 1A0PA 2K8AA 4NKTA 4K4HA 4KITB 5CJ7A 2R8KA 4B9SA 4CGZA 8ICBA 4M5DA 2G09A 4ECQA 3IDWA 3M6KA 1X6IA 3NVWA 1NKBA 2KP7A 4Y2TA 4C8MA 7ICEA 4DFJA 2AQ4A 4WBZA 1XWLA 5HRBA 2LM4A 3WKAA 3H4DA 5ALSA 3M1YA 3RAXA 3HIYA 1RXVA 3WU2U 3QNMA 1T3QA 5J2BA 4RQ5A 5DQIA 1XC9A 5L1LA 4AT7B 4E80A 3AQFA 3NVYA 4F71A 5KL8B 2A3VA 5EWGA 4IRKA 2BCUA 3HILA 5DB8A 3H8SA 5AM4A 2R8JA 4RQ1A 1KN5A 1KDHA 5KT7A 1FIQA 4QZIA 2BPGA 9ICMA 1NK5A 1RYUA 5DDMA 1L8OA 3RAQA 5DG7A 1ZQOA 4RQ0A 2XCAA 4UAYA 3QU7A 1S5LU 2QB1A 5DEDA 2BCQA 5CFSA 4AYBF 4Q8FA 3BQ0A 4O3MA 4DCCA 4IRDA 3LDAA 4PL1A 5ALYA 2GLEA 2WF6A 3A0BU 3T5KA 2I6XA 8ICLA 8ICUA 2KKVA 1NZBA 2L5YA 4ECVA 3EF2A 3JPOA 1ED1A 3NASA 5KAIU 2HHXA 2RRDA 4LZDA 5ALQA 2DUYA 3GV8B 4WC1A 1BNOA 2R18A 2WF5A 1SV0C 2KE7A 1RG6A 5ALRA 1SB3C 3DEEA 2KHVA 2JMGA 4PJ0U 2BCRA 2HN2A 2XO7A 5J2AA 5D46A 3CK6A 5J0RA 4X4PA 4F4YA 9ICRA 3PW0A 4O9MA 3PX4A 3BQTA 4XQ8A 1Z19A 3C18A 8ICXA 2J6TA 3MGVA 5KFLA 2HHWA 3EWAA 4LZGA 5KFXA 2G0AA 4O3OA 7ICPA 2P6UA 4I2EA 2ZTDA 3PO4A 1VDVA 2W3SA 2BQUA 4I2FA 5KAFU 3UQ2A 4FHXA 1CRXA 4FH3A 5J2KA 8ICNA 1Z1BA 5HP4A 1QTMA 3KD3A 3UQ0A 3JPQA 3UM9A 2W8LA 4JWMA 4AT8B 1FEZA 4P0QB 3WKBA 5B3PA 3ZDAA 3QU4A 4KN4A 4R8UA 4DL2A 3CRXA 4PHEA 2ID1A 1PVQA 2ZH4A 2GO7A 2FMPA 4NWIA 2Q0ZX 4OCZA 4GLXA 3H40A 3PSFA 1UEVA 4B9TA 4Z6FA 4EBKA 2LM1A 2W8KA 1JX4A 2DR7A 1P7DA 4UB6U 3F2DA 1R8AA 4PH5A 1L3VA 8ICYA 2YTUA 4J9KA 3JYYA 2BGWA 5J0PA 3AU6A 4UB5A 4NXWA 2H3QA 4M9GA 4X4UA 4X4NA 2FI1A 4RPZA 5B66U 1ZQMA 3KKAC 4IR1A 3M8RA 3F5AA 4X4SA 1HUZA 2DR5A 5DBCA 2AGOA 5L1KA 2NRZA 2CPRA 1F0MA 3E0FA 4CF3A 5KFUA 4GIBA 4ECYA 3BS5A 2KHQA 5K4LA 3JCFA 4Y2JA 2R8IA 4YMMA 4DQQA 3T3FA 4N7RA 2EWRA 4P4MA 1AQ6A 5ALHA 4R65A 5F2VO 2MRLA 4BUGA 3THVA 1DOQA 2LMRA 2Y9TA 5KFAA 4K98A 4O3SA 1Q46A 4Y2RA 4Y2XA 2ZIUB 2HBLA 2YMMA 3QUQA 3C21A 4EENA 1TKDA 5CA7A 4FH5A 2KIVA 2PMZF 2H3FA 4WQKA 5B3QA 4NLCA 4P0PB 1NO5A 2P66A 4WJ3B 3AQLA 8ICOA 3UXNA 1OUQA 4RWPA 4MEXA 1XU4A 1TV9A 4J9RA 1L3TA 7ICHA 3N7PD 4IRCA 1SL2A 4ECRA 2MU2A 2M2TA 1UPHA 2QB0B 4C4TA 1ZYQA 4O3RA 2E8NA 2MUTB 2HI0A 4DQIA 2Y1JA 4GXJA 2BQRA 3AN1A 2Y9UA 2W9MA 1HJPA 3GIMA 5HNKA 2LI6A 3RF9A 3IM1A 4QZCA 2EQYA 2Z7JA 5CHGA 4TUQA 3PNCA 5J8YC 5J2DA 2C2DA 3ZDCA 3BQ7A 4DLGA 3VCBA 3SI8A 4QWCA 4J9NA 4KB6A 4Z6DA 4NXXA 5KFTA 4O5CA 1Q79A 2ODGA 2GOLA 4O0IA 2WTFA 3UMCA 7ICJA 2FCLA 4TUPA 4DQRA 3KHLA 4BWJA 2G5IB 5KFEA 4YCXA 3MR3A 4E0DA 2ZUBA 4O5EA 4USAA 5J2JA 1NJYA 2WF7A 1OU5A 3RB0A 4EZ6A 2FMQA 2IHMA 5KG6A 1JRPA 3ETLA 3PR5B 5IIIA 3L9DA 4J9LA 4KLTA 1NJWA 3K4GA 3T5JA 5AHXA 2EH9A 1XS9D 3PO5A 4Y2QA 1B22A 4PGQA 1JAJA 3OV7A 4RUAA 5D61A 2P35A 3ORYA 5KG0A 4EEBA 1D8LA 3TANA 4WC5A 4WC7A 2RDJA 2NO5A 5HMMA 4IQTA 2K4HA 4CNQA 7ICMA 1SKSA 2V9WA 2XY5A 4NL9A 3EZ5A 4LEWA 2YX8A 1UQVA 4YN4A 5CRXA 3LVVA 2KZZA 2M2VA 4PGYA 4DOBA 1EXNA 3RR7A 3PZPA 4B9NA 7ICUA 1H38A 3OUYA 9ICAA 4WC2A 4RQ8A 1BPYA 2BCSA 3C5FA 1SGGA 1Y88A 1KFSA 4R66A 4B9LA 5CP2A 3BQ1A 2PFQA 5HRIA 4QZBA 4C8OA 2ZIWA 2W9CA 2NRXA 9ICLA 2F8KA 5DG9A 1LV5A 3GIIA 8ICEA 4O3QA 5AI6A 4KLEA 1HEKA 3PV8A 3LK9A 8ICCA 4DF4A 5GTIU 1M6YA 4ZH4A 4WOYA 4JK1A 2K8CB 3SEIA 2IOFA 4DSIA 5JTIA 4UD5A 1RPLA 2XCPA 2JHDA 1XO1A 2XGPA 9ICTA 3RJKA 1IG6A 3WK8A 1ZQBA 2LPEA 1S10A 5DQHA 3IP4B 1MSWD 2CXYA 3H0RB 4UASA 4DS5A 3MABA 5D63A 5G5HA 1XNSA 2GH1A 3GU3A 1ZQEA 4XJEA 2YQEA 4NXVA 4KLJA 2BE3A 2Q4TA 4JLZA 3QE9Y 1ZXIA 5KT6A 4M9HA 2XIDA 2QKQA 5J0OA 2IMWP 4YR2A 2BPFA 9ICIA 4NXUA 3H8JA 2VA2A 5KT5A 2B6GA 2P6RA 4B6JA 4RNNA 4UQGA 5AIBA 4LEVA 1N62A 1T4GA 3LYSA 4XRHA 5FP0A 4DFPA 3BDPA 2KN7A 2YB1A 1ZQVA 1OXJA 3CP8A 3D2SA 5KL1B 4FS1A 2JEFA 5EE1A 3V7LA 3EYZA 2LYAA 2IHNA 4YMOA 3PX0A 2BKEA 1L7NA 3IRUA 1Z3EB 3TFSA 2XGQA 2HHSA 4US8A 1ZD2P 4EP7A 4MEYA 3WFRE 1UEUA 1ZQXA 2HSZA 5KFRA 4KMUA 3MDCA 1C7YA 2IOHA 4RQMA 5DQGA 3KOOA 1KL9A 5HR7A 2ZIXB 3ICXA 3MGIA 1OW5A 5KFBA 4RWOA 2KEYA 2HVHA 2W7PA 1PK1B 3TARA 1JMSA 4ED3A 2JEGA 3KFUF 2HHTA 1ZQCA 3GQCA 2ZH9A 3TKAA 2K60A 4C7ZA 1WCNA 3AQNA 3NVVA 4US9A 1MQ2A 2A1JA 2O6KA 2EDUA 5HRLA 2LKYA 2IBKA 2FPKA 3JPSA 1MC8A 3BQ2A 1PUZA 1RZTA 9ICHA 2CN1A 2JH7A 3V7JA 5KFYA 1MIYA 2H3ZA 2W9BA 2C22A 1Q3VA 1KW4A 1SV4A 5IIJA 3EW9A 2ZIVB 5KFFA 3WFSC 2EZYA 4UARA 4KLLA 2KZ3A 2KZMA 5AM0A 2KJ8A 1SL1A 4HAIA 5KFQA 5DBBA 4DSFA 3QEBZ 1U9LA 2HHPA 2MSNA 1NNLA 1MQ3A 4KX5A 1RQNA 2JRZA 3H0MB 3WK5A 5E79U 1LKYA 4QZGA 4TURA 4YXJA 2ZTCA 3MFHA 4I2JA 1JN3A 1R89A 3QYPA 2B56A 1S97A 8ICAA 1JXEA 1S0VA 1ZQQA 7ICKA 1COKA 4K4GA 3PSTA 2G5HB 5HREA 1UA1A 4MF2A 8ICJA 1QQ5A 1LVHA 1NK6A 4F5PA 3K7DA 1R8CA 4X4RA 3RJHA 2DR9A 3T5HA 4NLGA 2VJ5A 1CUKA 4NJ8A 2BQ3A 4ED1A 1Z00B 5T14A 3M9NB 2RDIA 4NL9C 5J2EA 1Q3UA 3I1YA 1TFYA 3LVWA 1FFUA 4Q45A 4M9JA 4EBDA 1BPXA 4F2SA 1WG8A 3WFPA 3NVZA 5L1JA 1URJA 2HOFA 1ZQTA 3N7RC 2ZH6A 3WKCA 4XA5A 3H8WA 2YY6A 3TACB 2BBJA 4RQ3A 1FO4A 4FHWA 4YP3A 4IR9A 3OVAA 1RDFA 5AI9A 2NYVA 5KFGA 5AKJA 1IV8A 4PL2A 1ZD4A 2B0CA 1AROP 2Y0SC 1DXSA 2WB1F 2YMLA 4KLQA 1ZQYA 2FPLA 4DEZA 2W43A 4GFJA 4RT2A 4RQ4A 1VJ5A 5ALJA 1BPEA 1NJZA 3JPRA 3C1ZA 2ZUDA 1LB2B 3Q8QB 4PZOA 5KFZA 4QWEA 1ZQJA 2YMQA 5AKHA 5B5EU 3SZ2A 3WKDA 4KLGA 4X4TA 4QWBA 9ICCA 4ELUA 1N48A 4AT9B 2KFZA 2QLTA 5AK4A 2ASLA 4M6WB 8ICTA 4DQPA 4X4QA 1HUOA 3SYZA 3ZI4A 2DRAA 2DFLA 1ECWA 2UVWA 3OSNA 4PPXA 1UA0A 5HRDA 5EOZA 4JV0A 3JPNA 5IIKA 5AKKA 1S9FA 2B51A 3AQEA 5J2CA 2KIWA 5DECA 1MA7A 3Q8SB 1A6SA 1PK3A 4KN7A 3QUTA 2OM6A 4FS2A 4YR0A 3HKZF 5ALMA 2ISPA 3TFRA 2FLLA 4QWAA 3RB3A 4FHPA 3SD7A 2HHVA 2QARA 3LWLA 1ZQAA 4IQUA 2GA9D 5DGAA 2DBYA 4BXOA 5DLGA 2KD1A 4UBCA 1WWUA 4YQWA 3MDAA 2G08A 3T5LA 3OSPA 5AKXA 1S8OA 2XI9A 4MF8A 5KFHA 4WH5A 4LEYA 5L1MA 3KTQA 5ALEA 4BDPA 9ICGA 4HX0A 2R8HA 1ZQZA 2O1PA 4PZNA 4G9BA 5AKYA 8ICFA 4IS7A 4J9OA 4ECWA 3OVBA 5H2FU 4OAHA 2FE9A 2D6FC 5JUMA 1SWWA 4M2YA 5HR6A 1GO3F 5KT2A 2KG5A 1L5UA 2MAXA 1TAUA 4PGXA 4EEKA 1NI3A 1WOTA 4F3OA 1SZPA 5HR9A 3ISBA 1KBUA 4ATBB 2DGZA 8ICVA 2W03A 4ECXA 5EWFA 4LT6A 3PR4A 2I9GA 2JZBA 1ZRNA 3QU2A 3GZFA 3AEVA 1RQLA 5KG3A 2JEJA 4Y2UA 1B43A 2FMSA 2PBEA 4EEDA 4AYBC 4DOCA 1X6JA 4QIWF 4F4ZA 5EE3A 4UATA 3HWTA 4OO1J 3E58A 2ZHBA 4J03A 1QSSA 3E2EA 8ICGA 1TE2A 4RPXA 1YZ6A 5CR0A 5IINA 5HRFA 4DL5A 3HRDD 1KSPA 2DWQA 5ALIA 3AL0B 1RYSA 2GWSA 1DGSA 3B9JA 1V85A 4IQWA 5ALPA 5HMLA 4JUZA 3D6JA 1PX5A 1T3NA 3ZDEA 2F8LA 5J2HA 4WCWA 4WC3A 4P4PA 9ICWA 5KFKA 1J97A 2K8BB 1DGJA 4ELTA 4CF4A 2KSOA 2AGPA 2W7OA 3RB4A 1T8EA 4RPYA 4M9LA 2KICA 4DL6A 4P4OA 2KOBA 4C7YA 1NK7A 3SMVA 4YXMA 3TI0A 2VA3A 4QZAA 1X2IA 2W04A 3NGDA 4EX6A 2IOFK 3KHRA 4BJQA 3RTVA 2J6SA 5KFMA 2HHUA 2DRBA 1JALA 3SAFA 4ECTA 3H0LB 5AK3A 4OJ5A 4I2AA 1SXEA 2Q66A 4DL7A 3HJEA 1ZJMA 4EBEA 1DRGA 2EAMA 3OGUA 4A8EA 3RR8A 2DPIA 1Q8KA 4OAIZ 8ICWA 4KMOB 5BOLA 2NRTA 4IQVA 4U7CA 5AK5A 1J2NA 4DL3A 4RWQA 1L7MA 1ZETA 1XSPA 5KG1A 4F5QA 3RH4A 3PSPA 9ICQA 1KQQA 4I28A 3RJFA 1X9MA 2XY7A 2PFPA 1D9FA 1NK4A 3L3FX 5DB6A 1U4BA 5ALTA 1UETA 5BPCA 2ASJA 3PMNA 2IHOA 2HDOA 1TK5A 4B9VA 2BHNA 4NLKA 2ZH1A 2O5AA 3RJJA 3RB6A 4M47A 4I2DA 5DB9A 3ISCA 4GC6A 1KNYA 4DF8A 3TADA 5KT4A 2OEHA 4AT7A 3CYMA 5DB7A 3GV5B 5ALXA 3HJ1A 1U47A 2E8OA 5BOMA 4EZ9A 3AUOA 1KFDA 3RBDA 5KFOA 3ERCC 4ED6A 7ICQA 1J2MA 3BS7A 5AM3A 3SV3A 9ICSA 4KLUA 2VANA 4ED8A 5KTQA 4R8UB 2KV2A 3H39A 1XO0A 1SKWA 3H38A 1V9PA 8ICRA 7ICSA 4PHPA 3K1ZA 3Q8RB 3PMLA 1VLBA 4RNOA 2ZH2A 5J0QA 3M8SA 1GPJA 2V4QA 1SIJA 4F8RA 4RQ6A 9ICXA 4R63A 2KFNA 2KNJA 3PY8A 2F2AB 5ALKA 4NY8A 3M9MB 4F92B 2H5XA 2HMXA 7ICIA 4PHAA 4I2HA 3JZ0A 4LVSA 5TISU 1JIHA 5HRKA 4I0UA 3AQKA 2YB4A 2ZXHA 4UAVA 4DSEA 5KG2A 2PMZC 2M9NA 1VFGA 2EZXA 4UAWA 2HVIA 4J9SA 3QUCA 4YR3A 4I2IA 2JEIA 1Z4NA 4P2HA 4Q43A 2BDPA 5DKWA 5KG5A 4NM2A 4F2RA 4RZRA 5J0YA 4C8NA 2RHFA 4DWIA 1ZQNA 4DOAA 2OWOA 2HOIA 4WC6A 4C8LA 9ICUA 5AICA 1A77A 2WFAA 3BS5B 4MFCA 2XICA 3NTUA 1BPDA 2W11A 4X5VA 3WFQE 4R64A 2HBKA 2W3RA 3V6KA 1SL0A 2VIXA 3DV9A 4KX3A 4ACOA 4F50A 4DFKA 3WK7A 1UT8A 5AKEA 2BBHA 2ATLA 8ICSA 1S76D 3F5EA 2ES6A 1ZQLA 1TK8A 4AT8A 2LYBA 4KM5A 4F5RA 4K9AA 5J2FA 4P0QA 4NKUA 1JUDA 1BGXT 3GV7B 9ICOA 2NRWA 5EE0A 1D9DA 3CW2C 3OHAA 2WAQC 9ICVA 2E1EA 5KFVA 3NWIA 4I2BA 4JWNA 3GIKA 2D3DA 3Q8MA 1B4FA 1DK2A 3NVOA 2KJ9A 4DL4A 2IUBA 4DFDA 3BJYA 4MFFA 1YZ7A 2B4VA 3FM9A 2OXOA 5EWEA 3ZDDA 2ZJAA 2IA6A 3TAQA 3CNHA 3RJGA 2G07A 4K8VA 2F3NA 2KMDA 4Q44A 4DO9A 2A1AA 4LEZA 4Z6CA 3ER9B 2FPMA 1KKXA 4ED0A 4CE6A 2NRVA 4UB4A 5KG7A 2AHOB 3I28A 2M2UA 1NOMA 8ICQA 2VKQA 2NV3A 3MR2A 1PZNA 2OYYA 4QZ8A 1TFWA 2ASDA 5DG8A 2DQNB 1RXWA 1ZOLA 4ZOHC 1DK3A 4FHYA 4DSJA 2R8GA 3VC8A 4F4XA 2PI5A 4FBUA 4F72A 8ICKA 2NRKA 5J0XA 1JROA 2ZHAA 4UB2A 2UVUA 3PW7A 8ICHA 4YD2A 2AXTU 5J2GA 3K1RB 4K9BA 4KLDA 3C1YA 2LHTA 2HBMA 4QW8A 3U26A 3TADC 3NRZA 3Q8KA 5F9NA 4OJ6A 7ICLA 4EBJA 5A0LA 1Z1VA 1F44A 3GIJA 1B0XA 4Y2YA 3RJIA 2JR5A 4J9MA 1L3UA 1T94A 4B9UA 4KLIA 5HRHA 2Y1IA 3BZCA 3J81j 1N60A 2RP5A 5KFWA 4NLNA 3IV6A 3F2CA 1S0NA 2ZIUA 4BGDA 2HN1A 4WQLA 5AI4A 2HW3A 3NYBA 4O3NA 1L8LA 2NO4A 3PW5A 4F91B 5AI0A 2I5HA 4P0PA 8ICZA 3C2KA 1UCVA 2GAFD 4YVZA 4CDGA 3QX7A 4UD4A 3L5KA 2PFNA 4BWMA 3OVSA 2PI4A 3C5GA 1SXDA 2F1IA 3WK6A 2XC9A 1A76A 1ZQUA 3B0YA 5KFIA 5ALLA 4BX9C 2QB0A 4DS4A 2JXJA 3OUYB 2YMPA 1L6NA 4CF5A 2MUTA 4OJPA 4MFAA 1TK0A 2RLTA 1K1QA 2ZIWB 2W9CB 3FDSA 5DGBA 5J29A 5AKGA 1TAQA 1ZD3A 2OH2A 4X0AA 1ZQ1C 4NXTA 5JRTA 4DSLA 4QJFB 2WF9A 1ZQRA 4IG8A 5CEHA 2KVCA 5JTGA 4UB8U 4B9MA 2F1JA 1MIVA 5KFPA 4JB3A 1X9WA 5HHIA 5ALVA 1NZPA 2E5SA 5J8YA 1BNPA 2LYHA 3SQIA 1KFTA 4FZLA 3V7KA 3MFIA 4WC4A 1K5OA 4QZHA 5AM1A 1ZQKA 1QSLA 2FJ6A 7ICVA 3V6HA 9ICBA 5ALZA 1NKCA 3UPSA 2VA8A 3KBBA 2I1QA 2ZXIA 4M9NA 1K1SA 1D8YA 3PVXA 3MR5A 3N28A 2F76X 2PKEA 3M7DA 1U45A 7ICFA 5AI8A 2BCVA 3GDXA 3C23A 3D2QA 2AGQA 3IN5A 3UXPA 1KRPA 5AI5A 1WCLA 4GC7A 3AMZA 1TAMA 4S3NA 4RQ7A 5L1IA 2JH1A 5G5GA 2F1HA 2JV3A 5KFJA 4RT3A 2ZJ5A 3MCRA 4EYHB 4UB1A 3OJSA 1BVSA 5J0WA 2ZH8A 4OJLA 3WFOA 3N97B 2M0NA 2ISOA 1BPBA 4O5KA 2W55A 8ICMA 9ICEA 3AM9A 4LJXA 4C80A 2AU0A 5D62A 3OTQA 1CEZA 7ICTA 8ICPA 3G6VA 3ZD9A 5ALGA 3MC1A 4KLMA 2K4EA 2WHEA 1O08A 3C66A 4CCHA 1JXLA 2A1JB 4I27A 1QQ7A 5CFTA 5AKIA 2RQ5A 4YD1A 3OJUA 2A19A 3I76A 5KFDA 4I2CA 4Y2PA 3S6JA 2W9BB 3L4PA 3TQ1A 4FHVA 4MHVA 4JLXA 5DBAA 1Q78A 3WK4A 1U48A 1T7PA 2W54A 4RU9A 4QZFA 4O3PA 2HBJA 3Q8PB 3ONNA 1R8BA 4KLHA 2E1FA 4K96A 1X42A 5HC9A 2OHFA 4UW9A 2C2RA 1U49A 2PXIA 2M2WA 2MA1A 1V97A 4ECSA 4OAFA 5F3XB 1NK0A 3N4MB 4O68A 5AKLA 3M9OB 2N1RA 1LKYB 4Z6EA 1QH9A 5IIMA 4C8KA 3QZ7A 3KHHA 5ALDA 1SZHA 1HIWA 2EAPA 1TFRA 2ZG6A 1ZQGA 2WB1C 4Y2SA 1ZQPA 5AKZA 4G3IA 1V38A 4NLBA 1N5WA 1Z4OA 2D8CA
chains in the Genus database with same CATH topology
2IBKA 4WBYA 4RNOA 3C18A 2FPKA 4DQSA 3JPSA 8ICXA 1MC8A 2ZH2A 3BQ2A 4QZ9A 2J6TA 1RZTA 5KFLA 9ICHA 3V7JA 2HHWA 4HYKA 1S0OA 3EWAA 5KFYA 2C22A 5KFXA 2W9BA 4LZGA 5J0SA 1MIYA 1NKEA 4O3OA 5IIJA 5J0QA 7ICPA 3M8SA 4I29A 3EW9A 2P6UA 2V4QA 5KFFA 3WFSC 4GXKA 4F8RA 4I2EA 2ZTDA 3PO4A 2BQUA 4RQ6A 3HT3A 9ICXA 4I2FA 4R63A 2KFNA 4KLLA 2KZ3A 3UQ2A 2KZMA 4FHXA 3PY8A 3AQMA 4FH3A 5J2KA 4NY8A 1SL1A 3M9MB 3K75D 4KLFA 4F92B 8ICNA 5KFQA 5DBBA 4DSFA 2H5XA 5HP4A 1QTMA 4X4OA 4PHDA 7ICIA 3QEBZ 4PHAA 4I2HA 4NXZA 3UQ0A 1U9LA 4LVSA 2HHPA 3JZ0A 3JPQA 1JIHA 1MQ3A 5HRKA 2W8LA 4JWMA 4KTQA 1IXRA 4AT8B 4TUSA 3AQKA 3HP6A 4QZGA 3KHGA 7ICGA 4WC0A 4DSEA 5D49A 5KG2A 2ZUCA 4TURA 5DDYA 4UB3A 3ZDAA 2M9NA 1QSYA 4YXJA 2ZTCA 3MFHA 1VFGA 4KN4A 4I2JA 1JN3A 4UAWA 2BR0A 2HVIA 1R89A 4R8UA 4DL2A 1S97A 4J9SA 1JXEA 3H7IA 4PHEA 1BPZA 1S0VA 4YR3A 8ICAA 1ZQQA 7ICKA 2B21A 4I2IA 3LWMA 2JEIA 4P2HA 2ID1A 4Q43A 2BDPA 4K4GA 2ZH4A 5DKWA 1UA1A 2FMPA 5HREA 1V4AA 4MF2A 8ICJA 2Q0ZX 4GLXA 4FO6A 1ZQHA 1NK6A 1XSNA 3H40A 3PX4A 4F5PA 4JV2A 5KG5A 4NM2A 4F2RA 4RZRA 5J0YA 4C8NA 4DWIA 4Q8EA 1R8CA 1UEVA 4RWNA 3BQTA 1COOA 1ZQNA 3RJHA 4DOAA 4X4RA 2OWOA 4WC6A 2DR9A 3T5HA 4B9TA 4Z6FA 3B0XA 4C8LA 4NLGA 9ICUA 1A77A 1CUKA 4EBKA 4MFCA 3NTUA 1BPDA 2W8KA 4X5VA 2BQ3A 1JX4A 2DR7A 4ED1A 1Z00B 3QEAZ 4JV1A 4R64A 3M9NB 2RDIA 5J2EA 1JQRA 3RBEA 1R8AA 3V6KA 1TFYA 2ALZA 4PH5A 1SL0A 3ZDBA 1L3VA 4Q45A 4F50A 8ICYA 4DFKA 4J9KA 4EBDA 1BPXA 4M9JA 4F2SA 3JYYA 1UT8A 4QZDA 2BGWA 5J0PA 2ATLA 8ICSA 5CB1A 3AU6A 3WFPA 1S76D 4UB5A 1UT5A 2PFOA 1KTQA 4DSKA 4M9GA 5L1JA 1ZQLA 1TK8A 4X4UA 4AT8A 4X4NA 4RPZA 3MR6A 3UXOA 4F5RA 3ISDA 7ICRA 5J2FA 1ZQTA 2ZH6A 4NKUA 1BGXT 1ZQMA 4XA5A 3GV7B 1KLNA 3H8WA 3C2LA 9ICOA 2NRWA 4RQ3A 5CWRA 3OHBA 2DRBA 4IR1A 4FHWA 4YP3A 3QZ8A 1D9DA 4IR9A 5DLFA 2W9AA 3M8RA 3OVAA 3H4BA 3JPPA 2J6UA 5KFGA 2BPCA 3PX6A 4X4SA 3OHAA 5KFSA 1HUZA 2DR5A 5DBCA 9ICVA 5KFVA 1AROP 4I2BA 4RQ2A 4JWNA 3GIKA 3GFKB 3Q8MA 4ATBA 1XSLA 4KLQA 2AGOA 5L1KA 1DK2A 2ZH3A 4DL4A 1ZQYA 2FPLA 2NRZA 4DEZA 4FBTA 3H37A 4RT2A 4RQ4A 1X9SA 5KFUA 3BJYA 4MFFA 2UVVA 5EWEA 3ZDDA 4ECYA 2ZJAA 2IA6A 3TAQA 3RJGA 1NK8A 4EYIB 1BPEA 1Z00A 3ZD8A 2R8IA 4KLSA 4YMMA 1ZQWA 4Q44A 4DO9A 4DQQA 3T3FA 5L9XA 2C28A 1NJZA 1ZJNA 4Z6CA 3JPRA 4ELVA 4P4MA 1SKRA 5F2VO 4R65A 3C1ZA 2FPMA 2ZUDA 3AU2A 1LB2B 4ED0A 3Q8QB 3LQCB 4UAZA 3THVA 1DOQA 2NRVA 5KFZA 4UB4A 4M04A 4QWEA 4XQ7A 4QZEA 5KG7A 5KFAA 1ZQJA 3SZ2A 3HX0A 4UBBA 4X4VA 3IHQB 4RUCA 3RRHA 2M2UA 4KLGA 4BXOB 4O3SA 1NOMA 4QWBA 8ICQA 9ICKA 4X4TA 9ICCA 4ELUA 1N48A 4AT9B 3MR2A 1N56A 1PZNA 2ASLA 2KFZA 4M6WB 4QZ8A 4DQPA 8ICTA 4X4QA 1HUOA 3SYZA 1TFWA 5DG8A 2DRAA 2DFLA 3C21A 3OSNA 1RXWA 2UVWA 4PPXA 1UA0A 1TKDA 3MBYA 5CA7A 9ICNA 5HRDA 1DK3A 5EOZA 4FH5A 4JV0A 4DSJA 2R8GA 3HPOA 2HHTA 4FHYA 1TVAA 4F4XA 2ZH5A 2PI5A 3JPNA 2RFFA 3C2MA 5IIKA 4FBUA 5KFCA 1S9FA 8ICKA 1NO5A 2NRKA 5J0XA 2P66A 2ZHAA 4UB2A 2UVUA 3AQLA 8ICOA 4EEYA 5J2CA 3PW7A 1F5AA 3UXNA 3PW2A 5DECA 2AJQA 8ICHA 5KT3A 3Q8SB 4YD2A 5KG4A 4EBCA 4RWPA 4MEXA 1XU4A 4KN7A 4J9QA 2FLPA 3H3AA 5J2GA 1TV9A 2DR8A 4J9RA 1L3SA 3FYHA 1L3TA 4FS2A 4YR0A 4ECZA 7ICHA 4IRCA 3GILA 4F4WA 3HW8A 1SL2A 3C1YA 4KLDA 4ECRA 2KTQA 5HRGA 2M2TA 2ISPA 3TFRA 4ED7A 4QW8A 1ZYQA 5KFNA 2FLLA 4QWAA 3Q8KA 5F9NA 7ICLA 4EBJA 4TQSA 3RB3A 4O3RA 4FHPA 2HHVA 2MUTB 4ED2A 4F93B 4DQIA 5F9LA 2Y1JA 5TZVA 3LWLA 5J2IA 5J0UA 2DPJA 3GIJA 4GXJA 3TAPA 2BQRA 1ZQAA 2JZBB 3RJIA 2XY6A 2W9MA 1HJPA 4IQUA 3GIMA 4J9MA 1L3UA 4NLZA 5HNKA 5DGAA 4F5NA 1ZQFA 4B9UA 5DLGA 4BXOA 4KLIA 5HRHA 2Y1IA 3IM1A 4YQWA 4UBCA 4QZCA 1RYRA 4AT9A 3MDAA 4M6WA 5KFWA 5CHGA 4TUQA 3PNCA 3T5LA 4NLNA 3OSPA 5J2DA 2C2DA 1S0NA 4BGDA 4RNMA 3ZDCA 4DLGA 4K4IA 4MF8A 2HW3A 5KFHA 3NYBA 3HJ4A 1NK9A 4O3NA 3KTQA 3SI8A 2ZH7A 4QWCA 4J9NA 3SV4A 3PW5A 4YG2A 2R8HA 1ZQZA 4Z6DA 4F91B 4BDPA 9ICGA 5KFTA 2O1PA 4DLEA 4O5CA 3EPGA 1Q79A 8ICZA 8ICFA 3C2KA 3WFQE 4J9OA 4ECWA 3OVBA 4YVZA 4X0BA 4O0IA 4QW9A 2WTFA 4UD4A 2UVRA 7ICJA 5JUMA 3G6XA 2PFNA 4BWMA 4TUPA 4DQRA 1VJ7A 3OVSA 2PI4A 3KHLA 4BWJA 5KFEA 3C5GA 4YCXA 3MR3A 4M2YA 4E0DA 2ZUBA 4O5EA 5J2JA 2F1IA 5KT2A 1NJYA 4NM1A 1OU5A 2XC9A 1A76A 1ZQUA 3B0YA 3RB0A 1L5UA 4EZ6A 2FMQA 5KFIA 2MAXA 1TAUA 4PGXA 3G6YA 5KG6A 2IHMA 3ETLA 2C2EA 4F4KA 3PR5B 1WOTA 4DS4A 5IIIA 3L9DA 4F3OA 3OUYB 1SZPA 4J9LA 3ISBA 5C5JA 4KLTA 1NJWA 5HR9A 3K4GA 3T5JA 4ATBB 4YFKA 2MUTA 8ICVA 4ECXA 5EWFA 1XS9D 4QWDA 3PO5A 3RRGA 4MFAA 1TK0A 3PR4A 1K1QA 1ZQDA 1MIWA 4LT6A 3EPIA 2W9CB 3FDSA 5IILA 2I9GA 5DGBA 7ICNA 2JZBA 4DFMA 5J29A 3V72A 1TAQA 4X0AA 5KG3A 5HHHA 2JEJA 1B43A 3UPQA 2FMSA 1B22A 3MGHA 2PBEA 3JPTA 4DOCA 4PGQA 4F4ZA 4DSLA 1JAJA 3OV7A 3RH6A 4RUAA 3HWTA 1ZQRA 3ORYA 5KG0A 1S0MA 4IG8A 1ZQIA 1D8LA 3TANA 9ICPA 4WC5A 4WC7A 8ICIA 2RDJA 4B9MA 2ZHBA 2DVIA 5HMMA 4XUSA 9ICFA 4IQTA 2F1JA 4GXIA 1QSSA 5KFPA 3E2EA 7ICOA 1MIVA 7ICMA 2HHQA 1X9WA 1SKSA 8ICGA 5HHIA 1NJXA 4RPXA 4I2GA 1NZPA 2V9WA 2XY5A 5CR0A 5IINA 9ICJA 5HRFA 1BNPA 2ZJ8A 4F5OA 2LYHA 4E8FA 3EZ5A 3PW4A 4DL5A 4J9PA 4YN4A 4E7XA 3RH5A 4M0AA 1KFTA 1ZQSA 1KSPA 2ZTEA 2KZZA 2M2VA 5HRLA 4PGYA 4DOBA 1EXNA 4TQRA 1QLNA 1IM4A 3V7KA 3MFIA 1RYSA 3RR7A 4YMNA 4WC4A 4QZHA 2GWSA 1DGSA 4B9NA 4ECUA 5D4BA 2AQ0A 1ZQKA 7ICUA 2V4RA 1QSLA 3RJEA 5HMLA 4IQWA 1H38A 3Q8LA 3OUYA 4JUZA 9ICAA 1PX5A 1T3NA 4RQ8A 3ZDEA 5J0TA 1BPYA 3V6HA 2BCSA 3C5FA 5J2HA 4KLOA 9ICBA 1Y88A 4WCWA 4P4PA 1KEJA 5IIOA 4R66A 3V6JA 1NKCA 1KFSA 4B9LA 3UPSA 2VA8A 5CP2A 9ICWA 5KFKA 2I1QA 3BQ1A 1FA0A 2PFQA 4ELTA 4M9NA 5HRIA 1K1SA 4QZBA 3PVXA 1D8YA 4C8OA 2W9CA 1S77D 2NRXA 3MR5A 9ICLA 5DG9A 1LV5A 7ICVA 1U45A 2AGPA 7ICFA 2BCVA 3GIIA 3RB4A 4O3QA 3GDXA 1T8EA 4RPYA 3C23A 8ICEA 4M9LA 4KLEA 4DL6A 2AGQA 3UXPA 3PV8A 3LK9A 1KRPA 8ICCA 2FLNA 4DF4A 1WCLA 1YLQA 4P4OA 4GC7A 4ZH4A 1NK7A 4JK1A 4S3NA 4RQ7A 5L1IA 4YXMA 3TI0A 2VA3A 4DSIA 4NKTA 4QZAA 1X2IA 4K4HA 4UD5A 4KITB 5CJ7A 2R8KA 1RPLA 4B9SA 2F1HA 2XCPA 3NGDA 1XO1A 8ICBA 2XGPA 4M5DA 9ICTA 5KFJA 3KHRA 4ECQA 3RJKA 4RT3A 2ZJ5A 1ZQBA 4WC2A 4EYHB 3RTVA 4UB1A 1S10A 2J6SA 5DQHA 1BVSA 5KFMA 3OJSA 5J0WA 1NKBA 2HHUA 1MSWD 2KP7A 4C8MA 7ICEA 2ZH8A 3WFOA 4ECTA 4DS5A 4DFJA 3MABA 2AQ4A 4WBZA 1XWLA 3N97B 5HRBA 3H4DA 4I2AA 1ZQEA 2Q66A 3RAXA 3HIYA 4DL7A 1RXVA 2ISOA 1BPBA 1ZJMA 4EBEA 4O5KA 5J2BA 4RQ5A 3OGUA 5DQIA 1XC9A 5L1LA 4AT7B 4E80A 3RR8A 4KLJA 8ICMA 9ICEA 2BE3A 2DPIA 3QE9Y 5KT6A 4M9HA 8ICWA 5BOLA 4IRKA 5EWGA 2BCUA 2NRTA 4IQVA 5J0OA 2IMWP 4YR2A 5DB8A 2BPFA 9ICIA 3H8SA 2AU0A 3H8JA 2VA2A 5KT5A 2R8JA 4RQ1A 2P6RA 1CEZA 4RNNA 4UQGA 7ICTA 4DL3A 3G6VA 8ICPA 4RWQA 4XRHA 1T4GA 3ZD9A 1KDHA 1ZETA 5KT7A 4KLMA 1XSPA 4QZIA 5KG1A 4DFPA 2BPGA 9ICMA 1NK5A 4F5QA 3RH4A 3BDPA 3C66A 5DDMA 3RAQA 2KN7A 5DG7A 1ZQVA 1ZQOA 4CCHA 1JXLA 2A1JB 4I27A 4RQ0A 9ICQA 2XCAA 4UAYA 4FS1A 2JEFA 4I28A 3V7LA 3EYZA 2IHNA 1X9MA 2XY7A 4YD1A 2PFPA 3RJFA 5DEDA 3OJUA 5KFDA 4YMOA 1NK4A 3PX0A 2BCQA 1D9FA 4I2CA 2BKEA 4Q8FA 3BQ0A 5DB6A 2W9BB 1U4BA 3TQ1A 4FHVA 1Z3EB 1UETA 5BPCA 2ASJA 3PMNA 4IRDA 1TK5A 3LDAA 4B9VA 3TFSA 2BHNA 2XGQA 5DBAA 4NLKA 2HHSA 1Q78A 3T5KA 2ZH1A 2O5AA 8ICLA 1U48A 8ICUA 3RJJA 4EP7A 4MEYA 3WFRE 3RB6A 4M47A 1T7PA 1UEUA 4RU9A 4I2DA 4O3PA 5DB9A 4QZFA 3Q8PB 3ISCA 4GC6A 1KNYA 1R8BA 1ZQXA 4DF8A 4KLHA 5KFRA 4ECVA 4KMUA 5KT4A 3MDCA 5HC9A 3JPOA 2C2RA 1U49A 2PXIA 2HHXA 2M2WA 1C7YA 4LZDA 3GV8B 4WC1A 4AT7A 4ECSA 5DQGA 1BNOA 3MGIA 5DB7A 3GV5B 5KFBA 3HJ1A 1NK0A 4RWOA 1U47A 2HVHA 3N4MB 3M9OB 5BOMA 3TARA 1JMSA 4Z6EA 4ED3A 5IIMA 2JEGA 3QZ7A 3KHHA 3AUOA 1KFDA 3RBDA 5KFOA 4C8KA 1ZQCA 4ED6A 4EZ9A 7ICQA 4WC3A 3GQCA 3SV3A 9ICSA 2ZH9A 4KLUA 2VANA 1WCNA 1TFRA 1ZQGA 3AQNA 4ED8A 5KTQA 2BCRA 2XO7A 4R8UB 1ZQPA 3H39A 1SKWA 5J2AA 4G3IA 1MQ2A 5D46A 3H38A 1V9PA 5J0RA 4X4PA 4F4YA 8ICRA 3PW0A 9ICRA 7ICSA 4O9MA 2A1JA 4PHPA 2ASDA 4XQ8A 3Q8RB 3PMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IBK A;  4WBY A;  4RNO A;  3C18 A;  2FPK A;  4DQS A;  3JPS A;  8ICX A;  1MC8 A;  2ZH2 A;  3BQ2 A;  4QZ9 A;  2J6T A;  1RZT A;  5KFL A;  9ICH A;  3V7J A;  2HHW A;  4HYK A;  1S0O A;  3EWA A;  5KFY A;  2C22 A;  5KFX A;  2W9B A;  4LZG A;  5J0S A;  1MIY A;  1NKE A;  4O3O A;  5IIJ A;  5J0Q A;  7ICP A;  3M8S A;  4I29 A;  3EW9 A;  2P6U A;  2V4Q A;  5KFF A;  3WFS C;  4GXK A;  4F8R A;  4I2E A;  2ZTD A;  3PO4 A;  2BQU A;  4RQ6 A;  3HT3 A;  9ICX A;  4I2F A;  4R63 A;  2KFN A;  4KLL A;  2KZ3 A;  3UQ2 A;  2KZM A;  4FHX A;  3PY8 A;  3AQM A;  4FH3 A;  5J2K A;  4NY8 A;  1SL1 A;  3M9M B;  3K75 D;  4KLF A;  4F92 B;  8ICN A;  5KFQ A;  5DBB A;  4DSF A;  2H5X A;  5HP4 A;  1QTM A;  4X4O A;  4PHD A;  7ICI A;  3QEB Z;  4PHA A;  4I2H A;  4NXZ A;  3UQ0 A;  1U9L A;  4LVS A;  2HHP A;  3JZ0 A;  3JPQ A;  1JIH A;  1MQ3 A;  5HRK A;  2W8L A;  4JWM A;  4KTQ A;  1IXR A;  4AT8 B;  4TUS A;  3AQK A;  3HP6 A;  4QZG A;  3KHG A;  7ICG A;  4WC0 A;  4DSE A;  5D49 A;  5KG2 A;  2ZUC A;  4TUR A;  5DDY A;  4UB3 A;  3ZDA A;  2M9N A;  1QSY A;  4YXJ A;  2ZTC A;  3MFH A;  1VFG A;  4KN4 A;  4I2J A;  1JN3 A;  4UAW A;  2BR0 A;  2HVI A;  1R89 A;  4R8U A;  4DL2 A;  1S97 A;  4J9S A;  1JXE A;  3H7I A;  4PHE A;  1BPZ A;  1S0V A;  4YR3 A;  8ICA A;  1ZQQ A;  7ICK A;  2B21 A;  4I2I A;  3LWM A;  2JEI A;  4P2H A;  2ID1 A;  4Q43 A;  2BDP A;  4K4G A;  2ZH4 A;  5DKW A;  1UA1 A;  2FMP A;  5HRE A;  1V4A A;  4MF2 A;  8ICJ A;  2Q0Z X;  4GLX A;  4FO6 A;  1ZQH A;  1NK6 A;  1XSN A;  3H40 A;  3PX4 A;  4F5P A;  4JV2 A;  5KG5 A;  4NM2 A;  4F2R A;  4RZR A;  5J0Y A;  4C8N A;  4DWI A;  4Q8E A;  1R8C A;  1UEV A;  4RWN A;  3BQT A;  1COO A;  1ZQN A;  3RJH A;  4DOA A;  4X4R A;  2OWO A;  4WC6 A;  2DR9 A;  3T5H A;  4B9T A;  4Z6F A;  3B0X A;  4C8L A;  4NLG A;  9ICU A;  1A77 A;  1CUK A;  4EBK A;  4MFC A;  3NTU A;  1BPD A;  2W8K A;  4X5V A;  2BQ3 A;  1JX4 A;  2DR7 A;  4ED1 A;  1Z00 B;  3QEA Z;  4JV1 A;  4R64 A;  3M9N B;  2RDI A;  5J2E A;  1JQR A;  3RBE A;  1R8A A;  3V6K A;  1TFY A;  2ALZ A;  4PH5 A;  1SL0 A;  3ZDB A;  1L3V A;  4Q45 A;  4F50 A;  8ICY A;  4DFK A;  4J9K A;  4EBD A;  1BPX A;  4M9J A;  4F2S A;  3JYY A;  1UT8 A;  4QZD A;  2BGW A;  5J0P A;  2ATL A;  8ICS A;  5CB1 A;  3AU6 A;  3WFP A;  1S76 D;  4UB5 A;  1UT5 A;  2PFO A;  1KTQ A;  4DSK A;  4M9G A;  5L1J A;  1ZQL A;  1TK8 A;  4X4U A;  4AT8 A;  4X4N A;  4RPZ A;  3MR6 A;  3UXO A;  4F5R A;  3ISD A;  7ICR A;  5J2F A;  1ZQT A;  2ZH6 A;  4NKU A;  1BGX T;  1ZQM A;  4XA5 A;  3GV7 B;  1KLN A;  3H8W A;  3C2L A;  9ICO A;  2NRW A;  4RQ3 A;  5CWR A;  3OHB A;  2DRB A;  4IR1 A;  4FHW A;  4YP3 A;  3QZ8 A;  1D9D A;  4IR9 A;  5DLF A;  2W9A A;  3M8R A;  3OVA A;  3H4B A;  3JPP A;  2J6U A;  5KFG A;  2BPC A;  3PX6 A;  4X4S A;  3OHA A;  5KFS A;  1HUZ A;  2DR5 A;  5DBC A;  9ICV A;  5KFV A;  1ARO P;  4I2B A;  4RQ2 A;  4JWN A;  3GIK A;  3GFK B;  3Q8M A;  4ATB A;  1XSL A;  4KLQ A;  2AGO A;  5L1K A;  1DK2 A;  2ZH3 A;  4DL4 A;  1ZQY A;  2FPL A;  2NRZ A;  4DEZ A;  4FBT A;  3H37 A;  4RT2 A;  4RQ4 A;  1X9S A;  5KFU A;  3BJY A;  4MFF A;  2UVV A;  5EWE A;  3ZDD A;  4ECY A;  2ZJA A;  2IA6 A;  3TAQ A;  3RJG A;  1NK8 A;  4EYI B;  1BPE A;  1Z00 A;  3ZD8 A;  2R8I A;  4KLS A;  4YMM A;  1ZQW A;  4Q44 A;  4DO9 A;  4DQQ A;  3T3F A;  5L9X A;  2C28 A;  1NJZ A;  1ZJN A;  4Z6C A;  3JPR A;  4ELV A;  4P4M A;  1SKR A;  5F2V O;  4R65 A;  3C1Z A;  2FPM A;  2ZUD A;  3AU2 A;  1LB2 B;  4ED0 A;  3Q8Q B;  3LQC B;  4UAZ A;  3THV A;  1DOQ A;  2NRV A;  5KFZ A;  4UB4 A;  4M04 A;  4QWE A;  4XQ7 A;  4QZE A;  5KG7 A;  5KFA A;  1ZQJ A;  3SZ2 A;  3HX0 A;  4UBB A;  4X4V A;  3IHQ B;  4RUC A;  3RRH A;  2M2U A;  4KLG A;  4BXO B;  4O3S A;  1NOM A;  4QWB A;  8ICQ A;  9ICK A;  4X4T A;  9ICC A;  4ELU A;  1N48 A;  4AT9 B;  3MR2 A;  1N56 A;  1PZN A;  2ASL A;  2KFZ A;  4M6W B;  4QZ8 A;  4DQP A;  8ICT A;  4X4Q A;  1HUO A;  3SYZ A;  1TFW A;  5DG8 A;  2DRA A;  2DFL A;  3C21 A;  3OSN A;  1RXW A;  2UVW A;  4PPX A;  1UA0 A;  1TKD A;  3MBY A;  5CA7 A;  9ICN A;  5HRD A;  1DK3 A;  5EOZ A;  4FH5 A;  4JV0 A;  4DSJ A;  2R8G A;  3HPO A;  2HHT A;  4FHY A;  1TVA A;  4F4X A;  2ZH5 A;  2PI5 A;  3JPN A;  2RFF A;  3C2M A;  5IIK A;  4FBU A;  5KFC A;  1S9F A;  8ICK A;  1NO5 A;  2NRK A;  5J0X A;  2P66 A;  2ZHA A;  4UB2 A;  2UVU A;  3AQL A;  8ICO A;  4EEY A;  5J2C A;  3PW7 A;  1F5A A;  3UXN A;  3PW2 A;  5DEC A;  2AJQ A;  8ICH A;  5KT3 A;  3Q8S B;  4YD2 A;  5KG4 A;  4EBC A;  4RWP A;  4MEX A;  1XU4 A;  4KN7 A;  4J9Q A;  2FLP A;  3H3A A;  5J2G A;  1TV9 A;  2DR8 A;  4J9R A;  1L3S A;  3FYH A;  1L3T A;  4FS2 A;  4YR0 A;  4ECZ A;  7ICH A;  4IRC A;  3GIL A;  4F4W A;  3HW8 A;  1SL2 A;  3C1Y A;  4KLD A;  4ECR A;  2KTQ A;  5HRG A;  2M2T A;  2ISP A;  3TFR A;  4ED7 A;  4QW8 A;  1ZYQ A;  5KFN A;  2FLL A;  4QWA A;  3Q8K A;  5F9N A;  7ICL A;  4EBJ A;  4TQS A;  3RB3 A;  4O3R A;  4FHP A;  2HHV A;  2MUT B;  4ED2 A;  4F93 B;  4DQI A;  5F9L A;  2Y1J A;  5TZV A;  3LWL A;  5J2I A;  5J0U A;  2DPJ A;  3GIJ A;  4GXJ A;  3TAP A;  2BQR A;  1ZQA A;  2JZB B;  3RJI A;  2XY6 A;  2W9M A;  1HJP A;  4IQU A;  3GIM A;  4J9M A;  1L3U A;  4NLZ A;  5HNK A;  5DGA A;  4F5N A;  1ZQF A;  4B9U A;  5DLG A;  4BXO A;  4KLI A;  5HRH A;  2Y1I A;  3IM1 A;  4YQW A;  4UBC A;  4QZC A;  1RYR A;  4AT9 A;  3MDA A;  4M6W A;  5KFW A;  5CHG A;  4TUQ A;  3PNC A;  3T5L A;  4NLN A;  3OSP A;  5J2D A;  2C2D A;  1S0N A;  4BGD A;  4RNM A;  3ZDC A;  4DLG A;  4K4I A;  4MF8 A;  2HW3 A;  5KFH A;  3NYB A;  3HJ4 A;  1NK9 A;  4O3N A;  3KTQ A;  3SI8 A;  2ZH7 A;  4QWC A;  4J9N A;  3SV4 A;  3PW5 A;  4YG2 A;  2R8H A;  1ZQZ A;  4Z6D A;  4F91 B;  4BDP A;  9ICG A;  5KFT A;  2O1P A;  4DLE A;  4O5C A;  3EPG A;  1Q79 A;  8ICZ A;  8ICF A;  3C2K A;  3WFQ E;  4J9O A;  4ECW A;  3OVB A;  4YVZ A;  4X0B A;  4O0I A;  4QW9 A;  2WTF A;  4UD4 A;  2UVR A;  7ICJ A;  5JUM A;  3G6X A;  2PFN A;  4BWM A;  4TUP A;  4DQR A;  1VJ7 A;  3OVS A;  2PI4 A;  3KHL A;  4BWJ A;  5KFE A;  3C5G A;  4YCX A;  3MR3 A;  4M2Y A;  4E0D A;  2ZUB A;  4O5E A;  5J2J A;  2F1I A;  5KT2 A;  1NJY A;  4NM1 A;  1OU5 A;  2XC9 A;  1A76 A;  1ZQU A;  3B0Y A;  3RB0 A;  1L5U A;  4EZ6 A;  2FMQ A;  5KFI A;  2MAX A;  1TAU A;  4PGX A;  3G6Y A;  5KG6 A;  2IHM A;  3ETL A;  2C2E A;  4F4K A;  3PR5 B;  1WOT A;  4DS4 A;  5III A;  3L9D A;  4F3O A;  3OUY B;  1SZP A;  4J9L A;  3ISB A;  5C5J A;  4KLT A;  1NJW A;  5HR9 A;  3K4G A;  3T5J A;  4ATB B;  4YFK A;  2MUT A;  8ICV A;  4ECX A;  5EWF A;  1XS9 D;  4QWD A;  3PO5 A;  3RRG A;  4MFA A;  1TK0 A;  3PR4 A;  1K1Q A;  1ZQD A;  1MIW A;  4LT6 A;  3EPI A;  2W9C B;  3FDS A;  5IIL A;  2I9G A;  5DGB A;  7ICN A;  2JZB A;  4DFM A;  5J29 A;  3V72 A;  1TAQ A;  4X0A A;  5KG3 A;  5HHH A;  2JEJ A;  1B43 A;  3UPQ A;  2FMS A;  1B22 A;  3MGH A;  2PBE A;  3JPT A;  4DOC A;  4PGQ A;  4F4Z A;  4DSL A;  1JAJ A;  3OV7 A;  3RH6 A;  4RUA A;  3HWT A;  1ZQR A;  3ORY A;  5KG0 A;  1S0M A;  4IG8 A;  1ZQI A;  1D8L A;  3TAN A;  9ICP A;  4WC5 A;  4WC7 A;  8ICI A;  2RDJ A;  4B9M A;  2ZHB A;  2DVI A;  5HMM A;  4XUS A;  9ICF A;  4IQT A;  2F1J A;  4GXI A;  1QSS A;  5KFP A;  3E2E A;  7ICO A;  1MIV A;  7ICM A;  2HHQ A;  1X9W A;  1SKS A;  8ICG A;  5HHI A;  1NJX A;  4RPX A;  4I2G A;  1NZP A;  2V9W A;  2XY5 A;  5CR0 A;  5IIN A;  9ICJ A;  5HRF A;  1BNP A;  2ZJ8 A;  4F5O A;  2LYH A;  4E8F A;  3EZ5 A;  3PW4 A;  4DL5 A;  4J9P A;  4YN4 A;  4E7X A;  3RH5 A;  4M0A A;  1KFT A;  1ZQS A;  1KSP A;  2ZTE A;  2KZZ A;  2M2V A;  5HRL A;  4PGY A;  4DOB A;  1EXN A;  4TQR A;  1QLN A;  1IM4 A;  3V7K A;  3MFI A;  1RYS A;  3RR7 A;  4YMN A;  4WC4 A;  4QZH A;  2GWS A;  1DGS A;  4B9N A;  4ECU A;  5D4B A;  2AQ0 A;  1ZQK A;  7ICU A;  2V4R A;  1QSL A;  3RJE A;  5HML A;  4IQW A;  1H38 A;  3Q8L A;  3OUY A;  4JUZ A;  9ICA A;  1PX5 A;  1T3N A;  4RQ8 A;  3ZDE A;  5J0T A;  1BPY A;  3V6H A;  2BCS A;  3C5F A;  5J2H A;  4KLO A;  9ICB A;  1Y88 A;  4WCW A;  4P4P A;  1KEJ A;  5IIO A;  4R66 A;  3V6J A;  1NKC A;  1KFS A;  4B9L A;  3UPS A;  2VA8 A;  5CP2 A;  9ICW A;  5KFK A;  2I1Q A;  3BQ1 A;  1FA0 A;  2PFQ A;  4ELT A;  4M9N A;  5HRI A;  1K1S A;  4QZB A;  3PVX A;  1D8Y A;  4C8O A;  2W9C A;  1S77 D;  2NRX A;  3MR5 A;  9ICL A;  5DG9 A;  1LV5 A;  7ICV A;  1U45 A;  2AGP A;  7ICF A;  2BCV A;  3GII A;  3RB4 A;  4O3Q A;  3GDX A;  1T8E A;  4RPY A;  3C23 A;  8ICE A;  4M9L A;  4KLE A;  4DL6 A;  2AGQ A;  3UXP A;  3PV8 A;  3LK9 A;  1KRP A;  8ICC A;  2FLN A;  4DF4 A;  1WCL A;  1YLQ A;  4P4O A;  4GC7 A;  4ZH4 A;  1NK7 A;  4JK1 A;  4S3N A;  4RQ7 A;  5L1I A;  4YXM A;  3TI0 A;  2VA3 A;  4DSI A;  4NKT A;  4QZA A;  1X2I A;  4K4H A;  4UD5 A;  4KIT B;  5CJ7 A;  2R8K A;  1RPL A;  4B9S A;  2F1H A;  2XCP A;  3NGD A;  1XO1 A;  8ICB A;  2XGP A;  4M5D A;  9ICT A;  5KFJ A;  3KHR A;  4ECQ A;  3RJK A;  4RT3 A;  2ZJ5 A;  1ZQB A;  4WC2 A;  4EYH B;  3RTV A;  4UB1 A;  1S10 A;  2J6S A;  5DQH A;  1BVS A;  5KFM A;  3OJS A;  5J0W A;  1NKB A;  2HHU A;  1MSW D;  2KP7 A;  4C8M A;  7ICE A;  2ZH8 A;  3WFO A;  4ECT A;  4DS5 A;  4DFJ A;  3MAB A;  2AQ4 A;  4WBZ A;  1XWL A;  3N97 B;  5HRB A;  3H4D A;  4I2A A;  1ZQE A;  2Q66 A;  3RAX A;  3HIY A;  4DL7 A;  1RXV A;  2ISO A;  1BPB A;  1ZJM A;  4EBE A;  4O5K A;  5J2B A;  4RQ5 A;  3OGU A;  5DQI A;  1XC9 A;  5L1L A;  4AT7 B;  4E80 A;  3RR8 A;  4KLJ A;  8ICM A;  9ICE A;  2BE3 A;  2DPI A;  3QE9 Y;  5KT6 A;  4M9H A;  8ICW A;  5BOL A;  4IRK A;  5EWG A;  2BCU A;  2NRT A;  4IQV A;  5J0O A;  2IMW P;  4YR2 A;  5DB8 A;  2BPF A;  9ICI A;  3H8S A;  2AU0 A;  3H8J A;  2VA2 A;  5KT5 A;  2R8J A;  4RQ1 A;  2P6R A;  1CEZ A;  4RNN A;  4UQG A;  7ICT A;  4DL3 A;  3G6V A;  8ICP A;  4RWQ A;  4XRH A;  1T4G A;  3ZD9 A;  1KDH A;  1ZET A;  5KT7 A;  4KLM A;  1XSP A;  4QZI A;  5KG1 A;  4DFP A;  2BPG A;  9ICM A;  1NK5 A;  4F5Q A;  3RH4 A;  3BDP A;  3C66 A;  5DDM A;  3RAQ A;  2KN7 A;  5DG7 A;  1ZQV A;  1ZQO A;  4CCH A;  1JXL A;  2A1J B;  4I27 A;  4RQ0 A;  9ICQ A;  2XCA A;  4UAY A;  4FS1 A;  2JEF A;  4I28 A;  3V7L A;  3EYZ A;  2IHN A;  1X9M A;  2XY7 A;  4YD1 A;  2PFP A;  3RJF A;  5DED A;  3OJU A;  5KFD A;  4YMO A;  1NK4 A;  3PX0 A;  2BCQ A;  1D9F A;  4I2C A;  2BKE A;  4Q8F A;  3BQ0 A;  5DB6 A;  2W9B B;  1U4B A;  3TQ1 A;  4FHV A;  1Z3E B;  1UET A;  5BPC A;  2ASJ A;  3PMN A;  4IRD A;  1TK5 A;  3LDA A;  4B9V A;  3TFS A;  2BHN A;  2XGQ A;  5DBA A;  4NLK A;  2HHS A;  1Q78 A;  3T5K A;  2ZH1 A;  2O5A A;  8ICL A;  1U48 A;  8ICU A;  3RJJ A;  4EP7 A;  4MEY A;  3WFR E;  3RB6 A;  4M47 A;  1T7P A;  1UEU A;  4RU9 A;  4I2D A;  4O3P A;  5DB9 A;  4QZF A;  3Q8P B;  3ISC A;  4GC6 A;  1KNY A;  1R8B A;  1ZQX A;  4DF8 A;  4KLH A;  5KFR A;  4ECV A;  4KMU A;  5KT4 A;  3MDC A;  5HC9 A;  3JPO A;  2C2R A;  1U49 A;  2PXI A;  2HHX A;  2M2W A;  1C7Y A;  4LZD A;  3GV8 B;  4WC1 A;  4AT7 A;  4ECS A;  5DQG A;  1BNO A;  3MGI A;  5DB7 A;  3GV5 B;  5KFB A;  3HJ1 A;  1NK0 A;  4RWO A;  1U47 A;  2HVH A;  3N4M B;  3M9O B;  5BOM A;  3TAR A;  1JMS A;  4Z6E A;  4ED3 A;  5IIM A;  2JEG A;  3QZ7 A;  3KHH A;  3AUO A;  1KFD A;  3RBD A;  5KFO A;  4C8K A;  1ZQC A;  4ED6 A;  4EZ9 A;  7ICQ A;  4WC3 A;  3GQC A;  3SV3 A;  9ICS A;  2ZH9 A;  4KLU A;  2VAN A;  1WCN A;  1TFR A;  1ZQG A;  3AQN A;  4ED8 A;  5KTQ A;  2BCR A;  2XO7 A;  4R8U B;  1ZQP A;  3H39 A;  1SKW A;  5J2A A;  4G3I A;  1MQ2 A;  5D46 A;  3H38 A;  1V9P A;  5J0R A;  4X4P A;  4F4Y A;  8ICR A;  3PW0 A;  9ICR A;  7ICS A;  4O9M A;  2A1J A;  4PHP A;  2ASD A;  4XQ8 A;  3Q8R B;  3PML A; 
#chains in the Genus database with same CATH topology
 1ZD5 A;  1L7O A;  4WBY A;  2DKX A;  4DQS A;  4QZ9 A;  4HYK A;  1S0O A;  4O69 A;  5GTH U;  5J0S A;  5ALU A;  1WYG A;  3KZX A;  1NKE A;  3D2N A;  4I29 A;  4GXK A;  3HT3 A;  2KJ5 A;  4IL6 U;  5C0Y A;  3AQM A;  4JMU A;  2EAN A;  3K75 D;  4KLF A;  4X4O A;  4PHD A;  4NXZ A;  2ZIX A;  3IG5 A;  4QNL A;  4EEL A;  1ZRM A;  2H3V A;  3NKU A;  4KTQ A;  1IXR A;  3QU5 A;  4TUS A;  1PK1 A;  3HP6 A;  3KHG A;  7ICG A;  4WC0 A;  5D49 A;  1CI4 A;  2KKP A;  2ZUC A;  5DDY A;  1X40 A;  4UB3 A;  1QSY A;  1N2X A;  4AP9 A;  3A0H U;  2BR0 A;  1L7P A;  3H7I A;  3OPX A;  1BPZ A;  1WUD A;  2B21 A;  3LWM A;  4NV0 A;  1V4A A;  2F77 X;  2KK0 A;  4FO6 A;  1ZQH A;  5CFU A;  1XSN A;  4JV2 A;  3M6Z A;  3BZK A;  4Q8E A;  1QCK A;  4RWN A;  1COO A;  3HKZ C;  2HOQ A;  3B0X A;  3DDH A;  2ZIV A;  3IG8 A;  3PHZ A;  4JV1 A;  3QEA Z;  1JQR A;  3RBE A;  1X9X A;  3WKE A;  2ALZ A;  3ZDB A;  5JU5 A;  4OD0 A;  4QZD A;  5CB1 A;  3NRW A;  1UT5 A;  2PFO A;  1KTQ A;  4C4S A;  4DSK A;  2WAQ F;  1X66 A;  1UHU A;  5AM2 A;  3WK9 A;  3UXO A;  3MR6 A;  3ISD A;  7ICR A;  1WWV A;  1KLN A;  3C2L A;  3SAG A;  4MKP A;  5CWR A;  3OHB A;  3QZ8 A;  2HCF A;  5DLF A;  2W9A A;  3H4B A;  3JPP A;  2J6U A;  1QQ6 A;  2BPC A;  3PX6 A;  5KFS A;  4O67 A;  4RQ2 A;  3ER8 C;  3GFK B;  1XSL A;  2E8M A;  2ZH3 A;  4FBT A;  3H37 A;  1X9S A;  1PVP A;  2UVV A;  2DKZ A;  3SR6 A;  1SWV A;  1NK8 A;  4EYI B;  1Z00 A;  3ZD8 A;  4KLS A;  5AK6 A;  1ZQW A;  2C28 A;  5L9X A;  1ZJN A;  4ELV A;  4CRX A;  1SKR A;  5ALW A;  3RFA A;  4FZN A;  1PVR A;  3AU2 A;  3ETR A;  2K4I A;  3LQC B;  4UAZ A;  2F44 A;  2QAR B;  4OJO A;  4M04 A;  2E3T A;  4XQ7 A;  4QZE A;  4QIW C;  3OWG A;  3HX0 A;  4UBB A;  4X4V A;  3IHQ B;  4RUC A;  3SEN A;  3RRH A;  4BXO B;  2VJ4 A;  9ICK A;  3T79 A;  1N56 A;  3UMG A;  5AIA A;  2K4P A;  3MBY A;  1YT3 A;  4FFD A;  9ICN A;  3HPO A;  1TVA A;  4FO1 A;  4U6P A;  2ZH5 A;  2RFF A;  3C2M A;  1N5X A;  5KFC A;  1N63 A;  2ESE A;  4EX7 A;  2G06 A;  4EEY A;  2CRX A;  1F5A A;  3PW2 A;  2AJQ A;  3ALR A;  2DF4 B;  4C0Z A;  2YN4 A;  5KT3 A;  4UAU A;  5KG4 A;  4EBC A;  1C20 A;  5EE9 A;  4Y2V A;  4J9Q A;  2FLP A;  3H3A A;  2DR8 A;  1L3S A;  3FYH A;  4ECZ A;  3GIL A;  3KZI U;  3QUB A;  4F4W A;  3HW8 A;  2KTQ A;  5HRG A;  3C29 A;  4ED7 A;  1SV0 A;  5KFN A;  4OAG A;  2BDU A;  4TQS A;  4O6A A;  4ED2 A;  4F93 B;  5F9L A;  5TZV A;  5J2I A;  5J0U A;  2DPJ A;  1D8B A;  3EUB 2;  3TAP A;  2JZB B;  2XY6 A;  4NLZ A;  1ZQF A;  4F5N A;  5ALO A;  4AT9 A;  1RYR A;  4M6W A;  3C28 A;  1N61 A;  4RNM A;  2E8P A;  4K4I A;  3HJ4 A;  1NK9 A;  3PSI A;  2ZH7 A;  3SV4 A;  4YG2 A;  4K97 A;  3SAH A;  4DLE A;  3EPG A;  2JGA A;  3ED5 A;  2LBO A;  4X0B A;  4QW9 A;  2UVR A;  3FAH A;  3G6X A;  5AM5 A;  1VJ7 A;  2Y0S F;  2XVT A;  4NM1 A;  3G6Y A;  2C2E A;  4F4K A;  4ICA A;  3FC4 A;  3F2B A;  3O0F A;  5C5J A;  4YFK A;  2WF8 A;  3RRG A;  4QWD A;  1ZQD A;  1MIW A;  4IC9 A;  3EPI A;  5IIL A;  7ICN A;  4DFM A;  3V72 A;  2KSO B;  4RQN A;  3H8M A;  5HHH A;  3UPQ A;  4EGW A;  3MGH A;  3JPT A;  1FFV A;  3RH6 A;  2K89 A;  1F5S A;  5CHE A;  1S0M A;  1ZQI A;  5KNI A;  1O03 A;  9ICP A;  4FE3 A;  8ICI A;  2DVI A;  3F53 A;  1JI7 A;  4K99 A;  4XUS A;  9ICF A;  4GXI A;  7ICO A;  5ALN A;  2HHQ A;  1NJX A;  4I2G A;  1IIP A;  2EZZ A;  9ICJ A;  2FDR A;  2ZJ8 A;  4F5O A;  4E8F A;  4EV6 A;  3PW4 A;  3QU9 A;  2BZF A;  4J9P A;  2EAO A;  4E7X A;  3RH5 A;  4M0A A;  1ZQS A;  2ZTE A;  5ALF A;  1QLN A;  4TQR A;  1IM4 A;  4YMN A;  3UMB A;  2KVS A;  3NUQ A;  2AH5 A;  4ECU A;  5D4B A;  2AQ0 A;  2V4R A;  3RJE A;  3Q8L A;  3NS1 A;  3R9K A;  5J0T A;  4ATB A;  4KLO A;  3V6J A;  1KEJ A;  2DL0 A;  5IIO A;  1RM6 C;  2OCE A;  4FZM A;  1FA0 A;  1S77 D;  3KKA A;  2H3I A;  1MN8 A;  3QXG A;  3N7S C;  4C4R A;  2FLN A;  1YLQ A;  1A0P A;  2K8A A;  4NKT A;  4K4H A;  4KIT B;  5CJ7 A;  2R8K A;  4B9S A;  4CGZ A;  8ICB A;  4M5D A;  2G09 A;  4ECQ A;  3IDW A;  3M6K A;  1X6I A;  3NVW A;  1NKB A;  2KP7 A;  4Y2T A;  4C8M A;  7ICE A;  4DFJ A;  2AQ4 A;  4WBZ A;  1XWL A;  5HRB A;  2LM4 A;  3WKA A;  3H4D A;  5ALS A;  3M1Y A;  3RAX A;  3HIY A;  1RXV A;  3WU2 U;  3QNM A;  1T3Q A;  5J2B A;  4RQ5 A;  5DQI A;  1XC9 A;  5L1L A;  4AT7 B;  4E80 A;  3AQF A;  3NVY A;  4F71 A;  5KL8 B;  2A3V A;  5EWG A;  4IRK A;  2BCU A;  3HIL A;  5DB8 A;  3H8S A;  5AM4 A;  2R8J A;  4RQ1 A;  1KN5 A;  1KDH A;  5KT7 A;  1FIQ A;  4QZI A;  2BPG A;  9ICM A;  1NK5 A;  1RYU A;  5DDM A;  1L8O A;  3RAQ A;  5DG7 A;  1ZQO A;  4RQ0 A;  2XCA A;  4UAY A;  3QU7 A;  1S5L U;  2QB1 A;  5DED A;  2BCQ A;  5CFS A;  4AYB F;  4Q8F A;  3BQ0 A;  4O3M A;  4DCC A;  4IRD A;  3LDA A;  4PL1 A;  5ALY A;  2GLE A;  2WF6 A;  3A0B U;  3T5K A;  2I6X A;  8ICL A;  8ICU A;  2KKV A;  1NZB A;  2L5Y A;  4ECV A;  3EF2 A;  3JPO A;  1ED1 A;  3NAS A;  5KAI U;  2HHX A;  2RRD A;  4LZD A;  5ALQ A;  2DUY A;  3GV8 B;  4WC1 A;  1BNO A;  2R18 A;  2WF5 A;  1SV0 C;  2KE7 A;  1RG6 A;  5ALR A;  1SB3 C;  3DEE A;  2KHV A;  2JMG A;  4PJ0 U;  2BCR A;  2HN2 A;  2XO7 A;  5J2A A;  5D46 A;  3CK6 A;  5J0R A;  4X4P A;  4F4Y A;  9ICR A;  3PW0 A;  4O9M A;  3PX4 A;  3BQT A;  4XQ8 A;  1Z19 A;  3C18 A;  8ICX A;  2J6T A;  3MGV A;  5KFL A;  2HHW A;  3EWA A;  4LZG A;  5KFX A;  2G0A A;  4O3O A;  7ICP A;  2P6U A;  4I2E A;  2ZTD A;  3PO4 A;  1VDV A;  2W3S A;  2BQU A;  4I2F A;  5KAF U;  3UQ2 A;  4FHX A;  1CRX A;  4FH3 A;  5J2K A;  8ICN A;  1Z1B A;  5HP4 A;  1QTM A;  3KD3 A;  3UQ0 A;  3JPQ A;  3UM9 A;  2W8L A;  4JWM A;  4AT8 B;  1FEZ A;  4P0Q B;  3WKB A;  5B3P A;  3ZDA A;  3QU4 A;  4KN4 A;  4R8U A;  4DL2 A;  3CRX A;  4PHE A;  2ID1 A;  1PVQ A;  2ZH4 A;  2GO7 A;  2FMP A;  4NWI A;  2Q0Z X;  4OCZ A;  4GLX A;  3H40 A;  3PSF A;  1UEV A;  4B9T A;  4Z6F A;  4EBK A;  2LM1 A;  2W8K A;  1JX4 A;  2DR7 A;  1P7D A;  4UB6 U;  3F2D A;  1R8A A;  4PH5 A;  1L3V A;  8ICY A;  2YTU A;  4J9K A;  3JYY A;  2BGW A;  5J0P A;  3AU6 A;  4UB5 A;  4NXW A;  2H3Q A;  4M9G A;  4X4U A;  4X4N A;  2FI1 A;  4RPZ A;  5B66 U;  1ZQM A;  3KKA C;  4IR1 A;  3M8R A;  3F5A A;  4X4S A;  1HUZ A;  2DR5 A;  5DBC A;  2AGO A;  5L1K A;  2NRZ A;  2CPR A;  1F0M A;  3E0F A;  4CF3 A;  5KFU A;  4GIB A;  4ECY A;  3BS5 A;  2KHQ A;  5K4L A;  3JCF A;  4Y2J A;  2R8I A;  4YMM A;  4DQQ A;  3T3F A;  4N7R A;  2EWR A;  4P4M A;  1AQ6 A;  5ALH A;  4R65 A;  5F2V O;  2MRL A;  4BUG A;  3THV A;  1DOQ A;  2LMR A;  2Y9T A;  5KFA A;  4K98 A;  4O3S A;  1Q46 A;  4Y2R A;  4Y2X A;  2ZIU B;  2HBL A;  2YMM A;  3QUQ A;  3C21 A;  4EEN A;  1TKD A;  5CA7 A;  4FH5 A;  2KIV A;  2PMZ F;  2H3F A;  4WQK A;  5B3Q A;  4NLC A;  4P0P B;  1NO5 A;  2P66 A;  4WJ3 B;  3AQL A;  8ICO A;  3UXN A;  1OUQ A;  4RWP A;  4MEX A;  1XU4 A;  1TV9 A;  4J9R A;  1L3T A;  7ICH A;  3N7P D;  4IRC A;  1SL2 A;  4ECR A;  2MU2 A;  2M2T A;  1UPH A;  2QB0 B;  4C4T A;  1ZYQ A;  4O3R A;  2E8N A;  2MUT B;  2HI0 A;  4DQI A;  2Y1J A;  4GXJ A;  2BQR A;  3AN1 A;  2Y9U A;  2W9M A;  1HJP A;  3GIM A;  5HNK A;  2LI6 A;  3RF9 A;  3IM1 A;  4QZC A;  2EQY A;  2Z7J A;  5CHG A;  4TUQ A;  3PNC A;  5J8Y C;  5J2D A;  2C2D A;  3ZDC A;  3BQ7 A;  4DLG A;  3VCB A;  3SI8 A;  4QWC A;  4J9N A;  4KB6 A;  4Z6D A;  4NXX A;  5KFT A;  4O5C A;  1Q79 A;  2ODG A;  2GOL A;  4O0I A;  2WTF A;  3UMC A;  7ICJ A;  2FCL A;  4TUP A;  4DQR A;  3KHL A;  4BWJ A;  2G5I B;  5KFE A;  4YCX A;  3MR3 A;  4E0D A;  2ZUB A;  4O5E A;  4USA A;  5J2J A;  1NJY A;  2WF7 A;  1OU5 A;  3RB0 A;  4EZ6 A;  2FMQ A;  2IHM A;  5KG6 A;  1JRP A;  3ETL A;  3PR5 B;  5III A;  3L9D A;  4J9L A;  4KLT A;  1NJW A;  3K4G A;  3T5J A;  5AHX A;  2EH9 A;  1XS9 D;  3PO5 A;  4Y2Q A;  1B22 A;  4PGQ A;  1JAJ A;  3OV7 A;  4RUA A;  5D61 A;  2P35 A;  3ORY A;  5KG0 A;  4EEB A;  1D8L A;  3TAN A;  4WC5 A;  4WC7 A;  2RDJ A;  2NO5 A;  5HMM A;  4IQT A;  2K4H A;  4CNQ A;  7ICM A;  1SKS A;  2V9W A;  2XY5 A;  4NL9 A;  3EZ5 A;  4LEW A;  2YX8 A;  1UQV A;  4YN4 A;  5CRX A;  3LVV A;  2KZZ A;  2M2V A;  4PGY A;  4DOB A;  1EXN A;  3RR7 A;  3PZP A;  4B9N A;  7ICU A;  1H38 A;  3OUY A;  9ICA A;  4WC2 A;  4RQ8 A;  1BPY A;  2BCS A;  3C5F A;  1SGG A;  1Y88 A;  1KFS A;  4R66 A;  4B9L A;  5CP2 A;  3BQ1 A;  2PFQ A;  5HRI A;  4QZB A;  4C8O A;  2ZIW A;  2W9C A;  2NRX A;  9ICL A;  2F8K A;  5DG9 A;  1LV5 A;  3GII A;  8ICE A;  4O3Q A;  5AI6 A;  4KLE A;  1HEK A;  3PV8 A;  3LK9 A;  8ICC A;  4DF4 A;  5GTI U;  1M6Y A;  4ZH4 A;  4WOY A;  4JK1 A;  2K8C B;  3SEI A;  2IOF A;  4DSI A;  5JTI A;  4UD5 A;  1RPL A;  2XCP A;  2JHD A;  1XO1 A;  2XGP A;  9ICT A;  3RJK A;  1IG6 A;  3WK8 A;  1ZQB A;  2LPE A;  1S10 A;  5DQH A;  3IP4 B;  1MSW D;  2CXY A;  3H0R B;  4UAS A;  4DS5 A;  3MAB A;  5D63 A;  5G5H A;  1XNS A;  2GH1 A;  3GU3 A;  1ZQE A;  4XJE A;  2YQE A;  4NXV A;  4KLJ A;  2BE3 A;  2Q4T A;  4JLZ A;  3QE9 Y;  1ZXI A;  5KT6 A;  4M9H A;  2XID A;  2QKQ A;  5J0O A;  2IMW P;  4YR2 A;  2BPF A;  9ICI A;  4NXU A;  3H8J A;  2VA2 A;  5KT5 A;  2B6G A;  2P6R A;  4B6J A;  4RNN A;  4UQG A;  5AIB A;  4LEV A;  1N62 A;  1T4G A;  3LYS A;  4XRH A;  5FP0 A;  4DFP A;  3BDP A;  2KN7 A;  2YB1 A;  1ZQV A;  1OXJ A;  3CP8 A;  3D2S A;  5KL1 B;  4FS1 A;  2JEF A;  5EE1 A;  3V7L A;  3EYZ A;  2LYA A;  2IHN A;  4YMO A;  3PX0 A;  2BKE A;  1L7N A;  3IRU A;  1Z3E B;  3TFS A;  2XGQ A;  2HHS A;  4US8 A;  1ZD2 P;  4EP7 A;  4MEY A;  3WFR E;  1UEU A;  1ZQX A;  2HSZ A;  5KFR A;  4KMU A;  3MDC A;  1C7Y A;  2IOH A;  4RQM A;  5DQG A;  3KOO A;  1KL9 A;  5HR7 A;  2ZIX B;  3ICX A;  3MGI A;  1OW5 A;  5KFB A;  4RWO A;  2KEY A;  2HVH A;  2W7P A;  1PK1 B;  3TAR A;  1JMS A;  4ED3 A;  2JEG A;  3KFU F;  2HHT A;  1ZQC A;  3GQC A;  2ZH9 A;  3TKA A;  2K60 A;  4C7Z A;  1WCN A;  3AQN A;  3NVV A;  4US9 A;  1MQ2 A;  2A1J A;  2O6K A;  2EDU A;  5HRL A;  2LKY A;  2IBK A;  2FPK A;  3JPS A;  1MC8 A;  3BQ2 A;  1PUZ A;  1RZT A;  9ICH A;  2CN1 A;  2JH7 A;  3V7J A;  5KFY A;  1MIY A;  2H3Z A;  2W9B A;  2C22 A;  1Q3V A;  1KW4 A;  1SV4 A;  5IIJ A;  3EW9 A;  2ZIV B;  5KFF A;  3WFS C;  2EZY A;  4UAR A;  4KLL A;  2KZ3 A;  2KZM A;  5AM0 A;  2KJ8 A;  1SL1 A;  4HAI A;  5KFQ A;  5DBB A;  4DSF A;  3QEB Z;  1U9L A;  2HHP A;  2MSN A;  1NNL A;  1MQ3 A;  4KX5 A;  1RQN A;  2JRZ A;  3H0M B;  3WK5 A;  5E79 U;  1LKY A;  4QZG A;  4TUR A;  4YXJ A;  2ZTC A;  3MFH A;  4I2J A;  1JN3 A;  1R89 A;  3QYP A;  2B56 A;  1S97 A;  8ICA A;  1JXE A;  1S0V A;  1ZQQ A;  7ICK A;  1COK A;  4K4G A;  3PST A;  2G5H B;  5HRE A;  1UA1 A;  4MF2 A;  8ICJ A;  1QQ5 A;  1LVH A;  1NK6 A;  4F5P A;  3K7D A;  1R8C A;  4X4R A;  3RJH A;  2DR9 A;  3T5H A;  4NLG A;  2VJ5 A;  1CUK A;  4NJ8 A;  2BQ3 A;  4ED1 A;  1Z00 B;  5T14 A;  3M9N B;  2RDI A;  4NL9 C;  5J2E A;  1Q3U A;  3I1Y A;  1TFY A;  3LVW A;  1FFU A;  4Q45 A;  4M9J A;  4EBD A;  1BPX A;  4F2S A;  1WG8 A;  3WFP A;  3NVZ A;  5L1J A;  1URJ A;  2HOF A;  1ZQT A;  3N7R C;  2ZH6 A;  3WKC A;  4XA5 A;  3H8W A;  2YY6 A;  3TAC B;  2BBJ A;  4RQ3 A;  1FO4 A;  4FHW A;  4YP3 A;  4IR9 A;  3OVA A;  1RDF A;  5AI9 A;  2NYV A;  5KFG A;  5AKJ A;  1IV8 A;  4PL2 A;  1ZD4 A;  2B0C A;  1ARO P;  2Y0S C;  1DXS A;  2WB1 F;  2YML A;  4KLQ A;  1ZQY A;  2FPL A;  4DEZ A;  2W43 A;  4GFJ A;  4RT2 A;  4RQ4 A;  1VJ5 A;  5ALJ A;  1BPE A;  1NJZ A;  3JPR A;  3C1Z A;  2ZUD A;  1LB2 B;  3Q8Q B;  4PZO A;  5KFZ A;  4QWE A;  1ZQJ A;  2YMQ A;  5AKH A;  5B5E U;  3SZ2 A;  3WKD A;  4KLG A;  4X4T A;  4QWB A;  9ICC A;  4ELU A;  1N48 A;  4AT9 B;  2KFZ A;  2QLT A;  5AK4 A;  2ASL A;  4M6W B;  8ICT A;  4DQP A;  4X4Q A;  1HUO A;  3SYZ A;  3ZI4 A;  2DRA A;  2DFL A;  1ECW A;  2UVW A;  3OSN A;  4PPX A;  1UA0 A;  5HRD A;  5EOZ A;  4JV0 A;  3JPN A;  5IIK A;  5AKK A;  1S9F A;  2B51 A;  3AQE A;  5J2C A;  2KIW A;  5DEC A;  1MA7 A;  3Q8S B;  1A6S A;  1PK3 A;  4KN7 A;  3QUT A;  2OM6 A;  4FS2 A;  4YR0 A;  3HKZ F;  5ALM A;  2ISP A;  3TFR A;  2FLL A;  4QWA A;  3RB3 A;  4FHP A;  3SD7 A;  2HHV A;  2QAR A;  3LWL A;  1ZQA A;  4IQU A;  2GA9 D;  5DGA A;  2DBY A;  4BXO A;  5DLG A;  2KD1 A;  4UBC A;  1WWU A;  4YQW A;  3MDA A;  2G08 A;  3T5L A;  3OSP A;  5AKX A;  1S8O A;  2XI9 A;  4MF8 A;  5KFH A;  4WH5 A;  4LEY A;  5L1M A;  3KTQ A;  5ALE A;  4BDP A;  9ICG A;  4HX0 A;  2R8H A;  1ZQZ A;  2O1P A;  4PZN A;  4G9B A;  5AKY A;  8ICF A;  4IS7 A;  4J9O A;  4ECW A;  3OVB A;  5H2F U;  4OAH A;  2FE9 A;  2D6F C;  5JUM A;  1SWW A;  4M2Y A;  5HR6 A;  1GO3 F;  5KT2 A;  2KG5 A;  1L5U A;  2MAX A;  1TAU A;  4PGX A;  4EEK A;  1NI3 A;  1WOT A;  4F3O A;  1SZP A;  5HR9 A;  3ISB A;  1KBU A;  4ATB B;  2DGZ A;  8ICV A;  2W03 A;  4ECX A;  5EWF A;  4LT6 A;  3PR4 A;  2I9G A;  2JZB A;  1ZRN A;  3QU2 A;  3GZF A;  3AEV A;  1RQL A;  5KG3 A;  2JEJ A;  4Y2U A;  1B43 A;  2FMS A;  2PBE A;  4EED A;  4AYB C;  4DOC A;  1X6J A;  4QIW F;  4F4Z A;  5EE3 A;  4UAT A;  3HWT A;  4OO1 J;  3E58 A;  2ZHB A;  4J03 A;  1QSS A;  3E2E A;  8ICG A;  1TE2 A;  4RPX A;  1YZ6 A;  5CR0 A;  5IIN A;  5HRF A;  4DL5 A;  3HRD D;  1KSP A;  2DWQ A;  5ALI A;  3AL0 B;  1RYS A;  2GWS A;  1DGS A;  3B9J A;  1V85 A;  4IQW A;  5ALP A;  5HML A;  4JUZ A;  3D6J A;  1PX5 A;  1T3N A;  3ZDE A;  2F8L A;  5J2H A;  4WCW A;  4WC3 A;  4P4P A;  9ICW A;  5KFK A;  1J97 A;  2K8B B;  1DGJ A;  4ELT A;  4CF4 A;  2KSO A;  2AGP A;  2W7O A;  3RB4 A;  1T8E A;  4RPY A;  4M9L A;  2KIC A;  4DL6 A;  4P4O A;  2KOB A;  4C7Y A;  1NK7 A;  3SMV A;  4YXM A;  3TI0 A;  2VA3 A;  4QZA A;  1X2I A;  2W04 A;  3NGD A;  4EX6 A;  2IOF K;  3KHR A;  4BJQ A;  3RTV A;  2J6S A;  5KFM A;  2HHU A;  2DRB A;  1JAL A;  3SAF A;  4ECT A;  3H0L B;  5AK3 A;  4OJ5 A;  4I2A A;  1SXE A;  2Q66 A;  4DL7 A;  3HJE A;  1ZJM A;  4EBE A;  1DRG A;  2EAM A;  3OGU A;  4A8E A;  3RR8 A;  2DPI A;  1Q8K A;  4OAI Z;  8ICW A;  4KMO B;  5BOL A;  2NRT A;  4IQV A;  4U7C A;  5AK5 A;  1J2N A;  4DL3 A;  4RWQ A;  1L7M A;  1ZET A;  1XSP A;  5KG1 A;  4F5Q A;  3RH4 A;  3PSP A;  9ICQ A;  1KQQ A;  4I28 A;  3RJF A;  1X9M A;  2XY7 A;  2PFP A;  1D9F A;  1NK4 A;  3L3F X;  5DB6 A;  1U4B A;  5ALT A;  1UET A;  5BPC A;  2ASJ A;  3PMN A;  2IHO A;  2HDO A;  1TK5 A;  4B9V A;  2BHN A;  4NLK A;  2ZH1 A;  2O5A A;  3RJJ A;  3RB6 A;  4M47 A;  4I2D A;  5DB9 A;  3ISC A;  4GC6 A;  1KNY A;  4DF8 A;  3TAD A;  5KT4 A;  2OEH A;  4AT7 A;  3CYM A;  5DB7 A;  3GV5 B;  5ALX A;  3HJ1 A;  1U47 A;  2E8O A;  5BOM A;  4EZ9 A;  3AUO A;  1KFD A;  3RBD A;  5KFO A;  3ERC C;  4ED6 A;  7ICQ A;  1J2M A;  3BS7 A;  5AM3 A;  3SV3 A;  9ICS A;  4KLU A;  2VAN A;  4ED8 A;  5KTQ A;  4R8U B;  2KV2 A;  3H39 A;  1XO0 A;  1SKW A;  3H38 A;  1V9P A;  8ICR A;  7ICS A;  4PHP A;  3K1Z A;  3Q8R B;  3PML A;  1VLB A;  4RNO A;  2ZH2 A;  5J0Q A;  3M8S A;  1GPJ A;  2V4Q A;  1SIJ A;  4F8R A;  4RQ6 A;  9ICX A;  4R63 A;  2KFN A;  2KNJ A;  3PY8 A;  2F2A B;  5ALK A;  4NY8 A;  3M9M B;  4F92 B;  2H5X A;  2HMX A;  7ICI A;  4PHA A;  4I2H A;  3JZ0 A;  4LVS A;  5TIS U;  1JIH A;  5HRK A;  4I0U A;  3AQK A;  2YB4 A;  2ZXH A;  4UAV A;  4DSE A;  5KG2 A;  2PMZ C;  2M9N A;  1VFG A;  2EZX A;  4UAW A;  2HVI A;  4J9S A;  3QUC A;  4YR3 A;  4I2I A;  2JEI A;  1Z4N A;  4P2H A;  4Q43 A;  2BDP A;  5DKW A;  5KG5 A;  4NM2 A;  4F2R A;  4RZR A;  5J0Y A;  4C8N A;  2RHF A;  4DWI A;  1ZQN A;  4DOA A;  2OWO A;  2HOI A;  4WC6 A;  4C8L A;  9ICU A;  5AIC A;  1A77 A;  2WFA A;  3BS5 B;  4MFC A;  2XIC A;  3NTU A;  1BPD A;  2W11 A;  4X5V A;  3WFQ E;  4R64 A;  2HBK A;  2W3R A;  3V6K A;  1SL0 A;  2VIX A;  3DV9 A;  4KX3 A;  4ACO A;  4F50 A;  4DFK A;  3WK7 A;  1UT8 A;  5AKE A;  2BBH A;  2ATL A;  8ICS A;  1S76 D;  3F5E A;  2ES6 A;  1ZQL A;  1TK8 A;  4AT8 A;  2LYB A;  4KM5 A;  4F5R A;  4K9A A;  5J2F A;  4P0Q A;  4NKU A;  1JUD A;  1BGX T;  3GV7 B;  9ICO A;  2NRW A;  5EE0 A;  1D9D A;  3CW2 C;  3OHA A;  2WAQ C;  9ICV A;  2E1E A;  5KFV A;  3NWI A;  4I2B A;  4JWN A;  3GIK A;  2D3D A;  3Q8M A;  1B4F A;  1DK2 A;  3NVO A;  2KJ9 A;  4DL4 A;  2IUB A;  4DFD A;  3BJY A;  4MFF A;  1YZ7 A;  2B4V A;  3FM9 A;  2OXO A;  5EWE A;  3ZDD A;  2ZJA A;  2IA6 A;  3TAQ A;  3CNH A;  3RJG A;  2G07 A;  4K8V A;  2F3N A;  2KMD A;  4Q44 A;  4DO9 A;  2A1A A;  4LEZ A;  4Z6C A;  3ER9 B;  2FPM A;  1KKX A;  4ED0 A;  4CE6 A;  2NRV A;  4UB4 A;  5KG7 A;  2AHO B;  3I28 A;  2M2U A;  1NOM A;  8ICQ A;  2VKQ A;  2NV3 A;  3MR2 A;  1PZN A;  2OYY A;  4QZ8 A;  1TFW A;  2ASD A;  5DG8 A;  2DQN B;  1RXW A;  1ZOL A;  4ZOH C;  1DK3 A;  4FHY A;  4DSJ A;  2R8G A;  3VC8 A;  4F4X A;  2PI5 A;  4FBU A;  4F72 A;  8ICK A;  2NRK A;  5J0X A;  1JRO A;  2ZHA A;  4UB2 A;  2UVU A;  3PW7 A;  8ICH A;  4YD2 A;  2AXT U;  5J2G A;  3K1R B;  4K9B A;  4KLD A;  3C1Y A;  2LHT A;  2HBM A;  4QW8 A;  3U26 A;  3TAD C;  3NRZ A;  3Q8K A;  5F9N A;  4OJ6 A;  7ICL A;  4EBJ A;  5A0L A;  1Z1V A;  1F44 A;  3GIJ A;  1B0X A;  4Y2Y A;  3RJI A;  2JR5 A;  4J9M A;  1L3U A;  1T94 A;  4B9U A;  4KLI A;  5HRH A;  2Y1I A;  3BZC A;  3J81 j;  1N60 A;  2RP5 A;  5KFW A;  4NLN A;  3IV6 A;  3F2C A;  1S0N A;  2ZIU A;  4BGD A;  2HN1 A;  4WQL A;  5AI4 A;  2HW3 A;  3NYB A;  4O3N A;  1L8L A;  2NO4 A;  3PW5 A;  4F91 B;  5AI0 A;  2I5H A;  4P0P A;  8ICZ A;  3C2K A;  1UCV A;  2GAF D;  4YVZ A;  4CDG A;  3QX7 A;  4UD4 A;  3L5K A;  2PFN A;  4BWM A;  3OVS A;  2PI4 A;  3C5G A;  1SXD A;  2F1I A;  3WK6 A;  2XC9 A;  1A76 A;  1ZQU A;  3B0Y A;  5KFI A;  5ALL A;  4BX9 C;  2QB0 A;  4DS4 A;  2JXJ A;  3OUY B;  2YMP A;  1L6N A;  4CF5 A;  2MUT A;  4OJP A;  4MFA A;  1TK0 A;  2RLT A;  1K1Q A;  2ZIW B;  2W9C B;  3FDS A;  5DGB A;  5J29 A;  5AKG A;  1TAQ A;  1ZD3 A;  2OH2 A;  4X0A A;  1ZQ1 C;  4NXT A;  5JRT A;  4DSL A;  4QJF B;  2WF9 A;  1ZQR A;  4IG8 A;  5CEH A;  2KVC A;  5JTG A;  4UB8 U;  4B9M A;  2F1J A;  1MIV A;  5KFP A;  4JB3 A;  1X9W A;  5HHI A;  5ALV A;  1NZP A;  2E5S A;  5J8Y A;  1BNP A;  2LYH A;  3SQI A;  1KFT A;  4FZL A;  3V7K A;  3MFI A;  4WC4 A;  1K5O A;  4QZH A;  5AM1 A;  1ZQK A;  1QSL A;  2FJ6 A;  7ICV A;  3V6H A;  9ICB A;  5ALZ A;  1NKC A;  3UPS A;  2VA8 A;  3KBB A;  2I1Q A;  2ZXI A;  4M9N A;  1K1S A;  1D8Y A;  3PVX A;  3MR5 A;  3N28 A;  2F76 X;  2PKE A;  3M7D A;  1U45 A;  7ICF A;  5AI8 A;  2BCV A;  3GDX A;  3C23 A;  3D2Q A;  2AGQ A;  3IN5 A;  3UXP A;  1KRP A;  5AI5 A;  1WCL A;  4GC7 A;  3AMZ A;  1TAM A;  4S3N A;  4RQ7 A;  5L1I A;  2JH1 A;  5G5G A;  2F1H A;  2JV3 A;  5KFJ A;  4RT3 A;  2ZJ5 A;  3MCR A;  4EYH B;  4UB1 A;  3OJS A;  1BVS A;  5J0W A;  2ZH8 A;  4OJL A;  3WFO A;  3N97 B;  2M0N A;  2ISO A;  1BPB A;  4O5K A;  2W55 A;  8ICM A;  9ICE A;  3AM9 A;  4LJX A;  4C80 A;  2AU0 A;  5D62 A;  3OTQ A;  1CEZ A;  7ICT A;  8ICP A;  3G6V A;  3ZD9 A;  5ALG A;  3MC1 A;  4KLM A;  2K4E A;  2WHE A;  1O08 A;  3C66 A;  4CCH A;  1JXL A;  2A1J B;  4I27 A;  1QQ7 A;  5CFT A;  5AKI A;  2RQ5 A;  4YD1 A;  3OJU A;  2A19 A;  3I76 A;  5KFD A;  4I2C A;  4Y2P A;  3S6J A;  2W9B B;  3L4P A;  3TQ1 A;  4FHV A;  4MHV A;  4JLX A;  5DBA A;  1Q78 A;  3WK4 A;  1U48 A;  1T7P A;  2W54 A;  4RU9 A;  4QZF A;  4O3P A;  2HBJ A;  3Q8P B;  3ONN A;  1R8B A;  4KLH A;  2E1F A;  4K96 A;  1X42 A;  5HC9 A;  2OHF A;  4UW9 A;  2C2R A;  1U49 A;  2PXI A;  2M2W A;  2MA1 A;  1V97 A;  4ECS A;  4OAF A;  5F3X B;  1NK0 A;  3N4M B;  4O68 A;  5AKL A;  3M9O B;  2N1R A;  1LKY B;  4Z6E A;  1QH9 A;  5IIM A;  4C8K A;  3QZ7 A;  3KHH A;  5ALD A;  1SZH A;  1HIW A;  2EAP A;  1TFR A;  2ZG6 A;  1ZQG A;  2WB1 C;  4Y2S A;  1ZQP A;  5AKZ A;  4G3I A;  1V38 A;  4NLB A;  1N5W A;  1Z4O A;  2D8C A; 
#chains in the Genus database with same CATH homology
 2IBK A;  4WBY A;  4RNO A;  3C18 A;  2FPK A;  4DQS A;  3JPS A;  8ICX A;  1MC8 A;  2ZH2 A;  3BQ2 A;  4QZ9 A;  2J6T A;  1RZT A;  5KFL A;  9ICH A;  3V7J A;  2HHW A;  4HYK A;  1S0O A;  3EWA A;  5KFY A;  2C22 A;  5KFX A;  2W9B A;  4LZG A;  5J0S A;  1MIY A;  1NKE A;  4O3O A;  5IIJ A;  5J0Q A;  7ICP A;  3M8S A;  4I29 A;  3EW9 A;  2P6U A;  2V4Q A;  5KFF A;  3WFS C;  4GXK A;  4F8R A;  4I2E A;  2ZTD A;  3PO4 A;  2BQU A;  4RQ6 A;  3HT3 A;  9ICX A;  4I2F A;  4R63 A;  2KFN A;  4KLL A;  2KZ3 A;  3UQ2 A;  2KZM A;  4FHX A;  3PY8 A;  3AQM A;  4FH3 A;  5J2K A;  4NY8 A;  1SL1 A;  3M9M B;  3K75 D;  4KLF A;  4F92 B;  8ICN A;  5KFQ A;  5DBB A;  4DSF A;  2H5X A;  5HP4 A;  1QTM A;  4X4O A;  4PHD A;  7ICI A;  3QEB Z;  4PHA A;  4I2H A;  4NXZ A;  3UQ0 A;  1U9L A;  4LVS A;  2HHP A;  3JZ0 A;  3JPQ A;  1JIH A;  1MQ3 A;  5HRK A;  2W8L A;  4JWM A;  4KTQ A;  1IXR A;  4AT8 B;  4TUS A;  3AQK A;  3HP6 A;  4QZG A;  3KHG A;  7ICG A;  4WC0 A;  4DSE A;  5D49 A;  5KG2 A;  2ZUC A;  4TUR A;  5DDY A;  4UB3 A;  3ZDA A;  2M9N A;  1QSY A;  4YXJ A;  2ZTC A;  3MFH A;  1VFG A;  4KN4 A;  4I2J A;  1JN3 A;  4UAW A;  2BR0 A;  2HVI A;  1R89 A;  4R8U A;  4DL2 A;  1S97 A;  4J9S A;  1JXE A;  3H7I A;  4PHE A;  1BPZ A;  1S0V A;  4YR3 A;  8ICA A;  1ZQQ A;  7ICK A;  2B21 A;  4I2I A;  3LWM A;  2JEI A;  4P2H A;  2ID1 A;  4Q43 A;  2BDP A;  4K4G A;  2ZH4 A;  5DKW A;  1UA1 A;  2FMP A;  5HRE A;  1V4A A;  4MF2 A;  8ICJ A;  2Q0Z X;  4GLX A;  4FO6 A;  1ZQH A;  1NK6 A;  1XSN A;  3H40 A;  3PX4 A;  4F5P A;  4JV2 A;  5KG5 A;  4NM2 A;  4F2R A;  4RZR A;  5J0Y A;  4C8N A;  4DWI A;  4Q8E A;  1R8C A;  1UEV A;  4RWN A;  3BQT A;  1COO A;  1ZQN A;  3RJH A;  4DOA A;  4X4R A;  2OWO A;  4WC6 A;  2DR9 A;  3T5H A;  4B9T A;  4Z6F A;  3B0X A;  4C8L A;  4NLG A;  9ICU A;  1A77 A;  1CUK A;  4EBK A;  4MFC A;  3NTU A;  1BPD A;  2W8K A;  4X5V A;  2BQ3 A;  1JX4 A;  2DR7 A;  4ED1 A;  1Z00 B;  3QEA Z;  4JV1 A;  4R64 A;  3M9N B;  2RDI A;  5J2E A;  1JQR A;  3RBE A;  1R8A A;  3V6K A;  1TFY A;  2ALZ A;  4PH5 A;  1SL0 A;  3ZDB A;  1L3V A;  4Q45 A;  4F50 A;  8ICY A;  4DFK A;  4J9K A;  4EBD A;  1BPX A;  4M9J A;  4F2S A;  3JYY A;  1UT8 A;  4QZD A;  2BGW A;  5J0P A;  2ATL A;  8ICS A;  5CB1 A;  3AU6 A;  3WFP A;  1S76 D;  4UB5 A;  1UT5 A;  2PFO A;  1KTQ A;  4DSK A;  4M9G A;  5L1J A;  1ZQL A;  1TK8 A;  4X4U A;  4AT8 A;  4X4N A;  4RPZ A;  3MR6 A;  3UXO A;  4F5R A;  3ISD A;  7ICR A;  5J2F A;  1ZQT A;  2ZH6 A;  4NKU A;  1BGX T;  1ZQM A;  4XA5 A;  3GV7 B;  1KLN A;  3H8W A;  3C2L A;  9ICO A;  2NRW A;  4RQ3 A;  5CWR A;  3OHB A;  2DRB A;  4IR1 A;  4FHW A;  4YP3 A;  3QZ8 A;  1D9D A;  4IR9 A;  5DLF A;  2W9A A;  3M8R A;  3OVA A;  3H4B A;  3JPP A;  2J6U A;  5KFG A;  2BPC A;  3PX6 A;  4X4S A;  3OHA A;  5KFS A;  1HUZ A;  2DR5 A;  5DBC A;  9ICV A;  5KFV A;  1ARO P;  4I2B A;  4RQ2 A;  4JWN A;  3GIK A;  3GFK B;  3Q8M A;  4ATB A;  1XSL A;  4KLQ A;  2AGO A;  5L1K A;  1DK2 A;  2ZH3 A;  4DL4 A;  1ZQY A;  2FPL A;  2NRZ A;  4DEZ A;  4FBT A;  3H37 A;  4RT2 A;  4RQ4 A;  1X9S A;  5KFU A;  3BJY A;  4MFF A;  2UVV A;  5EWE A;  3ZDD A;  4ECY A;  2ZJA A;  2IA6 A;  3TAQ A;  3RJG A;  1NK8 A;  4EYI B;  1BPE A;  1Z00 A;  3ZD8 A;  2R8I A;  4KLS A;  4YMM A;  1ZQW A;  4Q44 A;  4DO9 A;  4DQQ A;  3T3F A;  5L9X A;  2C28 A;  1NJZ A;  1ZJN A;  4Z6C A;  3JPR A;  4ELV A;  4P4M A;  1SKR A;  5F2V O;  4R65 A;  3C1Z A;  2FPM A;  2ZUD A;  3AU2 A;  1LB2 B;  4ED0 A;  3Q8Q B;  3LQC B;  4UAZ A;  3THV A;  1DOQ A;  2NRV A;  5KFZ A;  4UB4 A;  4M04 A;  4QWE A;  4XQ7 A;  4QZE A;  5KG7 A;  5KFA A;  1ZQJ A;  3SZ2 A;  3HX0 A;  4UBB A;  4X4V A;  3IHQ B;  4RUC A;  3RRH A;  2M2U A;  4KLG A;  4BXO B;  4O3S A;  1NOM A;  4QWB A;  8ICQ A;  9ICK A;  4X4T A;  9ICC A;  4ELU A;  1N48 A;  4AT9 B;  3MR2 A;  1N56 A;  1PZN A;  2ASL A;  2KFZ A;  4M6W B;  4QZ8 A;  4DQP A;  8ICT A;  4X4Q A;  1HUO A;  3SYZ A;  1TFW A;  5DG8 A;  2DRA A;  2DFL A;  3C21 A;  3OSN A;  1RXW A;  2UVW A;  4PPX A;  1UA0 A;  1TKD A;  3MBY A;  5CA7 A;  9ICN A;  5HRD A;  1DK3 A;  5EOZ A;  4FH5 A;  4JV0 A;  4DSJ A;  2R8G A;  3HPO A;  2HHT A;  4FHY A;  1TVA A;  4F4X A;  2ZH5 A;  2PI5 A;  3JPN A;  2RFF A;  3C2M A;  5IIK A;  4FBU A;  5KFC A;  1S9F A;  8ICK A;  1NO5 A;  2NRK A;  5J0X A;  2P66 A;  2ZHA A;  4UB2 A;  2UVU A;  3AQL A;  8ICO A;  4EEY A;  5J2C A;  3PW7 A;  1F5A A;  3UXN A;  3PW2 A;  5DEC A;  2AJQ A;  8ICH A;  5KT3 A;  3Q8S B;  4YD2 A;  5KG4 A;  4EBC A;  4RWP A;  4MEX A;  1XU4 A;  4KN7 A;  4J9Q A;  2FLP A;  3H3A A;  5J2G A;  1TV9 A;  2DR8 A;  4J9R A;  1L3S A;  3FYH A;  1L3T A;  4FS2 A;  4YR0 A;  4ECZ A;  7ICH A;  4IRC A;  3GIL A;  4F4W A;  3HW8 A;  1SL2 A;  3C1Y A;  4KLD A;  4ECR A;  2KTQ A;  5HRG A;  2M2T A;  2ISP A;  3TFR A;  4ED7 A;  4QW8 A;  1ZYQ A;  5KFN A;  2FLL A;  4QWA A;  3Q8K A;  5F9N A;  7ICL A;  4EBJ A;  4TQS A;  3RB3 A;  4O3R A;  4FHP A;  2HHV A;  2MUT B;  4ED2 A;  4F93 B;  4DQI A;  5F9L A;  2Y1J A;  5TZV A;  3LWL A;  5J2I A;  5J0U A;  2DPJ A;  3GIJ A;  4GXJ A;  3TAP A;  2BQR A;  1ZQA A;  2JZB B;  3RJI A;  2XY6 A;  2W9M A;  1HJP A;  4IQU A;  3GIM A;  4J9M A;  1L3U A;  4NLZ A;  5HNK A;  5DGA A;  4F5N A;  1ZQF A;  4B9U A;  5DLG A;  4BXO A;  4KLI A;  5HRH A;  2Y1I A;  3IM1 A;  4YQW A;  4UBC A;  4QZC A;  1RYR A;  4AT9 A;  3MDA A;  4M6W A;  5KFW A;  5CHG A;  4TUQ A;  3PNC A;  3T5L A;  4NLN A;  3OSP A;  5J2D A;  2C2D A;  1S0N A;  4BGD A;  4RNM A;  3ZDC A;  4DLG A;  4K4I A;  4MF8 A;  2HW3 A;  5KFH A;  3NYB A;  3HJ4 A;  1NK9 A;  4O3N A;  3KTQ A;  3SI8 A;  2ZH7 A;  4QWC A;  4J9N A;  3SV4 A;  3PW5 A;  4YG2 A;  2R8H A;  1ZQZ A;  4Z6D A;  4F91 B;  4BDP A;  9ICG A;  5KFT A;  2O1P A;  4DLE A;  4O5C A;  3EPG A;  1Q79 A;  8ICZ A;  8ICF A;  3C2K A;  3WFQ E;  4J9O A;  4ECW A;  3OVB A;  4YVZ A;  4X0B A;  4O0I A;  4QW9 A;  2WTF A;  4UD4 A;  2UVR A;  7ICJ A;  5JUM A;  3G6X A;  2PFN A;  4BWM A;  4TUP A;  4DQR A;  1VJ7 A;  3OVS A;  2PI4 A;  3KHL A;  4BWJ A;  5KFE A;  3C5G A;  4YCX A;  3MR3 A;  4M2Y A;  4E0D A;  2ZUB A;  4O5E A;  5J2J A;  2F1I A;  5KT2 A;  1NJY A;  4NM1 A;  1OU5 A;  2XC9 A;  1A76 A;  1ZQU A;  3B0Y A;  3RB0 A;  1L5U A;  4EZ6 A;  2FMQ A;  5KFI A;  2MAX A;  1TAU A;  4PGX A;  3G6Y A;  5KG6 A;  2IHM A;  3ETL A;  2C2E A;  4F4K A;  3PR5 B;  1WOT A;  4DS4 A;  5III A;  3L9D A;  4F3O A;  3OUY B;  1SZP A;  4J9L A;  3ISB A;  5C5J A;  4KLT A;  1NJW A;  5HR9 A;  3K4G A;  3T5J A;  4ATB B;  4YFK A;  2MUT A;  8ICV A;  4ECX A;  5EWF A;  1XS9 D;  4QWD A;  3PO5 A;  3RRG A;  4MFA A;  1TK0 A;  3PR4 A;  1K1Q A;  1ZQD A;  1MIW A;  4LT6 A;  3EPI A;  2W9C B;  3FDS A;  5IIL A;  2I9G A;  5DGB A;  7ICN A;  2JZB A;  4DFM A;  5J29 A;  3V72 A;  1TAQ A;  4X0A A;  5KG3 A;  5HHH A;  2JEJ A;  1B43 A;  3UPQ A;  2FMS A;  1B22 A;  3MGH A;  2PBE A;  3JPT A;  4DOC A;  4PGQ A;  4F4Z A;  4DSL A;  1JAJ A;  3OV7 A;  3RH6 A;  4RUA A;  3HWT A;  1ZQR A;  3ORY A;  5KG0 A;  1S0M A;  4IG8 A;  1ZQI A;  1D8L A;  3TAN A;  9ICP A;  4WC5 A;  4WC7 A;  8ICI A;  2RDJ A;  4B9M A;  2ZHB A;  2DVI A;  5HMM A;  4XUS A;  9ICF A;  4IQT A;  2F1J A;  4GXI A;  1QSS A;  5KFP A;  3E2E A;  7ICO A;  1MIV A;  7ICM A;  2HHQ A;  1X9W A;  1SKS A;  8ICG A;  5HHI A;  1NJX A;  4RPX A;  4I2G A;  1NZP A;  2V9W A;  2XY5 A;  5CR0 A;  5IIN A;  9ICJ A;  5HRF A;  1BNP A;  2ZJ8 A;  4F5O A;  2LYH A;  4E8F A;  3EZ5 A;  3PW4 A;  4DL5 A;  4J9P A;  4YN4 A;  4E7X A;  3RH5 A;  4M0A A;  1KFT A;  1ZQS A;  1KSP A;  2ZTE A;  2KZZ A;  2M2V A;  5HRL A;  4PGY A;  4DOB A;  1EXN A;  4TQR A;  1QLN A;  1IM4 A;  3V7K A;  3MFI A;  1RYS A;  3RR7 A;  4YMN A;  4WC4 A;  4QZH A;  2GWS A;  1DGS A;  4B9N A;  4ECU A;  5D4B A;  2AQ0 A;  1ZQK A;  7ICU A;  2V4R A;  1QSL A;  3RJE A;  5HML A;  4IQW A;  1H38 A;  3Q8L A;  3OUY A;  4JUZ A;  9ICA A;  1PX5 A;  1T3N A;  4RQ8 A;  3ZDE A;  5J0T A;  1BPY A;  3V6H A;  2BCS A;  3C5F A;  5J2H A;  4KLO A;  9ICB A;  1Y88 A;  4WCW A;  4P4P A;  1KEJ A;  5IIO A;  4R66 A;  3V6J A;  1NKC A;  1KFS A;  4B9L A;  3UPS A;  2VA8 A;  5CP2 A;  9ICW A;  5KFK A;  2I1Q A;  3BQ1 A;  1FA0 A;  2PFQ A;  4ELT A;  4M9N A;  5HRI A;  1K1S A;  4QZB A;  3PVX A;  1D8Y A;  4C8O A;  2W9C A;  1S77 D;  2NRX A;  3MR5 A;  9ICL A;  5DG9 A;  1LV5 A;  7ICV A;  1U45 A;  2AGP A;  7ICF A;  2BCV A;  3GII A;  3RB4 A;  4O3Q A;  3GDX A;  1T8E A;  4RPY A;  3C23 A;  8ICE A;  4M9L A;  4KLE A;  4DL6 A;  2AGQ A;  3UXP A;  3PV8 A;  3LK9 A;  1KRP A;  8ICC A;  2FLN A;  4DF4 A;  1WCL A;  1YLQ A;  4P4O A;  4GC7 A;  4ZH4 A;  1NK7 A;  4JK1 A;  4S3N A;  4RQ7 A;  5L1I A;  4YXM A;  3TI0 A;  2VA3 A;  4DSI A;  4NKT A;  4QZA A;  1X2I A;  4K4H A;  4UD5 A;  4KIT B;  5CJ7 A;  2R8K A;  1RPL A;  4B9S A;  2F1H A;  2XCP A;  3NGD A;  1XO1 A;  8ICB A;  2XGP A;  4M5D A;  9ICT A;  5KFJ A;  3KHR A;  4ECQ A;  3RJK A;  4RT3 A;  2ZJ5 A;  1ZQB A;  4WC2 A;  4EYH B;  3RTV A;  4UB1 A;  1S10 A;  2J6S A;  5DQH A;  1BVS A;  5KFM A;  3OJS A;  5J0W A;  1NKB A;  2HHU A;  1MSW D;  2KP7 A;  4C8M A;  7ICE A;  2ZH8 A;  3WFO A;  4ECT A;  4DS5 A;  4DFJ A;  3MAB A;  2AQ4 A;  4WBZ A;  1XWL A;  3N97 B;  5HRB A;  3H4D A;  4I2A A;  1ZQE A;  2Q66 A;  3RAX A;  3HIY A;  4DL7 A;  1RXV A;  2ISO A;  1BPB A;  1ZJM A;  4EBE A;  4O5K A;  5J2B A;  4RQ5 A;  3OGU A;  5DQI A;  1XC9 A;  5L1L A;  4AT7 B;  4E80 A;  3RR8 A;  4KLJ A;  8ICM A;  9ICE A;  2BE3 A;  2DPI A;  3QE9 Y;  5KT6 A;  4M9H A;  8ICW A;  5BOL A;  4IRK A;  5EWG A;  2BCU A;  2NRT A;  4IQV A;  5J0O A;  2IMW P;  4YR2 A;  5DB8 A;  2BPF A;  9ICI A;  3H8S A;  2AU0 A;  3H8J A;  2VA2 A;  5KT5 A;  2R8J A;  4RQ1 A;  2P6R A;  1CEZ A;  4RNN A;  4UQG A;  7ICT A;  4DL3 A;  3G6V A;  8ICP A;  4RWQ A;  4XRH A;  1T4G A;  3ZD9 A;  1KDH A;  1ZET A;  5KT7 A;  4KLM A;  1XSP A;  4QZI A;  5KG1 A;  4DFP A;  2BPG A;  9ICM A;  1NK5 A;  4F5Q A;  3RH4 A;  3BDP A;  3C66 A;  5DDM A;  3RAQ A;  2KN7 A;  5DG7 A;  1ZQV A;  1ZQO A;  4CCH A;  1JXL A;  2A1J B;  4I27 A;  4RQ0 A;  9ICQ A;  2XCA A;  4UAY A;  4FS1 A;  2JEF A;  4I28 A;  3V7L A;  3EYZ A;  2IHN A;  1X9M A;  2XY7 A;  4YD1 A;  2PFP A;  3RJF A;  5DED A;  3OJU A;  5KFD A;  4YMO A;  1NK4 A;  3PX0 A;  2BCQ A;  1D9F A;  4I2C A;  2BKE A;  4Q8F A;  3BQ0 A;  5DB6 A;  2W9B B;  1U4B A;  3TQ1 A;  4FHV A;  1Z3E B;  1UET A;  5BPC A;  2ASJ A;  3PMN A;  4IRD A;  1TK5 A;  3LDA A;  4B9V A;  3TFS A;  2BHN A;  2XGQ A;  5DBA A;  4NLK A;  2HHS A;  1Q78 A;  3T5K A;  2ZH1 A;  2O5A A;  8ICL A;  1U48 A;  8ICU A;  3RJJ A;  4EP7 A;  4MEY A;  3WFR E;  3RB6 A;  4M47 A;  1T7P A;  1UEU A;  4RU9 A;  4I2D A;  4O3P A;  5DB9 A;  4QZF A;  3Q8P B;  3ISC A;  4GC6 A;  1KNY A;  1R8B A;  1ZQX A;  4DF8 A;  4KLH A;  5KFR A;  4ECV A;  4KMU A;  5KT4 A;  3MDC A;  5HC9 A;  3JPO A;  2C2R A;  1U49 A;  2PXI A;  2HHX A;  2M2W A;  1C7Y A;  4LZD A;  3GV8 B;  4WC1 A;  4AT7 A;  4ECS A;  5DQG A;  1BNO A;  3MGI A;  5DB7 A;  3GV5 B;  5KFB A;  3HJ1 A;  1NK0 A;  4RWO A;  1U47 A;  2HVH A;  3N4M B;  3M9O B;  5BOM A;  3TAR A;  1JMS A;  4Z6E A;  4ED3 A;  5IIM A;  2JEG A;  3QZ7 A;  3KHH A;  3AUO A;  1KFD A;  3RBD A;  5KFO A;  4C8K A;  1ZQC A;  4ED6 A;  4EZ9 A;  7ICQ A;  4WC3 A;  3GQC A;  3SV3 A;  9ICS A;  2ZH9 A;  4KLU A;  2VAN A;  1WCN A;  1TFR A;  1ZQG A;  3AQN A;  4ED8 A;  5KTQ A;  2BCR A;  2XO7 A;  4R8U B;  1ZQP A;  3H39 A;  1SKW A;  5J2A A;  4G3I A;  1MQ2 A;  5D46 A;  3H38 A;  1V9P A;  5J0R A;  4X4P A;  4F4Y A;  8ICR A;  3PW0 A;  9ICR A;  7ICS A;  4O9M A;  2A1J A;  4PHP A;  2ASD A;  4XQ8 A;  3Q8R B;  3PML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...