4MFHA

Crystal structure of m121g azurin
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALGKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Copper-sulfenate complex from oxidation of a cavity mutant of Pseudomonas aeruginosa azurin.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 32
structure length 128
sequence length 128
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4mfhA00
2GIMA 4DP9X 1A8ZA 2R7EB 4YSPA 2UXGA 2ZWNA 1HAUA 1A4CA 2PPDA 3ABLB 5E9NA 1GR7A 1CYWA 3C75A 3NSDA 3WKPA 4KO9A 4HALA 2FT8A 5B7EA 1V10A 5B1JA 4AKPA 2P80D 2GC7C 2UXVA 4PCYA 3SBQA 3TBBA 2MTAA 1KYAA 3HEIB 4P5RA 2PP9A 2BWDA 2BP0B 3U25A 2VW7A 5EHFA 4W1TA 1KDIA 2P80A 4YSAA 2H47C 2ZXWB 2UX6A 1ZV2A 2YAOA 2Y1AA 2VW4A 2FNWA 2Q5BA 2W88A 1FA4A 2AVFA 3S8GB 1JZIA 4KNUA 2BHFA 2RACA 2CUAA 1AANA 4YSUA 4NB7A 4L0PB 1N70A 4M4RB 2HX8A 2HRGA 1GSKA 1KGYE 1L9QA 1E5ZA 1IC0A 3FU7B 4KO6A 5IY5B 2J57A 4KO7A 1RZQA 1ZIAA 1J9TA 2E86A 1OE3A 3QJSB 1PLCA 2IDUA 1GYCA 2DWTA 2DWSA 5D4HA 1GS8A 4E9XA 1BYPA 4GP8B 1RZPA 4N4YB 1NICA 2WO3B 3PLYA 2J55A 1AIZA 3ASOB 7PAZA 2BW4A 1EHKB 2PPCA 4DP6X 4E9RA 1AZUA 4HCIA 3EH4B 1PCSA 4KO5A 4G70B 5I28A 5D4JA 1JOIA 1CC3A 4YVUA 1E65A 2GI0A 2XXFA 2PPAA 1FFTB 3FSVA 1MDAA 3NJGA 1CURA 2YARA 3SQRA 1HFUA 3QJUB 2EIMB 1W6LA 3AG3B 3WNIA 2DYRB 4M3HA 2EIJB 2CJ3A 1AACA 3QJTB 3OQRA 3T6WA 1WA0X 4HHWA 2QDVA 2IWEA 2VM3A 1ILUA 2XU9A 4YSRA 2XX0A 1AOZA 1CYXA 2LLNA 2MRYA 3BQVA 3NYKA 3QQXA 3FQ2A 3T71A 3UAEA 3FT0A 1CUOA 4NERA 1AS6A 3NP3A 1QLEB 1XB6A 2TSAA 3IN0A 1RKRA 1PZCA 2VM4A 4G7SB 4G72B 4Q8BA 3RYMA 1EZLA 3X1BA 1ID2A 1AZBA 1AAJA 2IH9A 4DPAX 1NIFA 3ERXA 3EH5B 3CVBA 4UAHA 4DP4X 3PXLA 4BWTA 1ZDQA 4A68A 1FWXA 4DP2X 3IEAA 4A66A 5I6MA 1GY2A 1GY1A 2FTAA 4G7RB 2PPEA 1YLBB 3FPXA 3DIVA 3T9WA 3OMIB 1M56B 3GDCA 1IKOP 2YXVA 3NJIA 3L45A 1JZGA 1PAZA 3AY2A 3EH3B 4UANA 2YAMA 4DP0X 4E9SA 1IBYA 5I6KA 1KCBA 3NT0A 2YAQA 3QJRB 4RH4A 3FU8A 2IDQA 1SF3A 2FT6A 1MG2C 2DV6A 5AFAA 4WKXA 1KV7A 1NIEA 1OF0A 2X87A 1WAEA 3IBOA 5I26A 5I5IA 4EF3A 1N68A 4YSOA 1AZCA 1OE2A 1WS7A 2BP0A 2FQEA 4FA7B 1KCWA 3AG4B 4KOCA 4DPBX 4KNTA 3NSYA 1OCOB 4CSZA 3ZDWA 1X9RA 1I53A 1NWOA 1SNRA 1UATA 3FQ1A 3EHBB 1M57B 2I85A 4GY4A 2VN3A 4YSSA 3HB3B 1A4AA 2NRDA 1GS7A 2XV2A 4HCGA 3X2QB 1ASQA 4HZ1A 5I6NA 1NIBA 5B1AB 1PNCA 3V9EA 3AG2B 5I6PA 3X1GA 2OJ1A 3WIAA 4KOBA 3PCYA 2YAFA 5B1BB 4DP8X 3UGEA 3X1EA 1TKWA 1QNIA 1BXUA 1WA2X 1ZPUA 4BDVA 3FSWA 2HLEB 3TBCA 2BW5A 2HRHA 2XLLA 4GP4B 5ANHA 2BP8A 1AR1B 2ZONA 2FQFA 2IWKA 3NSFA 1B3IA 1TU2A 1ET7A 2BWIA 2AZUA 2IDSA 3T6VA 3X1FA 1NWPA 3X1NA 2VW6A 4AKOA 5A7EA 1W6WA 3FS9A 1NZRA 1KBWA 4BXVA 4GXFA 3CVCA 2AFNA 2Y69B 3EF4A 4BWWA 3NJJA 3JT2A 1NDTA 7PCYA 3NSCA 4HAKA 1RCYA 1TEFA 2XWZA 1NIDA 4AKQA 3CDZA 1JERA 1TEGA 3ABMB 3D12B 4DP1X 1AS7A 3UABA 1JZJA 1GW0A 2I7SA 3CDZB 3S3DB 2CALA 2PP7A 2N0MA 4F2EA 2PCYA 4BWUA 3WNJA 1ETJA 2FJSA 2XXGA 1L9SA 1SF5A 2EILB 4WTQA 1BQRA 1SDDA 4JKNA 3SBRA 2GBAA 4HHGA 1OCRB 3QJQB 1OCCB 4A2GA 3AZUA 1ADWA 5F7AA 1BXAA 1SDDB 3MX0B 4W9ZA 4E9TA 2YAPA 4AI7A 2EIKB 4GYBA 1A65A 1JVOA 3OD3A 1ILSA 2B08A 4YSCA 1WA1X 1XB8A 1WS8A 5PAZA 4G71B 4QKTA 2PCFA 4TXVB 1IBZA 2YXWA 3OM3B 1BXVA 3NJMA 1V55B 3H4FA 4A67A 1ASPA 4YSQA 1MZYA 2YQBA 4E9VA 1PY0A 1AG0A 3H56A 2PLTA 4P5SA 1PLAA 2VSKB 3IN2A 1DYZA 4HIPA 2VSMB 3ASNB 5I6OA 4DP5X 3TASA 3JTBA 2IH8A 2ZOOA 3CVDA 4KNSA 3FYIB 3ZBMA 2FT7A 2UXFA 3NJKA 3TA4D 3KW8A 1MZZA 1ET8A 4A2HA 1DZ0A 4E9QA 5TK2A 2JXMA 2CCWA 3V9CA 1NINA 3FSZA 3N55A 4FAAB 1OCZB 6PCYA 2WO2B 1A3ZA 4HCFA 1BEXA 1KDJA 1PLBA 3FU9A 2W8CA 4AZUA 3QJVB 1IUZA 2BZ7A 2XV0A 1PMYA 5LDUA 2IWFA 3DKHA 2EINB 3G5WA 1JZFA 3UAAA 2GC4C 3TU6A 3WI9A 1J9QA 1NPJA 1AG6A 3KW7A 2FWLB 5B1JC 4A2EA 1URIA 2B3IA 1PF3A 2PPFA 4GP5B 3FYEB 3GXUB 3S3CB 1JXGA 3FSAA 1M9WA 1NPNA 2OV0A 5FC9A 2UX7A 4BK5C 2JFCA 4A2FA 2H5UA 2J56A 1XB3A 4F7KA 1L9RA 1KBVA 3PAUA 1J9RA 1A4BA 3NP4A 2AANA 1AZNA 3NJHA 2I7OA 2FQGA 2AZAA 3FQYA 1T5KA 1ET5A 1JZEA 3T6ZA 4BDVB 1XMEB 4BXSV 2VMJA 1JXFA 2QDWA 4F2FA 5I6LA 1JXDA 2XVBA 3WKQA 2UXTA 1L9OA 3PAZA 1NIAA 5B7FA 4MFHA 1W8EA 1L9TA 4Q89A 2IDFA 1BYOA 2HX7A 4JHVA 2BO0A 3PPSA 2HX9A 1OV8A 4CSPA 3SBPA 1SFDA 1OE1A 2FQDA 5B7MA 2CBPA 4YSDA 2X88A 2GB2A 4AX3A 3ZIYA 2OCCB 2DY2A 4X4KA 4ENZA 5F7BA 1L9PA 2PP8A 3WG7B 4YSEA 1GS6X 1X9UA 2A3TA 4YSTA 4NAJA 4A2DA 1E30A 3N2JA 3S8FB 1BAWA 2JKWA 3ABKB 5AZUA 4DP7X 1JZHA 4DPCX 2BZCA 1E5YA 5TK4A 1JVLA 5B1KA 2QPDB 1PZBA 2GSMB 1OOWA 3H4HA 3AG1B 2J5WA 1HAWA 3NJNA 5PCYA 3OMAB 5B3SB 2R7EA 1NTDA 1BQKA 2HXAA 3OMNB 3QPKA 2XYBA 8PAZA 3BVDB 2CAKA 1ZIBA 3MBWB 1SJMA 1AQ8A 1SHWA 2QT6A 9PCYA 5AKRA 1PZAA 2DYSB 5I5MA 3CZUB 4N8UA 5D4IA 4G7QB 1SHXA 4YL4A 1R1CA 2IDTA 2XUWA 4PAZA 3ABGA 4E9YA 1ASOA 1SFHA 3GYRA 4E9WA 2HZHA 3ZX1A 5I5JA 1ZDSA 3AW5A 6PAZA 4YVNA 2H3XC 1QHQA 2XX1A 4ZK8A 3S3BB 3NJFA 1F56A 2Q9OA 2WSDA 3FU7A 3NJLA 1VLXA 1V54B 1J5DA 3IE9A 1J9SA 2BP8B 2YAEA 2GHZA 2IAAC 4UF7C 4JHUA 3PAVA 3T6XA 3UACA 2YAHA 4QLWA 3UADA 2QPEB 1E67A 3CG8A 1AS8A 1AZRA 2TSBA 3FPYA 1PNDA 2XV3A 1BQ5A 1MG3C 1J5CA 3DTUB 4K9JA
chains in the Genus database with same CATH superfamily
2ZWSA 2WMPA 2J2ZB 3C87A 3QI9D 3U2SB 2E7LC 2EVHA 1CXKA 2R7EB 4HF5H 5B39G 4DCQA 3DJZA 1V3LA 1NCAH 3O3BA 4H1LB 4ZTPL 4HIIB 4PLKC 1I3RA 1PYWB 1JAEA 2E8YA 3X11A 5CGBA 1BECA 1ZT4B 2ZXAA 1KYAA 4CSTA 4TLKA 3KLAA 3ATFA 4AOFA 3C8KA 3P11L 4N0UB 4AQZA 4EQ3A 4PRAB 1FL6A 3D85B 4MMXB 1H3WM 2EDKA 3KLLA 2O5ZH 4AQ1B 3HUJA 2ZUQC 2L7EA 3O6FD 1NGYA 4QGTA 4W1TA 5HYIA 1KDIA 4KHTH 4ZSOA 5D1ZD 3E6FA 1MCCA 3CFBA 3KDPB 3RTQB 4DVBB 2AVFA 5EU6B 4OM1H 2YFNA 4BEIA 1DE4B 4U6VL 5L2KB 3WYRA 1KB9K 3D4YA 4R4BA 3L1OL 5HVHB 3ZDXF 1EJFA 1K9TA 4JDEA 1FORH 1HEHC 5H94A 4XZ4A 2YEZA 5JOFB 1YVLA 2BIMA 5DURB 2Y5TA 4KO6A 1AHWB 2ENSA 5DRXB 4U4IA 3VFUA 3FBQA 5IFJB 2X89D 5HJBA 2WQ8A 3MJWA 1MFBH 3B2UD 3QDMB 1KGCE 3EOTH 5D1ZC 2CGYA 5FO7B 1T1WB 2IF7A 4HPOL 2EUVA 2H32H 1X5XA 2DEYX 3QQ9D 3E38A 2C1OA 2XI9A 1TTCA 1KB5L 3CSFA 1AIZA 4GEJA 3HKFA 4CA4A 3LMJH 2EVFA 3OJMB 1U8QA 2OFQA 4OKDA 3K6IA 4HCIA 2DKSA 3QDGB 1D9KC 3C5SB 4YDMA 4UOQA 4WY7H 1VACA 4M4PA 5D1QD 5FOJA 1N5YL 2XBDA 1KBGL 4N2EA 5D70L 2E9BA 2PWEA 4ZODA 2VKXA 3UJJH 3T3ME 1DBML 2MQ0A 3TO4D 4WO4B 3FKUS 4M3HA 1G1CA 1NBZB 1X5GA 3VA2C 1P4BH 2J2ZA 3FHAA 2A2QT 3IFLH 3T6WA 3VI4B 4XNMB 1UCTA 4WSGA 1BD2A 4NKQB 2IH3B 1ILUA 5D9SB 4S1RH 3OR6B 4GUOA 5I18H 1CYXA 2LLNA 1U6AL 4R97C 3T71A 7FABL 1T0MA 4W9GC 1BAFL 1KACB 4R4FL 4L0YA 1F6LL 4PRPD 3HHSA 1BLNA 3RX8A 4HUXB 1NCTA 2OI9B 1F4WL 3J2PA 3UTZA 1AKPA 4S0TD 2EP6A 1GZQB 3RFZC 2IDCA 4IDJH 3X1BA 3BH4A 5FFGA 1CI3M 4HLJA 2WM0A 4AQ1A 3DX8A 3VYPA 4P2QB 2K1MA 2EDBA 1MLCB 3ZZLA 1NQBA 3ZQXA 4KTDL 4N28A 3CFDB 3HPLA 1CU4H 2ZUVA 3S35H 3JV6B 2Y07H 5EBMB 3GLAA 4KRPB 4OFPA 5E1AA 4F1SA 5G4NA 1U41A 5SX5K 3FPXA 3EBGA 2X4TB 2NXYD 3BW9B 1F18A 3MRBA 5DXWA 4DP0X 3X14A 1JZGA 3DOSB 4JPWL 5CP7B 3U4EA 3V6OE 3N1PC 4NJ9L 2E9IA 4IHBA 1HL5A 3KYAA 1RLBA 3CUPA 4HXAH 2H0FA 5FO7A 1BOGB 1MFDL 4ANXA 3FB8B 1ZLWK 4X5XA 4P2OB 2BP0A 3QDJB 4ZQKB 3LIZH 1S7RB 5CNHA 2MOQA 4AYBA 4BCXA 2DIBA 2WXOA 2YGPA 3R06A 2X2JA 1Q9OA 1GRWA 5K1VA 1NCDL 3BUPA 5AYTA 2QADC 4NUGH 4X6DF 4Z0XA 4XO8A 2YK1L 5IMMA 1PCXA 4E5XB 2WZ5A 2EE3A 2EXWC 4XAKD 5F1KC 1P84K 5B38A 5DRWB 1H3TA 2VNCA 4HUUB 2QADB 5HGGS 3HG1D 2J4WH 4NLAA 2QQKH 5CJOL 4EMZA 1OZTG 1DSFH 1NIBA 4OZ4A 1OAQH 3I3DA 1MAMH 5LGYA 5IHLB 2QSQA 3UGEA 1JZ7A 2JE8A 1PZ5B 3TS8A 5J7CC 1PD6A 2PXYD 3GSQB 4N3UA 3V4PL 1SYSB 4XNBA 2DLFH 5HJGA 3ZYOA 5D1QA 1NEPA 1WA2X 4UOW0 1NCBL 1LD9B 4K0OA 2JIXA 3NTCH 5C6TH 3BDXA 3L7FB 4QHPA 2NSMA 1RUAH 2BINA 1B3IA 3ZDZB 4N0FB 2WAQA 4G8IB 4U7KA 3P2BA 3WE1A 3CFTA 4B9IA 3SCMB 3T6VA 1UM4H 1J1PH 2R1WB 3C09B 3LH2L 4LO9A 4NNXB 4OF3A 5LXGL 3TWCH 4ANWA 4P49A 4HWBH 2J71A 2NY6C 4N2KA 5DO8A 3W56A 3ATEA 5A40E 4CC1A 3PWUA 2IEPA 2Q0ZX 3H3KA 4Z78B 4LARL 4UTAA 4HF5L 3CFDA 2DWEB 4QGYA 4BHUA 3D12B 2DS4A 3I9AA 2A9NL 4PJIE 4EIUA 3FOLB 4QRSB 1V7NL 4CVZA 3S88H 3HE7D 5FYLL 1AYRA 2CNZA 5KSBF 5AYUL 4PJ5B 3X14B 3WNKA 3RGVB 2PP7A 4K8RD 1REIA 5C1MB 2Y6SD 3EYFB 5ESVB 4C4BA 5J4MA 2E5EA 2ENPA 2ICEB 4FQ2H 4ZS6D 3OKEB 4HA1A 3N04A 1L9SA 4QRRA 2EILB 2PO6D 1S7XA 1ZHLB 2LHAA 1YMME 2XWEA 1BOGA 2V5YA 3KYOB 4XODA 2EADA 1N5AA 4YFDB 1YZZA 4R7NA 3P0GB 5EEYA 3I50H 4QNPF 4K23H 5IV2B 1INQB 2ED8A 3JV0A 2HMID 4WK4B 1JGVL 1BD2D 4JG5A 1IGYB 4TUUA 4YWGL 3BP6B 5C0FA 1KTKE 4GRMA 1RJCA 4AQAA 1P7QA 2AEIT 5BRZE 4L8DB 1WG3A 1ZANH 4ZO9A 3WY4A 3ZR6A 2OXHA 4ZMOA 3VG9B 1I8LC 3IMVA 4GKZB 1AG0A 3WD5L 3GHBH 3VJ6B 3ZDXE 2Q86A 4HIPA 4OD3L 5DUPH 5GGUA 3RGBA 3WDJA 1EMTL 4C8XA 5GS0L 3CV5A 2YLKA 3O2DA 3HTLX 4HJGB 5D7JB 4J6RH 1E9QB 4KV5F 4MJIB 4ES8A 5J1AA 3DVIA 3PFQA 1CFTB 4BBWA 4F7CA 2IQ9H 3KM2A 4IW4C 3KW8A 4OI8A 2WGXA 1G5GA 4HCRH 4MD4A 3H55A 4FLSA 4PJ5A 4QMEA 1IV8A 4W9KC 3RDTC 4Y5XB 4AEEA 3H42H 3DV4A 5JOPD 1IL1A 2PW2B 1G6VK 1XF3B 4K3JL 5C0EA 2VL5B 2VTFA 3T0WA 1CE1H 5SV4A 3D8MA 3L3HA 4XHJD 2EDFA 2N59A 3OAUL 4TLTA 4L4VA 5JTWA 5JHDE 5IV2A 3G5WA 3QUKA 4OJYA 2YWZA 2VDNH 1G9MH 1DBBH 1XCWA 3WFBH 4J8RA 5I1LB 1BZOA 3EFDH 3GMRB 1CGTA 2DWYA 4M8QA 4LASH 1JXGA 1WBYB 5BJTB 4NQCA 2CXKA 5DRNB 5TTRA 3R0NA 1EAQA 3IMTA 4WUKH 1QSEA 3SPIA 4HGKC 3BRFA 4LLMA 1F00I 4AW7A 4YHPB 3QR1A 3CPUA 2ZXDA 4G8GB 3H54A 4D9QE 2O93L 4GSQA 1ACZA 1OGTB 4NPKA 3SPGA 4KV5E 4NKOA 3C5ZD 3JUZA 3FRPA 2XVBA 2HTKD 4U1JA 3VD7A 5M7QA 4YHML 3BDBA 4WCYH 4GUPA 1XR9A 1CF1A 1AXSB 4JFZH 3RIAK 4XBGB 1TSHA 1JZ2A 3MREA 1U93A 1JHLH 2UZYA 5DD1L 2VC2B 5AZEL 3VD4A 5IW6B 3UBHA 4Y2DD 3DURA 5KYYA 1R5WA 2Q86B 1XF3A 4JHAL 3QJZA 1OQXA 4HJGA 3PWPD 1RUML 1SZNA 2C5DC 3WG7B 3EGXB 1GS6X 3T77B 4YBQD 4OLVH 3S37X 3V4VA 4AG4H 2D9QB 3TP4A 4DP7X 1RZ7L 1EO8L 3Q48A 5EU4B 3TT3H 3UYPB 2I60L 3KVPA 5TDOA 2AEWA 5C0BA 5I2IB 3VFGL 3T0EC 4UZGA 5IQNA 2P1YA 1E40A 4L9LA 3MOAL 1MHPL 1ZTXH 4PY7A 4H88L 4JVPA 4GRLA 1KCUH 4WUUE 3ESNA 4YZFE 3RGVD 2H1LM 4JN1H 5J5EA 1XVSA 2IANA 2P48B 2WQRA 3CDGA 1ZVHA 1QWHA 2FLRT 4P9HL 1O75A 3DBXB 3FQXA 4LVHB 3UC2A 2XFGB 3T2LA 3POCA 3CZLA 5J0BA 1CXHA 4YEFA 4TF4A 5C2BH 2VDKH 3BI9X 5I19H 1EANA 5F70A 2DYSB 5INCB 3LHPL 4LSRH 5D4IA 5I5MA 3K81A 2MKWA 4HWBL 4U05A 1K8DA 4UV4L 4HKBB 1QLFB 3QUZA 2FDBP 3MOBH 3LN5B 1YYLH 3EOYG 4TOYL 3GUTA 3L6FA 3QPXL 3AW5A 3N42F 5I1LA 1TQSA 5I75C 1T22A 4XT1C 1FLRL 4L4TE 2FYVA 2YQ2A 1BOYA 1JPGA 2HB0A 5SWSD 2VLJD 1UM4L 2XWBB 3VACA 2Z92B 1J5DA 1U92B 4XMKH 5BW7C 4OCSH 2HWZH 3ZHDA 4B27A 3V4PB 1AO7E 2F8XC 1TJIH 2RHEA 3FTVA 3HI5H 4FG6C 3OKKA 4QLWA 3CQFA 2IADB 3L17A 4K73A 1V27A 4WJG3 5IQMA 5H37A 1OGTA 4QF1A 4ELKA 3QNZB 1KIPA 1LWHA 4J3OC 3BVVA 4XVUC 1B3JA 3D05A 1Q0XL 4MLSA 3BH8B 1PNDA 2CRZA 2VZSA 3E3QC 3GLEA 3NVQA 1V7ML 3CHXA 1BIIB 3NZHL 1EZVX 3OPZL 3BAEL 3FZUD 2R51A 4L9LB 4WWKA 1QQDA 2NX5D 2IMNA 4X8CA 1IGCL 2AAAA 1KN4H 3VWKB 3RZCB 2OR9H 2ZOKB 4CADB 1VA9A 1RVFH 4JCMA 5DK3A 4DKAA 4OUOA 2BDNH 4N2CA 1X6NA 2Y7QA 3RZCD 2XC8A 3QG6A 3HC0A 4Y1TA 3KPRE 3DROB 5FYKU 5JHAA 3U82B 1BQHG 1T66C 3KLDA 2NY1B 1PKQB 2X2UA 1OSZA 4FS0A 4PRIA 2R56H 2AJXH 1R34A 3AS2A 2KLTA 4UILL 1Z7JA 4LSPL 3V0DA 1H8OA 3VH8A 4U6YB 3ECWA 2VW7A 1MVYA 2N7BA 4JVWA 3WN6A 4MMXA 4NZ8A 1M42A 4XNUL 4ZD3H 4LL9A 4MDJA 1D5ZA 1NGYB 3NCEB 2C1PB 5FV2A 1L7IL 1RSFA 1GOFA 1IU1A 3ROLB 1G5AA 25C8H 4JFHD 4NB7A 2N0KA 2VMCA 1U91B 5EZPA 4L3AA 4B9YA 4P4KD 4YZWA 1KNOB 1GSKA 4JREB 1IKFH 3CSPA 2Y6TE 2NXYC 1AGCB 4YBLB 3PQYE 3QEUB 3RU8L 4LCYA 1JVKA 5H37G 4Y1AE 1D5IL 5E8PB 4RQQA 1CTNA 5HYJA 2X4QB 3D08A 2JJSA 2ZXBA 3VXRB 3QO0B 2CLRA 3KL3A 1IAKB 3HE6D 3VXME 1DBJL 3VWKD 3MHZA 4N4YB 1NICA 1PLGH 2R2EA 4P3WA 5HI3D 3GO1H 4WUUB 2DMGA 2X1WL 4K2UL 4L5FH 5SWSA 1DO6A 2C9UA 4K7PH 3REWA 2TRHA 1G9MC 3V4LA 2CSPA 3BOVA 4YDIL 3G5ZB 3BZFA 3QDHA 3MJ8B 1ZGLM 1KGWA 1MQKL 2X53A 3ZTDC 4X6CE 5AOZA 4EJ1C 1P4IL 4MJ5A 4XTRD 1WO2A 1JK8B 1W6LA 3D2TA 1VJSA 4HD9A 1M2VA 1FCGA 4I1PA 1ADQA 3FONA 2ZUWA 4Z3IA 3FMGL 2HCZX 3THML 5J6HA 4FULA 1JPST 4JFXB 2XVLA 5KW9L 3ZE1E 2VDML 4Y4HA 1X4YA 4MCZB 1U8HA 3ELAT 5T3XE 2HFEB 1CDCA 3EJTA 4WI9A 2EDLA 3LHPH 1A1NB 4LSRL 4W6XB 1R9FA 1DR9A 1Z9MA 3WKNA 1WIUA 1ND0B 1TTFA 3PV6B 4IBTA 4NGHH 4DHLA 3FT0A 4KY2A 3MOBL 4PRID 3NP3A 2YD0A 2AI0L 3I6GB 3N43B 5JXAL 3IN0A 5IVXE 3TJEL 2F5BL 2JELH 2X1QA 2UV3A 4WCYL 5CCGE 2PYEB 4AQ1C 1PPIA 1TJGH 2WSPA 4WI0B 1MCBA 4S0HA 1GZQA 3VG9C 4AYID 4HIHA 4FRWA 4DP4X 4FQ1H 5E6IB 1X5LA 1FWXA 2NY6B 1D2PA 1J5HA 5CHNA 4HP5A 1NC4A 3VNYA 5KS9E 3E80A 1UCBH 3MFFB 4RRPG 1YLBB 4U6HB 5BZWA 1C8QA 3NJIA 1QYGL 1YUKB 2YAMA 3QQ3A 2V2TA 2RCSH 1TENA 4AM0Q 1NSNH 4RAHA 3RUGF 4NSKB 1F6AB 2J8UA 3QZMA 3AFLA 3QAZB 3PWPB 5E94B 2DV6A 4Z6AT 4X4XB 4GW5B 4KHXH 2X87A 2X4QA 3GTTA 1OB0A 3BN9D 1LGVA 3U1QA 2K8QA 2NSQA 4DWHA 3Q2NA 1UWXH 1MLBB 4JFDE 2J21A 3H3BC 2QEJA 3D69B 4W9FC 3GJEA 3QR2A 4PJHE 5EZLB 2ADFL 2E46A 1QSZA 3CSTA 2CR6A 4H1LG 3QARA 1Q1JH 3ARPA 1GIGH 4PR5A 4NRZB 2X6UA 1LYQA 3EHBB 4OGXL 3MJ8A 1XGPB 1YEJH 1TZOA 4MNGE 3CLFL 4RA3A 4HT1L 1Z9SB 2NRDA 2GIXA 3MODH 4GBXA 2A5UA 4HPOH 5CGYC 3OKMB 1BG1A 4BSVA 5B1AB 1PNCA 3E6HA 3QORA 1JFHA 1ONQA 2OTUB 3LVTA 3VFUB 1CZ8H 2ZOTA 2IC2A 3A6BH 5IMOA 1CDHA 3JXAA 3QEQE 4R0LC 5FF6B 4J5VA 1Q90A 2Q6WB 3BZ5A 1R46A 3G7TA 1BXUA 4QKXB 4YHZH 1H3PH 1PZ5A 2F54E 3FO1B 3UAJC 3SCMD 4L0ZA 1KGUA 4TYUA 4IGBA 3T0BA 2CWRA 2XN9D 3NEOA 2H0EA 3K6NA 1D5IH 1N5YH 1GJUA 4W9CC 1DE4A 2B5IB 4H25B 2MFNA 3ATDA 3QT2A 1TETL 1L0YA 3X1FA 2H32A 5C0IB 3ARFC 3CX2A 5GGQH 3MPCA 4AGPA 4AL8L 5JQHC 2XWJB 4M1CC 1G7LB 4KK6C 2FJUB 4GXFA 5KBLA 3FQWB 2B1HH 1H9DA 1BF5A 1FZOB 4GPVA 2R9HC 4A7GF 5KVGH 3UTOA 3EAKA 3V52H 3ZSSA 4H8UA 2W1NA 3NJJA 5F9OH 4LSTH 4BKTC 3MBEB 3VWJB 5B8CA 1HHKA 1TEFA 3IWVA 4AKQA 1E6JH 5I18L 5JHDD 4U0RB 1MEXL 2XQYG 3KCPA 3NIGB 2KH2B 3TM6A 4NUQA 3DX9B 3UYOD 2ITDB 4OCYH 1RK1A 5C7XL 3T3PF 1EHXA 3QAQA 3MBXL 3OR6A 5I1GH 1AQKH 2F6AA 3V4VL 4IGBC 4GQZA 4MXQD 4QY8B 3FFOA 3SEPA 1M53A 3PIQB 1YA5A 4GW5A 4LEOB 3GSWA 4W9EC 1WZ1L 3B9VA 1HSBB 3IAQA 2FX9L 4L2YA 2WNXA 3CXDH 4A2GA 5KZCB 1MLBA 3DUHA 3MRJB 2BVQB 5E0FA 4E9TA 4GG8B 2COVD 2R0ZL 4R2GC 5HD8C 2M8XA 5F6HJ 3U0TB 3RFZA 2OMVA 2UZIL 3JBG7 1U2YA 3DA0A 2OJZH 5EOQL 4LDLB 2F5BH 1GGBL 4AGNA 4PJIF 3IDXL 4XC1H 4H13C 4JM2D 4H25A 4L4VD 5JHBA 3NCXA 4MXVE 4DKDC 1MZYA 3TIDA 3KWVA 4TUKH 2DM4A 1JPTL 3DXAB 3M7FB 3UAFA 1I1AA 1P4IH 3OKMA 4L1DA 3ASNB 5CHNB 4JQXA 2FCBA 5IMOB 4ZS7H 4X8GA 3GSXB 1MY5A 2FO8A 3FB8A 2QQKL 2Y36L 4PJ5D 3S35X 1E27B 4QWWC 3P4OB 1MZZA 4L5FL 1MIEL 4WKZB 1NSNL 4JG9A 1DZ0A 5EEVA 5KSAC 1SEBB 4JHZA 1DQDL 5I1AA 3MLPA 1ZSDB 1IC5L 4Y0GA 4PCSA 3IJYA 1U58A 1FGNL 3INOA 1P9MA 4Z7UE 1KIRB 4XNXL 2R59A 3FTYA 3LZFL 1MI5D 5HVHC 4ADJA 1DQLH 2BY1A 4LCCC 5T1LB 4XN2A 4XVTL 2BVPB 4W9LC 5D7KE 3ZL2A 2GPZA 4QWWD 2DLFL 1TF4A 4M6NL 3L2LA 1NGWB 2AEOA 1HHKB 3STLA 2EINB 3P77A 3RWFB 3L3HB 5F1SA 3RDTD 4LHUB 5B4MD 4PRBA 4XWGL 3NSJA 1RZFL 5B1JC 3MDJA 1ULVA 2PPFA 2Q8BH 3TJHC 2NYKA 4Q6IA 5FC9A 2Z1PA 1U3YA 3VFRB 3E9TA 4F7KA 2Z8VC 4M8QB 3QZNA 2XG4B 3MNWA 3UJIH 2EUWA 1MFAH 4FE9A 1ACCA 4U6TA 2ED6A 3PU7A 4Y7MA 3LXUX 4IRSA 1UD5A 4TRPH 3ARDD 3FTZA 5D5MF 2OW7A 4AXWA 3QDAA 1AQDB 4U1HA 1QVOA 2H6OA 4WK2B 3LSOB 3TH2T 1L7TL 3H7BB 1DEDA 1JG9A 4QRPB 2VN7A 1AOHA 3FOLA 4QRSA 1UENA 1OV8A 2Z4QA 3MKKA 3GKWL 4R4NC 5TE7L 4OGXH 2FQDA 3FQRA 4KVCL 3V0VA 1UH4A 4G43B 4G8IA 4Q9CA 3MUY1 3JYCA 3H53A 5DTFB 2J1XA 3EJYC 5F7BA 5KOMC 3UZEC 1L9PA 3RA7H 3F01A 3K91A 1GPOL 2R1WA 3OKEA 4WW2F 2BVPA 3TA3A 5F0PB 3I50L 3N2JA 4ZPVB 5I1JH 4KTEL 3QORD 3DUSB 3PWPE 2JKWA 3CZEA 1JZHA 4L5FE 2R29H 2EDWA 1J0IA 1IEHA 4WKZA 1CIUA 2AQNA 3ORJA 3QHTC 5EIIG 3LV3A 3TC9A 3GGWA 1QSED 3ULVL 1OOWA 4TSAL 4NZUH 4JRYD 4RMWA 1T2JA 1Q9WA 1KBPA 1HILB 1NTDA 5FHBH 3O41A 3QIUC 3Q1SH 2E9JA 3QPKA 4PGDA 4L23A 3RGVA 3TPKA 3VM5A 4L4TB 1FG2A 1JN6A 2XZCH 4JFHE 1A1MB 3BQUC 3FTWA 1KG0B 3BZ4B 2BOBA 1SHWA 2QT6A 1ADQL 1MF2L 4PU2A 5ID0A 5DHEA 2ATPB 4KQ0A 5LGJB 4XPGH 1KTDA 4HUNB 5I1HH 5A3ID 3WJJC 1EH9A 4QXTA 1LE5A 2AV7A 1N5AB 1NFAA 5E6ID 2JLLA 1JYNA 4ZOBA 2BSSA 1SFHA 2B9AA 1R3JB 5DJDA 1FP5A 4CN1A 5EU6E 2W07B 1EEYA 4NKMB 4MJ6A 4U3CA 1VIWA 5AW6B 1UXWB 2YPKB 4OBSA 1T22B 2C9AA 1V54B 4UI2A 3QNFA 4NN5C 1R5IB 1BQLL 1NLBH 2OI9C 4Z3GA 1J9SA 4JGJA 3DX4A 4I9WE 5DS2A 4MHHI 1XIWC 4F5CE 2EEBA 2QPEB 3CH8A 1XXFC 4LT7A 5I16B 2OSLB 3LRSA 1EXUB 4M43H 3SGEI 3FPYA 3SPHA 3TEYA 2OZ4L 5FM8A 2NCMA 4OCMC 5J12C 2EKSB 5C2UB 2ZOLB 3H7BA 2BHZA 4HH8A 4WI2A 4D7BA 3CDFA 4MZRA 4DP9X 1A8ZA 2AXWA 2Z4QB 4YHIB 1LO4L 4Q9RH 1DLFL 2XIDA 3A23A 2EH7H 4JO1L 3D0VA 3FUHA 2Y3NA 5DJ8A 3ALPA 4NQCB 2X0VA 1RZJH 3ETSA 2RQ8A 4TMPA 3SGJC 4HSCX 5AZEH 4LLWA 1RJLA 1TJIL 3L9RA 5JXEC 2X70B 4PRIE 1KTDB 3LJ3A 4KGLA 4Z7NB 4KROD 4PEEA 5I0ZA 1VFMA 2D4DA 5T1KB 4R6UA 1CFSB 2XQYA 3SGEH 2WNWA 4YHNB 1R3JA 4M7LH 1KYOJ 5F88A 1KC5H 1A3RH 4V1DD 1I8IA 4BFIB 1XR9B 1TYRA 1G7IA 4FXGB 4JE4B 1A8JH 5D1ZB 4EUPG 1WIPA 2V7NB 1FA4A 1AI1H 3S8GB 2H6UA 3OAZH 1EZSA 1IJ9A 2PXYC 4DIXA 4MDJB 3P2TA 3TF7C 1KXHA 4L0PB 4DFIA 4J39A 4P4KB 5IW6A 5EIIB 1I4FA 1Z5LB 3CZFB 1E5ZA 2LT9A 3UO1L 4N2DA 4DZBB 2VLJA 1CR9H 5EPMA 5IY5B 1QBBA 3CFIC 4LOUC 2L7QA 4HHAB 4JFSA 2WTPA 5K1NA 2R0LH 1GYCA 4LSPH 3FRPB 2D03H 2IBZX 4Y89A 2DTMH 5HYJB 2Y9RT 2BS9A 1DJZA 1MJJB 5K5YA 5DJ2B 3JYBA 2WLIB 4H7VA 1IAKA 3ARYA 3ZHFA 3ARGA 3BCFA 3GTNA 5JIIA 2X44D 4NHUB 5IKCB 4X8JA 4F24A 3MLZL 2DQJH 3DURB 4M5YL 1QA9A 3VO0A 1RJLB 3IYLW 4D2NA 1WICA 4RDQF 5LNEA 2Q76A 3L5IA 1ACXA 2GI0A 2AERT 3TGXA 3ESMA 1FFTB 3Q2VA 3EGXA 4KKCC 2EJ1A 3LHAA 2HWZL 3WNIA 3M6DA 2VT0A 4UQEA 1HWWA 1NL0H 5L0QB 2PO6A 3X11B 2ZOLA 4NUGL 5CGYD 2XBTA 3WJLA 4OLXH 5FLUA 3QJTB 4PJDF 3IMSA 3SKOB 2BS71 4P06A 1GZPB 3EFOA 1K4CA 4YSRA 1G4MA 4LVOB 3Q06A 4F27A 2D8KA 2FECI 3EO1A 1TDQA 4GRWB 2XN9E 2CD0A 2YBGA 1KY7A 4JZJA 1QLEB 1F1AA 1A66A 5EU6A 3N3EA 5DJ0B 5EMYA 5DZPA 2WANA 2ZAHA 2IH9A 5I8EA 1CI5A 2AQ2A 2AMUA 4DPAX 5CJBA 5CP3H 2Y07L 5AENA 1GYAA 2CQVA 3NABH 1MJ8H 5DRXA 4H20H 4JO4H 1UH2A 5D1XD 1AC0A 4L1LA 4MA8L 4P04A 2D7OA 5L4IA 2IAMB 3DC0A 4G7RB 5H37H 2OZNA 4NHUA 5FGBA 3WFDL 3M88A 2XBZA 1LO0L 4IJTA 4PGCB 3HZMB 3AY2A 1K4DB 3EH3B 3MGOB 4XVJL 3MA9L 3TYGL 3QJRB 5BZWB 3FU8A 2IDQA 3WKYA 5AL8A 5DU7A 3P4MA 3VX1A 1KWGA 4PJ9A 2AQ3A 3QIWC 3BH8A 1WZKA 1RIUL 2FJHA 2IJ0C 4AVKA 2F58H 1KCWA 1U4FA 3AG4B 1CE6B 1I1FA 3PL6B 4ESKA 3KGRA 3QVAA 4FQXD 4PRNB 3X17A 4X8JB 4MBOA 4M56A 4LGSB 4N85A 1UATA 2V7HB 5GRJL 3WY3A 4JZJB 5LXVA 5TE4L 2EKJA 2I5YH 3G08A 4L4VE 2V8MA 3OKNA 1VFUA 1JNHA 3D52A 2YUZA 4Z8FL 2XV2A 3QQ4A 4P2RE 5ELIA 3SYPA 4YDIH 1Y1UA 4HZ1A 4FQLH 4N90D 3VFVB 3QQDA 2QHLA 4NQSA 4HC1A 5L88L 5KVMC 1SVBA 3H2WA 1SM3H 1Q72L 4X7DC 1DVQA 2YSTA 3WS6C 1K3IA 2ZKHH 2G60H 1QNIA 2VLRB 3HR6A 2YRZA 2R2CA 4RDBA 4BDVA 2G0KA 1L3NA 4JY4B 3TBCA 3B4NA 1R3IH 3BQUB 2R4RL 3LZPA 5HHVL 5ANHA 2HVJB 1XBRA 1O9WA 1KJ2H 4FXKB 4PJ7B 3MRCA 5F1IB 5GSRB 4J3SA 3QDMA 2VW6A 5FM5O 1MKFA 5E1AB 4WQOA 1C1EH 4WFEE 5DJYA 1GOHA 1G7QB 2VN5A 3FCGA 3C9NA 1N7MH 1OAYL 4RZCB 3SCMC 3M1OA 5KYNA 1WBXA 35C8H 4Z1PA 5ESQA 4NC1C 4GKSB 1YEHH 1DBKH 4L8SB 4ELMA 3SB3A 3HNSH 3CDZA 4PRPA 5DMGC 3MRHA 1QRND 2QQQA 2W9DH 2NY2D 3DHMA 4WZ9A 2R2EB 5A6LA 4LARH 2I7SA 4CVWA 2F74B 1H15B 5JHLA 1DVSA 3V5KB 1NL0L 1S3KL 5ADOH 2WIIB 4JGMA 2BC4B 5DF0A 4HVBA 1NFDF 2AK1L 2W81C 4QYOB 4M6OH 1VGKA 5F0MB 1FO0A 1T4WA 4QY8A 1V3KA 4K23L 4Z7WF 3PFUA 3CFNA 4QRRE 1NMAL 2ICEC 5LGHL 3QUMH 3GBMH 2XNAB 3OX8A 3KGUA 2L04A 5ISZE 3FN9A 4NQDD 1S7WB 2DDQH 2EIKB 3UPRB 2BVQA 3ULSB 3MQIA 1KB9J 1P7BA 3VGGA 3I6KA 4TXVB 1GXEA 1KLFB 1SBSH 1OAQL 3NJMA 5AKTA 4FQIL 3P73A 2VXTH 1MFVA 1CTMA 1G7HB 3DX8B 5CLXA 3UTSB 3IN2A 2IALA 4XVSL 5GZOC 3DX0A 3BO8B 3NIGE 5AD0B 1NCIA 4IRZA 4BA0A 3CZJA 4IQHA 3ARTA 1P7HL 2BJMH 1L9NA 2H2PD 5DD1H 3QYMA 3FYIB 3EYVB 3R7QA 1D6VL 1GH7A 4F8PA 3BW9A 1ED3B 1QMUA 5E6IA 3MRHB 2NR6C 2HLFD 3MA7A 5DQ9A 5HSFA 4F7PB 2I69A 5HYSA 3IMBA 1B0GB 3D1MC 2WY3B 5EBLB 1JNJA 3MFFA 4LCIH 2F7RA 3V5KA 5J13C 2JQMA 4X6DB 2W0FB 3DIFA 5T1LD 3PE9A 5E2TH 3NIFE 1CFVH 3ZT6A 4UDTB 3NH7H 5HJ3B 2PTTA 3S5LB 4KK9D 1U58B 1GGUA 1U8KB 4JG0L 2KUTA 3KD4A 2UUDK 3WFHA 2EYRA 2OZ4A 1Z9SA 3C6EA 3K46A 5DUMH 3B3IB 2ZYRA 1BDYA 4FQXA 3UCQA 4M8UA 4CKVX 5GGQL 4IKKA 2DQCH 3I84A 4BFOA 3LS5H 2XN0A 5DO2D 1KEGL 2D7PA 4LAQH 3UAAA 5I15H 4R97B 3QFGA 3GMPB 4H20L 4JO4L 4TULL 3QEGH 4HUVA 2VQ4A 3DO4A 1WH0A 3V0GA 3C6SB 3DHUA 4YR6A 1NPNA 3EJCA 2UX7A 3M17A 4A6YL 4UTBH 2H5UA 1USQA 2P52A 2WWKO 5BV7H 4IKLA 4AE1A 3L95B 2ZP0T 5D1ZI 3SE9H 4G1EA 4BSVB 2HRPH 3LN4B 4PJAE 2K0RA 2V9UA 1L3WA 4PJAA 1KEML 4DQOH 3TBTA 4GAJH 3KL5A 5FF6A 5D7JA 3ARUA 2DIJA 1AQDA 2XPZA 1OAXH 1B0GA 5CN2A 1PW3A 2YMTA 3CFEB 4TLUA 3KCWA 3LVEA 4EI5D 1WFIA 2QR0B 4NCDA 2XWTB 3MOQA 2YOAA 3L4YA 5FDYA 4KQ3H 1KELL 2TRYA 2LU7A 5K93A 4HIEB 3TF4A 3MJGX 3P3TA 1YEHL 1RZKH 3VFSA 5CM1A 3L5JA 4CVXB 1QTYT 3QHZH 5AD0A 3SO3C 5IESH 4HK0B 1V8HA 3FCSA 1QPKA 4NM8L 4YGAB 3VXPB 3F6JA 4XMPH 1YO4A 3GSOB 5I17B 4KBPA 1IBFA 1OT1A 5J89A 5B38G 3O6ML 4S1SL 5TK4A 4X5XB 2KDGA 3DHJA 3PXHA 1E5UI 1BJ1J 5DEGA 3RWCA 1KGIA 2OPCA 1BD2E 4ISVB 1KPUA 1FL5A 1DP0A 1U8IB 4UNIA 4MD0B 3WDHA 2WBJB 3VB9A 1MHPH 1ZTXL 4FF9A 4OW6A 4XNZB 1XFPA 2E74C 2VDOL 5TFSH 3OAYK 5EC1B 1U8KA 4ABWA 5IVOA 3IGKA 4I0KA 2DQEH 5F89A 8FABA 4LU5L 5DZOA 1INQA 2QQLH 2X41A 2EVGA 2Y36H 4HGWA 1T89C 1XXDC 1TKWB 2IDTA 3MKGA 4GO9A 2ENQA 5EBWB 4F9LA 2G0LA 2QLYA 2IFFH 4GG8A 3C6LB 4G7VL 5I5JA 4GMSH 3WHE1 2H3XC 3AS0A 2WQSA 3C60A 5GS2H 4KNQA 3F8UB 3KPRB 3QCTH 4Z76B 4NOFA 3O4LB 2VXVL 2XWTA 1NCAL 4JFEE 3VXSA 1TUPA 3KBEA 1RUPL 2WQUA 1VKXA 1IBHA 1FLRH 5HGHB 1QKZL 1DUYA 2XRAH 4X6DE 2BS8A 1IB5A 4P2OD 3SZ6A 3UJJL 2VC2H 3T6XA 4LBAA 3IMRA 1AHWC 1Q9LB 2AXFB 3EGDB 3SD2A 2AJZA 4H8VA 1M7DA 4XI5D 5DD6B 1MFAL 2MNWA 5AKSA 1C9SA 4FTVA 5E8DH 3TBTB 4JFFA 3SE8H 5FOBB 4E36A 5DZVA 2Y3AA 4AYSA 1BZ7A 5DK0B 4Y4HC 5J11B 3LKSA 4N2FA 2P5WA 4G71B 4X6CA 2A6DA 4PJ6A 1Q4NX 2K78A 4MWFA 3PWUB 2KLRA 4Z78A 1U3HA 3II2A 4UT7L 2NXZB 3EJSA 4LDCA 1AO7B 3NN8A 1H8NA 5C0EB 2ADIA 3DXAD 5IJKA 1XZ0A 2EEDA 3EO0B 4Z77A 2OP4L 1CDYA 4OD1L 4I48B 4MDIB 1KWKA 4KH2A 1XDTT 3FUFA 3GHPA 4FDWA 3MBWA 3QWNA 5IBTH 4OBRA 2N4IA 3RKDC 1QRKA 3HEIB 2PP9A 1JGUL 3OJVC 2PCXA 4I2XB 4NZTL 3GMLA 4EOWH 3BWAB 1KZQA 3JTSA 5EEZA 1BMGA 3GMRA 1MJ7H 1PX3A 4C83A 4ZX4A 1FH2A 2Y1VA 3CFCH 1UVQB 1INDH 5IUCA 1BVLA 1KGXA 5F7DA 2K8MA 2ZXWB 2NPLX 2LLLA 3LSOA 3L7EA 4ISVA 4L9LC 4NO0D 2BSTB 5EUOA 2MCG1 5KVDE 5F96L 1ODAA 4LOEA 5CJXA 2AS5M 4GAAA 1VKXB 3PUUA 4YEEA 2CHZA 4DAGL 2QHRL 3IK2A 1C7TA 2VM9A 4FG0A 4HC1L 4U1JB 3CC5A 1I9JH 4N20A 3GSRB 5CINL 3VFNA 2PMZA 4XP1L 1JTPA 2VOTA 3MBED 4O2CA 4NZUL 3DVGA 4KTGA 2H7WA 4MQ7B 3KPRA 3QHFH 3SDCB 5K9KB 1UGNA 2FJFB 4UV7H 4UT6A 5C70A 3GGWB 1M71A 1U6AH 4DK3A 1DVFC 3D07A 4HUMB 3GZOA 5I0VA 3NGBB 1GGCL 4AZ8A 1UWXK 2J4WL 1MFNA 1TNNA 2C9PA 2G2PA 4B60A 1FFNA 1X7TA 2WWNA 5CXPA 4Y5XA 5GXBB 1HHHB 1QI5A 3BZ4A 1WP6A 3HKZA 4YHLL 4NFCA 3BJLA 1XAUA 3CTTA 2ICCA 2WXRA 2YS4A 4M5TA 2YJQA 4OF5A 4X9YA 2D2OA 4TNWK 5L4MA 1TTRA 1LNUB 1U2CA 3CDGB 3ARZA 3O3DB 3CN1A 1NAMH 3N9GL 2BSSB 4IS6A 4ODWA 1DJHA 2FB4H 2A1WL 2DQEL 2QDVA 5HTSA 1GVIA 4I0PC 4DNLA 3BQVA 4X6EA 1FZMB 3BMVA 4LDEB 1UXWA 1MQ8A 2JKNA 3DVFA 3W57A 1SMDA 4P5TA 1HL8A 3FQTB 3ZTJG 1KB3A 4GQ9L 4L4TA 1D5BA 1Q38A 3TCXA 2C1PA 1QRNB 4IEFB 2AQQA 5DK2A 4FQ1L 2P8LB 1J8RA 3RYMA 3FUNA 2G3MA 3CJJA 4ZX5A 2H3KA 2L8AA 1YEKL 1AGDA 3HI6H 3PXLA 3AT8A 1S5HA 3CN2A 2QPFA 4GI8A 4JPKL 3TBYB 5I6MA 3AMLA 1L0QA 4JO1H 3BH9B 4OGQC 2HKFH 4HJSA 2RCSL 2YKKA 1V3MA 4LLUB 5KVGL 3T9WA 4X0KA 1HH6A 3LDBC 1IKOP 1OTTD 1J1OH 3MREB 4QHUB 2VJ8A 4KKLD 4OLYH 2QV4A 4OZHF 1G84A 3TOPA 4J3XA 1A4JA 1JGLL 3B9AA 4ICWA 4XMPL 1SXNA 4DEWA 1NOAA 3P0VL 2ZPKL 3S36X 1RJYB 3W11D 2EYTA 2YC1B 3O6MH 2Z91B 5ANME 3T77A 1N68A 3GPEA 1DJGA 3MLSH 4MJIE 4MQ7A 4Z3TA 3IMUA 5CR8A 1SEQL 4UMSA 5ISZD 4GAGH 3ZDWA 1M2VB 3NK3A 3D39D 4WIQA 5F7KC 2W59A 4P4RB 5DHYB 3MRFB 1OT2A 3HHMA 1JGUH 3B9KD 4WTWA 2P5PA 3OR7A 4PRIB 5DUPL 1KJMA 4KKRA 2ODIA 2CIIB 3TX4A 2VXQA 3U7YH 3QIWD 4AV5A 3LPWA 2JQAA 1UKSA 5EO1A 3HB3B 4XGZB 5DK2B 4QJ5B 1IM9A 1EFXB 1FZKB 3O6FC 3O8XD 4C59B 1QFUL 3VXTA 2VXUL 5CLTA 3KJ6H 4PP2B 2WQXA 2MKLC 3F7YB 4G7VH 1F6FB 5DSCA 5INCA 1D5ZB 3GBDA 4NN6B 5DZJA 1PKOA 5T1KA 1H3PL 3WIAA 5B1BB 3EFFB 3DBSA 5B3JE 4Z3FA 3QCTL 3X1EA 1OOAA 4N90E 3VFVA 3F83A 4HKBA 4JFQA 3BH9A 1JCKA 2VIRA 4JPVL 2NDFA 5C9KA 1XV8A 2PTVA 4OFYA 1IGIH 2J44A 3FHEA 1TOXA 1QG3A 2XLLA 3LRGA 4WNQA 5CEXB 4JZNA 5FECA 4UDUB 4XPAL 2ARWA 4FYTA 4QHUA 4Y16D 2WWMC 2ROYA 1I9RL 1NC4B 3HNTL 3L3DB 1I4FB 1Z5LA 5BOZG 1U33A 2ZWZA 4WEBH 4NRXB 1UOVA 5HGDA 3FFDB 3G9VA 3TBSB 4BXVA 5CSZB 5ES4B 3KL0A 1QO3A 2WUBH 2BFVH 1AGDB 3EF4A 3OF6A 4BWWA 4GH7B 1UM5H 4YXHL 2WMPB 3U2SA 4NSKA 1RURL 1Y6MR 2BVTA 3QEQD 4OTXH 4G8FB 2M1KA 4RGNE 3L3IB 3DUUA 2ZNXA 3MRFA 2CIKB 5DJ6A 3CDZB 4FNLL 3FC8A 4PB0L 2RA1A 4ZO8A 5EZOL 3ZYJA 4I85A 3CZSA 3RZCA 3VSTA 4BWUA 3UMTA 4OD2A 2XN2A 3WFDH 4HAGA 5CD5C 1FHNA 2ZKXA 1Q0EA 4JFXA 3T0EA 5BOPA 1FL6B 5I71C 3MLVH 1I9EA 4NRZA 4Y4FC 3LQAH 3QJFA 15C8L 4WWID 4LHUD 1F90H 5EUOE 3EFFA 1TVDA 5I8EB 4YLCA 4W9ZA 3AITA 4QHMA 2NUPA 2CBMA 4HT1H 5F96H 2XKSA 1LK3H 1XF5A 3CXDL 5HVFB 3PV6A 4RBPK 4JX0A 3AS1A 3SKOA 4P4RA 5DHYA 1WFOA 3HN8A 4LSUL 3ALXA 4MX7B 2Q6WA 1KJMB 1T7VA 2Z93A 2B0SH 4P3CH 4A67A 3SBWC 4K4KA 1GTNA 2FSDA 4E9VA 1GGBH 3FO1A 1NFDA 2OMTB 2DQ6A 4IOIB 4QHKJ 2PLTA 1JHKH 4XPHL 2NX5E 3H7LA 4FLQA 3TA3C 1JGIA 2F0CA 5HYJD 1P2CA 3DX2A 1KN2H 4QD2E 3RWJA 3OAUH 4OCXH 1F4XH 1T4KB 4Z8FH 3DMMA 3G6JB 4Z7QE 1UA3A 2WXIA 5HPOA 4HLZH 2DKUA 2F8OA 3AB0C 4ZFFA 5AUMA 3EOTL 4E9QA 4W81A 4OLZL 2F61A 1AD0A 1MHEA 2RH0A 1BFSA 3G9AB 2FJGB 1T1ZB 2QFPA 1CBVL 1OAZH 2WO2B 1IFRA 4HWUA 4NBZB 1UWYA 1OZUA 2X09A 3QG7H 4HCFA 1R3IL 1NCNA 3AY4C 2ZSVA 2EDOA 4RAVB 4D3CL 1TZIA 4FQHB 4WO4A 4NYLB 1F0LA 2A4ZA 3SBWA 4G42B 5J9PA 2J1KA 5ESAB 3LS4L 1C1EL 3GRWH 1URLA 1VZGA 3Q1SL 4X0NA 1JMZA 4LCCB 1UUNA 5BXFA 1FVCB 3K6OA 3R1GH 1KJ2L 4D7PA 2X6MA 1SDYA 2DQUL 5AW1B 3AQXA 3PQYD 3Q43A 1F86A 2G75A 4RFEB 2X28A 4Z7UF 3M1BA 4GW4A 5C86A 4F2ME 3OSKA 3MUJA 4HETA 2F2HA 2CR3A 3QNYB 1IC7H 4RGNC 5BQDA 1SOXA 3LB6D 3WLBB 2ZCKL 2QSTA 4EI5A 4RRPA 2C7FA 4MMXC 5KBNC 2XZZA 4R2GD 3HRPA 5IHUH 2Y1YA 3T6ZA 4PGEA 3UBXI 4WO4C 2BNRB 2C3WA 3MNMA 4I89A 4XTRC 5H4YA 4CJ0A 3E8UL 1BQLH 4ETQB 1Z3RA 1HCYA 3WN5A 3ZYIA 2DIEA 4EXKA 5LGHH 3NQIA 2CK0H 4D0BA 1CJYA 4OFDA 4P9HC 4Y2DB 2P8MA 4OF6A 3MACH 3MRNA 4Q6YA 2CDFB 2R23B 2XWJA 2HX9A 5FM4A 1H5BB 3TEXA 1BEYL 2R4SL 1ORQB 3NIDE 4YHKL 3SKJH 2CHWA 3WO4C 4AX3A 1GC1H 4L9DA 1OGAA 1BSIA 3IFOB 3WHXA 5JXEA 4XN9A 1IM3D 1OALA 3RWIA 1ZOXA 4IRJB 4A2DA 5EF0A 4WI7A 1LE9B 3DMMB 5I30L 1J87A 4ZZKA 5JHLH 5I73C 1BAWA 1FC2D 4PV1C 1WQVT 1BZQK 2CJTA 4DPCX 3DX1A 1MCFA 5FHBL 3PY9A 1RK7A 1UXLA 1OP5H 2VDPH 2VLKE 4WWPA 4HWNA 2OQJA 3EJZC 1HXKA 2GG1A 1ADQH 1MF2H 2O5NA 2P46B 1UYWL 3EHBD 3RU8H 1XF2A 2E7DA 1MHCA 4PD4J 3D85A 2K6WA 4C4KT 1OM3H 2Q8BL 5IW1A 1T0MB 3QWRA 5A2FA 5D96B 1SHXA 2G2RB 4NO5A 1HJBC 3HRZA 2X1PA 3E6FB 3GSQA 1EO5A 1D7BA 3FO2A 1RURH 4PWFA 1JWMA 5CJOH 1JWUA 2LFGA 4O02B 4DN4H 1O7DC 1KYUA 1S7WA 4JO2L 3V5DA 4Y2DA 2J5LC 3EZ8A 5F7EH 3ULUE 2WIMA 3TZVA 3W39B 1QHQA 1QZ1A 1H3VA 4PYGA 5B39B 4MLIA 2Q9OA 3FU7A 4N2HA 5L4FA 3RURA 1DDTA 4LCUA 5J06A 2LU3A 1F4XL 2OMXA 5HI4D 2BK8A 2XWXA 4MKTA 4OU3A 5IFJA 4WI4A 2X4SA 2NNAB 3IE9A 4KC3B 4LHQB 5EOCJ 5T5FL 3US0A 1IVLA 3UXFA 4HGMA 4R0LB 2VZ3A 5HP5A 2FIRT 5DZLA 4EZLA 2GBUA 3EYUL 5SV3A 3CX5J 3PDDA 5DC2A 1INEH 3IJYB 1UACL 1KYDA 1LWJA 3O4OC 3O3UN 4FNLH 1KT2B 1G0DA 4A7GA 3L08A 3LQAC 5TPWL 3OAWA 2OQJB 4BFFA 1YEGH 3ARDB 2Q10A 4ZFZB 3CHSA 1IGML 4TPRH 4WTZA 1I7UB 4L29A 2O61B 5BV7L 3BCDA 4QRRB 2OULB 4PI2A 4UDTA 2FT8A 4PGJA 2WLZA 2ZKYA 3RI5K 2L7UA 1UD6A 4Z77B 3R0MA 1U9KA 1E5CA 4NP9A 1UOWA 3EJQA 4HIJA 4JFWA 1UWGH 4G6AD 1MCWM 4LHUG 1QEWA 4NWUL 3QA3B 1E90A 3RFRA 3ZE1B 2K3TA 4MTMA 3AAZA 4IMKC 1GZHC 1NEZG 1LQBC 1QWNA 5C0FB 1R75A 2PKDA 3SDCC 1YAIA 1QW9A 4KUZH 4JANA 5E5LA 5HDWA 3DHPA 2KPWA 1G94A 2YWYA 5G5DB 4J8QA 3SOTA 3CFEA 3CFJB 3IRPX 4XNZC 1EV2E 4Y5VC 4GKZA 4LSVH 4AJVA 2AVGA 1MNNA 2O5YH 4FOMA 2KERA 4F91B 1X4ZA 4TVPD 2ITCA 3SDDA 1EDYA 1EBAA 4YDKH 4J4PC 4JG1H 1EEYB 3CDYA 5HBBA 3N06B 1OSPL 1U21A 2YPKA 4LQFL 3UC0L 1G7JA 2JIXD 3GRGA 2VUYA 4DKFL 3VXPA 4FYSA 2DWTA 3G5VB 1GS8A 2IAMD 3QC6X 4S2SA 3W39A 2VLRE 1RK0A 5EU3B 1NUGA 4XMWA 5TQ0H 4HIXH 5DEGB 2Z8SA 5ALCH 5CCJA 3M46A 2CO3A 3SDCA 2Y7LA 5IVXB 3MODL 2VAJA 4M3KB 1BJ8A 4P59H 4JO5A 2VDMB 5HDBE 4HIEA 1NCCL 3V6BR 4HWZA 3WD5H 2WYZA 2NOYA 2XXFA 3HC3L 3UG5A 1UXSB 3IDYC 4XCCH 8FABB 1HC1A 3EBAA 1ZLEA 4HIJB 2FEEI 4OT1H 4DGIL 1A7RH 1G4RA 2WBJC 1FC1A 4BYHA 1R3LB 1U4EA 5GGSY 1CLOH 4FADA 4G82A 3LKPB 5A2IH 1WBYA 5BJTA 1YNTA 1SHSA 1A1MA 4JGUA 4HEMA 1CN4A 3VX0A 4R7NB 4N2GA 2E3VA 5F97E 1TZHA 2R4SH 2VE6A 1RMFL 2X9WA 1JV5A 1F4YH 5L88H 3MUUA 2XIBA 3HS0C 4JHWL 2BCKB 2BIOA 1X5ZA 5DJXB 4D0DB 3CVIH 3O0LA 5I1GL 4P5TB 1P7KB 1DQMH 1AI1L 1YDPA 3QDJD 4I9WD 1ETB1 1EZLA 2K4WA 3IKCA 1PY4A 3K8KA 2O5XH 3FAXA 1HZHL 1E3ZA 3EH5B 3CVBA 3ZQ9A 2K45A 3L5WB 4JFFB 4NS0A 2H6PA 1Z1WA 3Q2CA 1U93B 5DVMA 5EBWA 2R2HA 1R5IA 3VXRE 3SE3A 4MMZA 4JAMA 3DK0A 3CVHB 4GO6B 3SDAD 2A1WH 2A6DB 3FQUB 2JXMB 4PJFF 3B43A 1M6OB 5FLVA 4LLDB 5AAWC 3QZBA 2ZP8A 4PTUB 5IBTL 1XHHA 3HHRB 3L5XL 4FHKA 4PG9A 3F85A 2EDRA 3QYCA 5I6KA 3FUDA 1UACH 1EXUA 2D7TH 1HH6B 2CO6A 5AB1A 3WKMH 1G1OA 1NUFA 5LBSH 2WPGA 2FO1A 3UYPA 1M7DB 1KV7A 1NIEA 5JUEH 1ZVSB 3DV4B 6TAAA 4JRFA 2AK4E 2FBOJ 5FOBA 2VLKD 3PGFH 4S2SB 3SOBL 4AG4L 4K15A 4Y1AB 1LK2A 2VR3A 3F7VA 4U1LA 2WXMA 3G6JF 3ZE0E 1LWRA 4PWKA 3B2VH 3EO0A 4OZIE 5DJXA 4C56A 2I85A 4FQCH 5EOTB 5CIPB 1UOLA 4IJ3C 4XMZA 3BXNA 43C9A 3QUMB 3D25B 4V2CB 4HIQA 5GRJH 4IBQA 3D85D 2CGRL 4NN7C 1CFMA 1LO5B 5EZJA 3AG2B 4ZOEA 2ICWJ 5HGBA 2XT1B 2G5BA 1XGUA 3KLQA 1IAIL 1KB5B 5GRUL 3OGCB 2XFXB 1DJYA 4NN5B 3ZE1F 4JDVB 4U1GC 1BBJB 3QDGD 1JFQH 2DLTA 1Q94A 4JN1L 2BP8A 2A74C 3NCBB 1BBDH 5CS7A 2OLDA 1T5WB 5LCVH 2GSGA 3ML9A 1S7UA 3C8HA 3SDAB 4JGNA 4Q52A 2EDJA 3S5ZA 3WXWL 1B0RA 2AV1A 2AZUA 3X1NA 5JZ7D 4KX8A 4QF1B 4ELKB 2IAMA 5EOCH 4M6NH 2J8UF 4PLJD 1KV3A 3RL1A 4ZMQA 4JE0A 5J3HC 3GSRA 5DEZA 2FX9H 2Y1ZA 4K5PA 1CDGA 4MS6A 3CVHL 3R18A 4MJ2A 2V6HA 4APQC 4OJFL 4MYPA 1NDTA 1YEEL 1C16B 2JKJA 1YQVH 5K39A 1JERA 4DP1X 4CDGC 1I8MB 2MHAB 5K9KA 1RQ5A 2Y2YA 3S3DB 5LHDA 5MEQB 3DETC 2DQTH 3DROA 2A6IB 3UGXA 1PFCA 4IIQC 1I8KA 3G6AA 2QJDA 1NAMA 4GW1B 3D0VB 4FKEA 1E4HA 4YE0A 1OW0C 4BRJA 2RTTA 3FXIC 1KXQA 4OD2B 4ZXBA 3QJOA 5FFOA 3U9UA 4TUOA 1NJ9A 5DHVB 2O30A 3MX0B 2ZYHA 2YGQA 3NZ8A 4U3SB 3VRIB 1IZKA 2DMHA 3FZUC 4QCIB 1RY7B 5DRNA 3WMPA 1SBSL 4KPHL 3LH8A 3AJ7A 4IS6B 4APQA 3L1GA 4GKNB 4JDVA 3S36L 3A4EA 3VUAA 3HJEA 3V95A 4PIBA 3G5YB 4JR9H 4KXAA 1WGOA 2IH1B 4AEHL 4N2OA 1JPEA 4BFJA 2AJSL 1CXEA 3U36A 3LQMA 3VTMA 3KWWA 2YQBA 4RIRB 3X12A 4LCYB 2ZAGA 5ITBH 1NGXA 3B9DA 4N9OB 2YD7A 5E7BA 2HLAA 4X6FB 3X3GH 2J6WA 2R29L 5E99L 3ATBA 4DP5X 2E7MA 4NQED 1T80A 5C09A 4ATWA 2RALA 4C58B 4PJBB 5L9DH 2FT7A 4OZFA 4XXWA 5CU9A 2WXQA 1NGQL 3E3QE 4J3UA 2BY3A 3WU1A 1SVCP 3QNZA 3L8QA 2WLYA 4NZFA 3DIDA 4MNHB 4KGJA 1UHVA 3L9YA 1UZ8B 4ZG1A 2VAAB 1OTUD 4JFYB 1G7PB 4PW4A 3FK3A 1HYSC 2ICWB 4PW3A 3PGFL 2D7QA 1GGYA 1GJIA 3RL1B 4AEFA 5DWUL 4NZDA 1TO5A 2F74A 5C0BB 1IUZA 4WGKA 3POHA 2MPAH 5JYMA 3B7SA 4J6IA 1ZK5A 3S5YA 4GS7C 2OYMA 3ZR5A 4AJWA 4U7SA 2QKIC 3VFOB 2VXQH 1KY6A 2BWQA 1J9QA 5KZCD 4KJYA 4XPAH 5E4EB 4A2EA 1SLWA 5EF3A 1ZY9A 1URIA 3K80A 1CCZA 1WFJA 4KWUA 3I3BA 3O3AA 3S3CB 1A7QH 3LYRA 5AW0B 3UTQA 4F15B 1N3NA 3ARVA 1I8KB 3G6AB 4JZOB 5DDHB 3QUXA 2YGVA 2KC0A 3TONA 4RWYH 4GSDL 2D7MA 2E6PA 3NJHA 2WSKA 3AADB 3BFWA 1SYVB 5K1JA 2R69A 4HIHB 4Z7UB 4L3EA 5DJ0A 5LAPA 2C34A 4BDVB 2FWOB 3MX0A 5JXAH 3LIZL 1JPGB 2K70A 2F1EA 2GAZB 2WN3A 4ANUA 1BGXL 1L9OA 4EZKA 3ULVH 2VDMH 1UXMA 2DTSA 3IBEA 1X44A 4JHVA 4N22A 3J7HA 2UYLB 4KVNH 3D33A 3WIHH 4R26L 5B7MA 4OZFG 2CBPA 2XZCL 3GI8H 4RZCA 1SUHA 4F7PA 1O7VA 3BGFC 1IT9L 1VGEL 5EORH 5ESQB 3IDGB 2EZ0D 4I4WB 2YD3A 4N0CC 1X9UA 3GSNA 4PJ8A 4NAJA 4MAYB 3QUXC 3PDGA 5IQ9B 4LOFA 2HSIA 3TVMA 1HCVA 3S88L 3S8FB 4N8VA 1BZEA 1N8OE 1LEGB 2X7LB 4D94A 3BPCA 4OZIB 4D8PB 5JPNC 2AXJA 4GRWH 1KULA 3WEBA 4G8GE 4NC2B 4Z3HA 5DYFA 1CXIA 3GWJA 3NJNA 1NUNB 3NTCL 3PWLA 5I1KL 5B3SB 1O7DE 2KYIA 4BZ2L 1OSEA 5L0QC 1BQKA 2HXAA 4F7EB 1PD0A 4K3HA 2BSEA 2UVFA 4HUXA 3V7MA 2HFEA 4TQ8A 4JK0D 5T3ZD 5EOCL 4TVPE 5DVOA 3UTZB 1MAML 2G3ZA 3NQKA 4UU9B 2V33A 4YR6B 5DO2C 4PHXA 4R83A 3U0PB 3HRZC 4ABUA 3AT9A 1W0VB 1TTBA 3BN9C 1UT1A 1VCBC 2ZX5A 4WW1B 3SPVA 3TTYA 4HJ1A 3VFOA 2Z1KA 2NY2C 5C07A 1SXSA 2F7OA 4N87A 4QHMB 5IJDC 3LX9A 5LCVL 1L6ZA 3JUYA 4XC3H 1JWMB 3UYRL 1B0IA 2ISDA 5JNYB 3NJFA 2GQHA 5I74C 4BSJA 1WUNT 2VLRA 1VLXA 1MHEB 2JKSA 3BDYH 5BRZA 3T2NH 3TZVB 3US1A 4KZDL 1I8AA 4UM8A 4PBVC 5CP7A 3BPNC 4FJZA 4XNQB 1TQBB 2OMBA 2X4NB 2VJXA 1CG9B 3OLGA 2LGNA 3F00A 5D7LA 4FQHA 3UADA 1E67A 2CPCA 3CG8A 4KKAD 3BPCB 3HC4H 3CHQA 2BIHA 1BFTA 4WEUD 3SJVD 2WW8A 4M62L 4GAYB 4FCHA 1MG3C 4W9IC 5DQJA 1J5CA 4K9JA 5AVVB 4FXGC 3N42B 4K3EH 2GIMA 3PJNA 4I18A 4IRJC 1TEYA 1HXYB 1ZT1A 2Q3XA 1NLDH 3O0RL 1ITCA 4XBEH 3I85A 1MCDA 4FQ2L 3UIZA 4JMNA 4AEHH 4FMVA 2G75B 2MH4A 3TV3H 4OZGA 3LRMA 2J6EH 2BIQA 4LL1A 4XB8A 5B7EA 2A6JB 1FNFA 1JYXA 1OD7A 2GC7C 1BXXA 1G9EA 3X3GL 1NFIA 2WVVB 3LEXB 4KK6D 4L4TD 3TVMB 3QIBB 4BJLA 1RAMA 5A16B 5ESAA 2IPKA 3APMA 1BM3H 1FO0B 2C9RA 4IRJD 2P47B 4PJCE 3RRQA 1LXMA 1NDMB 1J05A 2OX5A 1W16A 4PJHB 5D71H 5GRVK 1KGJA 2EEFA 2I9LA 2XNAA 2KPNA 4OGYL 3QB7C 4JQVC 3REVB 4FKKA 1V05A 2X4RB 3T3MB 5I0YA 1T6WA 3L7FA 4Z7VF 2PYEA 4AC2A 4Z76A 4PJAB 1A2YA 1SXCA 2X4PB 3NCMA 4XCNA 4HJJL 1F58H 1UT9A 3OF6D 1G7HA 1I9IH 1DUYB 4WW1A 1E27A 1AKJD 4OUUB 2H32B 1FPTL 1ICTA 3QJSB 1CO1A 3V8OA 3E9UA 1NGZB 3HJ0A 2LW3A 3JV4B 4OLXL 3CFQA 1UC6A 3MRIA 3IU3A 1BYPA 1RHFA 4HFWA 4JFPB 4I18B 4JPQA 1HJCA 1FZOA 3IJ7A 5E8EA 4TSCL 4FTVB 2VR5A 4B7IA 4CMHC 2WBKA 4YFLF 3E0GA 5DEJA 1EHKB 1P5UA 2VLRD 5DD3L 1CF8H 3GRBA 1FFQA 5F9OL 2PYEE 4X4XA 3QHFL 5BUAA 4NKDA 3EH4B 4RESB 3DPBA 3MRKA 5DHVH 5HHVH 3MV8A 4JLRA 3HNVH 4GRWF 4AIXA 1CC3A 1XF1A 5EA0L 3S2AA 5DLLA 5DZ9A 2Z7UA 5D2LA 3C2AH 2DI7A 1IZJA 2GEQA 3S4SA 5EZLA 1XSOA 2EYRB 4X80H 2G2RA 4AQOA 2VISA 1BD2B 2YN5A 4PR5B 4ICXA 4URTB 1FJ1B 2Z9TA 3DOHA 3A21A 3V5DB 3HG0A 5AW8B 3HNSL 4B50A 2XG4A 7TAAA 4FQJL 5F7DB 4RMBA 3ULUC 5I1CH 3MCLH 4NERA 3ULVC 2APBA 4X7FC 3VI3E 3GZKA 1DQIA 3GC3A 1SY6L 2TSAA 1JV2A 4P46C 3O3EA 4WFGE 3UYRH 3EUUA 3VI4E 4MB1A 3DRQA 1EO8H 4NO5B 3QW9A 4OT1L 1NGZA 2NX5B 1NIFA 3ERXA 3QDJE 3ALWA 3O4LA 4ONFH 5DT1H 1E8YA 1VFAA 2F54A 4UAHA 4KTYA 4G1EB 4ZFOA 4GIAA 2CKBH 3LPPA 4A66A 5F9AC 1S8DA 5DLMH 4AVJA 1BF8A 4A7VA 1DCEA 3CQPA 3QEQA 4GKLA 1D5XB 4PWIA 5KJRL 2OSYA 4O5LL 1S7TA 3KLSA 1Z5YD 4PUBH 3KH4A 3P4OA 4A04A 2YXVA 5FA3A 4D8OA 2Y4SA 2FJFA 1GHFH 4YE4H 1RUQL 4Z7QF 4ZMVA 2FEJA 1A7PL 2F54D 5F9JA 1F4WH 4R0LA 2W38A 2IG2L 4MWFB 4K5LA 1R3HB 4A38A 4YX2H 4L4VB 3IBOA 1RVFL 3LV3B 2Q3AA 1MCHA 2G5UA 1OE2A 2D3JA 1YJDH 1KUMA 4PRHD 3AQZA 2G60L 1U8CA 4B9JA 1XF4A 4DTGH 4IBVA 3VVWA 1KT2A 4Z0XB 4AYDC 4RLDA 4AUYA 2A83B 5T33H 2RFXB 3U0WH 5D6CB 4WJ5A 4E5XA 1DVFA 4B9PA 4E5XG 3LY6A 1PKQE 1ZE3H 3D6GA 5FWQA 5L2KE 4TSBH 2NY4D 4JM4L 5A2CA 3BGMA 1JV2B 5D2LB 4X6EB 4XP6H 1MCRA 3E2HB 3LZNA 2YPVH 2AQSA 12E8L 5KS9F 3NMEA 3MLYL 3ZE2E 1KB5H 1HWHB 5EB9A 2KDYA 2QVKA 4DP8X 1NOLA 5TQ0L 2AITA 2Z31D 5ENWA 1TKWA 4U1NB 4OAWB 3E1F1 2CCLA 5HI5D 4ZUWA 4AXWB 3TH4T 3FSWA 3ZY7A 3RVTC 1G7MB 3QEHB 1DQJA 1KBGH 1UT2A 2ZONA 3QEGL 1F1GA 4YK4C 5KYYB 3QDGE 3DGGA 5HHMD 3DRTB 3ZL4L 1NWPA 5IVXA 2AK1H 2F19L 3O2WL 3DV6B 2A0LC 4X9HA 5F2FA 3B83A 1TU2B 1AGEA 1Z5HA 3ZLQC 3CU7A 1EVUA 5HDBF 3V4VB 2JTYA 1J5OH 4K3DH 4I7ZC 3IS0X 5I15L 4F7TA 4D9RD 2Y69B 3GBML 4G43A 2Q7YB 3MRGB 3US9A 2F54B 4Q4EA 4H26B 1BP3B 4KUCD 2AHIA 5C92A 7PCYA 5IQ7L 2ATAA 1RCYA 1JRHL 2UWEB 4E41B 4XNUH 2YGNA 4ZD3L 7FABH 3FJTA 1R5VA 5C0JA 5EU3A 1KCKA 4KTEH 3WIIH 3CWGA 3EYFA 1A9BA 4UAOC 4UZUA 3BIKA 2R1YB 4ZOAA 4PYHA 3VXOA 2FBJH 4X6CF 1OAXL 3PQYA 1F3DJ 1MFEH 3KS0H 1JSYA 4ABQA 3I9GH 5ETUB 4APQD 5B3NA 5CLWA 3FO9A 4Q74A 1Q9WB 3TFKC 3WHE0 1MH5B 2DEXX 4I48A 4MDIA 3AXIA 2FUQA 1R3HA 4Y5YA 5F3HA 3OHXB 4HHGA 1OCRB 3BUTA 3BN3B 4NT6A 5T1DL 4NDMA 4WU5A 2WLJA 3ARXA 4BFIA 3GPSA 4WWKD 4WO4D 2NMSA 5ENWB 3H9SB 2ATPA 2PCPB 3IDNB 3UG3A 2HJFB 4HH9A 2CNYA 4NKIL 1THCA 2NSXA 3JTSB 3OD3A 5JQ6H 1HL4A 5MP6H 4HEPG 1D5BB 4L8DA 4QCIA 1A6AB 3ILPB 5DHXB 2COQA 1J48A 2HLFC 1U8NA 4ACPA 3CH1A 4ZUVB 5LBSL 1KFAH 1NKRA 2V37A 1OCWL 3DOIA 4FNTA 3ZW3A 5CO1A 4LLYB 3OHMB 1T04B 1G1YA 3CMGA 4KI5F 4XNDA 2DM3A 4WFHD 4IM8A 4PB9H 4FNQA 4YBHA 5AAWA 3R7RA 5FYJU 4DESA 4FA8A 3JTBA 4JM2F 4XZUB 5LCVA 2HLAB 5KS9B 3IGAB 3KAAA 4NRXA 4F2MB 5DI8A 4OZHE 1ET8A 2WZAA 1OQOA 1CF8L 3EOAB 3PJSA 1SRDA 1BVOA 4POZD 2EC9T 4MGXA 4UINH 1DQVA 1IX2A 2UUDH 1MAJA 2IFFL 1QP1A 3K6DA 5CSBA 3VRLF 2GY7B 1MW3A 2EKSA 3TA3B 3HZKA 4NWTH 4OSUH 5A7BA 4KJWD 2B59A 3D9AL 3Q44A 4P2RB 2IGFL 3O45A 4AT6B 4EVNB 1NEZA 1RLWA 4MMYB 2NXZC 3I3EA 1CD1B 2BMKA 3H0TB 4U3XA 4YGVB 1NCJA 4YNYB 1JXKA 5E08L 1HNGA 3FB5B 1ZVSA 1LO5A 5EZJB 5I8OH 2NYYC 3VI3F 3BEVB 2EXYC 4G5AA 4HS8L 3TU6A 3HOGA 3O41B 4NO0A 4NN6C 3KW7A 4FLOA 3H2QA 1UCBL 4LPWA 3WELA 1PS3A 1AGFA 3PGCA 2R1YA 2JKIS 1X6LA 4HPYL 4BINA 4YHNA 2XICA 1QSEB 5CF3A 1IAOB 4TNWF 4PUBL 3VXTB 1WITA 2NXZD 5JPMC 5DEFA 4M7LL 5KUMA 5T1JA 1X5HA 1LE5B 4FTDA 3ZDYE 1D9KD 1FH5H 4U1MA 3D25A 2DQHH 4PLNC 1K6QH 5E8PA 4AEIL 1YYCA 4OCNC 3QUYA 4HZAA 2QL1A 1G0XA 4RGOL 4ERSL 4N1EA 1G6RH 2MIZA 2VZ1A 2EDNA 3B2DC 3KG5A 5IFAH 3O4LD 1DUZB 6FABH 2H9GA 3D0LA 4HHAA 3LKOA 5I0WA 3U4AA 4Y16A 1UJ3B 3HZMA 5FKPB 2MHAA 5CEZL 2BO0A 3FTXA 4QXUH 4OCRL 3PS6A 4GQRA 5JIPA 2DM7A 3BZFB 3MGTB 4EVNA 5IIEA 1CT8B 5TE6H 1F4AA 3P3YA 3D87B 2GCYA 4MXWL 1NAMB 3Q6GH 1XT5A 4MJ5B 5KYXA 4JL2A 1VHPA 1TVBA 2DWDA 2YEQA 2IXQB 4FHBD 5FYKE 3KLAB 5I71B 3KLHC 2ZX9A 4BUHA 2A9DA 3RTLA 3L4TA 5AZUA 5JDJA 1X4XA 2WP3T 2WXJA 3QUYC 5CUSL 4NYLA 5T33L 4EPSA 1OW0A 1JVLA 5B1KA 3BWZA 1RULL 3P9LB 2W0LA 2V7HA 3QCUH 5PCYA 4ABVA 2F58L 4I3SL 1S9KC 3BAJA 3LKNA 1RIVL 5SWZD 4NCC1 4R4BB 3O45B 4AT6A 3GK8H 1IEAB 2ALAA 5GS0D 1H6UA 1VSCA 2R69H 4Y4KB 5FUZH 5T3XL 3X12B 1CGSL 3BLKA 3MXWL 4OLVL 2LU5A 4DUVA 1NGQH 1E4WL 1MVFA 2MCAA 2UZXB 2AK4A 3APDA 3HLKA 4U1IB 3ARBD 3WMSA 2D0HA 1IQDB 1HOCB 3Q05A 1LVEA 1SLVA 4Y16B 5AW4B 5MEND 3ZT7A 5HVWA 5CLYA 4XOAA 4PN6A 3S3BB 4WI6A 1UB5A 3H42L 4Q9BA 4NENA 5DUBB 4AUJA 1ORSA 2Y5QA 3IWUA 2WLLA 1RFDH 3MUGA 1MRDH 5TD4A 1A0QH 4QRBA 1E4JA 2I5YL 4PJFE 2NXYB 3MRNB 3PWPA 1Q8MA 3TLRA 2PNDA 4PSPA 1ZVYA 4X6FA 1NM9A 2EXWD 4AJ0A 4ZFOL 1AS8A 4F9PC 2TSBA 2WLIA 1USZA 1Z9PA 3N50A 3Q5YA 3H1ZA 3WTXA 3W0WA 1T1ZA 3B8YA 2RJMA 5JORB 4I18C 4IRJA 1NCCH 1H15A 6CGTA 1IEBB 3KGSA 4KJYB 1RUKL 1BWWA 1M05B 5SX4H 2WB7A 3I9PA 5C97A 5LG6A 2D3LA 2JNZA 2Y7QB 3HG1B 4JM2C 1BQSA 4ELDA 1NAKH 2RB8A 3GMMB 3BDYL 4A7QA 1GR7A 2BHYA 1CYWA 3NSDA 4GSXA 1ZA6B 1SVZA 3UTQB 3OZLA 5I8OL 5DJCA 4PRNA 3G6DH 1T0PB 1WD8A 5CINH 2PYFA 5G4OA 3B7TA 1NBVH 5IQOA 1ECYA 4U6YA 4HD5A 5JQ6L 2W65A 3ILEA 1F45A 1BM7A 4PJ5E 4Q6KA 1XF2B 3RWEB 2HKFL 4W68A 4UAOB 3QQ4B 2WBWB 3JWDL 3P9WB 5IZ7A 3OG6B 2G4GA 3WNPA 3D18A 3HUJF 1MLCA 2VW4A 1HCZA 2CZNA 4OLYL 4H8WL 1JZIA 3JV6A 2I24N 3BSHA 1KLGB 3AU1A 3PYCA 2VCOA 5BO0D 3SHSA 1HEJC 4YSUA 4QHNA 1N70A 1U3NA 3BVNA 4LLQA 4UTAL 2X4TA 2CGZA 3IFPB 1L9QA 4MX7A 3HLAB 2DEWX 3N85H 4LSVL 1NC2B 1SN5A 1MCEA 3FNKA 3GB7A 3FU7B 1DVUA 3EGSA 4G3YH 3NDZE 3RIAF 3OWRA 1O6VA 2A9MH 1MIEH 3LRKA 2X4SB 4XCNB 3HBZA 1X5MA 2BP5M 5IB2A 3FCBA 4LKXA 1PQZB 1TZAA 4N8VB 4N2LA 4QRPE 5E4IA 5E6ZA 3VWJA 4AIOA 5B8CB 5B1CA 2LAGB 5HYSB 5JORA 4E9XA 4Z23A 4OUUA 2FB4L 2HJLA 4JFEA 3FU6A 1S7RA 2WO3B 1T7WA 5AYQA 4B5EA 4P59L 1WCQA 4K94C 3WHXB 3KEHA 3HG1A 1I1YA 4KRNA 3RUGA 5E24E 4E9RA 4ELMB 2YBRB 4FZ8L 2BHUA 3AUWB 1YMMA 3LNFA 3NJXA 4HIXL 4UNVA 2HA1A 4PJ9B 1Z3GL 1ACYL 3SIKA 1JK8A 3PIQA 1UOKA 5IM7A 1HL9A 2FJHB 4NQXA 1MRCH 4QRAA 4WY7L 4I4WA 4PJ8B 5DRWA 3HNTH 3KPSD 3D7PA 1X3DA 3AG3B 1KJVB 2DYRB 1W0VA 3A22A 3QXVA 2V17L 2WTRB 1AGBB 1EWHA 3RZCC 3U0TA 4NRYB 3CPLB 3OKOB 3BT0A 3T6QC 4C56D 4FD0A 2IWEA 3ZKSD 4XMKL 3MXWH 1ND0A 5DMIL 4FLHA 4MSWA 3UAEA 3VD9A 4NO3A 3FQ2A 5DD5H 1OK0A 5C0AD 4CRPA 1OWRM 3DO7A 4I0CC 5E4EC 4X83A 3UPRA 4BSWB 2YD6A 4KDTA 3GM8A 1MCNA 4NZRL 4UM8B 4FQPA 3N91A 4TV3A 2L7JA 2XG5A 2XJKA 4LRIA 4HISA 2X9YA 1NCBH 3ZE2B 1LEIB 4LKXB 3TEUA 1RU9H 1T1WA 3R8BB 1MWOA 3UTSA 1H8SA 1FRGH 5A2AA 3MV01 2ED7A 4JFEB 3ULUH 3IEAA 1ZGLA 4A39A 2DWEA 1S6NA 1ZSDA 1WZAA 4UT6L 2PPEA 4MCMA 5BRZD 4AGMA 4A37A 3BIBX 3G5VA 1JPFB 3MLUH 1ED3A 4XI5C 3RWHB 3DSFH 5BQ7A 5JOEA 4N1CA 1QFHA 1E2ZA 1S9VA 2IIJA 2WLHA 3F62A 3K2UH 4GI6A 3FSOA 3MZTA 2GTZB 2XY2A 3NZUA 2B0SL 1T2QH 3D30A 4P3CL 4CGTA 3ZE0F 3EDFA 1OF0A 1KJVA 1LO4H 4Q9RL 4HS3A 2PTTB 3S5LA 4WU7A 4LRIC 5IESL 3DGCR 1O6TA 5GJTH 2IPKB 2XQ0A 2HJLB 3MV7D 1PJWA 4CKQA 4O9HL 5EU6D 3TZVD 1RZJL 4NNYB 4E9LA 1IGIL 1ZHBA 4XCCL 5D9SA 3GBEA 1HXYA 4NO3B 5EBGA 2DD8H 3KPMA 5JW4N 1LTXA 2NY0B 1S78D 5M94B 3K6SB 4GY4A 3U9PL 5JMOC 3MMEB 5C6PB 2VLKA 3BT2L 1A6TA 2R15A 1A14L 1XIWD 3ME0B 5GGUB 3WDIA 4YBQC 2BRQA 2FZ3B 3JQOB 4FX5A 4PJIB 1AGBA 1BX2A 5E8OB 2XKNB 3RVVD 2WN2A 1YJDL 3HRZB 5HXMA 4Y2NA 2GT9A 4DUXA 1WV7T 5HPMB 1NLBL 2Y7MA 1YNKH 2HLEB 2ADFH 1AY1L 1TIUA 1LLAA 2BW5A 2X4RA 3IDUA 1G7JB 4PJ9D 2FQFA 3HZVB 4GMSL 1MIML 3DOSA 3EJZD 3G04B 3T3MF 3K71A 1Q9LA 2AXFA 3EGDA 4L05A 2H4EA 5D7JD 4HOXA 2DQDL 2N56A 5E0QA 5DD6A 5A7EA 2NQ3A 4D9QD 2QR0A 4FFZH 5L7XH 1KBWA 1OGAD 1YEEH 2L0DA 3E8VA 2J8UE 1PAMA 4J12A 4WTXA 4GG6F