4MFHA

Crystal structure of m121g azurin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALGKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Copper-sulfenate complex from oxidation of a cavity mutant of Pseudomonas aeruginosa azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4mfhA00
1AACA 3NSDA 1ASQA 3SBPA 1IBZA 2Q5BA 1J9RA 1X9UA 1AZRA 4DP9X 1AS8A 1BEXA 1QNIA 4HIPA 3NP4A 3EF4A 3NJMA 3X1BA 1J5CA 4QLWA 5B7EA 2OV0A 2FJSA 3EH3B 3NJGA 4HHWA 1AOZA 3DIVA 4UF7C 4GXFA 2I7SA 1AZBA 4G72B 1A4BA 1W8EA 2HX7A 3EHBB 2UX7A 4M4RB 4A2EA 2P80D 2XV2A 6PCYA 1TU2A 4DP4X 3QJRB 1NPNA 4G71B 2J5WA 1ZPUA 1SFDA 3IE9A 4GP4B 5D4HA 4E9XA 1L9SA 5B1KA 1IC0A 1A4CA 2XV0A 1AZUA 2W88A 5B1BB 3AW5A 3S3BB 1JERA 3FSZA 4HHGA 4JHUA 5LDUA 4MFHA 1MZYA 1ID2A 2XUWA 5B3SB 1NICA 4YSRA 2WSDA 2IWFA 4JHVA 5EHFA 4W1TA 2PPCA 1A3ZA 4Q89A 1L9OA 4DPBX 1JXFA 2HX8A 4UAHA 4E9RA 1MDAA 1SHWA 3T6ZA 5A7EA 4EF3A 5PAZA 2BWIA 3ZIYA 2YQBA 2I85A 2VSMB 4PAZA 3AZUA 1GS7A 2W8CA 3ASOB 4N4YB 2PP8A 6PAZA 5FC9A 2YXWA 1PLAA 1KBWA 1NIAA 3FYEB 3JTBA 1I53A 3S3DB 1MG2C 1NIDA 2X88A 3NJFA 1GS8A 1WA2X 2JXMA 1E30A 3V9EA 1KCBA 3TU6A 2UXFA 4TXVB 1IKOP 4YSCA 3UABA 3QJQB 3OD3A 4M3HA 1ZV2A 1PLBA 3DKHA 4KOCA 4YSQA 1URIA 1E67A 2EIKB 1JZJA 2YAPA 2PPAA 4G7RB 1GY2A 1PNDA 2FQFA 1MG3C 1A4AA 3BVDB 2PCYA 1PMYA 2XYBA 3PAUA 1V55B 2N0MA 1NWPA 4A2FA 5I5IA 4E9QA 5I6LA 5I26A 3S8GB 1ILSA 4F2FA 4YSUA 3UGEA 4BK5C 1OF0A 3GXUB 3FSWA 1V10A 3T6WA 2IH8A 2OJ1A 4DP8X 2AANA 3ABGA 3CDZA 4BXSV 3FQ1A 2YXVA 2IDUA 2HRHA 3NSCA 3GDCA 2GSMB 2DWTA 1A8ZA 4YSOA 3UACA 1FFTB 1OE1A 4BXVA 3PAVA 2XXGA 2FNWA 1PNCA 2VSKB 2OCCB 3CZUB 1AAJA 4Q8BA 1SHXA 2PPEA 4E9TA 1AS6A 3GYRA 4ZK8A 5B7FA 1KGYE 1FWXA 4DP0X 1ETJA 3FQYA 1AANA 3WG7B 3IEAA 1W6WA 3QJSB 4GP8B 4NAJA 1XB8A 2Q9OA 1ZIAA 1OCZB 4HCGA 3H4FA 3X1FA 3FSVA 2EINB 1E65A 4QKTA 3WNIA 4P5SA 3T6XA 3NJIA 1HAUA 9PCYA 3DTUB 2MRYA 3U25A 2CAKA 4DPCX 3C75A 2H47C 1ASPA 4A2GA 5I6PA 3NJKA 2BP0B 3HEIB 3IBOA 1BYOA 1CUOA 1XB6A 1L9RA 1NWOA 1OE3A 3ASNB 2YAEA 2DY2A 1RZQA 1KYAA 1GS6X 4HAKA 4AX3A 2DWSA 3CDZB 4KO6A 4E9YA 4WTQA 3HB3B 3EH5B 1MZZA 1TEGA 1E5ZA 4KNSA 2VW7A 3ZDWA 3T9WA 4DP5X 2PPFA 1FA4A 1JZFA 2ZXWB 2BW4A 3TA4D 1AZCA 3FPXA 2J55A 1XB3A 1ILUA 1WA1X 1GY1A 1NINA 4GYBA 2H5UA 1NZRA 2FT8A 4AZUA 1JZHA 2P80A 2PP7A 2VMJA 4G70B 4WKXA 2CUAA 4DP7X 3L45A 2GC7C 4FA7B 3WNJA 2R7EA 4HCIA 1PCSA 4DP1X 1PZAA 1ZDSA 5I28A 2IAAC 3ZBMA 3FPYA 8PAZA 2ZONA 4YVUA 1M56B 2ZWNA 3NJLA 1RKRA 2J56A 1AZNA 2XLLA 2GC4C 4YSEA 2HRGA 4DPAX 2UXGA 3ABMB 4HCFA 1V54B 3OMAB 1PZBA 2IDQA 1VLXA 4A2DA 1EZLA 2DV6A 2IWEA 4KO5A 4YSDA 4CSZA 2YAFA 3UADA 1CYXA 3FT0A 1NIBA 3FU9A 5F7AA 2BWDA 1BXUA 3FYIB 3H4HA 4AKQA 1N68A 2XU9A 3UAAA 4KNUA 3X2QB 2PLTA 1GYCA 1ET5A 2VW6A 4X4KA 4N8UA 1OCOB 4A2HA 2VM3A 2HLEB 1SF5A 5AKRA 3PXLA 2BP0A 2BZCA 3S3CB 5I6OA 1J9QA 1ZDQA 5I5MA 1PAZA 4BWTA 1BXAA 3FQ2A 2LLNA 1IUZA 1X9RA 5D4JA 3PAZA 4KO9A 3SBRA 1NIFA 3FSAA 3QJVB 4BDVA 3WIAA 2AZUA 3TBBA 4G7QB 4DP2X 1SFHA 2B3IA 1OCRB 2FT6A 2GHZA 2IH9A 4K9JA 2TSAA 2CBPA 1SF3A 2HXAA 3OMIB 5IY5B 2R7EB 2AVFA 2YAQA 4JKNA 5TK2A 2YAHA 2CCWA 3QPKA 1JZIA 2IWKA 2UXVA 3EH4B 2JFCA 2PCFA 5TK4A 1CYWA 1KDJA 3IN0A 2NRDA 1AG0A 5B1JA 2CJ3A 4AI7A 1SDDB 1RCYA 4DP6X 2YARA 2BO0A 5B7MA 3G5WA 3NYKA 4CSPA 5B1JC 2AZAA 4W9ZA 7PCYA 1GW0A 1ADWA 2QT6A 1AG6A 3OMNB 3AG1B 2PP9A 1BXVA 3QJUB 2GBAA 1R1CA 4E9WA 1BQRA 2TSBA 2A3TA 1QLEB 4A68A 1RZPA 3SBQA 1WA0X 2VM4A 2DYSB 2BP8B 1NPJA 3ERXA 3TBCA 3X1GA 1JOIA 3OQRA 1EHKB 5AZUA 1KV7A 4UANA 2CALA 4BDVB 2H3XC 2QPDB 1BQ5A 4GY4A 1PLCA 2IDTA 1XMEB 3FU7A 2BZ7A 3N55A 3NJHA 3CVCA 2WO2B 4BWWA 2EIJB 1WS8A 1QHQA 2XXFA 2XWZA 2JKWA 4HALA 3X1NA 1AR1B 3S8FB 2UXTA 1DYZA 3FS9A 3WKPA 3CVDA 2Y69B 3PCYA 5D4IA 2E86A 3TASA 3PLYA 1L9QA 2IDFA 1SJMA 4HZ1A 3H56A 3CVBA 4G7SB 1T5KA 4BWUA 1BAWA 4RH4A 1W6LA 4A67A 2J57A 4P5RA 1OCCB 1GR7A 1B3IA 2QDWA 1BQKA 1HAWA 4F7KA 4PCYA 7PAZA 3AG3B 4KNTA 1KDIA 4YSSA 2X87A 2YAOA 3ZX1A 2BHFA 1ASOA 1A65A 3WI9A 1L9TA 1UATA 3SQRA 1IBYA 1PY0A 1J9TA 3CG8A 3QJTB 3RYMA 1SDDA 2I7OA 4YSPA 3N2JA 1TEFA 1CC3A 3NT0A 1PF3A 3AY2A 4AKOA 1WS7A 3PPSA 3NJJA 1J9SA 2HZHA 1M57B 1HFUA 2XX0A 3JT2A 3AG4B 4YSAA 4AKPA 1OV8A 1PZCA 1CURA 3FU7B 3NSYA 2ZOOA 4NERA 3T6VA 1KCWA 5PCYA 3NJNA 2QDVA 1TKWA 2BP8A 3QQXA 1GSKA 2WO3B 1DZ0A 2FQEA 4YVNA 2RACA 4KO7A 1JXDA 2XV3A 4A66A 1M9WA 1ZIBA 5ANHA 5F7BA 3V9CA 5I6KA 5B1AB 3MBWB 1NIEA 4NB7A 3WKQA 4F2EA 3UAEA 3FU8A 3NSFA 4YSTA 4KOBA 3D12B 5I6MA 1NTDA 3ABLB 3NP3A 5E9NA 1OE2A 4E9VA 4YL4A 2EIMB 3KW8A 2PPDA 1JZGA 5I6NA 1ET7A 2MTAA 2BW5A 5I5JA 2GB2A 4L0PB 1JXGA 1NDTA 3OM3B 1JVLA 3X1EA 1ET8A 2XVBA 3T71A 2VN3A 2DYRB 1WAEA 1YLBB 1AQ8A 1E5YA 2YAMA 1N70A 1AS7A 1L9PA 2B08A 3ABKB 2QPEB 2FT7A 4GP5B 4ENZA 1BYPA 1AIZA 2UX6A 1OOWA 2VW4A 2GIMA 2GI0A 2AFNA 2FQDA 2FQGA 2FTAA 4FAAB 2XX1A 2EILB 3IN2A 2HX9A 1SNRA 3BQVA 2FWLB 3KW7A 5AFAA 3MX0B 1JZEA 1KBVA 1J5DA 2IDSA 4E9SA 3AG2B 2Y1AA 1F56A 1JVOA
chains in the Genus database with same CATH superfamily
1UENA 4JHAL 4JVWA 1XAUA 4ODHL 1KN4H 3N1PC 3WKYA 2APXA 4KK5C 1JHTA 4R2GB 1X6NA 2V7NA 1NCBH 3INUH 1RK0B 3QAZC 4PTUA 3VRJB 3UIZA 3ILEA 5ETUB 1J5CA 3ARFD 4OLWH 2LAAA 2XZQH 4XMLL 1KIUB 5AAMC 3MBXL 4L1LA 3FO0H 1EDYA 1TYJA 2VE6B 4WUUD 4YDLC 3WTWA 2APBA 4IEFB 4TL5A 4A04A 4FQJH 1T03H 1MLBA 2WKOA 3TZVA 2ZOUA 3BQUD 4M4RB 2BMKA 3RJDA 3D69A 4AW7A 3HI1A 5C6TL 2QGEA 4JCLA 1CVSC 4U1LB 1XGRB 3RGVC 5HHPA 3GRWA 1EPFA 1T4WA 4JFZH 5FS5A 3A6CL 4GW1B 2YA2A 4PW3A 2V37A 4HJUA 2P5EB 3VGAC 3C6EA 4OQTL 3FSZA 1XIWC 3NCCB 1DVFC 2H32B 2GTQA 3O2DA 1O0VA 4L8CB 4ZXBD 3REWB 4HIQA 1OOAA 5CJXC 3CFJA 5LBGA 1RHHB 1RUAL 3AUWB 1EXGA 3NUKA 3MA9L 3ZHDA 5CGBA 1ES0B 5JXAL 4NRXA 2BWIA 1FFRA 4A37A 2VSMB 4DEWA 1F18A 5BO1H 2B39A 4PG9A 4ZAKB 3D08A 3VFRB 5HXMA 1YDPB 4HSCX 1HILA 3WLWD 2D73A 5F6IB 1URLA 3GXPA 1IRAY 4L4VA 4GG6E 1UA6H 4IK6A 2IXQA 2WXPA 4PN6A 4YQXH 3VQ1C 2I9TA 2DIEA 1B0RA 3FAWA 3RY6A 4RGMB 1AD0B 4GO8A 1KJVB 4EN3B 3L2NA 5FCUH 1QSFA 4JFDA 3VQLA 2OMZA 4JM2A 2WLZA 3CSFA 4ONHB 4L8BB 4W9DC 3UJTL 3D06A 4KMTL 3UAFA 4PWGA 5DJ2A 1QR4A 3N43F 2FO8A 4P5KB 1KEGH 2BNRE 1MG3C 1G6VK 1D7DA 1Z3RA 3E6FA 2D4FA 4A2FA 5C0AE 2C34A 3E9UA 2AQ2A 4ZNEE 4AC4A 2EH7H 3AFLA 5ICYA 1QNZL 2FHBA 2CRIA 1EDHA 4IIQC 4UT9H 2SODB 1ZHBB 3MJ9A 5MERB 1SEBA 2YD0A 4M6MH 4MCZB 1VEOA 1YYLL 1JGUH 5DGQA 2BS8A 4BKSC 4XVUD 4ZI8A 4DO6A 1XQ4A 1ZLUH 2NUPA 2UWEE 5LB1A 2G5UA 2XRAH 5ECGA 4JFXB 3OPZL 2R39A 4QRSB 3RHWF 4IBZA 2GSMB 5C70A 1LO0H 2ZXEB 1DQML 4PGJA 2VLRD 1OP4A 3AQDA 3HS8A 3GJFK 1MCSA 3SGDI 2ZCLH 4P9HL 2B8OT 3QUZD 3W37A 4IMKC 3CPLA 3C5ZB 3QFJB 4JHBA 4Y1SA 4ENEC 1WZLA 1U8HB 3HE6A 1PYWB 1J18A 3HZ3A 4KUZL 4ZK8A 1LHZA 4HVBA 2X6BA 1KCSL 5LN4A 5D1QA 1UA7A 4ZW7A 4NPYA 4L0ZA 4Y1AD 3EYUL 3DXAB 1E3FA 4GP8B 1KJ2A 3FHQA 1GYUA 4QYOA 4CSTA 3AUVA 3H4FA 4H4NA 1BQSA 1N5YH 3VE0A 2MKWA 1GZPB 3I50L 5KUMA 2W0KA 1IB5A 3QJOA 4TTDC 4I2XB 3NJIA 2G9HA 4EUPG 5L2KA 1MOEA 1IGTB 2E56A 3C8KA 1CQYA 4J3SA 4HJGB 4WFGE 1VZIA 2H9GB 4POUB 5ACMA 4GSQA 1WE5A 5IT2H 5JHAA 1DFBL 4PJ8C 3LZQA 5GHWH 1W15A 5DHDA 3FB7B 4N0CD 4YXKH 4XNAA 3CSYB 1ZHNA 5C3LD 4MAYA 1F90H 3ETSA 4JE0A 3ZHLA 4HCRL 3TF4A 1K2DB 3LEVL 4U1IA 3NESA 2B16A 3D0LB 4HAKA 5CEYA 2EIZB 4UQEA 5K9OA 5CJ8A 4PV1C 3RVUC 4KRMB 4MA7H 4XP5L 4P4KA 1B4JH 1PZSA 3H54A 4PRHE 2CH8A 3MO1A 5D9SA 3D9AL 1WP6A 7CGTA 2ICWJ 2N0KA 4F7EA 1CR9H 1NCWH 3AJ7A 4HK3J 3OKEB 2NNXA 4P59H 3WUWA 43C9B 5GS0L 3OKYA 3B7YA 4CBZA 2YD4A 2E74C 3VFUA 5KSBF 1AZCA 2CDEB 2KPWA 4BFGA 1ZT7B 1NINA 4LFHG 1FNLA 5AWNL 3M07A 4X0KB 5J6SA 2WXMA 3O9WC 2DRUA 5GIRA 5LNEA 3VH8B 2BCKB 4I1PA 3W81A 5DRNA 3NCWA 4F9PC 2A73B 2NYKA 4Z7UB 1ECZA 2NLJA 1HZKA 5J12C 5JHDD 4TVPE 3MN8A 4HIHB 5CXPA 1OZUA 3MNWA 1D7FA 1A3LH 2OMXB 1JZ6A 4BFKA 1KBPA 2HMID 3MCKB 4Y2DA 2PUQT 4ANUA 2OMVA 4NN7C 1UTDA 1I9EA 5HSFA 2HFGH 3GB7A 4DKTA 4YSDA 3UBHA 1QRNA 4Y5VC 1ZTMA 3MACL 5AENA 1W72A 3FF8A 2F1AA 4TQPA 1Q0XL 3GMMB 4IKJA 3O3EA 1FNEB 3R1GL 4PJBE 3ZDYE 2OJZH 4KNUA 2WKLA 5SWSB 1UFUA 5TDPA 3KWWB 5G55A 4X6CB 1DVUA 2FWSA 4YO0B 4KDWA 4PM1A 1I85A 3FQ2A 3I6GA 3U7WH 5EA0L 4KJYB 3QXDA 3OKNB 1Q0YL 4ONFH 3OZ9H 4I13B 4Z77A 5CU9A 4W4OA 2VRKA 1AFVL 2C4XA 4X7SL 4I3RL 4UIKH 1SJEB 4PVLA 1CDGA 4N0FA 4UYQA 5DR5L 1FGNH 2QKIA 1BXXA 1BSIA 2DBJA 2W38A 3MFFB 5CJBA 4OCNC 1BIIA 3OMIB 1XCTB 1T7XA 3W39B 2WUBH 5I18L 2AV7B 2Z0UA 4KDTA 3DX4A 4WGKA 5DZLA 4RISH 2Y72A 1KGWA 2OYMA 4JPVL 1MWAL 4KH9A 4FQ2H 4DEUA 3O3BA 4PJFF 4Y4KB 3UYRL 1I8LC 5LGJA 5IFHL 3W38A 5FEBA 2M83A 3DHUA 4GMTL 4G6AC 3EYOB 4L3EE 5FM8A 1ZWIB 4B0MM 1QO3A 1R3LB 4KKCD 5B1JC 4CSPA 4KZDL 1OP3K 2AZAA 1GYVA 3SE8L 3HPJB 4DSYA 3AWFA 3DVGA 3DSFH 2A6JA 3MC0A 3MNMA 5E1HB 3V55A 1U3ZA 2W60A 3M46A 1JYNA 3ISYA 4UWQB 5K69A 4B41A 5I1CH 1R1CA 2CR3A 2D3JA 4LF3B 4OB5L 5I1LA 3HMXH 5FA4A 1GZHC 5DC0A 4KAQL 3KPSB 4U1KB 2VLJE 5ALBL 1O6SA 3CMOL 3V4PA 2DYPA 5DS8A 2K6WA 1CFQA 5I19H 4WI5A 3TYFA 3AS3A 1S7WB 2R29H 2HP4A 2ZG1A 1WC7A 3EO9H 3TVMD 4H5SB 4AMXA 3K8MA 5DVOA 2D31B 1E27B 4UDUA 3WU1A 2W0LA 4XPAH 2EIJB 3LPGA 3SZ6A 2VLKA 4EZMA 4W6WB 5K9JH 1DBJL 4MXQC 4B60A 4FLQA 3BT2H 1XV8A 5C09A 2FEDD 2PCXA 2Y23A 2YGPA 4NQXB 4OQ1A 1BZQK 4NQTA 3NZUA 3V0AC 2MCMA 5DMKA 2R2EA 3B83A 1RUAH 4JFHD 3L5WA 3N04A 1Q72L 2Q76A 4G7SB 1BZEA 4Z7WB 3OF6A 1Y6KR 2D7TH 1N6QH 4QRPD 5E03A 5F88A 1R3IL 3Q5TA 3WUZA 4YBHA 3D39D 4H13C 4R0LC 4N6RB 4ZFGL 2BNQB 3U1SL 3TFBA 1EK3A 4FQIL 1OEZW 1KIPB 1QRKA 4RGNB 2EXSA 3QWRA 4KZEL 3JT0A 4BKTC 3BHBA 4HMDA 4EIGB 4M93B 1EAPA 5IW1B 3CC1A 3EJSA 4WI4A 4QTFA 2XBTA 5E99H 1ASOA 2GFBB 1Z9PA 5IQOA 4K5MA 1IBYA 2IH1A 1CICC 2QVTA 3L95B 2YPVA 4J3TA 3B7TA 3BFQG 1G7JB 5D7LB 1CC3A 1CXFA 2J1XA 5CMAB 3B8YA 4WI3A 1FYTB 1HIMH 3IFNH 5E8DL 5TPWL 1WS7A 4U6XB 3RIAK 4MYPA 4WWKA 5FGCE 1RUQL 3V5KB 3C2AH 3MJ7A 2R15A 1OW0C 2HZHA 2CSPA 4KQ4H 1I3RB 4OCYL 4PS7A 2G4EA 2XX0A 3BKYL 3G6DL 1H8SA 1GVIA 2Y22A 2QFRA 5K9KB 3PHQA 3QULA 4FXKA 4CNIA 2HT4D 2Y7OA 3ARDD 3BKCH 1KG0B 3NJNA 4Q4EA 3S0PA 2ESVB 1C8PA 2YIHA 5LXVA 3CUPB 2AK4E 2P5PA 2CR6A 3PWLA 4Z76A 3OGCA 1SEQL 3ZHKA 4H1LA 2X2JA 2Q86A 2CIIB 3O2VH 1ICTA 3QUXC 5FO9B 2O5NA 5F1OB 3FCBA 2X70B 3CN3A 3LN9A 4U33A 1H3GA 1YEFL 4BH8A 4YK4B 3NVQA 5D8JL 4FMFA 3ABLB 3IETB 2R83A 3LKPB 4LCVA 3ZDXB 3K6DA 1MW1A 4P9HH 4FYSA 4RFEB 1KCRH 4CW1A 5B21A 3DUHA 3V4UH 1YNLH 4HDIB 4YFLF 3RVTD 5TTRA 3R7QA 4UQ2B 4AG4H 2BWQA 3QA3B 3BUQA 3U30C 1R5WB 2LFGA 5F9JA 3KNBA 4FTDA 4J27A 1ONQB 2WD0A 4LCWD 2ITEA 1NANH 3FKUS 1R3HB 4ENZA 4P06A 2PYEE 4TRPL 5J12B 1RK1B 1MCWM 1BPVA 3KPRD 4P57B 3WLBB 5K9QG 1VFUA 3TEYA 1H8OA 3L17A 3HZVA 3U0PB 3WJMB 2XX1A 5KS9A 3X14B 2DIJA 2VITA 4N2BA 4A7VA 1B0WA 4URKA 5IV2B 3O4LE 3LPOA 5E1AB 2CQVA 3VI4A 2DQHH 4CVZA 4LDOB 4N6QA 1HYSD 4PGDB 4U6VH 2W0FB 5F8RC 3FT4B 4NIYE 1IILE 3QIWA 4R5XA 5BS0E 3KR3L 5MHSE 1NSNH 4ZPTB 1X4YA 4P4RA 4LPXA 4ALAC 3N1MC 3T2OA 4ZTPL 1UD6A 1KTRL 3T4YA 2ICEA 3FZUD 2W92A 3I9PA 4YHZH 2NX5E 1W2KT 4YFDB 2N7SA 2FX7L 1NMBH 5IF0A 1LEGA 1QNIA 3S6CA 3QDMA 4HIPA 4Y4HC 5CR8A 2PYFA 3PGCA 5IEKA 3Q06A 3D48R 2UZPA 1Z66A 3F84A 3VM5A 3F01A 3DK2A 3Q1SL 3N1GC 1JZ2A 5H4YA 5IUCA 1L0XA 3C9NB 1IM9A 3MLRL 2VISB 1S7VA 4Y16A 3UGUA 5FECA 1PKQA 3WO4C 5IR1A 4Z7VB 4FRWA 3HS0A 5E6IA 4ELDA 4JAMB 2YD8A 2XV2A 3C6LB 4JGMA 5CFAA 1FO0L 3BVVA 4L9LC 4YEEA 4G71B 3EYQC 4K55A 4PTTB 3GWJA 1SOKA 4TLTA 4XZUB 3AWGA 4LVHC 5FW8A 1UXSA 1YC7A 4IIZA 4YHPA 4G43A 3WIHA 4A2MA 1MW0A 4L1TA 1SN5A 5JIQA 5C97A 3VFWA 1L7IL 4NKIL 3IVKB 5CHNA 2WCGA 3HC3H 4HF5L 5HD8D 1NDGB 1UXWA 3TJPA 3ULVH 1WFTA 3KVDD 4MA3A 3V5DB 3MV8E 4K3HA 3SDXF 4JO4H 4H88L 4OLUL 4X4ZA 1GGUA 2ZOKA 3L4UA 3N3EA 1DL7H 2A0LD 3MV01 3NACH 3DDGA 2AXGA 1N2RA 4MJ5A 5DJZB 4E9RA 1MDAA 3VG9C 1Q94B 4PBVC 3SHSA 2P52A 5F3BB 3TT1L 3WS3B 3ECUA 4UQAA 1BFSA 3P54A 3HKZA 1EEZA 3WFCL 4JZJA 2GITA 1N3NB 1YMMB 4XRCB 1JJUA 1L9MA 3H9SE 4XMUA 4ZMNA 1U42A 3LKOA 4A38A 1WT5C 4KXZI 4KY1H 4HOZA 2GTWB 3QWOA 3ZK0A 3TV8A 2AKRA 4NUPA 3P4NB 4ELMB 1MCHA 3FYEB 1NBQA 1GCFA 5EU3A 1TJGL 4N90D 3MCG1 3HC4L 1WA2X 4YWGH 3MUHL 4YXHL 3HNVH 5AZ2H 2J6EA 1RZGB 1FCCA 3ATFA 1RK0A 3JUYA 2E6QA 1A6VL 3VRJA 1QI4A 3Q44A 1CK0L 5ETUA 1URIA 2LLLA 1AKJB 3ELQA 4KVCH 5DR5H 1GY2A 1HXKA 2ZCHL 1KIUA 3Q13A 4PP1D 3BVDB 2DMGA 2VE6A 5GGTH 5I18H 2EXYC 5TQ2L 2NCEA 5K93A 5GZOD 5JDSB 2FRGP 4M4RA 4TVPL 2WSKA 2FVNA 5I1JL 4MAUL 3G6JE 4U1LA 1XGRA 4OCXH 3ZE1F 3FSWA 5I1IH 2ID5A 4HLZH 1TTFA 1OGSA 2E7DA 3SCMC 4GW1A 2RIKA 3U9UB 5IFHH 3EAKA 4FFZL 2P5EA 2VDQB 3HJ0A 4WDIB 3ULSB 4ZOEA 2H32A 2YXVA 1FAKT 3P2TA 3UTZB 3SE8H 5L88H 2IG2H 3ECWA 5GJSL 4QIRA 1ZTXE 4XR8C 2EO1A 3REWA 4WK2B 4X9BA 5C08D 4EUPB 1S7XA 1NUNB 1X5HA 3AB0B 5IBUG 4QHMB 1RHHA 1N4XH 2BCMA 3CZUB 3FJTA 1ZV5A 3R4DA 1AZZC 4JRXD 3HHRB 4DQOH 4OB5H 1ES0A 4HIIB 4LDLB 4EEEA 3MRPB 5AYTA 4Z23A 1E3ZA 3IEAA 4ZAKA 3VFRA 4PVBA 3UP6A 1YDPA 2DKUA 5F7WC 1GPOL 1ZIAA 3IJSB 2NYYD 2WIIA 4I48B 4R6UA 1A25A 2F2HA 3DURB 3FQUB 1MIEH 2Q8AH 3S36H 3D6GA 3SDCC 1Q90A 3D07A 2CO7B 1MNUH 4NSKB 1A0QL 4WUUE 4NNYA 1P7BA 1AD0A 5GRVL 4EZLA 1MCDA 1MAML 1UM5H 1KJVA 3TO2B 4EN3A 5FO8B 1OB1B 4NQEB 4JRYB 3QISA 4OD3L 5KVEL 1I7UB 5C7XL 4NGHH 3QUXB 3U2JA 1BYOA 1R0AH 1CUOA 4S1RL 3GHBH 4ONHA 5D7SL 4XVTL 3ML9A 1G4MA 1UJTA 2ADFH 4XGZB 3ZYIA 2B5IB 2VQ4A 4HCRA 1KB5L 2J21A 3S97C 4P5KA 3ISRA 1KBGL 1NCAL 3C60B 3QQDB 5E2TL 4XP9H 4KO6A 3WMPA 3O6ML 1N0XH 3EH5B 4UZSA 3CFDA 4KZEH 5DJ8A 5KJ7E 3QNXA 4MA1C 2A9CA 4DP5X 5C9KA 1ZHBA 1ACZA 1WV7T 3QRFM 3ARGA 3VVWA 3FPXA 4LRNH 1ILUA 1P2CB 4FFYA 1TEYA 1B0IA 2F54D 3ARFC 4F24A 1P7HL 2A1WH 4MZRA 1YEKH 1MRDH 2VMJA 4JFXA 4JCMA 2XN2A 1F45A 4QRSA 4H8PA 1XCWA 2GK0B 4LLAA 4AYFB 2O5XL 3GBDA 2F53A 8FABB 3HG2A 1AO7D 3SE3A 3C5ZA 3QFJA 2QMKA 5L4MA 2LW3A 1PYWA 2G9KA 2G30A 2IGFL 4TNGA 2C9SA 3T5WA 5IMKB 3IXAB 1KPVB 1MELA 5CFHA 1MJJB 2W95A 5BMFL 2YWZA 3CFBB 4DAGL 5TD4A 5KVGH 3T0EB 2IH3B 3ISWA 2UXGA 3KXFD 5C0BD 1IBBA 2X89D 4AQEB 2QSTA 2GPZA 4UU9B 4YHIB 5F8QC 1AE6L 3ZZSA 1XBDA 1P9MC 4LIQH 3BPOB 1J1OL 2FGWH 3AM8C 3I2CL 4J3UA 4MCYB 2D2OA 4CSZA 3KCWA 1GZPA 2YD7A 4I2XA 1YEFH 3ZO9A 1IGTA 1LO4L 2APSA 4MX7B 3S5YA 3SE9H 2C9AA 4HJGA 5D8JH 2H9GA 4AIEA 2MWCA 4GI6A 4X4KA 4ILDA 2ZWKA 4GI8A 1IBFA 1P1ZB 5DT1H 1MVYA 2AQPA 2YMXH 4G8AC 3FB7A 2OK0H 3CSYA 1RD6A 4DW2H 3LPFA 3RX7A 1NAKL 2YD9A 2F8XC 4EKXA 3VXQB 3CQFA 2YQGA 4XNYH 2VDRL 1KXQA 1CD1B 2HT2D 4ONGH 2CK2A 2VDPB 3D0LA 5I66B 2EIZA 1QBAA 5E1IA 2WQSA 2EH8L 2ZSVB 1EQWA 2UUDK 4R26H 3RWEB 2VLRE 3UMNA 3VXRB 1S9WB 4P2OD 4OZGB 1YECH 3OKEA 4M3JA 3VSTA 2JCCF 4Q9QH 4Z7OB 1CT8B 3BAXA 4XXWC 3ZO0A 2WBJD 5AUMB 4KKAD 4I4WB 1BM7A 5IFJB 2CDEA 5IOKA 2CCWA 4WRLA 4E41B 4X50A 3APFA 1ZT7A 1MCRA 4LGPB 2EVFA 2G2NA 4KRPB 5L8JB 1AG0A 4X0KA 4A6YB 2AC0A 1QOKA 1WTGT 1I8IA 2PO6B 3F7LA 3S3SA 3VH8A 3SKUD 3FH8A 4FQLL 4GQ9L 5D2LB 2ZKHH 4TSBL 1LDPL 4AW4A 2BSRB 2A73A 4Z7UA 3N5AA 3WY4A 3S96B 4Z7QE 5I0DA 2BVEA 3GXTA 4O5LL 4NZ8A 2EE2A 4HIHA 4JHZA 4ALAL 2OMXA 4N0UE 4XPGL 5JZ7D 4ZW5A 4HS8L 4LCYB 4XVUC 4DKAA 3V6ZA 3B2XA 3HFFA 2CWRA 3ENEA 3MCKA 2P8PB 2Q6WB 3VXMB 3CVHL 1QLFB 3T3PB 3B2VL 2PMZA 1EJFA 3EGSB 3NPZB 2BINA 5DJYA 1J8SA 1F6LL 3W0WB 3ROLB 2Q7YA 3QUZC 2DQIH 5F71A 3GMMA 5L9DL 5E1GA 5LKNA 1PW3A 2VQUA 3EUDA 2F19L 3KWWA 3MOBH 5D7IB 5F0LB 2FEEL 4I0PB 2WO2B 1KB3A 2XXFA 3LZRA 2FB4H 2UXTA 2AJXL 4YO0A 3DOHA 1JNJA 2Y69B 4KJYA 2E86A 3OKNA 5EUKB 5J56B 3GZOA 5EN3A 1YEIL 4H88H 4V2BA 3I74A 3MV7B 5JR1H 2LE9A 4OGXH 4YAQB 4NFBA 3MLYH 1SJEA 1NFDB 3GK8H 4LSUH 2AGJH 4HXAH 3TT1H 3NPSC 1CBJA 3MFFA 3RNQB 4KQ3L 1XCTA 1ZA6B 2WXRA 1J7VR 1KYDA 4N0CC 3TO4B 3W39A 3IRCA 5JHDE 2AV7A 1V3LA 3GTNA 4JKKA 4AEHH 4WLCA 4RQQB 1FNFA 3LXCA 2HLFD 5CJOL 1UT1A 2C1PB 5BOJA 3P2BA 5HDBE 1PY0A 5KSVB 4KBPA 3QJTB 4NXSA 1SPDA 3EYOA 4UZUA 1ZWIA 4AIXA 3ZKXC 4HWUA 1R3LA 5IESH 3PL6D 1PTZA 1CD0A 2ROYA 1VSCA 3HPJA 2QQKH 2Y7SA 1BZOA 3T8MA 3UTTB 4LBEB 4OCWL 5DEZA 4APQB 3JZ7A 4YSAA 3L16A 1USZA 3DARA 4UNVA 2GSIB 1CURA 5GS2H 4YDMA 3KPSA 4U1KA 4PLKD 1R5VB 2R1WB 1FPTH 4M7KL 3SOBH 4ZO9A 4OJEH 3CFKA 3T3ME 1S7WA 1TZAA 3H3PL 1R3JB 3FB5B 4XPFH 3GJEB 1TCRB 3ZE0F 1ZVHA 4H5SA 4GQPH 2P44B 3ZT5A 4YFEA 2ZWYA 2D31A 1JPTL 1TU2B 3GPEA 5CINH 4ZTOH 1E27A 3CZKA 2HMIC 4IIQA 3KL0A 2EDFA 4KOBA 1MAKA 2UZXB 2X28A 5GJSH 3DMMB 4YL4A 3QS3A 4R90H 3MA7B 5IHWA 2PR4H 5EULV 4YLQT 1ZLUK 3AREB 2QVKA 4PJAB 1CIDA 5AW2B 3S5ZA 1JL8A 4FC3E 3QWNA 4Z7WA 1P7QD 1NKGA 2ZD0A 4F8OA 4MCNA 1TETL 4AWJC 5I0WA 2Z8RA 4MXVF 4N6RA 2BNQA 2VXQA 4IMKA 2VDML 4GS7B 1YQ2A 5ACZB 1XBRA 3LQAH 3LV3A 3U79A 4EDXB 1KIPA 3BZ4B 4IBUA 2BNUB 4JKPL 1EEUA 5IW1A 2ALAA 3QZPA 1XSKA 3L3HB 1UOWA 4EI0A 4X2UA 3UBXI 3KPLB 3IN2A 3ET9F 2GFBA 4F7TA 3O45B 3PP4L 2DQTL 2IDSA 1G7JA 5D7LA 4C83B 3NZ8B 4PJDE 2E0PA 4JQVC 4G5ZH 1FYTA 1GYAA 3VYNA 4U6XA 2JV6A 4KKZA 2ENQA 3EW3B 4LQ1A 5D7SH 3OJDA 3V5KA 3TOPA 4PJ5B 4MQXD 4QOKB 5J6GB 4MHHG 4YC2B 1I3RA 3L9BA 1VKXB 4GUPB 2KC0A 1KB5H 4M29A 2I32A 3JWDH 2LLGA 3D2UB 1KBGH 4PJ9C 4M62L 4RRPG 5E2TH 2UWEA 4QLWA 4NX0A 2YUVA 3O6MH 3UCRA 1A9EB 4R97C 3L7FB 3CHXA 4HHWA 4M1DL 1ZTXL 2BJML 4DHLA 4FZEL 2ESVA 1YA5A 1D9KB 4M43L 1C5CL 3CUPA 4JFHE 1W0VB 2JK5B 2FX9H 1V7NL 1LO3H 4JQIH 4M48H 4XO5A 4ZQTA 1VFOA 2GJ6D 3T2LA 5JPNC 4QRPE 4WGWB 5FO9A 1WG3A 3E8VA 2X70A 1KV3A 3D39E 3KVQA 3DRTB 1GIGH 4GO9A 4BEIA 3BVUA 1FO0A 2V5MA 2FLBT 5F89B 1CXEA 1F0LA 1WZKA 1IGFL 3TESA 5D4HA 2DQGL 4E9XA 4BRJA 3B3BA 3IETA 3P3SA 3SIKA 3T0BA 5JUEH 4Q9RH 4MNQD 4PJCE 3JVGC 2IFFH 3UERA 3SGJC 1CIUA 5EEZA 2HVJB 2I5YH 5DUBB 1YEEL 4HDIA 5ADOH 3TVMC 1NICA 4UOW0 2IWFA 3O9WA 5EHFA 4ZPVB 3MXWL 1R5WA 3LB6D 3F6LA 1FG2B 3U4EA 5JLZB 4GIAA 4M61B 1ONQA 1Z5HA 2ZF8A 5LBSH 4ZNCD 1UD4A 4X4MA 1R3HA 5DLMH 4FI6A 3T6ZA 3PPEA 1K8DB 5HDWA 4P57A 2FEDC 3WLBA 1KPUA 3U0PA 3WJMA 1FDLH 1XH1A 3UCQA 1EGJA 5I74C 5IV2A 1BQLL 1UM6H 5E1AA 2L7QA 2R0LH 1B9ZA 2D3LA 4PJ7E 4Z0BH 5FM4A 2NQCA 4M4PA 1T4KB 4QGTA 2W0FA 3FT4A 3RA7L 3H8NA 4HPYH 4LSSL 2N7AA 3S3DB 4JN1H 1WZ1H 3KPTA 2N1KA 1SYVB 3IT8D 2ERJB 4QTHB 3DTXB 3PUUA 4ZPTA 5D5MB 1KZYA 5CBEB 3GSNL 1MY7A 4LL4A 1KIRB 4ZX4A 2XQBH 4D9LL 3BH4A 1FVCB 1MIMH 5AALA 1AGBB 2FECL 1QSZA 4K71B 3MBED 2ZXAA 2WWMD 4JZOA 2Q10A 2N0MA 3H2PA 3C9NA 2Y6SD 2XY1A 2VISA 4L4JA 4FA6A 4MD0B 3UPRA 2AF2A 4Z7VA 4WW1B 3VFSB 4JAMA 3RP1A 5FYKL 3VA2C 3DX2A 3C6LA 5FFOA 2X9WA 4LCWE 1XZWA 5FUZL 4GRWF 3T0XA 4ZZFA 3F04A 2HT4C 1MHCB 3P9MB 4M56A 2YHGA 3CDZA 3KPRE 4P9ML 4DEPB 4FFZA 4TSBH 5JOEA 2OP4L 4PWFA 1A6TB 2HRPL 3IVKA 3F5WB 3S37L 5T1KB 3S35L 1NM4A 1SMDA 1NDGA 3SB3A 1OAQL 4PJBA 1FFTB 3WNLA 3V5DA 1TZHB 1HOEA 1C1EL 2FNWA 4QTIL 3HHSB 1AAJA 1SHXA 5B7FA 2OR9L 5DJZA 3B9VA 3B2VH 1EHNA 1EEYB 1Q94A 3ALPA 4CC1A 5L6YL 4WI6A 5F3BA 1GGCH 1SOSA 3WS3A 3V7AE 1KFAH 1OAYH 4Q2ZB 1CDCA 2G3ZA 4FJZA 2FZ3B 3T8XB 1XB8A 1YMMA 4XRCA 3RVTC 3WKMH 1U8KA 1FL3B 1SHSA 3X1FA 3EDEA 4OF3A 3UTSB 4BKLA 3F7PC 2GTWA 4KQ0A 4N9OB 3P4NA 3D25A 1XTLA 1IVLA 1WF5A 4DPCX 1L0PA 1OF2B 4PQXA 5HYQB 4FG0A 2P8LB 3GKWL 3VWJD 1B2WL 2VQTA 3NZHH 4G6MH 3IXTA 3WS6C 4HAGA 2FSEB 3MZGB 5F0JB 5DVKA 1AKJA 1A9BB 2CGRL 3V0EA 4DTGH 1HYSC 1PL3A 4AYBA 2A6IB 1QW8A 2DTMH 3L9YA 4XX5A 4QRTA 4PV9B 3ZL4L 4QD2E 1AIFB 4LO9A 3LXBA 3BZDA 3FZUC 4JG0H 5MENB 5HI5D 4L37B 3G6AA 3PRZA 3AXHA 4IU2B 2OZ4A 3S4SB 2J55A 1HEZB 3OTTA 1L5GB 4LGRB 4DVRH 3U9UA 2DKMA 5A1AA 3CHOA 3K2UH 4WDIA 5JHLA 4HD5A 4OV5B 3FTSA 2Y4SA 1TQCB 3UTZA 4IRZA 1OAUL 1LTXA 1A6UH 2DQCL 2IBZY 4FA7B 1B4TA 4JB9H 3V7MA 3WNJA 3A4DA 2X6CA 1CICA 2ZG2A 2OTPA 5C0JA 2WNWA 4MJHA 5GRJH 4RSYA 4LSRL 3FPYA 4N90E 3MPCA 2RFXB 1G1OA 1PG7W 4KX8A 3DRQB 4HIIA 1Q9WB 3MRPA 5DFVD 5DMYA 1V7MH 4S2SB 3LS4L 1OW0A 3NCYS 3PUCA 4RWYL 3W82A 2VL4A 4L1HA 4FYRA 4LVOB 5DVPA 4POZC 4Q0XL 3FU6A 3IJSA 4JO1L 4TKWA 5HD8C 4PJ9B 2EC8A 5JMOC 2YAFA 3DURA 3FQUA 3WFHB 1AR1D 1C8QA 3N85L 3QO1B 4KMQA 3VJ6A 3QI9B 2A0LC 2BIPA 3R0MA 4NSKA 3UZEC 5FO8A 2D7NA 3TO2A 1QLEL 1OB1A 4JRYA 2IQ9L 3OHXC 4DGIL 1I7UA 4W70A 1TDQA 1UM4L 4LSTL 1SF5A 3QUXA 4PJHB 2DWDB 4NUGL 5F0MB 1ORSB 4OT1L 5T1LB 3V0WL 1QYGH 4DN4H 5EU6B 2NZ9D 3KLKA 1AH1A 3UC0L 5IVXF 2JQZA 2K4AA 3C60A 3GSXB 3QQDA 4JGJA 4MMXC 5CKAA 6FABH 3TV3L 1MRFL 3NIGE 2AABL 4FQPA 4CC0A 1SY6H 4OI8A 2NXZB 1MDTA 4BSVB 1LO5B 4X7TA 2NY0B 1JF5A 1WBZB 4NJ9H 1S6NA 4QJ5B 2E47A 1AXTL 2GHWB 1UCBL 4JRXE 5IOPB 4RSVA 2EKJA 4M1GL 4ZD3H 1P2CA 3QPKA 4Y89A 3HKFA 4KXAA 4NZUL 2OKMA 2AXFB 1G94A 1Z5LB 5I8KL 3RFZC 2GK0A 1MRCH 4AYFA 2GTZA 1MVUB 1VPOL 2VWEC 2WCPA 2X6MA 3BP5B 3W3BA 1UB6B 5GZOC 4FHKA 3P30H 5DEFB 2DF3A 2B9AA 4XP1L 4UILL 4PJXE 3QYNA 4U1GB 5IMKA 2OMTA 3NBNA 4B0MB 3IXAA 3L3KB 1KPVA 5KTEH 1MJJA 4OZIE 3CFBA 4BGLA 4M1DH 5AAWA 5JA9A 3RUGE 2BJMH 2IH3A 3T0EA 1TSRA 3IRPX 1CLZL 1BOYA 3QJUB 3HZKA 4AQEA 1C5CH 4M7ZB 4UU9A 3CVHA 4YHIA 4LPUA 3HVDA 4HT1H 2V3DA 4MSWB 4OAWA 4OH2A 2WHVA 2ZKYA 3F58H 4LEXH 3OQRA 1JGLL 4NCC2 5GZNA 1O9ZA 3HMWH 5KOMC 1JTOA 2WBWB 3ESVF 4XHQA 4AGNA 1FVDA 4E2OA 4IKNA 4Z18A 2DEWX 1P1ZA 1TJHH 3N55A 4CILA 1JRHL 1QHQA 3BXNB 3S3JA 3DX3A 4L9LA 1MQKL 3L08A 3QZWG 3INOA 3VXQA 2NYYC 2F54E 4GXUM 2MH4A 1CD1A 4XB7A 3AY4C 2OQJA 1PY9A 5T5FH 4IS6B 1JMZA 5I66A 5D1ZB 4XCYB 5BQ7A 3O2WL 3CLFL 3SKMA 3RGBA 5D2NB 3RWEA 3U7YL 2GUYA 3VXRA 5KVFH 4OGQC 3O41B 4OZGA 3WXWL 1YJDH 4RDQG 4CMMB 4A7SA 1AO7E 4PIRF 1CLOL 1OCCB 3EFFB 3MJ6A 4UBDD 1QACA 4QF1A 1B3IA 4W9JC 5AUMA 1O7SA 3B2UC 3RWFB 2BHYA 2L04A 2EUVA 5DMJB 4F9LC 5IFJA 4E41A 2IADB 3Q8AA 3KEHA 4NKMB 2IPTL 5D7KD 3KXFE 1H3VA 5C0BE 5J1TC 4L8SB 4A6YA 5TFSH 2HVKB 3KGRA 3CFNA 3OG6B 2F5AH 2WN2A 5D2LA 1F8TL 2XYCA 6CGTA 5LN8A 2XOTA 1E5UI 2NQ3A 3PPSA 2I60L 2E46A 4D9LH 4OU3A 3VXOB 5IFAH 3FCGA 1L7TH 4LCYA 2B1AH 4KWUA 5T5NF 3DETC 4UMGA 2Q6WA 2P8PA 1GZQB 3Q3GA 1QLFA 3UEQA 4B3EA 4N8CH 2CZNA 4NERA 3QWQB 3EGSA 4K94H 1HTYA 3W0WA 5EEYA 4WHCA 4XTRD 4J3OD 3ROLA 2K9UA 2XWCA 3FRPG 4HX1B 4KKNA 2QPFA 1DZ0A 4UTBL 4HJ1A 5E7FA 1JHLH 1B4LA 5GGUB 3BN9D 1KBBA 4KK9D 3H53A 4AK1A 5D7IA 1TJMA 4DK3A 2AEPL 2R23A 4F2EA 4PLOB 3F2LA 1DCEA 4JDZB 4NBXB 4YSTA 2IVFC 4OCSL 1MCNA 1OE2A 2DD8L 3MRBB 1J9CT 1NC4A 4A7TA 3V6OE 1FAIL 3MRIB 4XVOA 2PPDA 1RIUL 3WY1A 1UJ3C 4N5UA 5EUKA 2WN3A 4ODSH 1QWHA 2YEVB 3T77A 3MV7A 4PMFA 1WAAA 4QHUB 1ACYL 1NC2B 3B6SB 4YAQA 4JY5H 1EANA 1LMIA 1WAEA 4FQ1L 1TITA 1OCWH 1WBYB 2J1ZA 4JO2L 4EXKA 3LVTA 5D71L 5EO1B 1NFDA 5LG1A 4DOHE 3JV0A 3RNQA 2GY7B 2RMNA 1ZA6A 2P28B 5EN2B 3TO4A 3O0RH 2WZ5A 3MSPA 3OLDA 5B4MD 3VD0A 1NOFA 5AVRB 2FQGA 3CZJA 2FTAA 2HT2C 4RQQA 4V1DD 2ED7A 4I18C 2G3MA 3ZZLA 2C1PA 2E9IA 1MY5A 1E9QB 4LP4A 3DX0A 2R2BB 4MB4A 5KSVA 1VGKA 3MX0B 4ZS6C 5I9QC 3WKNA 2HKAA 3ASWA 4JX0A 5LCVH 3US0A 2JF1A 5F96L 3H7BA 4WW2C 2AS5M 3SDCA 4DKEL 4G6KH 4RBPH 1LWJA 2Q5BA 3G6JA 3WYRA 1U36A 2VB5A 2YOAA 3UTTA 2E4TA 3V6OC 2VTFA 5L7XL 4TYUA 3AACA 3B3IA 4ZG1A 4ZYKB 1U30A 2YXFA 3QXTA 3NIFE 2GSIA 3TP4A 1G6RL 5SWZD 3L9RB 1SLXA 1R5VA 2R1WA 1KXTB 1MF2H 2YBRB 2VNCA 3DIVA 3STBA 4QDGA 4UF7C 1SRDA 2I7SA 3BT0A 2JI2A 3ZZQA 1A4BA 1R3JA 1PSKL 3GJEA 1HHGB 2R1XB 4MMXB 5JZ7C 1TU2A 3LHPL 3L3OB 1NPNA 1PVHA 2R0ZL 2R4SH 2UZXA 2E6PA 1KXVA 3TBTB 1UZGA 3DMMA 2DQCH 3WN6A 2W88A 1C08B 3MA7A 3MCYA 1O7DC 5AVVB 5LDUA 5LQBH 2ZCKL 3ARFA 1GGYA 4XN7A 2WOBA 4PJAA 5J3HD 1VA9A 3UXFA 3C12A 3TNNA 3PGFL 5J9PB 1L6XA 5FYLH 2WSDA 4QHPA 4ZUUB 2HTLD 2OA9A 5CIPB 3CQQA 4QXWA 4Q9CA 1T5WB 3SGDH 2JTDA 4FTVB 1NH6A 5ACZA 1KN2H 1TZOA 5LAXB 3EDDA 4EDXA 3BAYA 3BZ4A 1T2QH 4LKXB 2BNUA 1YNTF 4QCIB 1UWXH 1M7IA 3FFOA 3L3HA 3SE4C 3N41F 1H6TA 3KPLA 1IMHC 2XV6B 3QCUH 2IANE 2NY6B 3N43B 3O45A 2SEBB 1JI2A 1W8OA 3NZ8A 1UM4H 4HW6A 4PCTA 4N2LA 2ARWA 5GRUH 3CIAA 3GI9L 4K8RD 1MCFA 4FNLH 1WFOA 1T1ZB 3TU6A 4PJ5A 3MGOB 4QOKA 2E9WA 5J6GA 2E75C 1VKXA 1ORQA 4GUPA 1TQTA 2WXNA 2HLFC 3D2UA 4M02A 2AEQH 3TV3H 1MRFH 1JXJA 3GLDA 3O6FB 1A7PL 3L7FA 2JWYA 2OXGA 3G04A 3OV6A 1SVCP 2P5WB 1D9KA 4XPBH 4F80A 3Q2CA 1NWPA 1W0VA 4K3DL 2JK5A 3PL6C 4M1GH 2PN5A 4FXGC 3S8GB 2B1HL 3MJWA 3Q2VA 3IB4A 2Z8SA 4F2FA 2E8ZA 1M53A 5D1XD 5J89A 3DRTA 4FQQB 4UT9A 2YO3A 4PRAA 5FUOH 3ZTCC 3BSZH 1HKLH 4HJ0C 5F89A 3KWUA 4X5WA 2Y07L 4PLKC 3P02A 3QIUD 2VABA 2NY2B 2WZ0A 1QBBA 3FW6A 5ITBH 2YD5A 1H6FA 1SXAA 2HVJA 5DUBA 1KENL 2CUIA 2PTTB 1QTPA 3RPKA 1N26A 2BIQA 4GSXA 5CP3H 3WGUB 2VZ1A 4ZPVA 4B7IA 1FG2A 5JLZA 2OFQA 4WTZG 3BRFA 4X9HA 1XO8A 3JWNE 5KVDH 2KPNA 2QV2A 4WUKL 3ORJA 1K8DA 4QRBA 3UZQB 3KPNB 4WO4D 1T83A 3UDWA 5F7HA 2V33A 5FGRA 5DCCA 1OAZL 1JE6A 4YHKH 2HKFH 5DZJA 1T4KA 3WNIA 6TAAA 3FQ4A 2VLRA 1HAUA 4W9KC 5F9WC 1NBVL 5EOCH 3BKML 3DTXA 5DFTA 5CBEA 1G5AA 2GJ6E 3QZBA 5A3ID 2PETA 1KIRA 3BZ5A 5I6PA 1QUPA 4GRWH 4CA4A 5KSBB 1IM3D 3V4VL 3G9VA 2MPAL 1AGBA 3H3BC 4HU2A 4MNQE 2V4LA 5GRWA 1RZQA 5JO5B 3UJIH 3V2AR 1GS6X 4JBSA 1OM9A 3QDGB 4K9EC 4ZODA 2WWKT 3S34L 3TJEL 2WGNB 3QEHB 3QIBD 4MWFB 3PREA 5JIPA 1G0DA 1H15B 4QYAA 4AK2A 4WTQA 4MD0A 4HLEA 5EOCJ 3WENA 3BSHA 4M7JL 4WW1A 3VFSA 3FCTB 4MQXC 5HY9B 1ZVYA 2YGVA 4RAVB 3TTSA 5JW4N 3L1OL 1PFOA 1CXHA 2MNUA 1CG9B 2FBOJ 4TNWF 2ORBL 3P9MA 4R9HA 1IBGL 2H5UA 1UQSB 4MRCA 1A6TA 3F5WA 3RWIB 4NOBA 3PWPD 5T1KA 2HH0L 1DHKA 3RWDB 4DP1X 4K15A 1TZHA 3BPLB 5I9QB 3HHSA 4PRID 5TE7H 4FG2A 3O81A 2ZONA 4KK6D 4YVUA 1B0GB 2KUTA 3OAYH 1EEYA 1DVZA 4FMKA 3V0GA 5D70L 4EAEA 8CGTA 1P5VA 2Z91B 2OMWA 4UINL 2R2HB 1AOHA 2ZKXA 3ARUA 4Q2ZA 3VXSB 2GG1A 3OMAB 5GGRY 4I1NB 3AXIA 2H41A 4QI3A 3T8XA 3KBEA 4HFWB 2LABA 3UTSA 4J3BA 3FU9A 3LB6C 1NCNA 2AEPH 1WIPA 2BWDA 4GKSA 2XCMC 1YUKB 3BJ91 1SJVA 3QXVA 1E5CA 4NO3B 3HI5L 1OF2A 2CLVB 2VM3A 5HYQA 4BUHA 2P8LA 4NQCD 5HHXL 3A6BL 4AMKH 4D3CH 5EZJB 3FBQA 1J9QA 1TTAA 2VR7A 2XDHA 3NCXA 2FUTA 5F1SA 1BXAA 2X2YA 4Y2OB 1X9RA 1HWWA 1JZ8A 1A9BA 3O6LH 4PJFB 4BDVA 2EEDA 2JLLA 2W5PA 1I1RA 3WXVH 1FL5B 5KBMA 2A6IA 1KY6A 1V3MA 2WOYA 4N2NA 4XNMB 5DTFB 1A4JB 1AIFA 4BFFA 2CBOA 1KNOA 5HYJE 4XCCH 5MENA 4L37A 4PYHA 4L2LA 3ULAB 2R7EB 5KSUB 2ADJB 4HUKB 4IU2A 4G2AA 2WLJA 3S4SA 2L7JA 2YAHA 1L5GA 2GBUA 4DCQB 4CAGA 3ZKND 4UUJB 4B5EA 3EJTA 3MBEC 3QHZL 1KDJA 4OV5A 2Y06H 2QQLL 1JPFA 2WWMC 2YUXA 3P3RA 4WJKB 3SEPA 1MFAH 2E7MA 1UCTA 2QADD 5I1EH 1CS6A 2WC7A 1AXSA 4AYEC 5DK3A 3ZTJH 2GYSA 4WEBL 3Q6GH 3U36A 4UTAL 4AVIA 4HK3N 3D3VB 4PGBB 2F9BT 3LJ3A 2AJUL 1W0YT 1HSAA 1Q9WA 3AU1B 3GHPA 4X6DE 1BCIA 2VZOA 4NWUL 2PP9A 5J13C 1Q8MA 2A3TA 3TZVD 3QZWB 1ZKAA 3SBQA 4PJ9A 2HCZX 5CGYD 5KANG 5IVOA 1DCLA 4N22A 4NNPL 3WFHA 4GXVL 1MFDH 1JOIA 3QO1A 1QABA 3QI9A 1S7TB 2P48B 2H26B 4DK6A 1OSYA 1T7YA 2R29A 4IRJC 4KI5D 3BDYL 1TNMA 1IAKB 1T21B 1G7HB 1LEKB 2EABA 4J6RH 4OZFH 5AKTA 3FHEA 5JPNA 3S8FB 4PJHA 1NFIB 1BAFL 4X42A 1SUJA 4HKBB 4LHQB 4J23A 5T1LA 2XWXA 3S5LG 1DQLL 1V3KA 3GIZL 4R84A 4J28A 4X8XA 5HGGS 4PJEF 5EU6A 1J1PL 1L3NA 5J4MA 1L9QA 2JLPA 1I3GH 2OJEB 3GSXA 3H56A 4NRYB 4OJFL 3SGJA 3RX5A 4BWUA 4KK8D 5ESVB 4BSVA 5E5UB 1JXKA 1LO5A 2O5YL 2J1KA 1PQZB 1WBZA 1WFNA 4ZFOL 1M7XA 3BLPX 4CN1A 4PGCB 5BVPH 5IOPA 3WOVA 4LP8A 1MFEH 1ZS8B 1RPQA 5K1VA 1MJ8H 3IAPA 5A16B 7PAZA 3MODH 4G9DA 2YS4A 2OULB 4FJ6A 3LH9A 1XCQB 4Q9BA 4ADIA 3CU7A 3CH1B 3CV5A 4JFDD 2DDQL 4YLCA 4KHXL 2FWOA 4JM2D 2YN3A 4MAZA 4PGZA 3NN8B 1GAFL 1TEFA 3DO7B 1MVUA 1TR7A 3BP5A 4I77L 3ZMEA 1UB6A 4MBRA 3O3UN 2W9DL 5HI5C 2BRRH 3JWOC 4QRPA 4K3EL 4ZO7A 5E8EA 1ZV9A 3D18B 5HVGB 4M03A 3OXRB 3DSNA 3MRDB 1IQWL 3WD5H 1E3XA 2WAQA 3AT0A 4Y9CA 4EOWH 1N67A 2X4NB 1H9VA 1ZJBA 2BSSB 3EHBD 5B8CB 3TBYB 5I1HL 1D5BB 4MSWA 2ZOOA 2OLDA 1JGVL 2X4SB 3EOBB 4LXFA 5ERWB 5HYSB 3FFDB 1E2ZA 4MB3A 2WO3B 4YDNA 1N6VA 2FQEA 3K1DA 5T1MB 1HHIB 4ODUB 1Z0NA 4NZRH 5DRWB 2C7UB 1KCVL 1HZHL 3HZMB 3GBMH 1NL0H 5ANHA 1Q9OA 2BSTB 2DL9A 5F7BA 5KZCB 2LTQC 5A2KH 1WIOA 2BVQB 2WWKO 4JJOA 3K6OA 4N8PA 2H3KA 1U3YA 3HE6D 3ALXA 3HUJE 3LH8A 1AR1C 5D1ZA 4PJ7A 4XCYA 4RMQA 4HIEB 5D1QD 4ZJ9A 3DUSB 5D2NA 4OIIL 1N70A 3O41A 4N87A 4WUKH 4AM0Q 4CMMA 1OT2A 2QPEB 1I8UA 2FT7A 3EFFA 3RWFA 4YS4A 3QEGH 3KAAA 1OAZH 2DBLH 1F42A 1U8JB 4NKMA 4Y5XC 2J12B 3VRLE 4HUWB 2E4FA 2HB0A 3WDJA 4EJ1C 4FAAB 4L8SA 2W0PA 4HZAA 2EE3A 5L0QB 1SNRA 2HVKA 1KT2B 3P69A 4ACTA 4XC3L 5FPIA 1BVNT 5CM1A 4MAYD 4KXZH 3KPMB 3DBSA 4WSKA 3VXOA 3SBPA 3P1VA 3E80A 4QAMB 3N42F 2BM3A 4P4KD 5E2UL 4R4BB 1GZQA 1MFBH 4JRFA 2C9UA 1F4HA 2X5PA 3FHAA 1IJNA 1HL9A 3WS6A 4F7PB 2NY4D 1JDCA 1X4XA 4LMQI 4O4YL 4F8TA 1P4BL 4HX1A 4K9EL 5K59E 3L1OH 1N7ML 4K7PX 2PWGA 1OXYA 1Q9KB 3IFLH 1JP5A 4LCUB 3SDXB 2VDOH 1YEDB 3PFQA 3LVEA 4JDZA 4BSWB 1SFDA 1DO5A 2EEAA 4WNQB 5B1KA 3MRBA 4Z1PA 1AZUA 3MRIA 1CJYA 3AW5A 2ZF9A 5D7KE 2QEJA 1MZYA 3RZCB 2OR8A 2G5BB 4QHUA 1NC2A 3B6SA 5LHDA 2VXSL 4AGQA 1WBYA 2K78A 1BMZA 3QS2A 1RIHH 5EO1A 4Y2DD 1T66D 5D7JB 1IC7H 3N9GL 2HX8A 1IC4L 4E9LA 2IBBA 5EN2A 1QRND 1SHWA 3IGAB 4M00A 4FL4C 4PJIE 2YSSB 5CEZD 1MPAH 1XL6A 3IKCB 4QXUL 5IUSA 2YRBA 4JUSA 4KXBA 1F3DH 1T3FB 2VO8A 4OZHE 2NW2B 5C2BH 4AC2A 1E9QA 5EB9A 2EDBA 2R2BA 1F4AA 3APDA 3QP3A 2Z4TA 4U1HB 5KW9L 1ZD6A 3MX0A 2MFNA 4N0RA 3T1FB 1KXHA 4Z3FA 1HQ4B 1NLBH 5FYJD 3A6BH 1NGPL 4UBDC 4OGYL 5K1JA 1E4WL 2ZG3A 4YDIL 1ADQH 3UABA 2DLTA 3QJQB 4IRJB 5HGHB 4QAWA 4M3KB 3ZE1B 4F1ZA 5F1IB 5BQDA 5DXWA 4G1EA 1F3DJ 1MREH 4ZYKA 3ARXA 4TUKH 2FGZA 3MDJA 4G7RB 2V5TA 5ID1B 1J5HA 2FQFA 1A4AA 3BKJL 3HC0B 2YBRA 3KE0A 2A6KB 3IDJB 2H1LM 3V0DA 1ZA3B 4KJWD 1HHGA 5GGTA 3WTYA 2R1XA 1NCDH 4GNKB 4MMXA 4O02L 2MQ0A 5CILL 3VRLF 1B6UA 4DF9A 3L3OA 2H1PL 1DBAH 3FRUB 3QHZH 3VA6A 2QQLH 2CK0L 2WGXA 4M6AA 3VI3E 4HFUH 4UT6H 2ADIB 2IH8A 3VGGA 2LVCA 4N1CA 1C08A 1KY7A 1QA9B 2B4CH 2NY7L 2IDUA 3EGXB 4V1DE 3ROOB 4XTRC 4J3OC 1P84K 1JYVA 4OFQA 1AGFB 3RDJA 1S7SA 1VESA 5J0BA 4OLYH 3WELA 5J9PA 2ZXGA 5DA4A 3FL7A 3SBWC 1OTTC 1TO4A 3K2IA 4ZUUA 3BN9C 3RFZA 3L5JA 4NWUH 5CIPA 1F1AA 4KK9C 3IS1X 1KC5L 4BCYA 4JGNA 1T5WA 1KOAA 2WKGA 3EOTL 3GYRA 4NENB 1A02N 1MI5B 2QZ5A 2WPGA 1Z9LA 4UAOC 2A77L 5LAXA 1AANA 1J88A 3LIZH 4QCIA 2G60H 3MLZH 5T3ZD 2C9RA 1PG7X 3CK0L 1XF5B 1NPUA 1DQKA 3VGDA 3SOTA 4FKEA 5E94B 5SWZE 4JLRB 1HINH 3LZNA 2BS71 4YBLB 5AKVA 5GJTH 4GRMA 2SEBA 2Z31B 2VLKD 1QUNB 1BFVH 3P2DA 4H20H 5KG9B 1TYRA 1BAFH 5AL8A 5C09D 4PD4J 2XIIA 1T1ZA 2H47C 2J88L 1F2XK 3KJ6H 3EJUA 3MUY1 1FJ1A 2QTEA 3GIZH 3MGOA 1XXDC 4AJYV 4JANB 5B4MC 1RZ7L 5DHVH 2DLFH 5B39G 1R6VA 3BOVA 4BFNA 4F20A 3TWYA 2F1EA 4OJFH 5HDLA 3FO1B 3ZTNL 2PKDA 4TQEH 2R56L 1D5IL 3O6FA 1INDL 4FCAA 4ZS7L 5FLUA 2M1KA 2O5YH 4S1SL 5BVJB 3DIFB 5DQ9B 2DWSA 4KTEH 2TRYA 4XAWH 5F7NC 3MKGA 3QWRD 4FN0A 2WANA 1LWRA 2XPYA 1ZT1B 2VXVL 3MVSA 2ZXWB 1RZJH 1RUML 4FQQA 4TOYH 3QFDA 5DZNA 2WMPB 1X5XA 3P77B 3VRIB 2BXZA 5FUCE 1NZRA 1UUNA 2P80A 4WWKD 3H6AA 4NAMA 2FJHA 5CGTA 1FNSH 1QEXA 3PIQB 1OAKL 1OARH 2PTTA 4RESB 4I5BA 2D03L 4EN2A 4MMZB 3TGXA 2GSGB 4QHNB 3K71B 3DVFA 3SGKA 5EU4B 3AQZA 3S48A 3F12B 4P46B 4MKTA 1G43A 1AQKH 4QNPE 4JFOB 2D7OA 2X1QA 3ABMB 4HCFA 1XTMA 3T0AA 4NUMA 3KPNA 4WY7L 1FORL 2A4EA 5J3HC 3DYPA 1JGIA 4PGEB 5BUPA 1KCVH 5ALCH 1NEZG 1S4IA 3QPXL 3BVXA 2V8LA 2HTLC 2ZE0A 1YEJL 1HSBB 4JFVA 2MEJB 3PWJB 4ZOBA 3VI3F 3UAAA 2YKLH 3K6IA 4J3XA 2I27N 2ZCZA 2WYZA 3ZTJG 4ERSH 2JCCB 4A2HA 1MFNA 1LDSA 3E2HC 5FUCC 4XC1L 5D1XE 2UY6B 5KSBA 3D5OF 2ZOWA 1ECYA 4AEIL 4ZX6A 4MYWB 4Y4FB 3MCLL 2GBTA 5CP7B 4YHMH 5C0BA 2EIEA 3PHOB 5FGBC 4XHJD 3QDGA 2X1PA 1UJ3A 3GSRB 3QEHA 4I8DA 4QRQB 4CU7A 2JB6B 4MWFA 1I9RL 1H15A 4PY8I 3L4TA 3RKDC 3K3QA 3QC5X 2EUXA 3FCTA 3IPEA 5HY9A 3TIEB 4NC0B 2YD1A 4RAVA 4DGVH 5IM7A 4WKZB 1B90A 3KGUA 4OZFG 1CG9A 1X6LA 2ZXDA 3QIWD 5BV7C 4FL4B 2ZWSA 4XC3H 3M8OH 5TK4A 4HS3B 2B3RA 1UQSA 1FE8H 3RWIA 4YDZA 3D30A 4AI7A 4AH2B 2APFA 3DX9B 1LO2H 5DK2B 5DFWH 3I3BA 4R8WL 3RWDA 5B7MA 4JVUA 3QDMD 4JKMA 1SLWA 4K7FB 5IHZB 3NGBB 4UTAA 3BWAB 3E1F1 2VN7A 4RBPK 4CADB 1B0GA 1DR9A 2YFOA 5DHXB 2VSCA 3PWVB 1OP5H 3TBVB 3B7RL 3TEWA 3HNTH 2Z91A 1G0XA 5FA3B 1IM9D 2R2HA 1C12B 1I1YA 3QIUC 5ICZB 2Y36L 3V6OA 1BQRA 5HHNB 1D2OA 3S5LB 3VXSA 3UBFA 4MCMA 2EDHA 5EV7A 1MJUH 4D0CB 2DLIA 1ZEAL 1EFQA 2W9EH 1SDYA 4HFWA 4OI9A 2NUTB 2AJYH 5DURD 5EO9A 4BZ2L 3JWNH 4GEJA 5AYUH 4X5RA 3HG1B 1A2YB 1JNLH 2X38A 1FGVH 3QJXA 4ZMOA 2KZKA 2H3XC 4NO3A 1JV2B 3LEYH 2CLVA 1K4DA 3OPUA 4N26A 2BVTA 3N40P 1LEIB 4Z7AA 1CFVL 3EJCA 4S1QL 3HG5A 2QFPA 3F05A 4Y9FA 3GLAA 4WO4C 4CMHC 4Y2OA 4O58L 1AI1L 1BX2B 3U9PL 1BEYL 1CLVA 4W9CC 4PJFA 1WGOA 2YA1A 3OKOB 1FL5A 5I23A 3CBKB 4RFNC 2OMNA 3PWPE 1BZ7B 5ICUA 5A2AA 4XNMA 1IKNA 1CXIA 1A4JA 2HJLB 1M2VB 4R5TA 5A3IC 3ZHFA 4G6FB 4DGWC 3IFOB 4RA0C 4AQ1B 4PRIE 5DD3L 5EDXA 1GR7A 5KSUA 4C57C 5E8PB 2ADJA 5FR3A 1RURH 3BAEL 1IGML 2WTOA 1ZT4B 2E7BA 3EYSH 1LLAA 4R7VA 4DCQA 3T08A 4JPSA 5KW9H 1WQVT 4DZBB 4UAOB 4UUJA 1YO4A 1UWXK 2YAOA 4UTCA 3KYKL 4GO6B 3BZEB 1UATA 3QIBC 4R3SB 3VFTB 3FO2B 5LXGL 1QTYT 5F9OH 4LHUB 1SXZA 2BIOA 2I7OA 3IU4L 4KRLB 4R2GD 4BZ1L 5CN3A 3GXIA 2HRLA 5EO0B 7FABL 1D6VL 4XPTL 4YDVB 3ZE0B 1SBSH 2P7TB 2XBDA 4B3VA 3D3VA 4PGBA 4IJTA 1HL8A 4L4TA 5E2VL 3AU1A 4Y1AB 5ILTL 5H2BB 5T5NG 4H8WL 4NQCE 3BKJH 5C0ND 1MEXH 4KTYA 1JK8B 3F7VA 4NHUB 3VG0L 4NT6B 2C26A 3T04D 3ZQ9A 5EIIG 1LVEA 3MLXH 3IDIB 3NIDF 5CILH 3LRHA 2EE9A 1GGIL 5B3JE 2WUCL 5EZIH 4KJPC 5ISZB 1S7TA 4N0UB 1BVKA 2DJMA 3P3YA 3L4VA 4G9FB 2H26A 4N0YL 2P5ED 1Y1UA 1XAKA 1T21A 4LRIA 1LEKA 1C5DB 4NB7A 5DQJB 2OL3L 1NFIA 2XXCB 3CXHK 3FBKA 3VXNB 4HKBA 1L4IA 3VW3L 3EYFB 4HXBH 4UMSA 2E27H 5I6NA 3MLSL 2YK1L 5AZEH 3FOMA 2IANA 1U8PA 2ZPKL 2OJEA 3TA3B 2H0PA 3EOTH 4NRYA 2LOEA 1F4YL 1TMCB 1MJ7H 3K6SB 4ZAKD 1EBPA 1IGYB 2B08A 4Z7IA 1PQZA 2QELA 2BFVH 4GP5B 2Z7UA 3CK0H 1O6TA 4LEOB 3UJJH 2LT9A 3V6BR 1ZK9A 4PGCA 5DRZA 1ZS8A 2H8PB 1E6JL 1KLGB 2AV1B 5A16A 4NM8H 1W0WB 2A7BA 4DZ8B 1RZFH 3NA9H 1XCQA 4GUOA 2UZYB 3SDDC 3GSOA 4FQXC 2LU5A 2A9BA 2FBJH 3CH1A 5AVZB 1ZHKB 2HX9A 3PJNA 3JV4B 5IHUH 4EN3D 4FF9A 2AW2A 4ABUA 2QGDA 1R47A 1JZEA 1GJUA 3NN8A 4GSUA 1F56A 4GI9A 1BW8A 1MFCH 5IQLA 2WXLA 3D18A 5TDNA 3OXRA 4LGSB 4KI5E 3ZDZE 1P0SE 3MRDA 2J72A 5DHEA 4TQIA 2YZ1A 2QHRH 3DV4B 1INDH 4LSQL 1QWUA 3ZKNC 3KYNB 2CJSA 2ZZUT 5FIEA 3PV6B 4QRRB 2X4NA 3WE1A 4HOMA 5LGKA 2YZ8A 2BSSA 3FTVA 5DQDH 2WXKA 5EF0A 5B7EA 3TBYA 3NCJH 1D5BA 5B8CA 3DJ9A 1HESA 2X4SA 3CZFB 5GS0D 5HYSA 2QADC 3FFDA 3ARGD 3L7EB 3ECQA 4LCCB 4M9OA 3TN0C 4XNXL 4ZW6A 4Z7NF 5T1MA 1HHIA 1QI3A 4OD2B 2C7UA 2KI6A 3HZMA 1FZOB 2EIDA 2BSTA 4B96A 3OC5A 3U0WL 3WV0A 3TURA 4IOSA 2Y2WA 4KVPA 4TPRH 3BESR 3TZVC 2CHZA 5CZXD 3KZ8A 2XV0A 2ODHA 5HGAB 3C5ZD 3QFJD 3KHQA 1JERA 4XBGA 5CGYC 4N9GB 2BS9A 3P0GB 4JFDE 4JR9H 3P0YH 4HIEA 1J1XH 1IV8A 5K33A 5GPRA 3WJLC 4JHVA 4AUJA 3DUSA 3X3FL 4HMCA 1DBMH 4KKQA 1EBAA 4KI5C 5FK9B 3WIIL 2K8QA 3DHJA 4RETB 3SYAA 3DXAD 2Y1YA 4OV6F 4KKPA 5D6DA 4MDJB 4UAHA 4OR1A 3I9GH 2RAMA 1T20B 1M42A 3OAYK 5HHMB 5F3HA 2F58H 1KGXA 1U8JA 4GG8B 5A40E 1RUKH 5EOTB 4HUWA 4GSDL 4N4YB 1OT4A 4P3CL 1KT2A 5GQBA 2O6DA 4KK8C 4AE1A 1NIAA 3CZLA 4FG4A 1E8WA 1FC1A 3JTBA 3SDYH 1RU9H 2F18A 1OTSD 3QUML 1IKOP 1IJ9A 1Z0MA 3MRRB 4L2YA 5L4JA 3RY6C 5FOBB 4JHWH 4R4BA 4MJIB 4GRWB 4KUCD 1ZV2A 3ZKSD 1FVEA 2FATL 4QO1B 5HVHB 3KPQB 3UPAA 1M1XA 4JM2C 4F7PA 2R0WL 3TC9A 2JI1A 3DHPA 3AROA 1JDAA 3Q5YA 5AL0A 4K5LA 3CDCA 2JB5L 3CCHA 1Q9KA 1WO2A 1MCOL 3DUUB 5D1QE 4LCUA 4JW3A 4DUWA 3SDXA 1UGNA 3MKKA 1QFOA 5CJQL 4RFNB 4K8RL 3WEMA 5IJVA 1DP0A 1WEJL 1YEDA 4EKJA 4BRVA 1RVFH 4D7BA 3KCPB 3GXUB 3VB9A 1HX0A 2DQFB 2X9YA 2VDLH 4N1EA 2H2PC 3LDBB 4WU5A 3FB8B 3EHBC 4DP8X 2WP3O 3DO3A 5IGXH 5BV7L 5A2FA 2OMUB 3EDKA 5E1QA 3RZCA 4N2KA 2G5BA 4PWKA 4UB0L 3VYPA 1PS3A 1QHPA 1KCUH 4I3GA 4P2QB 5D7JA 5MEPB 1QP1A 4B6ZA 1D5MB 4X5PA 5HHVH 4DP0X 1HN1A 3IGAA 4FKKA 4OJCA 5FFGA 2OXHB 4G6JH 4FQHB 3TBWB 5B39B 3GJFH 5CLWA 3IKCA 4YHOL 3HE6C 3TEZA 1T3FA 5SWSD 3LD8C 2NW2A 3BH9A 3QORC 1YEWA 1PX3A 1G9NC 5D1QC 4U1HA 3FSVA 4F15C 5AB1A 4KTGA 3HG3A 1JFQH 1FBIL 3T1FA 1XFPA 1HQ4A 3DTUB 1LD9B 1CFVH 4H2CA 2MCPH 3OXSB 4AXWA 5HYJA 1RZKC 4D9RE 4BHUA 3LKQB 4EI5B 1ASPA 3HFML 5C0DB 4IRJA 5DWPA 1BEYH 5HGHA 2YD2A 1EJ8A 3EJQA 2Z6FA 3VSQA 1N8ZA 3W2DL 5JW5A 3M6DA 1EJ6A 1FH2A 3LNHA 3VFOB 2Y1ZA 4PH8A 1DQTA 2AJSH 5CCKL 5FF6B 5T8IA 5ID1A 2ZAIA 3HC0A 3ARYA 2A6KA 3IDJA 4C4KT 4RFOH 3CDFA 4YHNB 1G7LA 2VXUH 5DO8A 1ZA3A 3DECA 3P9LB 4Z6AT 3AS1A 4WHYH 4WTZA 4Y4KD 2R4RH 1K85A 2WINA 3FRUA 4P4KC 1LP9E 2J2ZB 1NCIA 1GMIA 1QRNE 3LZFL 1ML0A 4Z78A 5CBAA 5CEZE 4GYBA 5E6ZA 1JPSL 1MFUA 2MQ3A 1IGJB 5DUPH 4AE0A 3LKSB 1QA9A 2NY4C 2GQHA 3EGXA 2XN9B 3ROOA 4BSJA 2X9ZA 1AGFA 2GC7C 3SDDB 4IK7A 4FQXB 4OIBA 4ZX3A 5EF3A 2AEIT 5M7QA 2IPKB 3HC2A 1G7IB 4MZ2A 4H8WH 5FYJE 3SSGA 1CGSL 3VXUE 1DN0B 3KPSD 4NENA 3F3HA 1MI5A 4XPHL 4JPIB 5CZRA 1AZNA 2O5ZL 1BVLB 2PXYB 1XSJA 4N85A 4WO0A 2DPKA 1A1NA 1FIGH 1TQBB 1GGIH 5JQ6H 1XF5A 4LOEA 1M71B 5I76B 2ADYA 1TTRA 4JLRA 2ZUUA 1BD2B 1BAGA 5IVXB 1NIBA 1T66C 2Z31A 1QUNA 4Y2DC 3H4HA 1CLYL 1E6OH 2A38A 5KG9A 2PLTA 3TN0B 4JPKH 1GGTA 1UZ6E 2FSDA 1DVXA 3U1QA 2N59A 3BEWA 4UYPA 1VGEH 4JANA 5ELIA 3SO5A 2YK1H 1DQDH 5I5MA 3NH7H 4HJEA 5E5MB 4GJTB 3GGWB 4PS8A 3LY6A 3VQMA 3FO1A 2H0FA 3DGDA 3PAZA 1TLKA 2BNQD 1NIFA 5C07B 2XSKA 5BVJA 3DIFA 1OB0A 2AZUA 2XKSA 5DQ9A 4DP2X 4RGND 3JWNG 4AT6B 1I85C 4YE0A 5E4AA 3EBHA 2FT6A 4N2FA 3JYCA 2IH9A 4TNEA 4K9JA 1ZT1A 4JUTA 2E9JA 2DLHA 1U8MB 1RI8A 2X3BA 3WTVA 4JKNA 2WMPA 5FW6A 5D7LD 2Z7ZA 2QKIC 3LS5L 3VFPB 1SQMA 1FYTD 3HLKA 4BM7A 2Y1VA 5T3ZE 2WBXA 3IN0A 2F8OA 4PBXA 4WI8A 1BZ9A 5FAAA 1K3ZA 4YZFE 2PABA 5EZOL 3PIQA 3MUGB 2Z8WC 4X7CC 3BMWA 4MMZA 4JQXA 2GSGA 2AQNA 2CDFB 2HKHH 5TE4L 2VLKE 5EU4A 1BGXH 1NDMB 2M26A 3CE1A 3WSQL 3LPWA 5C09E 3HE7B 1XH2A 4F33B 3F12A 3Q43A 4X98B 2ESVD 3L8QA 2UYLB 4U4IA 4JFOA 2UV3A 2V5SA 4MNGB 3IFPB 4XO4A 2J8UF 1OP3H 4GUQA 3WNKA 4M9PA 1S9VB 2CG9X 2XNAB 4NN6C 1V5JA 2F5BL 5EEXA 1FC2D 3RBSA 1HSBA 1HCVA 3UBXG 2ZXCA 3PWJA 4NNXB 1EHKB 2W1NA 3D0VB 4IYKA 3VQ2C 3WFDL 2CJUH 1XMEB 1EZSA 4DPRA 1G1YA 5EU7E 3II1A 4HHAB 2UY6A 2B15A 2V5YA 2WLYA 3NRQA 3NZSA 2OSLB 4Y4FA 3DV6B 5CP7A 3CVDA 5T33L 1V05A 5D4IA 1NCHA 3PHOA 2AI0L 5DA0B 1R17A 4F37F 3EFDL 4GKNB 4S0SD 3RL1B 3VNYA 1G9ML 4BQBA 1SJMA 1HEJC 3GSRA 1JTPA 4GRLC 4QRQA 5T5FA 1UD3A 2JB6A 3GRWL 5I1KL 2V17L 3LEXB 2XPGB 1AC0A 1YPZF 2WB1A 3TIEA 3BVWA 3O2DL 5TQ0H 3PABA 1DJWA 3ATDA 4WKZA 4Z3HA 3VMNA 4JGUA 4P3CH 2F61A 4PUBH 1T2XA 1KZQA 5D7EA 2X87A 4HS3A 1BDYA 3CXDL 1U9KA 3IJYB 5SX5K 4H8VA 3UH8A 5C08B 4H44C 2VZUA 4JM4L 2BSBA 4H25A 3BVNB 5EIIB 1QVOB 3QORB 4TSCH 4AH2A 3DX9A 5DK2A 2B0SH 2OI9B 1MHPH 3DX7B 3AADB 4K7FA 4BZ1A 2Z9TA 5KJRL 1DQJB 3BWAA 2OX5A 2XT1B 4CADA 4PB9H 2FATH 1G7PB 1M57B 4WHTA 1E8YA 3TBVA 4DERA 2QPUA 1DQIA 2ARJQ 1JNNH 1ZAGA 4ODVL 5FA3A 3QBTB 5ICZA 1C12A 4WWKC 5HHNA 4E5XG 1AMYA 2I69A 5F0PB 4D0CA 3C6LD 3VD2A 1NAML 2R27A 2NUTA 4HOWA 2BSDA 1HDMB 4K8RH 1CBVH 2KDGA 4FXKC 3DOIA 5DJDB 3HG1A 1A2YA 5IB4A 1U3HB 4A66A 5C0EB 3MRFB 3THML 4CU8A 1ZIBA 1JV2A 3KBPA 3V9CA 1PD1A 4XCFH 2VDOB 1NIEA 4ZRGA 4PJIA 4LB8A 1S3KH 1T1YB 1U0QA 1NCUA 3F6JA 3NSFA 1LEIA 1UZ8B 2FJFB 2OL3A 3VI4E 5CD5D 4LVEA 1JZGA 1WGVA 1BX2A 2MTAA 2ZP8A 2ZICA 2PTUA 2C7FA 1JHKL 2D9CA 2GB2A 4R5VA 3MJ9L 3S98A 3UG3A 5D7HA 4K23L 2XVBA 3QQNA 3OKOA 5BRPA 1M2OA 4YDKL 1J87A 3PFUA 5D96B 1BZ7A 1FLRL 1AHWC 1AS7A 2Y7LA 1S9KC 2HJLA 1KLUB 1M2VA 5F7DA 3QDME 3B7SA 3SBWA 3QCVH 3IFOA 1YMMD 4KRNA 4AQ1A 1CLCA 4TM9A 4MBOA 1BYPA 1ZT4A 3QNYB 4DZBA 4ICXA 2GCYA 4XHJC 1PKQE 3BZEA 1I7TB 1I7RB 4PJGE 3MLUL 4R3SA 3MUUA 1IAIL 3FO2A 3VFTA 5AFAA 5J11C 3QRBA 4LHUA 2WXOA 4P23B 3NAAH 1G9NL 3QYMA 5HHQB 1R24B 2AEWA 5D6CB 2ZQKA 5EO0A 5LCVA 4YDVA 5E95B 2P7TA 4WZ9A 1KJ2L 4IBQA 3TXAA 1TKWB 1AKJD 2YFNA 2ZUQC 1RZKL 2V9TA 3X3GH 3QIWC 1TPXB 4HETA 5H2BA 1ID5I 3CFEB 3L4ZA 5CCKH 4Y19B 3U2SB 4PRDB 4QHKI 3RTQB 3WN5C 4X7EC 5E4EB 2YBGA 1F3JB 4B9JA 1QSEB 1JK8A 3IPBA 1IIKA 4NCDA 3FN3A 3NJGA 4NT6A 1IGIH 3VTMA 4A7GF 3IDIA 1IAMA 1XH0A 4GXFA 1MQ8A 1ZE3H 2VMDA 4KV5F 5DHYB 5A6MA 4G9FA 3BP4B 5C6PB 1JD9A 4PVMA 3BD4A 4RNRB 5D72L 3UO1L 2MKLC 4JDTL 5CZVL 5HDQL 5AD0B 1C5DA 3OAZH 1PY4A 4CGUB 2OR7A 2XKUA 3TFKD 3EYFA 1YNTB 1PGRB 2Z35B 4AM0B 4UT7H 1IC5H 3MV9B 3N41B 4J4PA 2GBVA 3PWNB 3QUYB 1GHFL 4PU2A 3A67H 3TA3A 1RLWA 1X5GA 5DK0B 5IQ9B 4L0YA 4X6EB 2N01B 2P8MA 4W1TA 3K6SA 2GT9B 1AHKA 5DVLA 1F6AB 1OP9A 1IGYA 1QBLL 3FUHA 1OTUD 5D93C 4F1SA 4LEOA 5FLVA 4YPJA 5MP6H 2Z7YA 4DVBA 4LASH 2H8PA 4AV5A 1KLGA 2AV1A 2I85A 1KGUA 1SOQA 3APNA 1W0WA 1FSKC 5EEVA 4ORGB 2V2TA 2PP8A 3HCVB 4MNHB 1ZHKA 1OQOA 4NQED 3SQOL 2WTRB 3FTXA 4JRYD 5LWYL 3HA0A 3Q8EA 3VGFA 3QUXD 2ZIDA 3W1ZA 1U2HA 4PS4L 5KS9F 2HT3D 1NIDA 1XGYH 2W07A 3F62A 4PPTA 3NJFA 4U0RB 4G11A 4LFHD 1NMAL 1MCPH 4LCIL 2P5EE 3Q0HA 2M8XA 2YRZA 2OSXA 3V0VB 5DZPA 3C60D 2FEEI 5AEAA 3KYNA 4PI0A 5CEZL 3PV6A 5DHVB 3PY9A 1WSST 4HIJB 2AJZB 4QRRA 1RJZA 3LXUX 1EIBA 1COBA 1SJXA 4RMWA 4URTB 1TTBA 2F7OA 4EIBA 1ZCRA 4PWIA 1S46A 3ZLQC 3CZFA 1CU4H 5HYIA 2QGBA 3L7EA 2NY1B 3PAUA 1QFWI 1WFUA 5JOFB 4BK5A 4Q6IC 3P11L 1RIVL 2BC4B 2J3SA 3F7KA 5FXCH 3ULUD 5EFIB 4HC1H 1FH5L 5FYJL 4P5MB 4ZW3A 4OD2A 7TAAA 4GRLB 1CXLA 3CZSA 1URZA 1NM9A 4H8HA 5BCAA 1R3KB 1SVBA 5CD3B 1ESOA 1EJOL 3OJVC 5C0NC 3T6WA 4O2EB 3BSZA 4TSAL 4IHBA 5HGAA 4BXSV 1IT9L 15C8L 3LZLA 2F7RA 2FNBA 2VL5A 3GDCA 4N9GA 3VXTB 1HKFA 3HNSL 1U8QB 1UFGA 4OIAA 3T0ED 4X7FC 5FK9A 1P7KB 4HBCL 2D2CC 1OHQA 1UD5A 3NCMA 25C8L 1YRKA 2FD6H 3LCYA 1J48A 4WHYG 2COVD 1XSIA 3RWCB 4P2RB 1RXLA 1F4WL 1OP5K 3BGMA 4XMXA 2JJWA 3MRCB 5JW4R 3EBGA 5GZND 4GG8A 5F7KC 1VERA 4ZMXA 5EOTA 3WDHA 5IQNA 3TYGL 1Z9OA 4FE9A 3WHE1 5D4QA 5G4NA 3UTQB 3QIUA 4J8RB 5HGDB 3PJSB 1IKFH 1LQBC 3HHMA 4P5SA 4ZAKC 9PCYA 1EH9A 3U25A 2CAKA 5MEQB 5F6IC 1KEMH 1XT5A 4UV7L 4GPVA 3V4PL 4NBYB 4JPWL 1T04B 4LOFA 5EZPA 2X05A 2AI0H 1QI5A 3WFBH 4RGMC 5FOBA 2NNAA 1G9MH 1EHLL 4MJIA 4L1BA 5T3ZL 5I1DB 4EN3C