4MFHA

Crystal structure of m121g azurin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALGKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Copper-sulfenate complex from oxidation of a cavity mutant of Pseudomonas aeruginosa azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4mfhA00
2N0MA 1HAUA 2HRGA 3TASA 9PCYA 1VLXA 4A2GA 1EHKB 1NIDA 4BWWA 4NB7A 3AG3B 1M56B 5FC9A 1PLAA 2GSMB 1XB3A 4G70B 2FWLB 2AZUA 2AZAA 3CDZA 1OE1A 1OCZB 4N4YB 1AR1B 3X1NA 1B3IA 1OCCB 4A67A 4P5SA 1SFHA 2YAMA 2FNWA 3ASOB 2JXMA 3WNJA 4E9VA 3PAVA 4N8UA 4E9YA 1BXAA 1ET8A 5B1AB 4E9SA 2YAEA 1FFTB 5TK2A 3UAEA 1AS8A 3JTBA 4DPAX 1ASOA 5A7EA 1SDDA 4KNTA 2P80A 1PLBA 2YXVA 5B1JC 1URIA 3PCYA 3ZX1A 2GI0A 3T6XA 1JXFA 4FA7B 1BEXA 3HEIB 1A4CA 5I6OA 3FQ2A 5D4IA 1A4AA 5AFAA 2GHZA 2BWIA 2PCFA 1W8EA 2EILB 3WI9A 2HXAA 2WO2B 1DYZA 3FPXA 2IAAC 6PCYA 2J5WA 1J9RA 1KGYE 2GB2A 1BXVA 1ET5A 4G7SB 2CUAA 2I85A 3ABLB 1WS8A 2BWDA 1R1CA 4RH4A 4AKPA 4K9JA 2DV6A 1GYCA 1OCOB 2BW5A 4KOBA 4YVNA 1J5DA 2QT6A 4E9WA 4AKQA 3SBQA 2DY2A 3IEAA 4TXVB 2PPEA 3UAAA 3V9CA 4DPBX 4UF7C 2XV2A 1HAWA 2TSBA 3S3BB 4M3HA 1NIEA 1KV7A 2B3IA 3U25A 1NPNA 4GP5B 1FWXA 2UX7A 3BVDB 1ASPA 2IH8A 5D4HA 1JZEA 3WG7B 1BQKA 1WS7A 6PAZA 3QJRB 2B08A 3S8GB 4KO6A 1HFUA 3G5WA 2AFNA 2R7EB 4YSTA 1IKOP 1NWPA 3AZUA 2CAKA 4Q8BA 4HZ1A 5D4JA 2XYBA 1JZHA 3GYRA 1MZYA 1ZDSA 4F2EA 1AS7A 4MFHA 1AZBA 1WA1X 3WIAA 3NSFA 1J5CA 2IDTA 3OMNB 1JOIA 2QDWA 1UATA 3NSCA 1BAWA 2BP0A 2CALA 1I53A 1SJMA 1TKWA 2DYSB 2YAFA 3D12B 1ZDQA 1PNCA 5I5MA 2UXVA 3L45A 2PPAA 4X4KA 3SBPA 2IWKA 1IC0A 1BQ5A 1IUZA 1E5ZA 4KO5A 2VM4A 3UACA 3X1EA 1ET7A 3TA4D 3SQRA 5E9NA 4CSZA 5B1KA 3C75A 1DZ0A 1OF0A 2FQGA 2FTAA 2GC7C 2QPDB 2XV0A 2VN3A 3HB3B 1GSKA 5IY5B 4EF3A 5I6LA 5ANHA 2BHFA 5I6MA 5EHFA 2UXFA 2YAHA 3CVDA 5I28A 1A65A 1JVOA 3FPYA 1J9TA 2IH9A 1T5KA 2H47C 3FSAA 2FT8A 2DWSA 2HX8A 3MBWB 4YSAA 4W1TA 4BK5C 1YLBB 1PF3A 4YSEA 2BP8A 3N2JA 4DP5X 4YSOA 1GR7A 1M57B 1J9QA 2Q9OA 1V55B 3NJNA 2BZCA 3ZBMA 1PZAA 1JZFA 4HALA 3NP4A 1AQ8A 2H3XC 2W88A 3X1GA 5LDUA 2IDFA 1ETJA 1SF5A 2FQDA 3NJJA 5PCYA 5I6PA 4ENZA 1KDIA 1BYPA 1GY2A 2ZXWB 2HX7A 3T6WA 3CVCA 5B3SB 1A4BA 1ZIAA 4KNSA 1SFDA 4DP7X 2YARA 3PAUA 1PLCA 3QPKA 4HIPA 4NAJA 3EHBB 4W9ZA 3EH3B 3FT0A 4PAZA 1JXDA 1TEGA 2XU9A 3X1BA 4G72B 1ID2A 1ZIBA 5F7BA 4A66A 1F56A 4HCGA 1EZLA 2MRYA 3DIVA 3PPSA 2VW6A 1AIZA 3AW5A 3QJVB 5I5IA 2XXGA 1ZPUA 2LLNA 3X2QB 1AG0A 2I7OA 1GS6X 1GS8A 1CURA 1SF3A 2BO0A 1IBYA 1L9OA 1ADWA 4BDVB 4NERA 3DTUB 3T71A 2EIJB 4HCIA 3NJLA 1L9PA 2XX1A 4A2FA 1XB8A 4HAKA 3PLYA 3ZIYA 4A2EA 3PAZA 4YSCA 3AY2A 1WAEA 2PPCA 1NIBA 3NT0A 3IE9A 2J55A 3FYEB 3NP3A 3UGEA 1PZBA 4BWTA 2E86A 2YAPA 3FSVA 3H4FA 5I26A 2YQBA 1BXUA 2TSAA 3IBOA 5PAZA 2FJSA 3TU6A 1TU2A 2VSMB 4YSSA 3NSYA 4GYBA 2EIKB 1ILSA 1PNDA 2X88A 3RYMA 2HX9A 3FQYA 3T6VA 1L9SA 3EH4B 4YSRA 3S3CB 2XXFA 3IN0A 3NJIA 2WO3B 2H5UA 3TBCA 2OCCB 1SNRA 3T6ZA 1GS7A 2Y1AA 3ABGA 1X9UA 2OJ1A 2UXTA 3JT2A 3NJMA 5I6KA 1OE2A 4KO9A 2CJ3A 2J56A 1TEFA 4A68A 2IWFA 4DP6X 4YVUA 2ZONA 5I5JA 2X87A 1JXGA 2NRDA 3ABKB 3ZDWA 3CVBA 2J57A 4E9RA 1WA2X 1E67A 3WKQA 4A2HA 2HZHA 1AZUA 2FQFA 4DP0X 1IBZA 4JHVA 3FQ1A 2XLLA 1NICA 2P80D 2BW4A 3TBBA 4DP2X 1A3ZA 1BQRA 2JKWA 1SDDB 3FSWA 1JVLA 3ERXA 4DPCX 1KCWA 7PAZA 2AANA 2GIMA 3AG2B 2R7EA 3UABA 3UADA 4WTQA 1RZPA 2ZOOA 4KOCA 4KO7A 1NWOA 3ABMB 2GBAA 2GC4C 1AOZA 4QKTA 4AKOA 4ZK8A 1NIAA 4YL4A 3IN2A 2XX0A 1AG6A 3OM3B 3NYKA 1GW0A 1PMYA 2DWTA 3ASNB 4JHUA 1W6LA 1N68A 3H4HA 5B7FA 1NDTA 2UXGA 1AS6A 4YSPA 2IDQA 1RZQA 1NINA 3NSDA 3FU8A 1MG3C 4E9QA 3X1FA 2EIMB 1OOWA 2DYRB 3KW8A 3S8FB 4DP8X 4GXFA 3QJTB 1KBVA 1E65A 2I7SA 3H56A 3FSZA 2FT6A 3OD3A 1QNIA 2VW7A 3BQVA 3EH5B 1WA0X 4E9XA 2Y69B 1JZGA 3FYIB 1XMEB 3NJFA 1SHXA 1AZRA 1OCRB 4DP9X 4GY4A 3MX0B 3EF4A 2VM3A 1GY1A 4L0PB 1CYWA 1KYAA 2XV3A 3OQRA 2IDSA 2WSDA 2PP8A 2RACA 1V54B 1CUOA 3DKHA 4BXSV 1CYXA 1L9QA 3T9WA 4UANA 2MTAA 4QLWA 3FS9A 2VSKB 2PP7A 4HHWA 3QQXA 2QDVA 2YXWA 1NZRA 2XUWA 2BP0B 2IDUA 1E5YA 1MZZA 4HCFA 4HHGA 3WKPA 3S3DB 1AAJA 4GP8B 4CSPA 4F2FA 2BZ7A 1A8ZA 3V9EA 3NJGA 3WNIA 4DP1X 2YAOA 1RCYA 2YAQA 4AZUA 2W8CA 4WKXA 4G71B 1E30A 2XWZA 2CBPA 4F7KA 5B1BB 2AVFA 4FAAB 1SHWA 1PAZA 2PPFA 3FU7B 4M4RB 2HLEB 1ASQA 2Q5BA 2FT7A 2XVBA 1JZIA 4G7RB 5F7AA 2VMJA 1XB6A 2CCWA 4P5RA 4PCYA 3NJKA 4GP4B 5AKRA 4AX3A 2PP9A 4A2DA 4YSQA 1KBWA 1NPJA 1KCBA 2A3TA 3AG1B 3FU9A 1AZNA 3CZUB 1L9RA 1L9TA 4AI7A 1J9SA 1QHQA 2ZWNA 4UAHA 1AZCA 3SBRA 4YSDA 2PLTA 1QLEB 4BDVA 2HRHA 7PCYA 3CDZB 3QJSB 1PZCA 1FA4A 1MDAA 2VW4A 2BP8B 1AANA 4JKNA 4DP4X 1OV8A 1V10A 2UX6A 4Q89A 3NJHA 4BXVA 3N55A 3GDCA 1X9RA 3OMIB 3OMAB 5B7EA 3KW7A 2PCYA 1NIFA 1N70A 1OE3A 4KNUA 5TK4A 4E9TA 1PY0A 2FQEA 4G7QB 1CC3A 2QPEB 3FU7A 1JZJA 1NTDA 5I6NA 5B7MA 3CG8A 1JERA 1AACA 1PCSA 1ILUA 2OV0A 2PPDA 5B1JA 5AZUA 2EINB 3QJQB 3GXUB 8PAZA 3AG4B 3QJUB 4BWUA 1ZV2A 1W6WA 1MG2C 3PXLA 4YSUA 1KDJA 1BYOA 1M9WA 2IWEA 2JFCA 1RKRA
chains in the Genus database with same CATH superfamily
3FFCB 2XKUA 3U9UA 3PF2A 1L5GB 1N6VA 4PJAE 1HHKB 4LHUB 5IVZA 3ULUL 2EYSA 1V8HA 1AR1B 2VDOH 3CIQA 4WHTB 4HS8L 3WL9A 4ZO6A 1E43A 3WIFB 3MO1B 3QHTC 5AZEH 2ICES 1G7HA 5TFSL 4XCCH 1ASOA 4IKIA 1SDDA 3RZCA 4WKZA 1PJWA 2Z35B 2VZ3A 4YIQB 3QFDB 2ZSVB 1BEXA 2CWRA 1FDLH 3QUZD 2IF7A 2MQCA 3II3A 3S34L 4R97B 3TFKC 5LG6A 1AI1L 1O6SA 4OF8A 4UQDA 4WCYH 1OGAA 1IKFL 3L2MA 3CFJB 1HHIA 3TFBA 5ICZA 1NDMB 2A4ZA 4XB3A 4J6IA 1T89C 4I0KA 4M6AA 5DD6A 4XWOC 3VXTA 3NIGB 2ZKMX 4XMZA 4Y16A 1JRHL 1KGYE 2BVPA 3G5ZA 2NLJA 3I3BA 2YPLA 3RUGB 5FM4A 5JDSB 5FYLE 2YMOA 4OZ4B 1B90A 4WO0A 4K9JA 3Q44A 3LQZB 3RJQB 4HQQL 5DJ0A 5IHZB 2IV9A 3KHQA 3CSYB 4PRNA 3OXSA 2GK2A 3TYGH 5GIRA 5EIVA 5DEZA 1NGYB 2AJYL 5KZCB 1A2YA 2CO7B 1UD6A 2CGZA 4GQ9H 3SJVB 1BQUA 1BVOA 1KEGL 3VXRB 5BRZA 4MRCA 3KWWA 2O5YL 4OGZA 3R06A 4J6RH 3LZFL 4NC2B 5D7IB 5HPMB 1M4KA 3LMJL 3U4BH 4NZFA 4R7NB 4XVSL 5E4AA 2PW1B 5C07B 1A5FH 2X4PB 1MXGA 3MRLB 2MEJB 3GDBA 4HIHB 5HY9A 1UKSA 1AD0B 3ALPA 3IPBA 1H3TA 3KYKH 2EEDA 3LNGA 4Y2OB 3CDFA 4MHHG 5D2NB 4CVXB 3BXNB 5I73B 1BPVA 4X4YA 2WLHA 2QHLA 3CFCL 4BQ9A 1MDTA 4OCMC 5E8NB 3CXDH 5HVGB 1HCVA 4JNXA 1UHVA 5B8CA 3HMWH 2JJTA 4P2RD 5DMIL 1I31A 4X98A 1LVEA 2PXYC 4DW2H 3IRZA 5FUZL 2YFOA 4ZW3A 2MFNA 3VM7A 4G82A 4HFUL 4AJYV 4OD1H 1MI5A 1N67A 4JJ5B 2CO1A 4FFWC 5HD8D 5JW4Q 2VABB 3MUY1 4L5FE 1A9EA 1E0OB 2E7BA 4GQZA 4OZHE 1M1XA 2QQKL 4N2LA 4IRSA 4TS6A 3S35L 3HPJB 3EYFB 1RK0A 3QEHA 4PJ7B 1FYTB 4K5NA 2WVUA 3O8XB 3HLAA 4X6DB 4ZJ9A 2EKSB 3DO7B 3O2WH 3CSFA 1T7WA 1FH5L 3O3EB 4JM2C 1CDBA 1X7SA 1F3JB 1ZA3A 4PBDA 2WZ0A 1U8PB 1LEKA 3SE4A 3MV9D 1Q9OA 4MDIB 2W60A 5C0AB 2N59A 3G7TA 4KDTA 1T2JA 3BJLA 3ILQD 1ZLVK 4FQCH 2MTPA 1J1XL 3CN4A 5IFHL 4ZT1A 1T5KA 1OXYA 2FT8A 3BISA 5IT2L 2MJWA 3CLEH 3V6FB 4TOYL 4ZD3L 3BVNA 2VGLM 1KXVC 4QNPE 1QYGH 5IBTL 1NBQA 2R0KH 3I74A 4Z7QF 1KPUB 3CN3A 5LKNA 4DTGL 3KJ6L 3DRTA 5AW0B 1UXSB 1XCQA 1EUTA 4MRBA 1OCWL 4LIQL 4NHUA 1WGVA 3WJMA 5FYKU 1TNNA 1D9KA 4GW5B 1AQ8A 2JJSA 3REVB 5JHLL 3O2VH 1BLNA 3V0IA 5HPOA 2BLFA 1JDDA 1NCDL 2R9HC 1AD9A 3RURA 2GBUA 1KDIA 3L3IB 1XBDA 3PXHA 4LSVH 1GMEA 5EZJA 4IRJC 3S35X 4XCFL 4XMLH 2HG5A 4MB4A 4QRPD 2XA3A 4HIPA 1GOGA 3NABH 4PG9B 2B1AH 4G6KL 3VH8A 1CQYA 5AL0A 4NAJA 2ZPKL 1NCTA 5BW7A 2G3ZA 3QNXA 2NW3B 3S6CA 1J0HA 1Y6NR 4M7LT 2JCCA 5MENA 3E6FB 3HG5A 2H9GB 3WTTA 4M6MH 5JW3L 3O0LA 2X10A 3T4AC 3HUJA 4LFHD 3HNVH 1VIWA 5EMYA 3FFCA 5EEVA 1KFAL 2WXHA 1L5GA 2OMWB 2ZCKL 1UM4H 4UT6L 2VLKA 2NT1A 1ADWA 3RKDC 4PB9H 2EXWC 4LHUA 3C09C 5ITBL 4C59B 5GS1C 4GO6B 4YZFF 4IU2B 3SDCD 4WV1B 2LFEA 4M93B 5G55A 3MO1A 2OMVB 4P8QA 3WTSA 1IEBB 2J55A 1JGEB 1PZBA 1JZ8A 1A9VA 2VRAA 3FUHA 1C5DA 4PTTB 1DQDH 3JV5A 2Z35A 4WFEE 3QFDA 2ZSVA 2NY1D 1RPUA 3RTQB 4BQ6A 4G5ZL 3RZWA 3ULAB 3MFFA 2FBJH 3F65A 5KJ7E 1X6NA 4R83A 1SQMA 1NDMA 1Z9MA 4PRBA 1RJLB 2K6ZA 5J7CC 4PD4K 4UWQB 3BVXA 4PJXB 1VEOA 1QMUA 1YHPA 2UZIL 3ELQA 5CLXA 5DO2C 3DSFL 1UWEH 4AYEC 4YE4L 1G7JB 4OZ4A 1OE2A 1P2CB 1SXZA 2DQDH 3LQZA 4PJEA 5LG1A 3WS6A 4ACPA 3CSYA 2CBMA 2Y5QA 1G7QB 1MY5A 2LFGA 2ENJA 1YEIL 4AZ8B 1WA2X 2CO7A 5JHLA 3BSZH 3GRBA 4W9DC 3QZPA 3NK3A 1TUPA 4HGWB 3VXRA 3BW9B 4AQ1A 2DQTL 4X9YA 1SQ2N 1EHAA 2ZWKA 1WHPA 2EE6A 3Q2NA 3QCTH 4TQHA 1JNHB 4DP2X 5D7IA 5HPMA 2EVFA 5LXGH 2JKWA 1SGKA 4XNDA 1YEGL 2BSBA 2PW1A 4FHJA 2X4PA 4WW2F 3MRLA 2UY6A 2X2HA 3GGWB 4HIHA 5CN1A 1AD0A 4MA7H 4FG0A 1HXKA 3UADA 3ZTNL 4YDZA 1U93A 1G6RL 4APQA 4BA8A 4Y2OA 3VQ2C 1I1FB 2NY4B 4I18A 5EU4B 1CK0L 3VXME 3CFTA 1VPOH 3BXNA 4Z7VB 4CVXA 4OGQC 5CBAB 1WZLA 2R1WB 3NPSB 5E8NA 5CUSL 2DQCH 1EV2E 2VR4A 4IBWA 2Z7UA 4UT6A 4EO5A 2Z8RA 4P5TB 1KLFA 3NRFA 1QKZH 1EDQA 3FOMB 1R0AH 2I5YL 1YAIA 1W6LA 5HYQB 4HJJH 2ENSA 2GJ6A 3NESA 4OKVB 2W92A 2ADGA 3T3ME 4OGAC 1T2QH 3BGFC 1RZFH 1SM3H 1U8KB 4KUZL 4PTUA 4R8WL 4YDKL 4JFPA 4DCQB 3CVHH 3NEXA 2VABA 3CZNA 2UWEE 2RGSA 3K8KA 3VVWA 3E2HC 2YRBA 5T5NF 5I1GH 3HPJA 3EYFA 3H56A 4PJ7A 1ZXQA 4HG4K 1JXKA 1OD9A 3GIVB 3WS3A 3ULVE 4E9XA 1YECH 4XZUA 3D85B 3O8XA 4MQ7B 2M83A 2FWOA 5D7SL 2CUIA 4F9LC 4X6DA 1YUHB 4TVPH 3VU2A 1MAMH 2EKSA 4QF1B 1LK3H 3MRPB 1RUPH 1JIBA 4JE4B 2IGTA 2EDFA 3M17A 2M8XA 4PEEA 2CMRH 4GRMA 1F3JA 3L1OL 4FJZA 1U8PA 2GQHA 5C0BB 3GO1H 5FKPB 4KJWD 2AVGA 3APNA 4E2OA 2X4OB 3VW3L 4DAGH 4TTGA 2EIDA 4NBYB 2I9LB 1JG9A 5DQDH 3WUWB 1ETA1 3TV8A 1G0DA 3ILEA 2HJFB 4BM7A 3MRMA 1RV6X 2JB5H 3ULSA 5C6TL 4Z7OB 3QYCA 2HB0A 2PO6D 3DJSA 5HYJE 1DVZA 1KPUA 4E5XG 3ZTEA 3QO0B 3GZPA 1LNUB 4ODHH 4X8GA 3EYUH 1UXSA 3MLUH 4PRPB 4XHJD 3TA3B 4S0TD 4TPRL 4TNVF 1AFVL 4Y5VB 1MIEL 4KK9D 3VACA 4MJID 2PTVA 4HXAL 3VI4B 4TF4A 4OH2A 2AVFA 2HRPL 1XIWB 3R19A 2O6PA 3SKUD 2V0AA 1Z32X 3L3IA 3N9GL 3P2TA 5GHWH 1G6RA 2XVBA 3CQQA 2ED8A 4L1HA 2N56A 1T20A 1XZWA 1YMMD 2OCJA 2AK1L 2BCKA 4NAQA 5IGXH 4WI9A 4OLVH 2AJSH 3BYTA 4MMXC 1UA6L 4BFGA 1UOWA 1N0LA 3D0AA 1MHEA 3QXVA 3E6FA 3RVUC 2H9GA 3SCMC 3CFMA 3IKKA 2Q76B 3RIFK 3GRWL 3ARZA 3VRLF 5IMMB 5IROA 5ADPL 4NKIL 5ID1B 3CFQA 2OMWA 5IK3B 1A6VL 3K0YA 4YHYB 2XBDA 1QBAA 4D7PA 1R5IA 3WLBB 4PIBA 4YMPA 4A7TA 3RGHA 5HDQH 3WHXB 1P4UA 1UB6A 3B2VL 4IU2A 1XGRA 4WV1A 1YEFL 4FF9A 2EJ1A 2HWZL 3VQLA 1OY3B 1P9MC 2K9UA 2OP4L 4YGVB 1IEBA 1V05A 1NCAH 1TJHL 1ZV5A 2VDLB 1JGUH 3O81A 4X0KA 5D9SA 3V52L 1NIFA 4PTTA 4KNUA 3P3SA 2EYTB 4RQQB 2IFFL 4P59L 1KSRA 3ASWA 2QPEB 3DLQR 3HG1D 4FNLH 3RTQA 3EF7A 4WU5B 3F12A 1V3JA 1JERA 4NC1E 4XPGL 2NX5E 5JZ7D 2OL3B 2NTFB 4G5AA 1RJLA 3BPOB 4GPVA 5A6MA 1WTLA 4LHQB 1HXMB 4AVHA 3MNWA 4B53A 1N5YH 5C09E 5SWSE 4YQXL 5BS0D 2HFFB 3G6JF 1EH9A 5EO1B 3US9A 1G7JA 4KRMB 1HAUA 1P2CA 1KT2B 1KTDA 1VLXA 1EDHA 1OM3H 5I1EL 3TVMB 3UP6A 1BQHA 4YX2H 2F19H 1G7QA 3NPZB 4OZGE 3DA0A 3WD5L 1XGTB 1MH5B 5EZIL 4AZ8A 2OAAA 1U42A 43C9B 3K74B 4GO8A 2XZQL 3NTCL 3OGCB 1B3IA 2WINB 4GI9A 5GRUH 4BFFA 3BW9A 4CC4C 4NOBA 1KGWA 3NFNB 3GRGA 3NZHL 4HJ1A 5I5MA 2BFVH 3QQ9C 5B1AB 2Y2YA 4U6YA 4QJ5B 2WIMA 4FMVA 4OFPA 4LEOB 4NQDB 3B4NA 2YRLA 2D9CA 3FAXA 3GGWA 1WLHA 4KVNL 3T6XA 3T0ED 1U36A 1XSIA 4XNXL 2VLJA 4G8AC 5EBLB 1OT2A 1I1FA 4Q9QH 5EU4A 5AFAA 4LLMB 3GRWA 4MD4A 3V0DA 3WI9A 5CBAA 1MQKH 1WZKA 2R1WA 4MJ4A 1C1EL 1P1ZA 5TF0A 2DLTA 4DKEH 4P5TA 4AENB 5EO9B 3RFZC 3FOMA 5EU3A 4B9FA 1AGDB 3P3YA 4G7SB 3F6IA 4L9LC 3AABA 4OJDH 5HYQA 1F4YH 4OKVA 2YD7A 3SKJL 2F8XC 1TPXB 3GXFA 3Q8EA 1HCYA 2MCPH 3SPVB 1R5VB 4K3DH 4AKQA 1UWFA 4DCQA 2ICCA 5ES4B 4TXVB 2AQ1A 4NO3B 4ZOEA 5F8QC 3SE3C 2GAZB 5FAAA 2D7PA 3LHAA 3T2QA 3U25A 3UTPD 4XXCC 5D4QA 1NFKA 4MQ7A 1HYRC 5EUOE 3U2SA 2WBJB 3QCVH 2BS8A 1YUHA 2CNYA 2IH8A 4L4TD 3VXNB 1MHCB 1R17A 4KVCH 4MMZA 3MRPA 1ND0B 1WWAX 2B08A 5FGRA 1KULA 4ANXA 5JXEC 5IREA 1JPEA 1FPTL 4C56E 2ICEB 4JM4L 2R2BA 5C0BA 3ZKSD 5FKPA 5F88B 1AO7B 4XWGH 5FOBB 2OL3L 3FQXA 2CR0A 4Y4KC 1F3RB 1FRGL 4S1DC 2VXTL 1OP9A 1LILA 1RFDL 2DLHA 2ZJSH 4M1DL 4DEWA 4U31A 1HEZA 3WIAA 3R1GL 2VXQA 1RXLA 3TZVC 3H55A 5HHMD 1UATA 2PYEB 1DVFC 3KBFA 5CINH 4N1CA 4NHCH 1LNUA 1T5XB 3KWXA 4OLZL 2KLTA 4Y5VA 2IG2H 3SBPA 3T4YB 3KDMB 1ZEAL 5DU7A 4DKAA 2OKMA 3VI4A 2L7EA 4QHUA 3BUPA 3V5DA 1BM3L 3VH8G 1HS6A 3LVEA 3BGMB 3WY1A 2IOIA 2D8KA 3I3DA 5EOCH 4I9WD 4FI8A 1IC4L 3F8UB 4LRIC 2Y23A 4NT6B 4KZEH 3GHPA 4MZRA 3Q2VA 4FTVE 4KJQD 5E24E 4WHYG 2XV0A 3U9PH 1RURL 3RVTD 4A55A 3PQYE 2X0UA 1DO5A 4FHBD 4N0CD 3VQMA 4F7EA 4PLJD 1QPPA 3QIBD 4UMGA 4WNQB 1HINL 5T1KB 3RIKA 1HEJC 1NKRA 4CMMB 3U7WH 2AV1B 4LHUG 4HKBB 4GMTH 2GK0B 1CD9B 5IMMA 2MNWA 1CBJA 2WXIA 1G9ML 3TCXA 5ID1A 3EDFA 3AROA 2K7PA 1M2VB 3RBGA 4QXGL 2AQ3A 4KMLB 3IJ9A 2ERJB 2R0ZL 3F7KA 3CH8A 5EA0L 3WLBA 5DJAB 3WHXA 1I1AB 1GGIH 4J27A 5LAPA 4GXVL 4CL7A 2FSEA 2G3NA 4WWKD 4WUUA 2Y7NA 2FCBA 5EDXA 2BZCA 4LSPL 5F7FA 1H3WM 4WUKH 4YGVA 1MCKA 3L3OB 3X1GA 1WD8A 4AV5A 2IJ0C 3LS4H 2XPGB 1MFUA 1J10A 1GW6A 4MXVE 4JPQA 4PW3A 3ZUNC 1SFDA 3G08B 4N2KA 1VADB 3EYQD 1SEBB 4Q9BA 5F0LB 2OL3A 2NTFA 2ZXDA 3PWPB 3ZYIA 2TRYA 1T03H 2J8UE 2WWKT 2X1QA 1HXMA 3VA6A 5CR8A 4Z3JA 5EEXA 3ATFA 2H3NB 3U1SH 3BQUB 3BE1L 2HFFA 1WUZA 4P04A 2WXJA 5D8JL 2GVYA 3EOTH 5EO1A 2VW6A 5BZWB 2X2UA 3QJVB 3RVVD 4OZIB 4JAMA 1KT2A 2WO4A 1IBDA 3DVNB 3X2QB 2AXJA 3DMMB 3MOBL 3VMNA 4TUOB 5F1SA 2FWSA 4XN7A 4YHLH 3O6ML 4NERA 3DTUB 1TXKA 5JXAH 2NYKA 3AFLA 4O9HL 3ZYZA 43C9A 3FSOA 4Z7QB 1HL9A 4OT1L 1D6EA 3OGCA 1I1CA 2WINA 2QGDA 3MA7B 1Q72H 3NFNA 3D30A 3RJDA 1WAEA 4EDWL 2NYYC 3IE9A 1KXHA 4RFNB 2RHEA 2XT1B 3F83A 1MNNA 4G3YH 5F93C 4BJLA 1NCHA 4LEOA 4NQDA 1XEDA 1VGKA 3D0VB 4BD4A 4AV0A 1ACYH 4AYID 4N8VA 5EBLA 4C58B 3QW9A 5BOZG 4F80A 1DJHA 4H2CA 1QLEH 3MRJB 3ARPA 5CIPB 3VE0A 5AD0B 1G7LB 1RL1A 2V2TB 4R4FH 4AIEA 4QDGA 4AENA 1SOKA 1GS7A 2CLRB 3BWUF 5EO9A 4KZCA 4AQAB 3HR5B 3QUYD 5J13C 1AGDA 1AZVA 3F7RA 3QI9A 3BT2H 1A3LH 2NNFA 4UB0L 3TV3H 2Z0UA 3VXOB 3D39D 2BY2A 4YVUA 4NZRH 1ONQA 3M45A 3P30L 3SPVA 2BC4B 1TJGL 1BEYL 1R5VA 2WVVB 1T21B 2OXGA 3MOAL 4K23H 2QSVA 2CQVA 3EJTA 4LCVA 3WKQA 4WI0B 4M48L 4NO3A 1ADQA 2EH8L 2NZ9D 3JVGA 2HZHA 1AQKH 4Y9EA 4ZZKA 5SWZA 1CVRA 2DZEA 1A1MA 5TQ2H 2YD2A 2C3HA 4D9RE 2BW4A 2GIXA 1Q0YH 1N7MH 4HMDA 2VQ1B 3F58H 5CJ8A 2ESVE 4BEIA 4CU7A 1KGXA 4PSRA 3GSNH 2WBJA 4CDGC 3ZSTA 3VXNA 43CAB 1F90L 2PWDA 1DL7L 1KCWA 3VCLA 2QSCH 3FUDA 1ZLWH 1ND0A 2WXRA 5AVWB 2OSXA 4KXCA 2WKOF 3I6LE 4PJIF 1RSYA 4NUMA 2XRAH 5E70A 2ICEA 5LAXB 4KHXH 3IFPB 5F88A 5INCA 1AO7A 3TOPA 5FOBA 1KCVL 1ZVSB 3U7YL 2FIKB 1LWRA 4I2XB 4CNIB 2QZQA 4K4KA 4ABUA 3SGEH 5M95B 4N0FB 4HUWB 4HK3J 2ZXCA 1R75A 4J3XA 4JFHD 1QSFB 5DO8A 5I19H 3TPUB 4OD3L 4KGLA 1U8JB 1BVKB 3FXIC 3V6BR 2IPUK 2YSTA 1NINA 4AJVA 1T5XA 3RWGB 1R3KA 2CU9A 5FEBA 5FHBL 4HK3N 5GRWA 1FFOB 3VTMA 4JHWL 2ZKHH 3VFSA 3T4YA 2EEBA 3KWVA 2DIEA 3B7UX 4DZBB 5DJ6B 3MLYH 2PXYB 3LPGA 4XNZC 2APXA 1E5AA 4N2BA 3EG9B 2JKNA 1L7TH 4OVVA 2Z7WA 2XIDA 4NT6A 3VD1A 2KQMA 4WI6A 1IZKA 3DOSB 1DQKA 3MX0B 3I50L 4WW2B 4YHOL 1GY1A 3PL6C 4OFYD 3ZTDC 4RISL 4LGPB 3B5TA 3PUCA 2R1XA 4JFDD 4XNYH 4ZX4A 4WNQA 5T1KA 4RNRA 4FQ1L 3VWKA 4CMMA 1JHKL 1EBPA 2OZ4H 4HKBA 2D3VA 2CR6A 2GK0A 3BAWA 2RQEA 5F3FA 1LMIA 3UROR 5JHBA 4MLIA 4LPVA 1W72A 3JBG7 3L1EA 2FZ3B 4JKPH 4LCIH 4E41A 2OLDA 2VSKB 4JZJC 4I85A 3QQ4B 4JFEE 1HXYB 4LARH 1T22B 1WF5A 1YO4A 2WYTA 2HT2C 3GMQB 1I1AA 2OYLA 3KMDA 2J88L 1RZJH 1D6VH 1TKWB 3QR1A 3QZWB 3GB7A 4GP8B 3UTQB 5CEZL 4J5VA 4UIKL 2A7BA 1OW0C 3BPCB 1VDGA 1E30A 1LO2L 4PHXA 1EEQA 4UBDD 5AKVA 4PREB 3N85L 1SHWA 1NCCH 2WOBA 1HH9B 3RIAF 3GS0A 1IFHH 4QWWD 5GRXG 2V2XB 1VZGA 1EAPB 1QA9B 3FJTA 2VJ0A 5HJBA 1VADA 1SEBA 1UXWB 2WWMD 1OSYA 3S5LA 4FABH 3PWPA 2D03L 1G7MB 4XMXA 4AXWB 1KBWA 4PJDE 4X6CF 4ANUA 1IZJA 3GBNH 3KR3L 3BUDA 1BQHG 2MH4A 4FQ2L 2H3NA 3BQUA 3QJOA 3KBEA 4AJ0A 3T6QC 4D8OA 4IRJB 1J9SA 4OZIA 2DBLH 1S4IA 5E99H 5IZ7A 3DVNA 1WQVT 3DMMA 1OPGH 5GQBA 2UUDK 1OTUD 4G6AD 1B4TA 4WFHE 4PJCF 1GKEA 4J3OD 2IBZY 3AS0A 1LQSR 3FU5A 5CZRA 3MA7A 4B9IA 4RMVA 3T4AB 3GDCA 1BMZA 3DTXA 4PPTA 5B7EA 3GMNB 3GUTA 3MLZL 4IS6A 1JYXA 2EYRA 2G30A 5CSBA 5KVFE 4MA8L 2QVIA 5TK4A 1CD1B 5D1ZB 2XA8H 1L9MA 1A47A 4ZXBD 1F58L 3D0VA 2I27N 3C09B 4A04A 2MSPA 2ZOWA 4B6ZA 5GS1B 1NEZA 1EHLL 5KUKA 1M1SA 1G0XA 2GABA 3TWCH 4FJYA 1UXMA 3MBXL 1U8HB 3MRJA 1N19A 2IGFL 3RB5A 1IGIL 2TAAA 5AD0A 4RGOH 5TE6L 2HFGL 3MRQB 4FERA 1WFJA 4PV9B 1AC6A 1B0RB 5A3ID 2CLRA 2BVEA 2O6CA 3EKCA 3HR5A 2R8SL 4GMSH 1RKRA 2DAVA 3VXOA 2Y3AA 2D2OA 3ZQ9A 3QUGA 2Z64C 1MJ7H 2BWQA 2QV2A 2C4XA 2WVVA 1T21A 5F9WB 1U21A 4NKDA 3TL5A 5DHVH 4WI0A 5DEFB 4DUXA 2CPCA 2AZAA 5IB1A 1OCZB 4H4NA 3IB4A 1FH2A 2N1TE 1D3CA 2DQIL 4HKXB 1M6OB 3ARXA 1IBHA 2C9XA 3MLXH 3M8OL 3PAVA 4I3RL 4N8UA 4V1DB 2VQ1A 1ZA6B 4RSYA 4ZW7A 1GPOL 3U6XS 5JR1L 1PZ5B 2FX7L 3PDOA 5KYNA 3BYYA 3MLSH 4HXBH 4S1SH 43CAA 5LBSL 2A9DA 3ZRCC 1UD3A 4GG6F 1V7ML 2V3DA 2PWGA 3GPSA 4BRJA 2V3FA 2G5BB 5KVGE 4MAYB 2BH0A 5FS5A 1OQXA 4X7TB 5FB8B 2WVTA 9CGTA 3KWUA 3QDAA 3OV6A 5LAXA 3IFPA 1CF8H 5L4MA 4N8CL 1ZVSA 2CJSA 1N18A 2FIKA 3CMOL 3MRFB 4CNIA 3C8KB 2Y1VA 4K9EH 2FEDD 3QUMB 3P0VL 1J9RA 4N0FA 4HUWA 1DEDA 4UDTB 1X5GA 3FONB 1QSFA 4W9FC 3QIWC 3TPUA 3BX7C 3KCWA 5FO8B 1HU8A 2RQ8A 4C4BA 1E9QB 3G6JB 4FNRA 1U8JA 1BVKA 5ANMA 3DPBA 1C08B 5G5DA 4PGJA 4HZLB 3S48A 5E6IC 3RWGA 3SO3B 3G6AB 1N10A 3OJDA 3VFUB 4DK6A 3V9CA 4WLCA 3VGHA 3GPEA 5FA3B 1BJMA 4DZBA 5DGQA 1HESA 5DJ6A 3IDYC 1DSFL 1WBXB 3GXIA 2XZZA 1HHHB 1AGBB 2PXYA 2OCFD 4L37B 2FB4L 2G5UA 3EG9A 3HS9A 5DTFB 4IQHA 4RGMC 3KS0H 4AQEB 3L9BA 3BGFB 2XTJE 1BQKA 3H3PL 3DOSA 1I9RH 3MX0A 3HJ0A 5F8RC 2XG4B 1M7UA 3FK3A 3AZUA 1QUPA 1SBBA 4XC1L 5AW1B 3DRQB 3UJIL 2EDWA 3DURB 3FB5B 3HE6C 2JJWA 3BN9D 1YYMH 4HISA 3W38A 1RD6A 1C5CH 3NFPA 2CGRH 1REIA 2FZ3A 5ESQB 2B39A 1UYWH 1R3HA 3EO1B 3NSFA 4PJBF 3QQ4A 4XCEB 3OPUA 4Z7WE 1T22A 4BK4A 2VQUA 4F2MB 5EBWB 3PPEA 4X7SH 4JPVH 3WELA 5MEOB 1TKWA 2JIXD 3RPBA 3OQ3B 1YYLL 2LR4A 1U6AH 3QZWA 3UTQA 3ZPDA 2F8IA 5EEUA 5CP3A 1IV8A 5HHXH 4LF3B 4OZFH 4OIIH 4U6XA 1T5WB 1U3YA 3S98A 2AV7B 2WY3B 1KXVA 2A0LC 3UYOD 4GAFB 2H26A 3P40A 5CM1A 3EDDA 3JWNG 2F74B 1EAPA 2XXMB 1B9KA 3NIDE 1DANU 1UXWA 3QRGH 1A22B 1KY6A 5DJZB 2QPDB 3GS7A 1G7MA 2W0PA 4AXWA 3EJSA 5B22A 3I6SA 5FPIA 2A77H 4Z95L 3VGDA 3OR7B 4ZAKB 3RNQA 3WEBA 1WG3A 4MSWA 1H6TA 4XP5L 4GSQA 5I6MA 3W57A 5C8JB 4M1GL 1HEHC 1TQVA 5L9DH 4M03A 1JVOA 2V33A 3D33A 2VMCA 1K5WA 4IRJA 3VI3F 2OS7A 4K0OA 3VXPA 5IIEB 3QUML 4YDNA 5EU5B 2AF2A 3ZKQD 1NAMH 5T5FL 3ZKXC 3MBWB 2RTTA 4W1TA 5IB2B 1XT5A 2IPTH 1DLFH 1PF3A 1PD1A 1X4YA 4HJ0C 1KJ3H 4TNVK 5F9JB 4H40A 3CQPA 3T4AA 3CDGB 1EGJH 1ES0A 1SN5A 2P45B 3HE7C 4N8VG 5C08A 3WDHA 2H8PB 3GMNA 3LRSA 3D51A 2C9PA 1CD1A 2EEXA 4QY8A 4YZWA 3AB0C 3CV5A 2BNQE 4Z7UF 3HZYB 3LKSB 2YIHA 2FGWH 5ISZB 3KXFD 5GS1A 2VDOB 5EFIB 1FP5A 1ZIAA 4JGNA 4ZS7H 1X9QA 1MELA 4FDWA 4HEMA 4LSQH 1E28B 3P9WB 4ODBD 5KJ4A 3D34A 5CN3A 3TEYA 1WD9A 1X7TA 1U8HA 4JX0A 3D50A 3KPQA 4NKQB 3F6LA 4YPJA 4AE1A 3W37A 3VFWB 2NUTB 4HJGB 1URZA 4PV9A 2IAMD 2G4EA 1XV8A 3DI3B 4GRLD 2CA3A 3BGAA 1JGVH 3SBWC 3BDXA 2ZWYA 5I76A 2CDEB 4Z3FA 1SMOA 4M5YL 2VJ8A 1GS6X 3V79C 2P42B 2FJGA 1BX2B 3MRIA 1U33A 2ZWLT 3DX7A 2Q8AL 4W4NA 2X2JA 5BZDB 2X6MA 4OSUH 1AC0A 4A2FA 3I9PA 3LZLA 1M6OA 5DWUH 3UOAB 4LLWB 4P2CG 3TESA 3O11B 5D72H 4JG5A 3K5RA 1DDHA 4V1DA 1ZA6A 2B0SH 3QEUB 2C8NA 2VISB 4OGXL 1HILB 3I2CL 1PZ5A 3GI8L 4I48A 3RX5A 1DQLL 2PR9A 1LO4H 3K91A 4YSSA 1OGPA 3ARTA 5FO9B 4HIXH 2G5BA 3BP4B 3U82B 3GBLA 4YFEA 5MERB 3VXUD 3OAZH 4X7TA 5EZLB 1SY6A 3EH4B 3UTOA 5T3ZE 2OYMA 3F7PC 2HVJB 1I3GH 4ZMAT 2C3WA 3LHPH 3MRFA 3C8KA 2WO3B 3C8HA 5HGAB 1BPLB 2QFRA 3H9YA 3HNSL 5T5FA 1NA8A 3MRDA 3L5IA 3FONA 4N2HA 5DMKB 4KHTH 4RMSA 1CTMA 5LHDA 1OAZH 4K71C 2IPUG 5FO8A 2UXTA 5GJTL 5L2KD 3OF6D 4NM8H 4W6XB 3F01A 1E9QA 3G6JA 2IWFA 2BZDA 1C08A 4P2OC 4Y5YB 4DN3H 4HZLA 4PUBH 1SYSB 1RVFH 3G6AA 1VFOA 4JN1H 4DGWC 5K93A 1BFOB 5J06A 1MJJA 1TVHB 2OFQA 2J73A 5FA3A 1ZHNB 2FQFA 1WBXA 3U30B 3RFZB 2I9TB 1HYSC 1HHHA 1AGBA 4KJWC 4Z0BH 4L37A 1IFRA 4JFFD 1KBBA 3KPSE 3WE1A 4L9LB 4D0CB 5L2JB 1BQRA 3IDMA 3A4AA 1IM3B 3MRHB 3MYJB 4MHHI 5F72S 8CGTA 2FVNA 4WFED 3C12A 5SV4A 5B38B 4AQEA 1IO4C 2IANA 2CG9X 3OJ2C 1J0ZA 4BELD 4RGNE 4C54A 1FNEB 2XG4A 3EJYC 1G5AA 2BVOB 2ZOKB 3ARGC 3DRQA 1H5BC 2VDOL 4TTDC 2ROYA 5JHDB 3DURA 3FB5A 3RDTB 1ID5I 4QRFA 4BSWB 3GZOA 5AZEL 4YUEH 4KKLC 1LEGB 3OM3B 1X4XA 4RZCB 2XCMC 4XCCL 3V9FA 1U95B 4F9LA 5ESQA 2IPKB 1I3RB 2ENPA 2Y06H 3EO1A 4XCEA 2IFGA 2O6DA 3NCCB 6FABH 4O02H 1FDLL 2Y7QB 1RZJC 2IDQA 5AOJA 5EBWA 5MEOA 1XZ0B 2DQMA 3BESR 4WCYL 3FOLB 2VDMH 2CBQA 3PV6B 3QS3A 1NCIA 3BWAB 5DSCB 3FO2B 3X1FA 4Y4KB 3HS0C 4ACTA 4MCZA 3NQIA 4HOZA 4GKNB 1FL6B 1B0WA 1T5WA 3O41B 4DP8X 3S5LG 2AV7A 2OW6A 1J8HB 2P28B 3Q2WA 5FUOH 3KL3A 2FT6A 3TT3H 3OAUH 1EIBA 5D7LE 3TZVB 2Y69B 4NQUA 1JZGA 2I32A 3POHA 2PETA 3FYIB 3RWCB 3GQFA 3QWRD 4PMFA 5DJZA 3TYGL 2IMMA 3QISA 5LLIC 4LK4A 1IAMA 4GQ9L 3OR7A 4FCHA 4PJIB 3OQRA 3VXMD 5EV7A 4PU2A 2OX5B 4K8RC 4MQTB 3WFHB 5C8JA 5GGVH 2WQUA 1S7VB 3DX4A 3OXRB 3MHZA 1MCBA 1PG7W 2JLPA 4J6RL 1OVZA 3FZUD 4YS4A 3E38A 2B16A 3U4BL 5IHLB 5IIEA 5KOVC 2AW2A 3APDA 3EJQA 1A5FL 3O3DB 2E59A 5EU5A 3REWB 3WN5B 3MBWA 2WXGA 4MMXA 5T8IA 3LXCA 2IDUA 5KBKA 2VCOA 2FSDA 3KYKL 4KXAA 4AMKH 3SCMA 3CDGA 4XVTH 1CF1A 2H8PA 1NEZG 3NDZE 4IOIB 5BUGA 3CXDL 4H0HB 4AZUA 2L04A 3L5XH 5B1BB 1ICTA 2WQ8A 3HMWL 3N1MC 3EFDH 4IW4C 1BJ1J 4M4RB 4OJFH 4XCYB 3PABB 3UBXB 3ULVD 1IE5A 4DW2L 3HZYA 3LKSA 1YQVH 5KVEH 1GJIA 5ISZA 4M61B 2H0JA 4X9BA 5EFIA 2VMJA 8FABB 1T1YB 2PR4H 3V6OE 1E28A 3L3DA 4OD1L 5ESAB 3SE9H 2XWJB 1P9MA 4O2FB 2PP9A 2ZX6A 1NPJA 3BUYA 3FH8A 1CQKA 4J3OH 1BZDA 3CHSA 2XBTA 3ETBJ 4MA1C 3L17A 2YEZB 2NXZC 2CDEA 1AZCA 5DK3A 3SBRA 2ZUWA 5JA8B 7CGTA 5L8JB 2ETWA 5HYJD 1BX2A 3O2WL 2XC8A 2DLGA 2PKDA 5BZDA 2VW4A 3BZDA 4N20A 4HULB 3PGCB 1BG1A 2ZAIA 1CG9B 2PABA 3EDEA 3P3TA 2R2CA 2LU4A 4LLWA 3O11A 3P0YH 4BZ1H 4ABVA 4FQCL 1CL7I 2PCYA 2VISA 3ARQA 1EXHA 1HILA 3HS8A 1ZE3H 2AJXH 3KPPB 3P9LB 3CLEL 3EOBB 5KSAC 5FO9A 2CDGB 3HA0A 1QYGL 3BMWA 4N3UA 2O5ZH 2R0KL 3FU7A 3BP4A 2WN3A 1ZLEA 1EO8H 4JKMA 5J9PB 2QVTA 3NZ8B 3D3VE 4CC4A 5JOEA 4KKCC 5CFAA 2YKLH 4K9EC 1I9EA 2OV0A 2G75B 3L4VA 5F97E 4Y2DC 5HGAA 2EACA 3VYPA 3GXUB 3O2VL 4X6CB 1R3JA 1A7BA 5DMKA 4LVNB 4RDQF 4HF5H 2RH0A 4C4KO 4LSVL 2XWRA 5BJTB 4Y5YA 4XMLL 4B9KC 4F5CA 5D70H 1SYSA 1PFOA 4JQIH 5B3JF 3NABL 3NEEA 5DC9B 2B1AL 5FC9A 3S96A 1BFOA 5F9DC 1TVHA 2NQDA 5T1LB 2VTFA 4NS0A 4Q9CA 1LK2B 4PJCB 1ZHNA 3X1NA 3TS8A 3RFZA 2I9TA 1ORSB 5J13B 4M6ML 2CXKA 3TBTA 1JFQH 4E9VA 4D0CA 4DGVH 5D7HA 3HNVL 4L9LA 3MYJA 3JTBA 1YN6B 3Q1EA 4J23A 3MV7D 5DVNA 3V4VH 3CAFA 2VMFA 5B38A 1URIA 5FW7A 1UM4L 3CVHB 3MTXA 4CMHC 3QFGA 4PB9L 2NY2C 3MJ6A 3ZDXE 5I6OA 1MLCB 4PRDA 1FNEA 4AEHH 2NSQA 2IQAB 1PU0A 2ZOKA 4IBUA 4ENEC 2NX5D 2AAVA 3SE3A 1EZVY 2XWBA 3S5YA 2M1KA 2WO2B 4XXCA 5F0JB 2IXQB 4AL8H 2R27A 1T4KB 6PCYA 1LEGA 3ARBC 3T04D 4MNQE 1DQDL 3QZWG 4IU3B 5IG7A 5C09D 5SWSD 2CK2A 2AK4E 2VLMD 2ZUQC 1TCRB 2B59A 2P5WB 4JO3H 5E51A 5LNGA 1BW8A 3P4NB 4Y5XB 4NCDA 3HKZA 3L7EB 2Y7QA 1NJ9B 5E2UH 5JXEA 1WAAF 1XZ0A 1OCOB 2ZUUA 1EX0A 2WN2A 2FBJL 1I9JH 3PV6A 4J4PD 4MBRA 4WEMB 1NFDB 4UM9D 5DSCA 3FO2A 1KJVA 4Y4KA 3AU1B 5T3XH 2YKKA 3RVTC 2PPEA 4IKLA 1BZQK 3LH2H 4OCNC 3U36B 2H45A 4L05A 1FL6A 3O41A 2XV2A 3SGJC 1JN6B 4L3EB 4H88H 4PJ9D 1E8ZA 2YPVH 3TZVA 3W11C 3W0WB 2WCGA 1UWEL 1KN4H 1DVFA 4NYLB 2WQWA 4NUPA 1A3RH 2X4RB 4P2QA 5C70A 1Q1JH 2DQDL 2VLLB 3LSOA 3SDXF 4LCWB 2JKTM 3N6YA 6PAZA 4PGBB 1NFIA 3UTSB 4NRYB 2BM3A 1SDAB 4P23C 1WFTA 4GG6B 2HTKC 3BSZL 3DDFA 2WKOA 4LLVB 3UZEC 1DFBH 2CAKA 4HZ1A 1URLA 3GYRA 3WFHA 1BD2D 4PHZA 1JPGB 1S7VA 2VJXA 3UAFA 2K3HA 3QCTL 4F2EA 1UT1A 3NSJA 4K3JH 5LXGL 1GZHC 4LRIA 1P7KB 1YY9D 3QEGH 5I0VA 1NC2B 1MJUH 4OCLC 3PL6B 4MA7L 2EUXA 1BWMA 3NSCA 3GMPB 2CALA 2J3SA 3S3PA 3DTDA 4QOKB 4X5WB 2IMNA 4YEFA 1VPOL 3K2MC 3JWDH 3MRKB 3R4DA 4IOIA 5CILH 5E8PB 2CGYA 2DQCL 3ARVA 1VZHA 3DXAE 2XVGA 3QSKB 1KBKA 5CZXC 4FYQA 3MV8A 1MHHA 3MJ7B 2ZSWA 4JZJB 1QKZL 4XCYA 1R0AL 3PABA 4FFYH 1BZ9A 2DTSA 3FQUB 4HJJL 3BD3A 1T1YA 3P0GB 1WZAA 2YJLA 1ROCA 2R83A 2GITB 1T2QL 1J88A 3PRZA 4GKZB 1RZFL 2FTAA 4YHKL 1SM3L 5G4OA 2XWJA 4MD5B 4CVWA 1BQSA 3ESPA 3CVHL 3QRFM 1DQVA 1TQBC 2CO6B 4C56D 2P24B 4XGZB 5EPMB 2BHFA 2VQTA 3CFEB 5EDSA 5C0NC 5EHFA 1XGYH 5I1GL 2AQSA 4YBQD 1NC4D 5J1AB 3MUUA 2Z65C 1QZNA 2YEZA 1YECL 4LL1A 3U0PB 1J87A 2DWSA 4TVPL 3VXSB 4L3CB 1MAML 1LK3L 1RUPL 4MZ3A 4PJBB 4B3VA 1T04B 4HMCA 1ZTXE 2VRQA 2F6AA 1TTUA 3FFDA 3PGCA 4FOMA 2CMRL 4DO5A 1CG9A 3T3PF 3F7QA 3GO1L 4FZEH 4KK6C 4POZD 1JNLH 1KYUA 2VM9A 4DAGL 4MCYB 4OKDA 1QFPA 3D2TA 3LEXA 3RIAK 5DQDL 4AC2A 1RERA 2KQNA 4PRIB 3KPPA 3RWIB 4YHNB 2K9FB 4LP8A 3JZ7A 4Y1AD 3EOBA 5LGKA 1DJWA 2CDGA 4CN1A 2JB5L 3RL2B 2H2PC 3BSZA 2QVKA 5GS3A 5F89B 5J9PA 3MJ9H 4FTVD 4ODHL 3EYUL 3NZ8A 1UUSA 3MLUL 3QPKA 4QIRA 3BRGC 4XP6H 3WKYA 4XN1A 2FATH 4U1NB 2ZYHA 3CVIH 4X6CA 2XU9A 2F8OA 1EZLA 1G9HA 2Z1KA 5GHWL 5GS2H 4TQPA 3MLTA 1GYUA 3NEOA 1GS8A 3QP3A 2ZXGA 1CGVA 3H0TB 4U4BA 3VI3B 4BDVB 5IGXL 1B2WH 4OLVL 5FKAB 2AJSL 5T1LA 1S3KH 3MRRB 3QUXC 4X5PA 1JGIA 3HRZB 4UOW0 4R4NC 3ROLA 1R33A 3ZGIA 5CKGA 1IX2A 1ORSA 4FNSA 4HWUA 2YXFA 3GNMH 1PPIA 1WV7T 1YN6A 3OGOE 2A73B 1P4IH 2WAHA 3HB3C 3QRLA 5CCJA 5DS2A 4LGSB 3VDBA 1BGXH 2XFGB 3DK0A 2X5PA 3FU6A 1MLCA 1PNDA 3UMTA 5HDQL 2GIYA 2HX9A 2X4QB 1UD4A 2WUCH 2IQAA 3QG6B 1L9SA 3T6VA 1R24B 5CN2A 4WAFA 4TUUA 3IN0A 2OMNA 2KS0A 3SB3A 1NCAL 1T4KA 1VSCA 1JGUL 3IS1X 2P5EE 3EBAA 2YPLE 4IU3A 2Y1AA 2DEWX 1TCRA 2P5WA 4W6WB 3H9SD 3P4NA 4Y5XA 4PGDB 4FNLL 5I6KA 1NJ9A 3ZVVA 1J48A 3ZZLA 4OUUB 3IFNH 1JXGA 1A1OB 4E42B 2NRDA 4KNQA 2HUHA 2DRUA 1JRHI 1NFDA 3UERA 2AXFB 3AU1A 3ZE1F 2PUQT 3TLRA 3JVFC 4ZFFB 5BRZE 3U36A 3FTXA 2H0EA 4CDHA 1JN6A 5CJQH 2HH0H 1N5YL 4U6TA 3ILDA 4ONFH 1JDCA 2P80D 5AVRB 1IGTB 3JXAA 3W0WA 2A38A 5K9KB 3V6ZB 4NYLA 1ANUA 3GSXB 3CSBA 5E6IB 2Y7SA 3IT8D 4LCWA 1OM3L 3LEVH 1P7QD 3BD5A 3GUFA 4PGBA 4YX2L 2F19L 2IEPA 2M26A 3BEVB 2Q87A 4NRYA 3UTSA 1W0VB 4UAOC 4A2LA 4GG6A 5F1IB 4KWUA 1UZGA 5BQ7B 5I8CB 1MCLA 5GRUL 4K7PY 3FU0A 1JPGA 2ADJA 2EDJA 2BFVL 2VDKH 3FBKA 5D93C 2XX0A 1AG6A 3ZU8A 4N2AA 4B9GA 4RGMB 1P7KA 1EXUB 2GTZB 5CU9A 5D7JC 3G5VB 5E2VH 3U79A 3ULUE 3L9RB 1PVHA 2DMGA 1JZ3A 2DLEA 3ARUA 1NC2A 3ASNB 1T4WA 3PL6A 3WEXB 3GMPA 1MI5E 4NKMB 4QWWC 5FO7B 4QOKA 3WFZA 4N22A 4Q9QL 4X5WA 4QXVA 3FU8A 2XWCA 2ARWA 2BIOA 4P3DB 3MRKA 1GIGH 1KZQA 1MQKL 3VFVB 2I26N 1JWUA 2O6EA 4DKEL 1MLBA 3FUMA 1GA2A 3MJ7A 4X42A 3A22A 4JZJA 4D9RD 1EQWA 3BUIA 1MVUA 1CGTA 5IBUB 2ESVD 3B9KC 1CIUA 3T2LA 3VQ1C 3FQUA 3PREA 4FA6A 5CCGE 1F4YL 1KTRL 4FEMA 1DBJH 5EF0A 2X9WA 2MCPL 3ZT6A 1XMEB 3L13A 4JS7A 5SX5H 2PWEA 4GRWE 3DUHA 4K3DL 4DP9X 4GY4A 3VMPA 3H54A 4LBAA 1HZKA 5DJ8A 5L8KB 1CYWA 3K81A 2CO6A 4J3OC 2P24A 2YGPA 4OM0H 5AOZA 4DF9A 3CFEA 2XV3A 4O5LH 1RIVH 2J2ZB 2QGEA 4XMPH 2FHCA 2D7TH 3FDWA 3WCYA 4QLWA 2ARJB 3QCVL 3VXSA 3GTNA 2NDFA 5LB1A 1WWCA 4KVCL 4PJBA 1T04A 1Q0XH 3KPRE 4JO8A 1DJYA 1QHPA 5B39B 3DV4B 5AVQB 2QVFB 3BVTA 3BKMH 5DURD 3V9EA 5BOJA 3U4AA 2CR3A 4TNGA 4BCYA 1W0YT 4DP1X 4MCYA 2QFPA 3OBAA 4JFZH 1J11A 1DBAH 2W8CA 1ZE3C 2CBPA 4OI9A 2ZJSL 4YHNA 4PRIA 2XQYK 3RWIA 3B6SB 3S37H 4Q14A 4YHIB 4J8RB 3VRIB 3RL2A 1KNOA 5F89A 2LU7A 4MS8C 4H0IA 5CINL 1XB6A 4NHCL 1IM9A 3X14B 3H2WA 4MXQD 1RAMA 1TFHA 3HE7B 5AKRA 5F96H 2IG2L 2A3TA 4F57H 1LEIB 2JCCE 5MENE 1JZ7A 2W65B 2BSDA 4XVUC 3F04A 3FFCE 3QDJB 2E46A 2ZOLA 3PWJB 1YZZA 5EOCL 4QGTA 1EXGA 1FL5B 4KZEL 5C0EB 4JFED 1FZOB 3H0TA 3HN3A 2PLTA 1DVUA 1QLEB 4BDVA 2DQHH 1T7ZA 5FKAA 3U9PL 1FA4A 3IMVA 1YY8B 3NACH 5B38G 3BMVA 1XCTB 3UAJD 5HSFA 3IGAB 3U7WL 4BXVA 4OCXH 4GMTL 4F7TA 2DYPB 4BQ8A 4ZYKB 1YYCA 4RGNC 5HI3D 4LLQB 5FLVA 3D4GA 4N85A 3FQ4A 1ZJAA 2EZ0D 4NWTH 3QEQB 2F1EA 1GGIL 2X4QA 1MCIA 3QG6A 3HG4A 2BNRD 3I02B 1K2DB 1R24A 3HN8A 2EVJA 4P46D 5HYFA 5HHOD 2JELH 2E3VA 2H32H 4AL8C 2CM5A 1ZANH 3T2PA 4WUKL 3NIGE 3C6LD 3GSNB 4FCAA 5EG6C 2VB5A 3RUGE 3K6IA 2Y1ZA 3LS4L 3DHPA 5DEJA 1DHKA 2WXMA 2P7TB 2A99A 4FXLA 4PGDA 4LIQE 1F6AA 3RG1C 4OUUA 4HIIA 4EUPH 4ZO8A 3L6FB 2N01B 1A1OA 4E42A 1QSVA 4WFHD 4KY1H 3D52A 3SJVE 1ZKAA 1E7VA 1T03L 3MGAA 3VXRE 4ZFFA 3RJOA 1FVCB 5C0FB 1ZS8B 5DJYA 4DOHB 3BD4A 3LKOB 1M42A 2J6EH 5D2LB 5DLLA 4CJ1A 1YSOA 5D7IE 3U1SL 3WNJA 2ZXEB 3FTVA 2VXSH 1IGTA 2Z92B 1ITCA 3QIWA 3EOTL 4NPKA 1A4KB 2DJSA 3V6ZA 3GSXA 5C07E 4NO0A 4P2OB 4KNTA 5ICXB 5B1JC 5E6IA 1HCFX 1OPOA 4JGMA 3CFIC 1TU2B 3LPPA 1SYVB 2GI0A 2IVFC 4YHLL 3VWJD 1JXFA 2AERT 2AQQA 3BEVA 2MQGA 5T1JA 1W0VA 5JXAL 1YVLA 1PBYA 5F1IA 2W95A 5D2NE 1NGPH 2OMBA 2OXHB 5BQ7A 2N7BA 4HH9B 2EE2A 4XX5A 1YNTF 1Q72L 2DMHA 1OAKH 4MQXC 1D2PA 1W15A 5DQJB 5I1HH 5J89A 1SN2A 1BBJB 4KRPC 5L4IA 4G3YL 2GTZA 2E7LC 3G5VA 25C8H 3IFLH 3CN0A 1AXTH 5L7XH 3QYNA 1AHWC 3GSOB 1RU9H 1JZ6A 4HU8A 4J3OF 1SMDA 4P3CH 3WEXA 2PO6B 4NLAA 1ACYL 3ARGB 4EI5D 4X8XA 5FO7A 1H5BB 2A5UA 2QT6A 1BHGA 1TCMA 3HE6A 3QORC 3B1TA 3JWDC 4Q6IC 3MLWH 4P3DA 3ROOB 4KKRA 1QLEL 3MROB 1Y0LA 2F68X 3DJRA 3VFVA 2GUYA 4PJ7E 2C3VB 1W16A 3ZL1A 4R4FL 4D9LH 1FYTE 2KH2B 1P5UB 3LPFA 3PWUB 3BT2L 1A3LL 4X6DE 3TV3L 1FWXA 1TNMA 4E68A 3L5WA 5ACLA 2A74C 4HLJA 4NZRL 2E74C 5KVMC 1GTFA 5H94B 4KQ4H 3ZXAC 2VZSA 1SLWA 4FQQB 3KHOA 3NN8B 4S0HA 4K23L 4JREB 5IEKB 4CVUA 1AQKL 4AY0A 3ZQXA 1UD5A 2J2ZA 4AIOA 5TQ2L 4HC1H 3HN5A 3SODB 1Q0YL 1N7ML 3F58L 3T5WA 1HVXA 4IMLB 3G6DH 1ZLVH 3GSNL 4MFHA 1ZGLB 4RMBA 2DWXA 2H4EA 2E5EA 2A9BA 5KVDH 1M6UA 2ZNWA 4R5VA 2QSCL 4H1LA 4ANKA 3I75B 2FEEL 5TDPB 2XY1A 1HQ4B 1MCWM 1QSZA 5FFOA 2XRAL 4R2GC 2Q1EA 1XR9A 5B39A 3DV4A 4U7KA 4Z18A 3ZKND 2EVHA 4KHXL 4X9FA 2YWZA 1AKJD 5IEKA 1WIUA 1KBPA 5I1AA 1WTGT 2ZICA 5I5RA 1SUHA 5IV2B 1WWBX 3OC8A 1H6FA 2FLMA 2C26A 4OZGA 1E5ZA 1YPZF 4P48A 1ET7A 5HI5C 4J8RA 5I19L 2V5MA 3HG1B 2X6UA 3QJHB 2AQTA 2XTJD 3FT9A 3W56A 4BGDA 5IEHB 1CLYH 4PRAA 3X14A 4N90E 3SDXB 5BMFH 2BP5M 3HE7A 3MNZB 1S9KC 4IBSA 4WNJA 2ZKHL 1LEIA 4KXZI 4OLEA 4DIXA 1E2VA 2VO5A 1P6WA 3HPLA 3T1WA 3CVDA 1PZ2A 5BOPA 1S7RB 3MLYL 4KI5C 4UQ2B 3QDJA 1NMCB 5BS0B 3OHXC 3PWJA 4C4UA 3FPYA 2FR4B 1CT8A 4OTXH 1L7TL 3E6HB 4NQCD 5GGSY 2HAZA 5C0EA 1FZOA 2PCXA 3FUNA 1ZHLA 4QI3A 2G5RA 2XETA 4BK5C 1YY8A 3DVGB 4RX4D 1TZHB 1XCTA 2H1XA 4N2GA 4XNYL 1OIOA 1V55B 3IGAA 3NJNA 4MA1B 2OZ4L 5F7LB 4YBLC 3SBWA 2DYPA 4O58H 2WXFA 1KYOJ 3UO1H 3RVWD 2AI0H 3SN6N 1P7HL 1JD7A 2X6BA 5D1QD 5F1KC 2W59A 3CNKA 4MJJA 2IOMA 4JKPL 35C8H 3NJJA 4LCIL 4DEUA 2X2YA 3B9VA 4LARL 4UTAA 1DFXA 5DHVB 3T0EB 2HX7A 3QEQA 2ZWZA 4B9PA 4F92B 1EAJA 1G87A 1RZJL 1D6VL 3IGFA 3I02A 3FO0H 1XSJA 4G7VH 4FADA 4FL4C 1ZLWK 5EUOA 4W9ZA 1DDTA 2VXVH 3GSNA 2WQSA 3S7GA 1NCUA 1FV1B 5KSAB 1NCCL 2NY0C 5HHQB 4FYRA 5MEQA 4HCGA 1P84J 2P7TA 3RDJA 3NCWA 2NY3C 3EADA 2A1WH 5D1XC 1IFHL 3KM2A 3ZKMD 5I5IA 2ZTBA 4ORGB 5FGBC 4KTDH 2K70A 4FABL 3RWEA 5DYOB 3OKNA 5C0FA 4HZAA 1ZS8A 3C5JA 2F8VA 3GBNL 1T2XA 5D2LA 5GGTH 1FFPA 4ZFZB 3L48A 3T3PB 2Z92A 1ZRUA 3BZFB 4X9GA 3MKGA 4P2OA 1EFXD 2DBLL 3ARWA 5E99L 4FHKA 4X5LA 3ZR5A 1OPGL 2DKMA 2BNQD 1TU2A 3L9EA 5IVOA 2HN7B 4QUOA 3VSTA 1F3DH 2CKBA 4GQRA 2YEVB 2JJVA 2NY7H 5K69A 4HH9A 5C0DB 3S3CB 4N5ED 1JNNH 5DQJA 1BBJA 3JSSA 5DXWA 2XBZA 4UM8B 3WNLA 3N1FC 3JV6A 4ZS6C 2XA8L 3GSOA 1ZVHA 4CMHB 5IFAH 2NY2B 1FZKB 3D2UD 1W8NA 3VGAC 4WEBH 4UOW1 4J2XA 3ARGA 4GINA 4Q56A 1IAKB 1H5BA 3CHQA 5DA0B 1KC5H 1MFVA 4MB5A 1PD0A 4FMFA 5TF1H 2OZ4A 3TWCL 1QFWM 3CVBA 3ROOA 3WUZA 2MOVA 4OZHF 5CCKH 2BCMA 4DH2A 1UURA 4RGOL 4A2HA 3VXQB 2C3VA 3KCPB 3ZSSA 4L29B 3CHOA 4U3SB 4LU5H 1A21A 2J21A 4JFYA 4YDJA 4GMSL 4P5MA 4G8GB 2D7OA 3WIHA 4G6MH 5E6ZA 1DVXA 5AAMC 1Z5YD 4PP1D 1MJ7L 2AJVH 4JDZA 4X83A 2F18A 4J3WA 2VNCA 2EDLA 1W0WB 4ZMOA 5C86A 4J12A 4OZFB 3HS0A 3LNEA 5C0BE 1R3LA 5GSVB 4LVOC 3MUZ1 4KOCA 3LZPA 4UZGA 2YK1H 4HSQA 4U05A 2YR3A 5T3ZD 2PWHA 3QIBB 1IARB 3IRPX 4WSKA 1CLOH 4UQ3A 3MLXL 3Q2CA 1C16A 4Y4FD 2XWXA 4PBVC 3EXJA 1PMYA 4IMLA 1ZGLA 4QNPF 4CN4A 2BIIA 4Z7OE 3MLSL 4S1SL 1W9XA 4HXBL 4NFCA 2J8UA 2ZXBA 4P23B 1KTLB 2VERN 5TDPA 1HQ4A 2KZKA 5GISH 3HZMB 4L8SC 4KI5F 3NSDA 5B21A 4WWKB 3B3IB 1CF8L 2HCZX 3VI4E 1TOXA 3L5HA 5LGHH 4XB8A 4Z0XA 4K9EL 3I6KA 5HXMA 1WCBA 5MHSE 4UIMB 3K6NA 5E1IA 1U9KA 3OD3A 1NAMB 3NRQA 3W82A 1KWKA 5HDLA 5LQBH 2WANA 1A7PH 2PTTA 3CZGA 3EH5B 2ITCB 3TNNA 5IW6A 2GKIA 3EH2A 3MBED 3ZK0A 2WLZA 5IEHA 1JZ4A 4P4RB 1PDKB 3MNZA 4EN3C 3GTVA 1MJ8H 1D5BB 2DMBA 1QBBA 3LB6D 1HL8A 4ZTPH 2R1YA 5DFVC 1Z6JT 4YC2B 1MN4A 1S7RA 4UQ2A 1KCUH 2X12A 3LN4B 3CTTA 2FR4A 1L9QA 4CN6A 2I07B 5J12C 3OJVC 2F0CA 1YDPB 3MR9B 1RUQH 1ZSHA 4J3UA 2FJHB 1CICC 1JPTH 1I9RL 3MCLH 4NPYA 5DUJA 3P30H 4HBCH 4WUUE 3DVGA 3L4XA 4EZMA 4JRLA 5EN2B 4P5KB 4OFIA 2MWCA 2BMKB 4APXB 2YD0A 4MJ5B 3WJJC 4G80B 4FFZH 3NJGA 1YYML 3BDYH 3K8MA 2B2XH 1C5CL 2VWEE 3I9GH 2CGRL 3K5SA 4HPOH 1OO2A 1UYWL 1PEWA 2YGOA 1AQMA 4L9DA 2Q10A 3B2PA 5DHVA 3T0EA 1FZMB 1UD8A 5E6SB 1TT6A 1JZIA 2P3YA 4X7SL 4JPVL 4YGAB 1HHJB 4P5RA 1AGEB 1BG9A 2WSPA 4LDLB 1U6AL 4ODSH 4GP4B 4GEIA 2I69A 4AX3A 2WTOA 5HHXL 1OAXH 1KCBA 3JWNE 4JPSA 4L3FA 3HZVB 4CSTA 5CJOH 4OIIL 4PBXA 2Z8SA 5GZND 4PBWD 1FCCA 1FV1A 4W4OC 3ZQWA 4KROC 1TMCB 4D9QE 5KSAA 5HHQA 5AW2B 4DK5A 4NENB 1BLIA 3D39B 4WZ9A 4HCRH 1HI6B 1ZVYA 2IH3A 5H4ZA 4WO4C 3QRGL 2ZX8A 4Y9CA 5DYOA 1UCBH 3VRJB 2OYPA 1MDAA 3MUJA 2J72A 4MGXA 2A77L 4Y2DA 4CU8A 1JPFA 3FUEA 4PCSA 3GHEH 3ZE2B 2LVCA 4G83A 3PHQB 3SDAD 5L9DL 2FHBA 2OTUB 2WVSA 3EHBC 3A0OA 3JTSB 3BZFA 1X7QA 4QRQB 5AOMA 4MYWB 4NQDE 4BKLB 4TRPH 1B6UA 2NNCA 4JZOA 1BWWA 4KKNA 1NAML 2YD9A 5ITFB 3GSVB 2IPTL 4Q58C 1CS6A 1DLFL 2Y7OA 2ZXQA 5CJXC 1J1OH 5F7MC 1KJ3L 4XNQA 1HE7A 5AVZB 5C0DA 2EE0A 4J4PC 1VACB 1EGJL 1PYWA 1QUNB 5SWQB 4JG9A 2VAAB 4FXKC 4UM8A 1EEYB 3VD5A 3P4MA 1WZMA 2OQJB 4N86A 4UI2A 1FZKA 3T3MF 4BFKA 4KITB 4HLZG 2FGWL 3JV4B 2W38A 5FGCB 3MC0A 4ZS7L 1PD6A 3SPIA 4LSQL 5EZPA 2LU3A 4ZODA 4URTB 2Z31C 3VFRB 1N8ZB 3IJEB 3EOAB 1ETB1 3ARBA 4AMXA 1NUNB 3VXQA 3K6FA 3O45B 4U3SA 3ULVF 5D96B 4MVBD 1MWAH 4O02B 1S7QA 3PXJA 1JGVL 4G8GA 2VDMB 3RHWF 1C5BH 2E9BA 2EP6A 4PJFF 1H15B 1R19A 2P1YA 5AENA 1W0WA 2RFXA 4OZFA 4GKOA 3CUPA 1LE9B 1NBCA 2WKLA 2IO5A 1NGWB 4OSUL 2C4FU 3SGJA 1ZT7B 1AO7E 3NCYP 1RMFH 1O5PA 4H1LG 5DWUL 5ILTH 4Q7DA 5D72L 1DYZA 4Q9RH 5FX3A 3WXWH 1DJZA 3LYRA 5EIIB 2B0SL 4IOSD 5B39G 1JUFB 4WGVB 5F0PB 5CLYA 4EMZA 3RPIB 3ALXA 2DBJA 2CCVA 2X41A 4YAQA 1P5VA 1LO4L 2PYEE 3FUKA 5A6IA 3KL0A 4PJDA 3ABLB 4HIXL 4WHCA 4P23A 4UAOB 1KTLA 2JKXA 4X4ME 1GYCA 2WLYA 4OFKA 5GSRA 3UZEA 1IMHC 1UM6H 3BFQG 3B3IA 1X5ZA 3EBHA 4G42B 5GRJH 1KCSH 4UNVA 1I3GL 3IEAA 4FN0A 5AOKA 5TDOA 5D93B 3LHPL 3QDMA 2ZP8A 1GZHA 5E1QA 1PLGH 4UIMA 5D7JB 1LLAA 1TQWA 5JYLA 1NAMA 4NBXB 1S9YB 2AEQH 4KHTL 2SEBB 1OAZL 4JUSA 3C60C 4PLOB 4QMEA 1PZ3A 3FT3A 4YBQC 3WHE0 4NM8L 2ITCA 4NNXB 5CP7B 4DN3L 1KGUA 3ARRA 1E4XH 4TM9A 2FD6H 4ODXB 2SODB 4PUBL 1EGJA 1WK0A 2LAGB 3BKCH 1RVFL 1IQDB 5KG9A 2BSED 1BA9A 4JN1L 1JI1A 2X89A 4G9DA 4JCMA 1IAIM 1OSZA 4KK5C 5AVYB 4Q8BA 1JMXA 1YEDB 3E0GA 1C8QA 3KPMB 3LN4A 4Z0BL 3M1OA 4G43A 3CHRA 3D9AH 2I07A 4E41E 4MNQD 2PW2B 4ZUUA 1YDPA 2VL5A 3MR9A 4XH2B 2HKAA 2FJHA 1VCAA 2IDTA 4FD0A 4JKKA 4P06A 1BAWA 3QWNA 2YPKB 5EN2A 2FLBT 1FNHA 2VDLH 1BFTA 3LZRA 4WRLA 2DQFA 3D18B 4MJ5A 4G80A 1DJIA 2Z93B 3VD3A 1I82A 1Y07A 4YUEL 4MNHA 2IH1B 5J11C 5ERWB 5D7KE 1YRKA 4G1EB 2Y06L 2NYZA 1UKTA 4Q0XH 6FABL 1FZMA 4O02L 3SSGA 4UINH 4NJ9H 3FF8A 1HHJA 3PWPE 2VDML 4LPTA 4XI5D 1AGEA 3B2UD 2CO4A 5EBGA 3A6CH 2ZX5A 3HZVA 3FTWA 3J07A 2ENYA 1DP0A 3OAZK 4NQTA 3HC0B 5CD3B 5FUOL 3QIUD 3AJ7A 4W70A 4XP4H 3TT3L 4BUQA 3WS6C 5L6YH 3BO8A 4OZIE 4ZPTB 3OAUL 2YUVA 4HFWA 4NENA 4HMEA 2A4CA 1AMYA 1HI6A 1AGCB 1BZ7B 2QHRH 4XO9A 5DJCB 3ZL2A 3R8QA 4Z7QE 5AW8B 5IW3A 1T6BX 3VRJA 3JTTB 3KM1A 4DFHA 1JCVA 4YSOA 2G0LA 3KZ8A 2A6KB 2R29H 5GGVL 3DGGB 1MCEA 5I1LB 2YWYA 3PHQA 4Z5RB 4LZKA 2CE6A 1TZGH 4F33B 3JTSA 1BVNT 3DXAD 3L81A 1MSPA 2V2WA 4N9GB 5A2FA 3BI9X 4TMPA 3DYPA 3S2AA 4G8FA 2XTLA 2VC2H 1FORH 1BYPA 1YPZB 4U1KB 3GSVA 5D2NC 3N0PB 2E7MA 3GFUA 5B3SB 3QUXA 5I73C 3KLQA 4HJTA 2EDOA 4AH2B 4KUCD 3BVVA 4AMKL 1RSFA 1OP4A 3CK0H 3CXHJ 2Q86B 3KYMA 1KIUA 1QUNA 4XVTL 1GRWA 4A2MA 3V4VB 5ENWA 1J0IA 2X1XR 2EDXA 3L5XL 1EEYA 3SO5A 1KXTB 5D55A 3DX9B 3X1BA 1BYNA 3P9MB 4G72B 3EFDL 3QPQC 3DVIA 1OARH 4OJFL 1TIUA 5KVEL 1GAFH 1YQVL 1FZJB 1MCDA 1U58B 3DDGA 3IDGB 3JV4A 1DQIA 3QO1B 3UTTD 5CEZE 5JW4M 2PR4L 4EPSA 5M7QA 2ALWA 4FYTA 4FULA 3SE9L 3T71A 4PS8A 4AYFB 3KLHC 1AIFA 7FABH 1PAMA 3VFRA 1N8ZA 3PUUA 1OM9A 3EOAA 5DC0A 5LXVA 2VH5H 4YZFE 4Y19D 3O45A 1F2XK 3PLYA 1EUUA 3W5MA 4UV4H 5EO0A 4O02A 3VGGA 5JNYB 3QJFB 3NT0A 2WKGA 3WKNA 2NUPB 4MA3A 3V0HA 3CJJA 3FSVA 4OD2B 3OLGA 1DQQA 4U1HB 1H15A 2EXYD 1XF4B 3OSVA 5K5YA 2NDGA 5FM5M 5A2LH 2X3AA 3DI2B 1LE9A 1NGWA 3FT1A 4KK8D 1ZT7A 3ZT7A 2DL9A 4EXPX 4XCNB 4LBEB 4CADA 4GLRH 4J3TA 5IQOA 1WUNT 4I2XE 1NKOA 2EKJA 4UQIM 2XN9B 3GKZA 2W0FB 3P0YL 4BZ1L 1KPVB 4KZDH 3J27A 5EIIA 4MAZA 4HV8B 1JUFA 3L7FB 1QSFE 3CDYA 2AJXL 5DUPH 1EZSA 5D7EA 3ZOAA 2KZWA 2ZAHA 2GY7B 2O5ZL 1EO8L 1TEFA 2LGNA 1KIPB 2RAMA 5E1GA 1T6VN 3FT2A 3O4LB 4NP4L 1EEZB 2AJZA 3QA3B 4AE0A 2YKLL 2DLIA 4JO1H 5ESVB 1YJDH 1WYJA 1P1VA 3FQRB 1HSAA 5D7JA 4P2AA 3DSNB 3MNDA 2MHAB 1AHWB 1NGXB 1S9YA 1WITA 3PWNA 3Q5YA 4HF5L 3RZCD 5EC1B 2SEBA 3BJ91 4OF7A 1KJMB 2MPVA 2ZKYA 4NNXA 1F00I 2WQXA 3CE1A 1JVLA 2XHNA 3QORB 5D70L 1U2CA 4OI7A 4LE8A 4JQIL 2DH2A 1IQDA 3MRNA 1OGAD 4ZUSA 4W9JC 4HIJB 4NZTH 3OL2A 4KO7A 1YEDA 1A7QH 2EDDA 2W80C 2A9AA 1QO3B 2RA1A 1JFQL 4AKOA 3B9KA 4DGVL 4Y16D 4LOUD 3RGBA 3IN2A 5D1ZI 2YPLD 4CC0A 2DWTA 5KW9H 2A74B 1T80A 4PJ5B 3V4VL 1OK0A 3PP3H 1YUKB 4XH2A 3SDDC 4NO2B 1HCZA 3RX7A 1HX0A 2AQPA 4ZX3A 5B7FA 1AKPA 4DZ8B 1QQDA 3FB6B 1XEUA 4AK1A 1Z9OA 1WT5C 3Q5OA 2YPKA 4TNWF 3IJHB 4AEHL 5C3LD 3NRPA 3VSQA 4AGNA 3GXPA 2ADYA 4R5XA 4DQAA 5BRZD 2Z93A 2EIMB 4AL8L 2Z4QB 4PV8A 3VX1A 5GRVL 4GQQA 4OI8A 1QNIA 3CX2A 4JO3L 3ECVA 4GAAA 4WK4B 4NAMA 4F58H 5DZLA 4PIRF 3W9DB 5E2UL 4R2GB 3KXFB 4CJ0A 4PLKD 4ANWA 4N1HB 4WW1B 3COOA 5L4FA 4OIBA 4HUNB 3SKNA 1I9JL 4FYSA 4BZ1A 1NMAH 5BVJB 4RDBA 5T3XL 4ZOAA 4ZSOB 2JE8A 2QKIC 4L0PB 1HNFA 3LH2L 5HGDB 3MJGX 4WU7B 2IAMB 2YOAA 2KBGA 3L08A 4M7LH 1V54B 4H88L 5CD3A 3TO4C 5HI4C 2YPVL 2XKNB 2DQJH 1KN4L 1A3RL 4JMXA 1R5WB 3HAEH 5CGYD 3ULUD 1Q1JL 2WBWB 1BZ7A 4XNBA 5DJCA 3E1F1 2QDVA 4WQOA 1MI5D 2EH7H 4RBPH 2EZ0C 3JTTA 2FBOJ 1U8NB 1DFBL 2ORBH 4W9HC 2A6KA 2F7QA 4Y4HC 2BZ7A 2XVKA 3DGGA 3NSXA 4Z5RA 3OHXB 4IRSD 4GAYB 2O26U 2Q0ZX 4K3JL 4A7UA 3MCKB 4F91B 3X12B 4N9GA 3WXVH 4Z78B 4X5QA 4JQIA 3QEGL 2HLEB 3EGXB 2NY4C 5LBGA 1MJUL 1MXDA 1RIHH 4U1KA 1ZJBA 2FT7A 1I7UB 5FA4A 3VXUB 2B14A 1T0NA 4JFTA 1GOFA 3BZEB 4XPFL 2HT4C 1UKQA 1XWVA 3KPSA 2Q86A 4ONOA 1CBVH 1P53A 2VKXA 3JWDL 4YBLB 4A2DA 4PWHA 5CILL 5IOPB 3V4VA 4AM0B 2Y6SC 5KUMA 4BCXA 1KXTA 3VG0H 3VRLE 4FFYL 4CVZA 5L2KB 3RAJH 1FZJA 1U58A 3Q7JA 4JLRA 3CZFA 1I8IB 3QO1A 4NWUH 4Z7IA 3LN9A 3PP4H 4EI6A 3E8UH 5GRVK 4HK0B 3FBQA 1MEXH 2P4AB 4U0RB 4RRPA 4ZO9A 2PYFB 3ETTA 3V0GA 4AYFA 3HHSA 4HA1A 5DHEA 1AANA 1TLMA 4HJUA 5DC2A 3R7QA 4DP4X 4RIRB 1D9KD 1XGYL 2WGNB 4V1DE 2LOEA 4OZFG 2H6PB 2HKFH 2NUPA 4JFFB 2XN0A 5D1XB 1RZGB 2QSTA 4GW1A 1XHHA 4OD2A 1AHMA 2YC1A 4U1HA 5ETUB 5SV3A 2X7LA 4ORZC 1UVQB 1USZA 1U8QB 4HWBH 2PCFB 2J1XA 2BY0A 1A66A 3ZHLA 3STZA 2JI1A 1MFMA 4XCNA 4LBEA 3FTGA 1FIGH 5D7LA 4FZEL 2Z7ZA 4XHQA 3VFTB 2EVGA 4NDMB 1IAII 2XN9A 2W0FA 3H7LA 3RGVC 1JNLL 1AVAA 5MEND 1KBGH 4HV8A 2N1KA 3L7FA 5B1JA 5CGBA 4JPIB 1KWGA 3B43A 3ZMEA 4ETQB 3G6JE 1Z3RA 1JS4A 3TP4A 1HSBA 3TA3C 2QVMA 2LQRA 2VLKD 2Y7MA 5BVPH 3MJ9L 4KTGA 3O4LA 4LHUD 5J56B 2EE9A 3IRCA 3RWFB 1H3VA 2BOBB 3QA3A 1M56B 1AR1D 2VDKB 4XP6L 3BZ4A 1VKXA 1JK8B 5CAYB 3KLAB 1XIWC 4G70B 5ESVA 1N3NB 3H9HA 2R69H 4U33A 2E7LA 3IMRA 4DPRA 2FATL 5B4MC 3CVIL 3DSNA 4HUXB 4L18A 1AHWA 1NGXA 4L8BB 3VG9C 4FNQA 1PY9A 1JSYA 1WBZA 2IWGA 5EC1A 4HKZB 4I0PC 2VZTA 4E9YA 2YBGA 3VGAB 4AIZB 3UAEA 1FFTB 5TK2A 1KJMA 4DPAX 3P4OB 2OSLB 1IJ9A 3QORA 4Q6IA 3OB8A 4YXHH 4O51B 2N4IA 3HRPA 1B2WL 4XN5A 1A4CA 1S8DB 2NNXA 4HIJA 1S3KL 3MREB 2R4RH 1CE1H 3TJHD 3S8WA 3NIFB 2J6WA 1TTRA 4GO9A 1K4DB 2Q7AA 3FKUS 2QZ5A 4FFYA 4K7PH 4XVOA 1E8YA 2LE9A 5MP6H 3GNML 3B9AA 3LRLA 3OKYA 3S4SB 3GMOB 2A74A 1P4IL 3LRGA 4PJ5A 4PB0H 3DX6B 2WTRA 1BGXL 4NO2A 4B9JA 2GB2A 1A6TB 4F2ME 2B1OA 1DANT 1XX9C 3IAQA 4DZ8A 3FB6A 1R1CA 1BOGB 3VFMB 4AKPA 2R4SH 1EERB 2WUCL 3T3MB 5AALA 4I5BB 5KZCD 3KVDD 4KKBD 3TIEB 1RZIA 5TPWH 1JXJA 3VXRD 4W81A 1TFPA 2D31A 4LRNH 4QTHA 2VWEC 4Z3TA 4TN9A 3B56A 1ZCRA 4XN4A 3T0AA 2YOCA 1MFAH 1KIRA 4G8IB 3W9DA 1E3ZA 4L8SB 1EA9C 2CO3A 3BPOC 3IFNL 4WW1A 2GFBB 1JZEA 3W2DH 1RIUH 1WS7A 4APQD 2JVUA 4PJFB 2P44B 3WO3B 3ARDC 4L1LA 3D48R 1UEMA 4WJ5B 4ZSOA 3OG6B 2NZIA 4NNYA 1N6QH 3BP5B 5HGDA 1HZHH 5CJQL 4WU7A 5HJ3B 2HH0L 4HOMA 3KLDA 4ONFL 4IM8A 3QAQA 4O4YH 3PNWB 4PJ8C 4OFDA 3TVMC 3WEAA 4OQ1A 1WIPA 3MJ9A 1R5WA 3NJXA 3D3VA 2GJ6D 1H3PH 3F64A 1T1WA 3LEVL 3ISYA 4J39A 4I9XA 1Z5LB 2YUZA 3LH8A 1VFMA 5D5MF 1U8NA 3AS3A 3MXVH 4Y88A 5HGGS 5E6RB 4AYBA 4Q97A 1TDQA 3T8MA 5TJWK 1OAQH 4ZPVA 5TTRA 1YAZA 2JK5B 1Y6KR 3OHXA 5MI0C 2VDKL 1TZOA 4FMKA 1CFBA 5J12B 3MCKA 1BVNP 1QTPA 3F5WB 3X12A 5E2VL 1HWHB 5G2NA 4KQ3H 3O8XD 1GJWA 3EGXA 5ISZE 5H8DA 4BK5A 5F2FA 5JOFA 1XD0A 1I7UA 5I0ZA 4LLYB 5J3HD 1G9MC 3HG3A 5IKCB 4BZYA 3JUZA 1GIGL 3OWRA 3IS0X 1NM4A 2KLRA 5IOPA 4AM0A 5KYYB 1KFGA 5DGRA 5I6LA 5J57B 5FXCH 2VDRH 2YZ1A 4LKCB 4NQED 2DEXX 1E9PA 1TPXC 3IKCB 2IV8A 2H2SC 4ODUB 1YA5A 4ZDHB 4BH8A 2IH9A 5A6LA 1I8IA 1T66C 4N2OA 1U92B 1DBJL 4RETB 2HX8A 2H32B