4MFKA

The crystal structure of acyltransferase in complex with decanoyl-coa
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
323
structure length
323
Chain Sequence
MDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLAVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Transferase
molecule keywords Putative uncharacterized protein tcp24
total genus 110
structure length 323
sequence length 323
ec nomenclature ec 2.3.1.-:
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mfkA02
4MFLA 4MFKA 4MFQA 4MFZA 4Q38A 4MFJA 4MFPA 4Q36A
chains in the Genus database with same CATH superfamily
2ZEEA 2K5TA 1Q2YA 3FECA 4FAIA 3PFOA 2EVNA 4OAEA 5LRKA 2V77A 2C1CA 5JPHA 2F7VA 3TCVA 1XMTA 3QAHA 3TOBA 4NEXA 4R87A 3FVLA 2B4DB 3D8PA 1X12A 1IY7A 1NMTA 5JM6A 4NF1A 1NSLA 2PJ7A 2ZOFA 4YFJA 2F8HA 1K4JA 7CPAA 2GREA 3KI9A 3ZZIA 1S7FA 1F57A 3L2NA 3FJUA 4P4DA 4FD6A 2B5GA 3D7DA 5AGEA 2Z3MA 4E0AA 4C7IA 1AUGA 3BJ8A 3TT2A 4DNCA 4ZY0A 4K3NA 1S60A 4HPSA 4M6HA 3EY5A 4KOWA 2AFMA 4KUAA 4P10A 4OMEA 4XNHB 1OZPA 2CTCA 2JBJA 5AG7A 5LRGA 4A31A 5JH9A 4A33A 4A38A 4A39A 4MFPA 2PVWA 1N71A 1KWMA 1BPNA 2Q4VA 4PK3A 1J4JA 2AFWA 2FVGA 4ZBGA 3S9MA 2HB6A 4A94A 2AE6A 3KHZA 3H8GA 4CAFA 1BPMA 3KASA 4UCPA 5C82A 3DGVA 5G21A 2AFUA 2EUIA 3MRUA 2CTBA 4JXQA 4XPLA 3PFEA 3EC4A 3SI0A 3BHXA 2HUZA 4M3SA 5CBMA 1Y7RA 1Q2CA 1R43A 3DLJA 4G1PA 3SI1A 2ZEGA 3NH4A 2G3AA 4UEEA 3CXQA 3K2KA 2DPTA 2IQ6A 2PJ1A 3GLJA 3EFAA 3S9NA 2A4NA 4UIAA 4P45A 3TC8A 1MJAA 1KUYA 1VGYA 2ZPAA 4P4BA 1Y9KA 2YNCA 4PPZA 4AG9A 2AFZA 4NXYA 3IGRA 2CF4A 2PC1A 4FD7A 1TF9A 5F09A 4QBJA 4U5YA 1ZO0A 5IX3A 4HKFA 3C26A 4IHMA 3TX8A 3D7FA 4OLLA 3CZXA 1I21A 1VHOA 2Q44A 2Z3KA 3F8KA 4OC4A 2ZEFA 1MJBA 4UWJA 1GHEA 3NE8A 2I3CA 2PJ6A 1YVKA 2ZOGA 2J8MA 2PQ8A 4KLVA 2Q0YA 4C7HA 2EK9A 4NJRA 5DWNA 3VH9A 3KQXA 2YNCC 4UF4A 1H8LA 3E0KA 5A28A 1LRZA 4HNYB 2V8GA 5KTAA 1FNOA 1LAMA 2PJ0A 2GFQA 3SXNA 2VI7A 3GKRA 1U6MA 4MHZA 4UEFA 1X10A 1B6BA 1JWQA 1UFHA 2NMTA 3DSBA 4KZTA 2J8NA 4H2KA 4OC3A 4F0YA 1LCPA 4ZX9A 2WSAA 1NSAA 2C27A 5KTDA 2Q4YA 4P4JA 3N5FA 5F46A 3K9TA 1UWYA 2CNMA 3KQZA 4TWEA 3QAYA 4PXCA 1QSMA 2OB0A 2ZEMA 2NYQA 3BLNA 3F5BA 4MRIA 4UFXA 4U9YA 5THWA 3RZAA 3IJ3A 1VHSA 1B87A 2EK8A 2FXFA 1FT7A 1XF8A 2IL4A 1M4LA 4FWUA 4ZX8A 2PJBA 3G3SA 4OC1A 3UY5A 1GYTA 3D67A 5HMNA 1L0CA 1ZG9A 5IB0A 4X8IA 2GLJA 4R3KA 4CAWA 2FL4A 4II9A 4PXDA 2ZEPA 4JWPA 4KSAA 4NCZA 5HH1A 3LODA 4R76A 3S6GA 3CPAA 4MBUA 4U9ZA 2B3VA 1PYTB 3OWCA 4A95A 4AVCA 4LX9A 2OZGA 3TE4A 1HDUA 1YW4A 4CGPA 3NA6A 1F2OA 2FIWA 3R9GA 2ABZA 4WWVA 4QUSA 4UIBA 1YW6A 2PDOA 4O23A 4CYNA 1AMPA 3ISXA 1IGBA 4YGOA 1YMEA 5CNPA 1IICA 2XEIA 1YK3A 3FMCA 1WWZA 1CM0A 5DWMA 3FB3A 2BO9A 3I1UA 1HDQA 4P44A 2ZW6A 4B13A 4MCRA 2PJ5A 1XOVA 1CPSA 2BOAA 4KVME 4YU9A 2BL1A 3EO4A 4P6YA 5K8OA 3S9LA 1QSNA 1XJOA 2Q7SA 2WPWA 5J1QA 1IOFA 1QSTA 3W6XA 4LQ6A 4Q7AA 3PB4X 3TO7A 4DYOA 3IEHA 2D4OA 2GLFA 2D4PA 4OADA 2WUUA 1IOIA 2P0WA 4KS9A 1A2ZA 4H6UA 2PJ3A 4WJBA 1IYKA 2OH1A 2JDDA 3B3SA 4LQGA 4P4IA 1BO4A 2F5IA 1CP7A 2BUEA 2RC4A 4M6GA 1YR0A 4H6ZA 4MI4A 1MJ9A 1YQEA 2CXAA 3H8FA 5LYFA 4P4FA 3H4QA 2EWBA 4YWYA 3LWUA 3PRTA 4FD4A 2ZENA 1TKFA 1AYEA 2Z11A 2PCUA 2ZW7A 4MCPA 4KVOE 3FIXA 4RI1A 2RB7A 4B6ZA 4F9VA 1ON0A 2WYRA 4C2YA 3D3SA 1IYLA 2VEZA 4UFWA 3RNZA 4EVYA 3PGPA 2YNDA 1YSJA 3F0AA 3H5ZA 3IU1A 3RBUA 3ISZA 5A27A 4KUBA 4HNWB 4NGRA 4UA3A 1IU8A 1LFWA 1YX0A 4XPDC 3VARA 4IK2A 4PXBA 1CPXA 4XPDB 2Z3LA 3CXSA 3PEIA 2G3TA 4NGPA 2ZEDA 5G1ZA 3H8EA 1RXTA 3GYAA 3GUXA 2OR4A 3GIUA 4KOUA 4XNHC 2O28A 4CYQA 2Q43A 4PSXA 4CGLA 2POKA 4B5PA 4MXUA 2Y0MA 4B14A 5BWAB 3B2YA 3FNCA 1YGHA 1Z8LA 4L89A 4M85A 4CGNA 5AG5A 3D66A 4MHDA 4NGNA 2FCKA 4I49A 4Y49B 2PIZA 1Z2LA 1V0CA 4HNXB 3QB8A 1BLLE 1XIXA 3KL9A 5HVFA 4CYPA 4E8OA 4MCSA 1Z8WA 2AJ6A 4A2ZA 3WC7A 4X3RA 3T9YA 1DE4C 4OP4A 2CNSA 2XEFA 2ANPA 4UWIA 2VXKA 2ZXVA 3B3VA 1WK4A 2BEIA 4P4EA 3SJEA 5AG4A 1ARLA 4FUUA 4UCMA 4B12A 4EFDA 3PBBA 2G0BA 1KZFA 1VIXA 4CAVA 1YREA 4C68A 1EE3P 2ODFA 2B4DA 5E96A 4AXVA 3VWEA 4CGOA 4CRZB 4CPAA 5D29A 2CIJA 4MFLA 3WR7A 2R1IA 3TOAA 2BSWA 3BXMA 5LYDA 3VWDA 1P0HA 5IB9A 4BBHA 2WZNA 3LACA 2H5MA 3T90A 5EMIA 4X2TA 4FD5A 2VZZA 4CAEA 3R96A 4GXHA 5DS0A 2HC9A 3KGQA 3SXOA 3FXTA 3KR5A 3MN8A 4AB7A 1Y0RA 3I9SA 2Z3PA 3PB7X 4E2AA 3B3TA 3TFYA 4IUSA 4DJLA 3FEEA 1LANA 1QQ9A 3RYOA 1TIQA 3PBEA 1I1DA 3SHPA 5D8NA 4OC5A 2OZHA 2Q51A 4NGTA 3FX6A 3CT9A 3S6FA 5HVGA 5ISVA 1ZLHA 2Q04A 3FYNA 5LRJA 5KTCA 2DEAA 4Y49C 1VKCA 3CXPA 4C2XA 3BI0A 2XEJA 3D7GA 3BJ7A 5ELYA 2PE3A 3CDXA 5JGFA 3NFZA 4RUHA 4MHYA 5I4MA 2C6CA 4MFJA 4UCNA 1PCAA 3IFEA 2C6GA 3V38A 3NH8A 1LAPA 1ELLP 3BI1A 1PU9A 1S7NA 2I79A 4ZY1A 2AFOA 1YVOA 4A32A 2FS5A 3FF3A 2PJAA 2NSMA 4JXRA 4R7MA 4OIWA 5K8MA 4GS4A 1R57A 4CRYB 3W6SA 5J8CA 1KUXA 1TKHA 2G9DA 2JEVA 5CPAA 1IIDA 4R3LA 1CG2A 2GIVA 3GY9A 4KOVA 3QNVA 1I12A 3R9FA 5K8NA 2QJ8A 1M44A 2ZW4A 2QYVA 3K9UA 8CPAA 3JUWA 3DR6A 4B5OA 4UFVA 2JEWA 1FY7A 4A30A 2C6PA 2Q4ZA 3PB8X 2GE3A 3WT4A 1TF8A 3IU2A 5F49A 3D68A 2X7BA 4UBRA 3TTHA 2FE7A 2PJ8A 3GB0A 1ARMA 3R1KA 1Z4RA 4MHPA 3S6HA 3EXNA 3VATA 3DDDA 4CGMA 4UEZA 2O4HA 3IWEA 4F9UA 1M4GA 2BCOA 3IWGA 4ZI6A 4ORFA 4Z65A 4MY0A 3JTKA 5I0CA 1Q2DA 4Q36A 4AG7A 4CS0B 4KSIA 1BAVA 2ARHA 4L8AA 3R9EA 1RTQA 4J3GA 3HLPA 4OC0A 3SI2A 2JLMA 4KVXA 1RO5A 1Z8XA 2JBKA 1TKJA 3JRUA 3PZJA 4IF5A 4ONUA 2ZEHA 4OKOA 1MK4A 2Z0ZA 3N7ZA 1S5KA 4QVTA 4NJQA 4B11A 1Z4EA 5JQ4A 5GCNA 4PV6A 2JDCA 1R3NA 1KUVA 1P4NA 1XMBA 4MJ8A 4X5KA 1TXRA 1YLEA 4R57A 1BOBA 2PR1A 5EC4A 1Y9WA 3SJGA 5J8FA 6CPAA 2V8VA 3D2PA 3KKWA 4KLWA 4B10A 4F6AA 3NE7A 3IWWA 5LYIA 2EO8A 2DXQA 2VZYA 2CY2A 1CX8A 4TNUA 2AFXA 4XPKA 4KOXA 4NGSA 3FRMA 2QVPA 4FBEA 1DTDA 2PJ9A 4YRHA 4ZGYB 1ZLIA 2OOTA 4R9MA 4MCQA 3CPXA 2Q7BA 3WABA 2B58A 2HV2A 2QIRA 5H84A 1M4DA 4PQAA 1YLOA 2CNTA 3P2HA 4LUAA 2B3UA 5FVJA 3R95A 4K30A 3KHXA 2B5GB 2V8DA 1XFOA 3I3GA 4F0XA 5HVHA 2DF5A 5LYLA 4JJXA 4KSFA 1QMUA 4OC2A 4BINA 3B3CA 3MGDA 1OBRA 1S7KA 3S6KA 3SJFA 1CJWA 4JD6A 4JYWA 2P6FA 2B4BA 2ATRA 4MY3A 1SQHA 3TO6A 2PVVA 2IMOA 2Z3OA 2YNEA 3DNSA 4BD9A 1JQGA 3D7HA 1ELMP 5F47A 2PRBA 1XE4A 2ZW5A 5G22A 4NGMA 4H89A 2R7HA 2REEA 2GANA 3LMSA 4GM5A 2PR8A 3B35A 3IO1A 4PSWA 4NSQA 4MHNA 2XEGA 4C2ZA 2Z3NA 2DPSA 5F48A 2GU2A 2EBJA 2ZEOA 4W9YA 1LOKA 1Z9UA 4M6IA 2VQYA 2Z10A 1M1DA 4KOTA 3D2MA 2FSRA 2I00A 4RS2A 1S3ZA 2PSWA 3PB6X 2J8RA 3W91A 4KORA 2PJCA 3B8GA 1ZG8A 4AVBA 1XBUA 5H86A 2O53A 3WC6A 3FH4A 5HXDA 1PUAA 4BMHA 3JVNA 2R98A 2FIAA 3PB9X 4ONWA 1XRYA 3NH5A 3T8WA 3D4UA 4JZ0A 4KOSA 4MMOA 5K8PA 2R8VA 3RO0A 2J9AA 4ZYQA 1CP6A 3PP9A 4EMEA 3DR8A 1QSOA 1Z5RA 3TO9A 2IJZA 3RAMA 3B7IA 2OZUA 2ZELA 2RFHA 2FT0A 2AFSA 3B3WA 3FEDA 4EWTA 1Q7LA 1Y7EA 2KCWA 1QSRA 2PIYA 1HEEA 2REFA 4PXEA 1XEBA 2OU2A 3KZWA 4Q38A 3P2FA 4CAXA 4RN7A 5EBVA 1Z8TA 2P6GA 1F2PA 4MFKA 4R6TA 3KR4A 4JLYA 4MFZA 2VBQA 2QMLA 3V8IA 5G20A 3SJXA 4CYOA 3FBUA 2YGWA 3HUVA 1M4IA 4NGQA 1CBXA 3V7ZA 3ZJ0A 4B5PB 4DUKA 2PRQA 4R8FA 3LD2A 4IAVA 5AG6A 4F8ZA 1VHEA 3IC1A 4NFRA 3WC5A 3IIBA 2VL1A 1S7LA 4MFQA 1Y0YA 2PJ4A 3A9LA 5IV0A 1ZG7A 4QB9A 4A37A 4AVAA 4QC6A 1NE9A 2PJ2A 3G8WA 4KOYA 2QECA 5C88A 4PK2A 2HQYA 2V8HA 4OIDA 1IB1E 2P6EA 4ZY2A 2WPXA
chains in the Genus database with same CATH topology
2K5TA 1Q2YA 2EVNA 4OAEA 5JPHA 3TCVA 1XMTA 3QAHA 3TOBA 4NEXA 4R87A 2B4DB 3D8PA 1NMTA 4NF1A 1NSLA 4YFJA 1K4JA 3ZZIA 1S7FA 4FD6A 2B5GA 5AGEA 2Z3MA 4E0AA 4C7IA 3BJ8A 3TT2A 1S60A 3EY5A 4KOWA 4KUAA 5AG7A 4XNHB 1OZPA 4A31A 4A33A 4MFPA 1N71A 2Q4VA 4PK3A 4ZBGA 1J4JA 2AE6A 4CAFA 4UCPA 5C82A 5G21A 2EUIA 4JXQA 4XPLA 3EC4A 2HUZA 4M3SA 1Y7RA 1Q2CA 2G3AA 3CXQA 2DPTA 3EFAA 2A4NA 1MJAA 1KUYA 2ZPAA 1Y9KA 2YNCA 4AG9A 4NXYA 3IGRA 2PC1A 4FD7A 4QBJA 4U5YA 1ZO0A 5IX3A 4HKFA 3C26A 4OLLA 1I21A 2Q44A 4UWJA 2Z3KA 3F8KA 1MJBA 1GHEA 1YVKA 2J8MA 2PQ8A 4KLVA 2Q0YA 4C7HA 5DWNA 2YNCC 3E0KA 5A28A 1LRZA 4HNYB 5KTAA 3SXNA 2VI7A 3GKRA 1U6MA 1B6BA 1UFHA 2NMTA 3DSBA 4KZTA 2J8NA 4F0YA 2WSAA 2C27A 5KTDA 2Q4YA 5F46A 2CNMA 1QSMA 2OB0A 3BLNA 3F5BA 4UFXA 4U9YA 1VHSA 1B87A 2FXFA 2IL4A 1XF8A 3G3SA 3UY5A 5HMNA 1L0CA 5IB0A 4R3KA 4CAWA 2FL4A 4II9A 4JWPA 4KSAA 4NCZA 5HH1A 3LODA 3S6GA 4MBUA 4U9ZA 2B3VA 3OWCA 4A95A 4AVCA 4LX9A 2OZGA 3TE4A 4CGPA 2FIWA 3R9GA 4QUSA 2PDOA 4CYNA 4YGOA 5CNPA 1IICA 1YK3A 1WWZA 1CM0A 5DWMA 3FB3A 2ZW6A 4B13A 4KVME 2BL1A 3EO4A 1QSNA 2WPWA 1QSTA 3W6XA 3TO7A 2D4OA 2D4PA 4OADA 2WUUA 2P0WA 4KS9A 4H6UA 1IYKA 2JDDA 2OH1A 1BO4A 2F5IA 2BUEA 2RC4A 1YR0A 4H6ZA 4MI4A 1MJ9A 2CXAA 3H4QA 4FD4A 2Z11A 2ZW7A 4DNCA 4RI1A 4KVOE 3FIXA 1ON0A 4C2YA 3D3SA 1IYLA 2VEZA 4UFWA 4EVYA 3PGPA 2YNDA 3F0AA 3H5ZA 3IU1A 5A27A 4KUBA 4HNWB 4UA3A 4XPDC 1YX0A 4XPDB 2Z3LA 3CXSA 2G3TA 5G1ZA 4CYQA 1RXTA 3GYAA 4KOUA 4XNHC 2O28A 4PSXA 4CGLA 4B5PA 2Y0MA 4B14A 5BWAB 3FNCA 1YGHA 4L89A 4M85A 4CGNA 5AG5A 4MHDA 2FCKA 4I49A 4Y49B 1V0CA 4HNXB 3QB8A 1XIXA 4CYPA 4E8OA 4A2ZA 2AJ6A 3T9YA 2CNSA 4UWIA 2VXKA 2ZXVA 1WK4A 2BEIA 5AG4A 4UCMA 4B12A 2G0BA 1KZFA 4CAVA 1YREA 4C68A 2B4DA 5E96A 3VWEA 4CGOA 4CRZB 4MFLA 3WR7A 2R1IA 3TOAA 2BSWA 3VWDA 1P0HA 4BBHA 3T90A 2H5MA 4FD5A 2VZZA 4CAEA 3R96A 3SXOA 3FXTA 4AB7A 3TFYA 3I9SA 2Z3PA 4E2AA 4IUSA 3RYOA 1TIQA 1I1DA 3SHPA 2OZHA 3S6FA 5ISVA 2Q04A 3FYNA 5KTCA 4Y49C 1VKCA 3CXPA 4C2XA 3BJ7A 4MFJA 4UCNA 1PU9A 1S7NA 2I79A 1YVOA 4A32A 2FS5A 4JXRA 4GS4A 1R57A 4CRYB 3W6SA 5J8CA 1KUXA 2JEVA 1IIDA 4R3LA 2GIVA 3GY9A 4KOVA 1I12A 3R9FA 1M44A 2ZW4A 3K9UA 3JUWA 3DR6A 4B5OA 4UFVA 1FY7A 4A30A 2GE3A 3IU2A 5F49A 2X7BA 4UBRA 3TTHA 2FE7A 3R1KA 1Z4RA 3S6HA 3EXNA 3DDDA 4CGMA 3IWEA 1M4GA 3IWGA 4ORFA 4MY0A 3JTKA 5I0CA 1Q2DA 4Q36A 4AG7A 4CS0B 2ARHA 4L8AA 3R9EA 4J3GA 2JLMA 4KVXA 1RO5A 4ONUA 3PZJA 4IF5A 1MK4A 2Z0ZA 3N7ZA 1S5KA 4QVTA 4B11A 1Z4EA 5JQ4A 5GCNA 4PV6A 2JDCA 4MJ8A 1KUVA 1P4NA 4X5KA 1YLEA 4R57A 1BOBA 2PR1A 5EC4A 1Y9WA 5J8FA 3D2PA 3KKWA 4KLWA 4B10A 4F6AA 3NE7A 2DXQA 2VZYA 2CY2A 4XPKA 4KOXA 3FRMA 4YRHA 4ZGYB 4R9MA 2Q7BA 2B58A 2HV2A 2QIRA 5H84A 1M4DA 2CNTA 3P2HA 4LUAA 2B3UA 5FVJA 3R95A 4K30A 2B5GB 3I3GA 4F0XA 4JJXA 4KSFA 3MGDA 3S6KA 1S7KA 1CJWA 4JD6A 2P6FA 2B4BA 2ATRA 4MY3A 1SQHA 3TO6A 2Z3OA 2YNEA 3DNSA 5F47A 2PRBA 1XE4A 2ZW5A 5G22A 4H89A 2R7HA 2REEA 2GANA 2PR8A 4PSWA 4NSQA 4C2ZA 2Z3NA 2DPSA 5F48A 1Z9UA 2VQYA 2Z10A 1M1DA 4KOTA 3D2MA 2FSRA 2I00A 4RS2A 1S3ZA 2PSWA 3W91A 2J8RA 4KORA 3B8GA 4AVBA 5H86A 1PUAA 4BMHA 3JVNA 2R98A 2FIAA 4KOSA 2R8VA 3PP9A 3DR8A 1QSOA 3TO9A 2OZUA 2FT0A 2KCWA 1QSRA 2REFA 1XEBA 2OU2A 4Q38A 3P2FA 4CAXA 5EBVA 2P6GA 4MFKA 4JLYA 4MFZA 2VBQA 2QMLA 3V8IA 5G20A 4CYOA 3FBUA 2YGWA 3ZJ0A 1M4IA 4B5PB 3LD2A 5AG6A 1S7LA 4MFQA 3A9LA 5IV0A 4QB9A 4AVAA 4QC6A 1NE9A 3G8WA 4KOYA 5C88A 2QECA 4PK2A 2HQYA 1IB1E 2P6EA 2WPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFL A;  4MFK A;  4MFQ A;  4MFZ A;  4Q38 A;  4MFJ A;  4MFP A;  4Q36 A; 
#chains in the Genus database with same CATH topology
 2ZEE A;  2K5T A;  1Q2Y A;  3FEC A;  4FAI A;  3PFO A;  2EVN A;  4OAE A;  5LRK A;  2V77 A;  2C1C A;  5JPH A;  2F7V A;  3TCV A;  1XMT A;  3QAH A;  3TOB A;  4NEX A;  4R87 A;  3FVL A;  2B4D B;  3D8P A;  1X12 A;  1IY7 A;  1NMT A;  5JM6 A;  4NF1 A;  1NSL A;  2PJ7 A;  2ZOF A;  4YFJ A;  2F8H A;  1K4J A;  7CPA A;  2GRE A;  3KI9 A;  3ZZI A;  1S7F A;  1F57 A;  3L2N A;  3FJU A;  4P4D A;  4FD6 A;  2B5G A;  3D7D A;  5AGE A;  2Z3M A;  4E0A A;  4C7I A;  1AUG A;  3BJ8 A;  3TT2 A;  4DNC A;  4ZY0 A;  4K3N A;  1S60 A;  4HPS A;  4M6H A;  3EY5 A;  4KOW A;  2AFM A;  4KUA A;  4P10 A;  4OME A;  4XNH B;  1OZP A;  2CTC A;  2JBJ A;  5AG7 A;  5LRG A;  4A31 A;  5JH9 A;  4A33 A;  4A38 A;  4A39 A;  4MFP A;  2PVW A;  1N71 A;  1KWM A;  1BPN A;  2Q4V A;  4PK3 A;  1J4J A;  2AFW A;  2FVG A;  4ZBG A;  3S9M A;  2HB6 A;  4A94 A;  2AE6 A;  3KHZ A;  3H8G A;  4CAF A;  1BPM A;  3KAS A;  4UCP A;  5C82 A;  3DGV A;  5G21 A;  2AFU A;  2EUI A;  3MRU A;  2CTB A;  4JXQ A;  4XPL A;  3PFE A;  3EC4 A;  3SI0 A;  3BHX A;  2HUZ A;  4M3S A;  5CBM A;  1Y7R A;  1Q2C A;  1R43 A;  3DLJ A;  4G1P A;  3SI1 A;  2ZEG A;  3NH4 A;  2G3A A;  4UEE A;  3CXQ A;  3K2K A;  2DPT A;  2IQ6 A;  2PJ1 A;  3GLJ A;  3EFA A;  3S9N A;  2A4N A;  4UIA A;  4P45 A;  3TC8 A;  1MJA A;  1KUY A;  1VGY A;  2ZPA A;  4P4B A;  1Y9K A;  2YNC A;  4PPZ A;  4AG9 A;  2AFZ A;  4NXY A;  3IGR A;  2CF4 A;  2PC1 A;  4FD7 A;  1TF9 A;  5F09 A;  4QBJ A;  4U5Y A;  1ZO0 A;  5IX3 A;  4HKF A;  3C26 A;  4IHM A;  3TX8 A;  3D7F A;  4OLL A;  3CZX A;  1I21 A;  1VHO A;  2Q44 A;  2Z3K A;  3F8K A;  4OC4 A;  2ZEF A;  1MJB A;  4UWJ A;  1GHE A;  3NE8 A;  2I3C A;  2PJ6 A;  1YVK A;  2ZOG A;  2J8M A;  2PQ8 A;  4KLV A;  2Q0Y A;  4C7H A;  2EK9 A;  4NJR A;  5DWN A;  3VH9 A;  3KQX A;  2YNC C;  4UF4 A;  1H8L A;  3E0K A;  5A28 A;  1LRZ A;  4HNY B;  2V8G A;  5KTA A;  1FNO A;  1LAM A;  2PJ0 A;  2GFQ A;  3SXN A;  2VI7 A;  3GKR A;  1U6M A;  4MHZ A;  4UEF A;  1X10 A;  1B6B A;  1JWQ A;  1UFH A;  2NMT A;  3DSB A;  4KZT A;  2J8N A;  4H2K A;  4OC3 A;  4F0Y A;  1LCP A;  4ZX9 A;  2WSA A;  1NSA A;  2C27 A;  5KTD A;  2Q4Y A;  4P4J A;  3N5F A;  5F46 A;  3K9T A;  1UWY A;  2CNM A;  3KQZ A;  4TWE A;  3QAY A;  4PXC A;  1QSM A;  2OB0 A;  2ZEM A;  2NYQ A;  3BLN A;  3F5B A;  4MRI A;  4UFX A;  4U9Y A;  5THW A;  3RZA A;  3IJ3 A;  1VHS A;  1B87 A;  2EK8 A;  2FXF A;  1FT7 A;  1XF8 A;  2IL4 A;  1M4L A;  4FWU A;  4ZX8 A;  2PJB A;  3G3S A;  4OC1 A;  3UY5 A;  1GYT A;  3D67 A;  5HMN A;  1L0C A;  1ZG9 A;  5IB0 A;  4X8I A;  2GLJ A;  4R3K A;  4CAW A;  2FL4 A;  4II9 A;  4PXD A;  2ZEP A;  4JWP A;  4KSA A;  4NCZ A;  5HH1 A;  3LOD A;  4R76 A;  3S6G A;  3CPA A;  4MBU A;  4U9Z A;  2B3V A;  1PYT B;  3OWC A;  4A95 A;  4AVC A;  4LX9 A;  2OZG A;  3TE4 A;  1HDU A;  1YW4 A;  4CGP A;  3NA6 A;  1F2O A;  2FIW A;  3R9G A;  2ABZ A;  4WWV A;  4QUS A;  4UIB A;  1YW6 A;  2PDO A;  4O23 A;  4CYN A;  1AMP A;  3ISX A;  1IGB A;  4YGO A;  1YME A;  5CNP A;  1IIC A;  2XEI A;  1YK3 A;  3FMC A;  1WWZ A;  1CM0 A;  5DWM A;  3FB3 A;  2BO9 A;  3I1U A;  1HDQ A;  4P44 A;  2ZW6 A;  4B13 A;  4MCR A;  2PJ5 A;  1XOV A;  1CPS A;  2BOA A;  4KVM E;  4YU9 A;  2BL1 A;  3EO4 A;  4P6Y A;  5K8O A;  3S9L A;  1QSN A;  1XJO A;  2Q7S A;  2WPW A;  5J1Q A;  1IOF A;  1QST A;  3W6X A;  4LQ6 A;  4Q7A A;  3PB4 X;  3TO7 A;  4DYO A;  3IEH A;  2D4O A;  2GLF A;  2D4P A;  4OAD A;  2WUU A;  1IOI A;  2P0W A;  4KS9 A;  1A2Z A;  4H6U A;  2PJ3 A;  4WJB A;  1IYK A;  2OH1 A;  2JDD A;  3B3S A;  4LQG A;  4P4I A;  1BO4 A;  2F5I A;  1CP7 A;  2BUE A;  2RC4 A;  4M6G A;  1YR0 A;  4H6Z A;  4MI4 A;  1MJ9 A;  1YQE A;  2CXA A;  3H8F A;  5LYF A;  4P4F A;  3H4Q A;  2EWB A;  4YWY A;  3LWU A;  3PRT A;  4FD4 A;  2ZEN A;  1TKF A;  1AYE A;  2Z11 A;  2PCU A;  2ZW7 A;  4MCP A;  4KVO E;  3FIX A;  4RI1 A;  2RB7 A;  4B6Z A;  4F9V A;  1ON0 A;  2WYR A;  4C2Y A;  3D3S A;  1IYL A;  2VEZ A;  4UFW A;  3RNZ A;  4EVY A;  3PGP A;  2YND A;  1YSJ A;  3F0A A;  3H5Z A;  3IU1 A;  3RBU A;  3ISZ A;  5A27 A;  4KUB A;  4HNW B;  4NGR A;  4UA3 A;  1IU8 A;  1LFW A;  1YX0 A;  4XPD C;  3VAR A;  4IK2 A;  4PXB A;  1CPX A;  4XPD B;  2Z3L A;  3CXS A;  3PEI A;  2G3T A;  4NGP A;  2ZED A;  5G1Z A;  3H8E A;  1RXT A;  3GYA A;  3GUX A;  2OR4 A;  3GIU A;  4KOU A;  4XNH C;  2O28 A;  4CYQ A;  2Q43 A;  4PSX A;  4CGL A;  2POK A;  4B5P A;  4MXU A;  2Y0M A;  4B14 A;  5BWA B;  3B2Y A;  3FNC A;  1YGH A;  1Z8L A;  4L89 A;  4M85 A;  4CGN A;  5AG5 A;  3D66 A;  4MHD A;  4NGN A;  2FCK A;  4I49 A;  4Y49 B;  2PIZ A;  1Z2L A;  1V0C A;  4HNX B;  3QB8 A;  1BLL E;  1XIX A;  3KL9 A;  5HVF A;  4CYP A;  4E8O A;  4MCS A;  1Z8W A;  2AJ6 A;  4A2Z A;  3WC7 A;  4X3R A;  3T9Y A;  1DE4 C;  4OP4 A;  2CNS A;  2XEF A;  2ANP A;  4UWI A;  2VXK A;  2ZXV A;  3B3V A;  1WK4 A;  2BEI A;  4P4E A;  3SJE A;  5AG4 A;  1ARL A;  4FUU A;  4UCM A;  4B12 A;  4EFD A;  3PBB A;  2G0B A;  1KZF A;  1VIX A;  4CAV A;  1YRE A;  4C68 A;  1EE3 P;  2ODF A;  2B4D A;  5E96 A;  4AXV A;  3VWE A;  4CGO A;  4CRZ B;  4CPA A;  5D29 A;  2CIJ A;  4MFL A;  3WR7 A;  2R1I A;  3TOA A;  2BSW A;  3BXM A;  5LYD A;  3VWD A;  1P0H A;  5IB9 A;  4BBH A;  2WZN A;  3LAC A;  2H5M A;  3T90 A;  5EMI A;  4X2T A;  4FD5 A;  2VZZ A;  4CAE A;  3R96 A;  4GXH A;  5DS0 A;  2HC9 A;  3KGQ A;  3SXO A;  3FXT A;  3KR5 A;  3MN8 A;  4AB7 A;  1Y0R A;  3I9S A;  2Z3P A;  3PB7 X;  4E2A A;  3B3T A;  3TFY A;  4IUS A;  4DJL A;  3FEE A;  1LAN A;  1QQ9 A;  3RYO A;  1TIQ A;  3PBE A;  1I1D A;  3SHP A;  5D8N A;  4OC5 A;  2OZH A;  2Q51 A;  4NGT A;  3FX6 A;  3CT9 A;  3S6F A;  5HVG A;  5ISV A;  1ZLH A;  2Q04 A;  3FYN A;  5LRJ A;  5KTC A;  2DEA A;  4Y49 C;  1VKC A;  3CXP A;  4C2X A;  3BI0 A;  2XEJ A;  3D7G A;  3BJ7 A;  5ELY A;  2PE3 A;  3CDX A;  5JGF A;  3NFZ A;  4RUH A;  4MHY A;  5I4M A;  2C6C A;  4MFJ A;  4UCN A;  1PCA A;  3IFE A;  2C6G A;  3V38 A;  3NH8 A;  1LAP A;  1ELL P;  3BI1 A;  1PU9 A;  1S7N A;  2I79 A;  4ZY1 A;  2AFO A;  1YVO A;  4A32 A;  2FS5 A;  3FF3 A;  2PJA A;  2NSM A;  4JXR A;  4R7M A;  4OIW A;  5K8M A;  4GS4 A;  1R57 A;  4CRY B;  3W6S A;  5J8C A;  1KUX A;  1TKH A;  2G9D A;  2JEV A;  5CPA A;  1IID A;  4R3L A;  1CG2 A;  2GIV A;  3GY9 A;  4KOV A;  3QNV A;  1I12 A;  3R9F A;  5K8N A;  2QJ8 A;  1M44 A;  2ZW4 A;  2QYV A;  3K9U A;  8CPA A;  3JUW A;  3DR6 A;  4B5O A;  4UFV A;  2JEW A;  1FY7 A;  4A30 A;  2C6P A;  2Q4Z A;  3PB8 X;  2GE3 A;  3WT4 A;  1TF8 A;  3IU2 A;  5F49 A;  3D68 A;  2X7B A;  4UBR A;  3TTH A;  2FE7 A;  2PJ8 A;  3GB0 A;  1ARM A;  3R1K A;  1Z4R A;  4MHP A;  3S6H A;  3EXN A;  3VAT A;  3DDD A;  4CGM A;  4UEZ A;  2O4H A;  3IWE A;  4F9U A;  1M4G A;  2BCO A;  3IWG A;  4ZI6 A;  4ORF A;  4Z65 A;  4MY0 A;  3JTK A;  5I0C A;  1Q2D A;  4Q36 A;  4AG7 A;  4CS0 B;  4KSI A;  1BAV A;  2ARH A;  4L8A A;  3R9E A;  1RTQ A;  4J3G A;  3HLP A;  4OC0 A;  3SI2 A;  2JLM A;  4KVX A;  1RO5 A;  1Z8X A;  2JBK A;  1TKJ A;  3JRU A;  3PZJ A;  4IF5 A;  4ONU A;  2ZEH A;  4OKO A;  1MK4 A;  2Z0Z A;  3N7Z A;  1S5K A;  4QVT A;  4NJQ A;  4B11 A;  1Z4E A;  5JQ4 A;  5GCN A;  4PV6 A;  2JDC A;  1R3N A;  1KUV A;  1P4N A;  1XMB A;  4MJ8 A;  4X5K A;  1TXR A;  1YLE A;  4R57 A;  1BOB A;  2PR1 A;  5EC4 A;  1Y9W A;  3SJG A;  5J8F A;  6CPA A;  2V8V A;  3D2P A;  3KKW A;  4KLW A;  4B10 A;  4F6A A;  3NE7 A;  3IWW A;  5LYI A;  2EO8 A;  2DXQ A;  2VZY A;  2CY2 A;  1CX8 A;  4TNU A;  2AFX A;  4XPK A;  4KOX A;  4NGS A;  3FRM A;  2QVP A;  4FBE A;  1DTD A;  2PJ9 A;  4YRH A;  4ZGY B;  1ZLI A;  2OOT A;  4R9M A;  4MCQ A;  3CPX A;  2Q7B A;  3WAB A;  2B58 A;  2HV2 A;  2QIR A;  5H84 A;  1M4D A;  4PQA A;  1YLO A;  2CNT A;  3P2H A;  4LUA A;  2B3U A;  5FVJ A;  3R95 A;  4K30 A;  3KHX A;  2B5G B;  2V8D A;  1XFO A;  3I3G A;  4F0X A;  5HVH A;  2DF5 A;  5LYL A;  4JJX A;  4KSF A;  1QMU A;  4OC2 A;  4BIN A;  3B3C A;  3MGD A;  1OBR A;  1S7K A;  3S6K A;  3SJF A;  1CJW A;  4JD6 A;  4JYW A;  2P6F A;  2B4B A;  2ATR A;  4MY3 A;  1SQH A;  3TO6 A;  2PVV A;  2IMO A;  2Z3O A;  2YNE A;  3DNS A;  4BD9 A;  1JQG A;  3D7H A;  1ELM P;  5F47 A;  2PRB A;  1XE4 A;  2ZW5 A;  5G22 A;  4NGM A;  4H89 A;  2R7H A;  2REE A;  2GAN A;  3LMS A;  4GM5 A;  2PR8 A;  3B35 A;  3IO1 A;  4PSW A;  4NSQ A;  4MHN A;  2XEG A;  4C2Z A;  2Z3N A;  2DPS A;  5F48 A;  2GU2 A;  2EBJ A;  2ZEO A;  4W9Y A;  1LOK A;  1Z9U A;  4M6I A;  2VQY A;  2Z10 A;  1M1D A;  4KOT A;  3D2M A;  2FSR A;  2I00 A;  4RS2 A;  1S3Z A;  2PSW A;  3PB6 X;  2J8R A;  3W91 A;  4KOR A;  2PJC A;  3B8G A;  1ZG8 A;  4AVB A;  1XBU A;  5H86 A;  2O53 A;  3WC6 A;  3FH4 A;  5HXD A;  1PUA A;  4BMH A;  3JVN A;  2R98 A;  2FIA A;  3PB9 X;  4ONW A;  1XRY A;  3NH5 A;  3T8W A;  3D4U A;  4JZ0 A;  4KOS A;  4MMO A;  5K8P A;  2R8V A;  3RO0 A;  2J9A A;  4ZYQ A;  1CP6 A;  3PP9 A;  4EME A;  3DR8 A;  1QSO A;  1Z5R A;  3TO9 A;  2IJZ A;  3RAM A;  3B7I A;  2OZU A;  2ZEL A;  2RFH A;  2FT0 A;  2AFS A;  3B3W A;  3FED A;  4EWT A;  1Q7L A;  1Y7E A;  2KCW A;  1QSR A;  2PIY A;  1HEE A;  2REF A;  4PXE A;  1XEB A;  2OU2 A;  3KZW A;  4Q38 A;  3P2F A;  4CAX A;  4RN7 A;  5EBV A;  1Z8T A;  2P6G A;  1F2P A;  4MFK A;  4R6T A;  3KR4 A;  4JLY A;  4MFZ A;  2VBQ A;  2QML A;  3V8I A;  5G20 A;  3SJX A;  4CYO A;  3FBU A;  2YGW A;  3HUV A;  1M4I A;  4NGQ A;  1CBX A;  3V7Z A;  3ZJ0 A;  4B5P B;  4DUK A;  2PRQ A;  4R8F A;  3LD2 A;  4IAV A;  5AG6 A;  4F8Z A;  1VHE A;  3IC1 A;  4NFR A;  3WC5 A;  3IIB A;  2VL1 A;  1S7L A;  4MFQ A;  1Y0Y A;  2PJ4 A;  3A9L A;  5IV0 A;  1ZG7 A;  4QB9 A;  4A37 A;  4AVA A;  4QC6 A;  1NE9 A;  2PJ2 A;  3G8W A;  4KOY A;  2QEC A;  5C88 A;  4PK2 A;  2HQY A;  2V8H A;  4OID A;  1IB1 E;  2P6E A;  4ZY2 A;  2WPX A; 
#chains in the Genus database with same CATH homology
 2K5T A;  1Q2Y A;  2EVN A;  4OAE A;  5JPH A;  3TCV A;  1XMT A;  3QAH A;  3TOB A;  4NEX A;  4R87 A;  2B4D B;  3D8P A;  1NMT A;  4NF1 A;  1NSL A;  4YFJ A;  1K4J A;  3ZZI A;  1S7F A;  4FD6 A;  2B5G A;  5AGE A;  2Z3M A;  4E0A A;  4C7I A;  3BJ8 A;  3TT2 A;  1S60 A;  3EY5 A;  4KOW A;  4KUA A;  5AG7 A;  4XNH B;  1OZP A;  4A31 A;  4A33 A;  4MFP A;  1N71 A;  2Q4V A;  4PK3 A;  4ZBG A;  1J4J A;  2AE6 A;  4CAF A;  4UCP A;  5C82 A;  5G21 A;  2EUI A;  4JXQ A;  4XPL A;  3EC4 A;  2HUZ A;  4M3S A;  1Y7R A;  1Q2C A;  2G3A A;  3CXQ A;  2DPT A;  3EFA A;  2A4N A;  1MJA A;  1KUY A;  2ZPA A;  1Y9K A;  2YNC A;  4AG9 A;  4NXY A;  3IGR A;  2PC1 A;  4FD7 A;  4QBJ A;  4U5Y A;  1ZO0 A;  5IX3 A;  4HKF A;  3C26 A;  4OLL A;  1I21 A;  2Q44 A;  4UWJ A;  2Z3K A;  3F8K A;  1MJB A;  1GHE A;  1YVK A;  2J8M A;  2PQ8 A;  4KLV A;  2Q0Y A;  4C7H A;  5DWN A;  2YNC C;  3E0K A;  5A28 A;  1LRZ A;  4HNY B;  5KTA A;  3SXN A;  2VI7 A;  3GKR A;  1U6M A;  1B6B A;  1UFH A;  2NMT A;  3DSB A;  4KZT A;  2J8N A;  4F0Y A;  2WSA A;  2C27 A;  5KTD A;  2Q4Y A;  5F46 A;  2CNM A;  1QSM A;  2OB0 A;  3BLN A;  3F5B A;  4UFX A;  4U9Y A;  1VHS A;  1B87 A;  2FXF A;  2IL4 A;  1XF8 A;  3G3S A;  3UY5 A;  5HMN A;  1L0C A;  5IB0 A;  4R3K A;  4CAW A;  2FL4 A;  4II9 A;  4JWP A;  4KSA A;  4NCZ A;  5HH1 A;  3LOD A;  3S6G A;  4MBU A;  4U9Z A;  2B3V A;  3OWC A;  4A95 A;  4AVC A;  4LX9 A;  2OZG A;  3TE4 A;  4CGP A;  2FIW A;  3R9G A;  4QUS A;  2PDO A;  4CYN A;  4YGO A;  5CNP A;  1IIC A;  1YK3 A;  1WWZ A;  1CM0 A;  5DWM A;  3FB3 A;  2ZW6 A;  4B13 A;  4KVM E;  2BL1 A;  3EO4 A;  1QSN A;  2WPW A;  1QST A;  3W6X A;  3TO7 A;  2D4O A;  2D4P A;  4OAD A;  2WUU A;  2P0W A;  4KS9 A;  4H6U A;  1IYK A;  2JDD A;  2OH1 A;  1BO4 A;  2F5I A;  2BUE A;  2RC4 A;  1YR0 A;  4H6Z A;  4MI4 A;  1MJ9 A;  2CXA A;  3H4Q A;  4FD4 A;  2Z11 A;  2ZW7 A;  4DNC A;  4RI1 A;  4KVO E;  3FIX A;  1ON0 A;  4C2Y A;  3D3S A;  1IYL A;  2VEZ A;  4UFW A;  4EVY A;  3PGP A;  2YND A;  3F0A A;  3H5Z A;  3IU1 A;  5A27 A;  4KUB A;  4HNW B;  4UA3 A;  4XPD C;  1YX0 A;  4XPD B;  2Z3L A;  3CXS A;  2G3T A;  5G1Z A;  4CYQ A;  1RXT A;  3GYA A;  4KOU A;  4XNH C;  2O28 A;  4PSX A;  4CGL A;  4B5P A;  2Y0M A;  4B14 A;  5BWA B;  3FNC A;  1YGH A;  4L89 A;  4M85 A;  4CGN A;  5AG5 A;  4MHD A;  2FCK A;  4I49 A;  4Y49 B;  1V0C A;  4HNX B;  3QB8 A;  1XIX A;  4CYP A;  4E8O A;  4A2Z A;  2AJ6 A;  3T9Y A;  2CNS A;  4UWI A;  2VXK A;  2ZXV A;  1WK4 A;  2BEI A;  5AG4 A;  4UCM A;  4B12 A;  2G0B A;  1KZF A;  4CAV A;  1YRE A;  4C68 A;  2B4D A;  5E96 A;  3VWE A;  4CGO A;  4CRZ B;  4MFL A;  3WR7 A;  2R1I A;  3TOA A;  2BSW A;  3VWD A;  1P0H A;  4BBH A;  3T90 A;  2H5M A;  4FD5 A;  2VZZ A;  4CAE A;  3R96 A;  3SXO A;  3FXT A;  4AB7 A;  3TFY A;  3I9S A;  2Z3P A;  4E2A A;  4IUS A;  3RYO A;  1TIQ A;  1I1D A;  3SHP A;  2OZH A;  3S6F A;  5ISV A;  2Q04 A;  3FYN A;  5KTC A;  4Y49 C;  1VKC A;  3CXP A;  4C2X A;  3BJ7 A;  4MFJ A;  4UCN A;  1PU9 A;  1S7N A;  2I79 A;  1YVO A;  4A32 A;  2FS5 A;  4JXR A;  4GS4 A;  1R57 A;  4CRY B;  3W6S A;  5J8C A;  1KUX A;  2JEV A;  1IID A;  4R3L A;  2GIV A;  3GY9 A;  4KOV A;  1I12 A;  3R9F A;  1M44 A;  2ZW4 A;  3K9U A;  3JUW A;  3DR6 A;  4B5O A;  4UFV A;  1FY7 A;  4A30 A;  2GE3 A;  3IU2 A;  5F49 A;  2X7B A;  4UBR A;  3TTH A;  2FE7 A;  3R1K A;  1Z4R A;  3S6H A;  3EXN A;  3DDD A;  4CGM A;  3IWE A;  1M4G A;  3IWG A;  4ORF A;  4MY0 A;  3JTK A;  5I0C A;  1Q2D A;  4Q36 A;  4AG7 A;  4CS0 B;  2ARH A;  4L8A A;  3R9E A;  4J3G A;  2JLM A;  4KVX A;  1RO5 A;  4ONU A;  3PZJ A;  4IF5 A;  1MK4 A;  2Z0Z A;  3N7Z A;  1S5K A;  4QVT A;  4B11 A;  1Z4E A;  5JQ4 A;  5GCN A;  4PV6 A;  2JDC A;  4MJ8 A;  1KUV A;  1P4N A;  4X5K A;  1YLE A;  4R57 A;  1BOB A;  2PR1 A;  5EC4 A;  1Y9W A;  5J8F A;  3D2P A;  3KKW A;  4KLW A;  4B10 A;  4F6A A;  3NE7 A;  2DXQ A;  2VZY A;  2CY2 A;  4XPK A;  4KOX A;  3FRM A;  4YRH A;  4ZGY B;  4R9M A;  2Q7B A;  2B58 A;  2HV2 A;  2QIR A;  5H84 A;  1M4D A;  2CNT A;  3P2H A;  4LUA A;  2B3U A;  5FVJ A;  3R95 A;  4K30 A;  2B5G B;  3I3G A;  4F0X A;  4JJX A;  4KSF A;  3MGD A;  3S6K A;  1S7K A;  1CJW A;  4JD6 A;  2P6F A;  2B4B A;  2ATR A;  4MY3 A;  1SQH A;  3TO6 A;  2Z3O A;  2YNE A;  3DNS A;  5F47 A;  2PRB A;  1XE4 A;  2ZW5 A;  5G22 A;  4H89 A;  2R7H A;  2REE A;  2GAN A;  2PR8 A;  4PSW A;  4NSQ A;  4C2Z A;  2Z3N A;  2DPS A;  5F48 A;  1Z9U A;  2VQY A;  2Z10 A;  1M1D A;  4KOT A;  3D2M A;  2FSR A;  2I00 A;  4RS2 A;  1S3Z A;  2PSW A;  3W91 A;  2J8R A;  4KOR A;  3B8G A;  4AVB A;  5H86 A;  1PUA A;  4BMH A;  3JVN A;  2R98 A;  2FIA A;  4KOS A;  2R8V A;  3PP9 A;  3DR8 A;  1QSO A;  3TO9 A;  2OZU A;  2FT0 A;  2KCW A;  1QSR A;  2REF A;  1XEB A;  2OU2 A;  4Q38 A;  3P2F A;  4CAX A;  5EBV A;  2P6G A;  4MFK A;  4JLY A;  4MFZ A;  2VBQ A;  2QML A;  3V8I A;  5G20 A;  4CYO A;  3FBU A;  2YGW A;  3ZJ0 A;  1M4I A;  4B5P B;  3LD2 A;  5AG6 A;  1S7L A;  4MFQ A;  3A9L A;  5IV0 A;  4QB9 A;  4AVA A;  4QC6 A;  1NE9 A;  3G8W A;  4KOY A;  5C88 A;  2QEC A;  4PK2 A;  2HQY A;  1IB1 E;  2P6E A;  2WPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...