4MFKA

The crystal structure of acyltransferase in complex with decanoyl-coa
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
323
structure length
323
Chain Sequence
MDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLAVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein tcp24
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Transferase
total genus 110
structure length 323
sequence length 323
ec nomenclature ec 2.3.1.-:
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mfkA02
4MFPA 4Q36A 4MFQA 4MFLA 4Q38A 4MFZA 4MFJA 4MFKA
chains in the Genus database with same CATH superfamily
2YNEA 3D4UA 1V0CA 1UFHA 1X12A 3MRUA 1YQEA 4MCSA 1YR0A 4XPDB 1IYKA 1S7KA 2Z3LA 3CZXA 4LX9A 4BD9A 3PBEA 3D67A 4KOVA 4ZGYB 1ZLHA 5ISVA 2PC1A 3BI1A 5I0CA 1S60A 3B7IA 4ORFA 4NXYA 2ZEDA 5A28A 3K9UA 3D8PA 2Z3MA 4OC3A 3LACA 2POKA 4NGSA 1X10A 4ZX9A 4CRZB 3D3SA 1LAMA 5CBMA 1CPSA 1PCAA 1R57A 5J8CA 1IOFA 1B87A 1BAVA 1Y0YA 2ZXVA 3IFEA 3SJGA 4B11A 3DNSA 2NSMA 4P4DA 1YLOA 2G9DA 2ZEHA 4OC5A 3EC4A 5KTDA 4NGPA 2PJ3A 4C7HA 4PSXA 4JZ0A 3GLJA 1BO4A 4EFDA 3R96A 3G8WA 1ZG7A 4CGPA 3B35A 3SJEA 4UFXA 5LYIA 4LQGA 4B10A 4J3GA 3V8IA 2B5GA 2JBJA 2PJ8A 2PDOA 2JDDA 4FD7A 3GYAA 3N5FA 3WR7A 2PJ6A 5K8PA 2GU2A 3NA6A 3D66A 2B4DB 4A94A 4Y49B 2VI7A 1F2OA 1QSOA 2KCWA 1EE3P 3NFZA 4OMEA 3DLJA 1Z9UA 4ZX8A 2ZEGA 4F0YA 5IX3A 2CY2A 1Q7LA 4IHMA 5CNPA 1QSMA 1MJBA 1FY7A 2ODFA 5HXDA 4A2ZA 1I1DA 1I12A 2YGWA 2OU2A 2Z10A 4II9A 2Y0MA 4HNXB 4CRYB 3H8EA 4PXDA 2ZEPA 4MHDA 2NYQA 1IB1E 3DR8A 4MI4A 4B5OA 2EBJA 3D68A 3FB3A 1QSNA 3JVNA 3BJ7A 3R95A 3S6KA 4OC1A 4E8OA 4AB7A 2R1IA 2PJ5A 4ZYQA 2CIJA 2EK8A 1YGHA 1GHEA 3FECA 4JXRA 4Z65A 5H86A 4YRHA 3EY5A 2V8DA 4QC6A 2REEA 4X5KA 1F57A 2FXFA 4MXUA 5BWAB 4R87A 4PXEA 4NGMA 5G22A 4MMOA 2ZOGA 4FWUA 1WWZA 2F8HA 1YLEA 1KUVA 2EVNA 4DYOA 3NE7A 1CPXA 3ZJ0A 4FD6A 4BBHA 2A4NA 4UEZA 5AGEA 2PVVA 4KOUA 3R9EA 1XMBA 3IU2A 2V8VA 2BOAA 2PJ9A 5F46A 2XEIA 2WPXA 4CGOA 5JPHA 1VHOA 2WSAA 5JH9A 4UCNA 2CTCA 2AFMA 2PQ8A 3TO9A 4FD5A 2G3TA 5JM6A 2Q4ZA 4UCMA 2PJBA 3EO4A 5DWNA 3W6XA 4A37A 4C7IA 4CGMA 4RI1A 4R7MA 1ZG9A 1BPNA 1M44A 3PZJA 3TC8A 3BLNA 4UFWA 3NH5A 4C2XA 3SJXA 1KWMA 1IY7A 2OZHA 3GIUA 3EFAA 4Q38A 3RAMA 2QVPA 4MRIA 5LYDA 4M6HA 2Z3PA 2ZW6A 1CM0A 1Z5RA 4LQ6A 5K8OA 1KZFA 3IU1A 3P2FA 4JJXA 5HVGA 2ZENA 4YFJA 4JWPA 2D4PA 4OIWA 1AUGA 3CXPA 3HUVA 4NJQA 3D2MA 1P4NA 3B8GA 4R9MA 2X7BA 3PBBA 1YMEA 3PRTA 4MFLA 3I9SA 1M4LA 4AVCA 1VHSA 2Z3NA 3P2HA 4ONUA 4NEXA 2JDCA 4PPZA 3SXOA 1JQGA 2DEAA 5LYFA 4MHNA 1FT7A 4B5PA 2OH1A 2VQYA 2G0BA 2AFXA 2QYVA 2C6CA 1AYEA 1XF8A 4NGTA 4KOSA 2V77A 4AVBA 2DF5A 1XMTA 4KSAA 2Z11A 2OR4A 1CG2A 1VGYA 5D29A 1H8LA 4DUKA 1RTQA 2XEJA 1R3NA 3H8GA 1OBRA 4XNHC 4Y49C 5ELYA 3S6FA 4PSWA 3CPAA 2I3CA 4R76A 4A32A 3V38A 1OZPA 2GREA 2Q51A 1B6BA 2Q7SA 2PR1A 5AG4A 3KR5A 4YWYA 3S6GA 2FCKA 4F9VA 4HKFA 1KUXA 2ABZA 2JEVA 4ZBGA 1TKJA 1Y9WA 3S6HA 3RBUA 1LFWA 2EUIA 1IU8A 1XOVA 1F2PA 1Z8XA 4HPSA 4RS2A 1A2ZA 1PYTB 1XE4A 1IOIA 1MJAA 1RXTA 2OB0A 2ZW4A 3WC5A 4CYQA 2G3AA 4RUHA 2Q44A 4NGRA 4KORA 4KUBA 4NGNA 4U9ZA 4DNCA 5HMNA 2B5GB 1XJOA 4FD4A 3VARA 2PJCA 3D7FA 3FNCA 5FVJA 3TCVA 2F7VA 4MHZA 5H84A 4HNYB 1QSTA 4M3SA 4OC2A 1CP6A 3PFOA 2CNTA 1YVKA 3F5BA 4OC0A 4TNUA 4KZTA 4X2TA 3ZZIA 5C88A 1QSRA 1NSAA 4IAVA 1VIXA 4NJRA 4P4JA 2BO9A 4B14A 1CP7A 3WC6A 2AFZA 1ELMP 3C26A 2Q04A 3KGQA 4AG7A 2PIYA 1SQHA 4XNHB 5GCNA 1L0CA 3IWEA 6CPAA 3IWGA 1S7FA 2C1CA 2JEWA 2Z3KA 4KOXA 3D2PA 2R8VA 2H5MA 4O23A 3TOAA 4MJ8A 3CPXA 4A31A 4JXQA 4A95A 3KASA 2AE6A 4GM5A 4UEFA 2HB6A 1YW4A 4X8IA 3FF3A 1QQ9A 2JLMA 4R6TA 5CPAA 1TKHA 1HDUA 3TTHA 1MK4A 2RC4A 2J8MA 2VZZA 3FYNA 4H6UA 2GFQA 4X3RA 2Q7BA 1TXRA 3B2YA 1IGBA 2O4HA 5F49A 5AG7A 3PB6X 3PFEA 3RO0A 4AVAA 4K30A 2ZOFA 4NSQA 4UEEA 1HEEA 2Q43A 1TIQA 3B3WA 2J8RA 2XEFA 4CAXA 1Z4RA 2C6PA 3BHXA 1PUAA 2GE3A 4KOYA 5D8NA 4OLLA 5F48A 1Q2YA 1NMTA 2VBQA 2HC9A 3OWCA 4M85A 3NE8A 5F47A 2WZNA 4MY0A 3WT4A 2VL1A 2OZUA 2Z3OA 5AG6A 2BCOA 2P6GA 1VHEA 3IO1A 4RN7A 2CNSA 4H6ZA 1ARLA 4EMEA 1M1DA 3VATA 3G3SA 4KLVA 4OKOA 4P4IA 2ANPA 3D7HA 4UWJA 3QAYA 4F6AA 1Q2CA 2D4OA 3A9LA 2R7HA 3PEIA 1J4JA 5KTAA 4FUUA 3LODA 3GB0A 1XFOA 2PE3A 4P4EA 4IK2A 3FBUA 3GY9A 3VWDA 2CXAA 2ZEEA 2AJ6A 3DR6A 1XBUA 1NE9A 5A27A 4B5PB 2ZW5A 3QAHA 4JD6A 2HUZA 1M4GA 4WJBA 1CX8A 2P0WA 5EBVA 2AFUA 4K3NA 1DTDA 2DXQA 5DWMA 3KQZA 4G1PA 4L89A 5HVHA 3K2KA 4I49A 5LYLA 2HV2A 1S5KA 1Z8WA 1IYLA 2V8HA 3IWWA 3KKWA 5AG5A 4P4BA 3PB7X 1FNOA 3IGRA 3PB9X 4WWVA 3CXSA 3EXNA 1P0HA 1RO5A 3JUWA 4ZY0A 2VZYA 3T90A 4AG9A 1ZLIA 2WYRA 5IB0A 4P44A 2ZELA 5THWA 2I00A 1JWQA 4R3KA 3DGVA 1ELLP 3TT2A 1M4IA 2QIRA 1Y9KA 2ZEFA 2FS5A 4KOTA 4P10A 2PSWA 3H8FA 1LCPA 4B12A 3WC7A 5J8FA 1MJ9A 4C68A 3CXQA 7CPAA 2EWBA 2BSWA 2IMOA 2PRQA 2VEZA 4CAFA 1ARMA 3H5ZA 4CAVA 5IB9A 2Q4VA 3TFYA 4FBEA 4TWEA 3D7GA 2AFOA 3KHXA 1XRYA 3FH4A 3CDXA 1N71A 1YK3A 1Z2LA 2IQ6A 4MBUA 4H89A 2O53A 5DS0A 1S7NA 2FSRA 1BPMA 3WABA 5LRKA 4XPKA 4PV6A 1LOKA 4GS4A 1ON0A 2I79A 2B3UA 4UIBA 3RYOA 3FRMA 3PGPA 3KQXA 3W6SA 1S7LA 2GLFA 2AFSA 4OC4A 1BLLE 4M6IA 4MCQA 3DSBA 4QUSA 2FIAA 1KUYA 2PJ1A 2PJ2A 4MCPA 3SHPA 4CPAA 2QJ8A 4P45A 1Z8TA 5I4MA 2CF4A 4MY3A 4A39A 2FIWA 4A30A 4IUSA 3DDDA 2B3VA 2JBKA 4OIDA 4NGQA 4MFKA 2ZEMA 4W9YA 2K5TA 3R9GA 3TOBA 2P6FA 3B3SA 1YW6A 2ZPAA 3I3GA 4B6ZA 2GIVA 1YSJA 1YVOA 2ARHA 3IEHA 2PVWA 2BL1A 3F0AA 3SJFA 3TO6A 2BEIA 4F0XA 2OZGA 3FIXA 4F9UA 1IIDA 2F5IA 1TF8A 2HQYA 3BXMA 3MGDA 4KVOE 5EMIA 3NH4A 1M4DA 3LMSA 2AFWA 3T9YA 1WK4A 2Q0YA 4HNWB 5IV0A 3TO7A 5K8NA 3VWEA 4A38A 2QECA 4NFRA 2WPWA 3QNVA 4P4FA 1K4JA 4CS0B 3SXNA 4PQAA 2CNMA 3RNZA 3KR4A 3LWUA 3RZAA 3UY5A 2ATRA 3K9TA 2EK9A 1ZO0A 2YNDA 3S9MA 2DPSA 3IC1A 3MN8A 4CYNA 4E0AA 4R3LA 5J1QA 3QB8A 1S3ZA 5F09A 1U6MA 2ZEOA 1LAPA 3T8WA 3B3CA 4U5YA 4QVTA 4L8AA 5EC4A 1LRZA 4QB9A 3SI1A 2YNCA 2PJ7A 3FX6A 3HLPA 4NF1A 3CT9A 3GKRA 3JRUA 3VH9A 3S9NA 4KS9A 1AMPA 4PXCA 3TX8A 1IICA 5LRJA 4M6GA 5JGFA 2J8NA 3B3TA 4KOWA 2GANA 3B3VA 4XPLA 4KSIA 1Z4EA 1HDQA 2B4DA 2PRBA 4R57A 4ZY2A 4FAIA 2RB7A 3FEDA 2IL4A 4MCRA 4UIAA 3IJ3A 1QMUA 2DPTA 4CYOA 3KZWA 1Y7RA 4UCPA 5G1ZA 2Q4YA 2FVGA 3KI9A 4P6YA 2PJ4A 4YU9A 5G21A 3SI0A 4AXVA 3PB8X 4CGNA 4QBJA 5G20A 8CPAA 3PP9A 4MFJA 3SI2A 1CBXA 4JYWA 4MFPA 4MFQA 4DJLA 5E96A 2XEGA 4E2AA 3KHZA 1ZG8A 3KL9A 1XIXA 3NH8A 4KUAA 2EO8A 2P6EA 2B58A 1Y7EA 2C6GA 2PR8A 1GYTA 4KSFA 1YREA 5HH1A 4CYPA 5JQ4A 4OAEA 1Y0RA 2REFA 4PK3A 4F8ZA 4A33A 3BI0A 3I1UA 3LD2A 1LANA 3FXTA 4OP4A 2WUUA 3FMCA 1BOBA 2BUEA 4BINA 4UWIA 4EVYA 4C2YA 4CAWA 4YGOA 5HVFA 3L2NA 2R98A 2V8GA 3E0KA 3FVLA 4H2KA 2OOTA 4UA3A 4XPDC 4BMHA 3TE4A 4EWTA 1CJWA 2B4BA 3S9LA 2IJZA 2RFHA 1DE4C 4LUAA 4ONWA 4CAEA 3F8KA 5C82A 5K8MA 2PJ0A 2VXKA 3ISZA 3ISXA 4U9YA 4JLYA 1Z8LA 4UF4A 4B13A 3BJ8A 1YX0A 3H4QA 2CTBA 3GUXA 3JTKA 3PB4X 4OADA 2Z0ZA 1TF9A 4PK2A 4KVME 3V7ZA 3D7DA 2FE7A 4ZI6A 2NMTA 2QMLA 4PXBA 4KLWA 2ZW7A 3R9FA 2FL4A 5LRGA 2C27A 2GLJA 1TKFA 1UWYA 2FT0A 4R8FA 4C2ZA 3R1KA 4Q7AA 2PCUA 4Q36A 4IF5A 4MHPA 5KTCA 2PJAA 2J9AA 4MHYA 2YNCC 4UFVA 1XEBA 2O28A 3IIBA 1NSLA 4CGLA 1PU9A 3FJUA 3N7ZA 3FEEA 4UBRA 3W91A 1R43A 1I21A 4GXHA 4MFZA 1Q2DA 4ZY1A 2PIZA 1VKCA 4NCZA 4KVXA
chains in the Genus database with same CATH topology
2YNEA 1V0CA 1UFHA 1YR0A 4XPDB 1IYKA 1S7KA 2Z3LA 4LX9A 4KOVA 4ZGYB 5ISVA 2PC1A 5I0CA 1S60A 4ORFA 5A28A 4NXYA 3K9UA 3D8PA 2Z3MA 4CRZB 3D3SA 1R57A 5J8CA 1B87A 2ZXVA 4B11A 3DNSA 3EC4A 5KTDA 4C7HA 4PSXA 1BO4A 3R96A 3G8WA 4CGPA 4UFXA 4B10A 4J3GA 3V8IA 2B5GA 4FD7A 2PDOA 2JDDA 3GYAA 3WR7A 2B4DB 4Y49B 2VI7A 1QSOA 2KCWA 1Z9UA 4F0YA 5IX3A 2CY2A 5CNPA 1QSMA 1MJBA 1FY7A 1I12A 1I1DA 2YGWA 2OU2A 2Z10A 4II9A 2Y0MA 4HNXB 4CRYB 4MHDA 3DR8A 1IB1E 4MI4A 4B5OA 3FB3A 3JVNA 1QSNA 3R95A 3BJ7A 3S6KA 4E8OA 4AB7A 2R1IA 1YGHA 1GHEA 4JXRA 5H86A 4YRHA 3EY5A 4QC6A 2REEA 4X5KA 2FXFA 5BWAB 4R87A 5G22A 1WWZA 1YLEA 1KUVA 2EVNA 3NE7A 3ZJ0A 4FD6A 4BBHA 2A4NA 5AGEA 4KOUA 3R9EA 3IU2A 5F46A 2WPXA 4CGOA 5JPHA 2WSAA 4UCNA 2PQ8A 3TO9A 4FD5A 2G3TA 4UCMA 3EO4A 5DWNA 3W6XA 4C7IA 4CGMA 4RI1A 1M44A 3PZJA 3BLNA 4UFWA 4C2XA 2OZHA 3EFAA 4Q38A 2Z3PA 2ZW6A 1CM0A 1KZFA 3IU1A 3P2FA 4JJXA 4YFJA 4JWPA 2D4PA 3CXPA 3D2MA 1P4NA 3B8GA 4R9MA 2X7BA 4MFLA 3I9SA 4AVCA 1VHSA 2Z3NA 3P2HA 4ONUA 4NEXA 2JDCA 3SXOA 4B5PA 2OH1A 2VQYA 2G0BA 1XF8A 4KOSA 4AVBA 1XMTA 4KSAA 2Z11A 4XNHC 4Y49C 3S6FA 4PSWA 4A32A 1OZPA 1B6BA 2PR1A 5AG4A 3S6GA 2FCKA 4HKFA 1KUXA 2JEVA 4ZBGA 1Y9WA 3S6HA 2EUIA 4RS2A 2OB0A 1XE4A 1MJAA 1RXTA 2ZW4A 4CYQA 2G3AA 2Q44A 4DNCA 4KORA 4KUBA 4U9ZA 5HMNA 2B5GB 4FD4A 3FNCA 5FVJA 3TCVA 5H84A 4HNYB 1QSTA 4M3SA 2CNTA 1YVKA 3F5BA 3ZZIA 4KZTA 5C88A 1QSRA 4B14A 3C26A 2Q04A 4AG7A 1SQHA 4XNHB 5GCNA 1L0CA 3IWEA 3IWGA 1S7FA 2Z3KA 4KOXA 3D2PA 2R8VA 2H5MA 3TOAA 4MJ8A 4A31A 4JXQA 4A95A 2AE6A 2JLMA 3TTHA 1MK4A 2RC4A 2J8MA 2VZZA 3FYNA 4H6UA 2Q7BA 5F49A 5AG7A 4AVAA 4K30A 4NSQA 1TIQA 2J8RA 4CAXA 1Z4RA 4KOYA 1PUAA 2GE3A 4OLLA 5F48A 1Q2YA 1NMTA 2VBQA 3OWCA 4M85A 5F47A 4MY0A 2Z3OA 2OZUA 5AG6A 2P6GA 2CNSA 4H6ZA 1M1DA 3G3SA 4KLVA 4UWJA 4F6AA 1Q2CA 2D4OA 3A9LA 2R7HA 1J4JA 5KTAA 3LODA 3FBUA 3GY9A 3VWDA 2CXAA 2AJ6A 3DR6A 1NE9A 5A27A 4B5PB 2ZW5A 3QAHA 4JD6A 2HUZA 1M4GA 2P0WA 5EBVA 2DXQA 5DWMA 4L89A 4I49A 2HV2A 1S5KA 1IYLA 3KKWA 5AG5A 3IGRA 3CXSA 3EXNA 1P0HA 1RO5A 3JUWA 2VZYA 3T90A 4AG9A 5IB0A 2I00A 3TT2A 4R3KA 1M4IA 2QIRA 1Y9KA 4KOTA 2FS5A 2PSWA 4B12A 5J8FA 1MJ9A 4C68A 3CXQA 4CAFA 2BSWA 2VEZA 3H5ZA 4CAVA 2Q4VA 3TFYA 4MBUA 1N71A 1YK3A 4H89A 1S7NA 2FSRA 4XPKA 4PV6A 4GS4A 1ON0A 2I79A 2B3UA 3W6SA 3RYOA 3FRMA 3PGPA 1S7LA 3DSBA 4QUSA 2FIAA 1KUYA 3SHPA 4MY3A 2FIWA 4A30A 4IUSA 3DDDA 2B3VA 4MFKA 2K5TA 3R9GA 3TOBA 2P6FA 2ZPAA 3I3GA 2GIVA 2ARHA 1YVOA 3TO6A 4A2ZA 2BL1A 3F0AA 4F0XA 2BEIA 2OZGA 3FIXA 1IIDA 2F5IA 2HQYA 3MGDA 4KVOE 1M4DA 5IV0A 3T9YA 1WK4A 2Q0YA 4HNWB 3TO7A 3VWEA 2QECA 2WPWA 1K4JA 4CS0B 3SXNA 2CNMA 3UY5A 2ATRA 1ZO0A 2YNDA 2DPSA 4CYNA 4E0AA 4R3LA 3QB8A 1S3ZA 1U6MA 4U5YA 4QVTA 4L8AA 5EC4A 1LRZA 4QB9A 2YNCA 4NF1A 3GKRA 4KS9A 1IICA 2J8NA 4KOWA 4XPLA 2GANA 1Z4EA 2B4DA 2PRBA 4R57A 2IL4A 2DPTA 4CYOA 1Y7RA 4UCPA 5G1ZA 2Q4YA 5G21A 4QBJA 4CGNA 5G20A 3PP9A 4MFJA 4MFPA 4MFQA 5E96A 4E2AA 1XIXA 4KUAA 2P6EA 2B58A 5JQ4A 4KSFA 2PR8A 5HH1A 1YREA 4CYPA 4OAEA 2REFA 4PK3A 4A33A 3LD2A 3FXTA 2WUUA 1BOBA 2BUEA 4EVYA 4UWIA 4C2YA 4CAWA 4YGOA 2R98A 3E0KA 4UA3A 4XPDC 4BMHA 3TE4A 1CJWA 2B4BA 4LUAA 4CAEA 3F8KA 5C82A 2VXKA 4U9YA 4JLYA 4B13A 3BJ8A 1YX0A 3H4QA 3JTKA 4OADA 2Z0ZA 4PK2A 4KVME 2FE7A 2NMTA 2QMLA 4KLWA 2ZW7A 3R9FA 2FL4A 2C27A 2FT0A 4C2ZA 3R1KA 4Q36A 4IF5A 5KTCA 4UFVA 2YNCC 1XEBA 2O28A 1NSLA 4CGLA 1PU9A 3N7ZA 3W91A 4UBRA 1I21A 4MFZA 1Q2DA 1VKCA 4NCZA 4KVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFP A;  4Q36 A;  4MFQ A;  4MFL A;  4Q38 A;  4MFZ A;  4MFJ A;  4MFK A; 
#chains in the Genus database with same CATH topology
 2YNE A;  3D4U A;  1V0C A;  1UFH A;  1X12 A;  3MRU A;  1YQE A;  4MCS A;  1YR0 A;  4XPD B;  1IYK A;  1S7K A;  2Z3L A;  3CZX A;  4LX9 A;  4BD9 A;  3PBE A;  3D67 A;  4KOV A;  4ZGY B;  1ZLH A;  5ISV A;  2PC1 A;  3BI1 A;  5I0C A;  1S60 A;  3B7I A;  4ORF A;  4NXY A;  2ZED A;  5A28 A;  3K9U A;  3D8P A;  2Z3M A;  4OC3 A;  3LAC A;  2POK A;  4NGS A;  1X10 A;  4ZX9 A;  4CRZ B;  3D3S A;  1LAM A;  5CBM A;  1CPS A;  1PCA A;  1R57 A;  5J8C A;  1IOF A;  1B87 A;  1BAV A;  1Y0Y A;  2ZXV A;  3IFE A;  3SJG A;  4B11 A;  3DNS A;  2NSM A;  4P4D A;  1YLO A;  2G9D A;  2ZEH A;  4OC5 A;  3EC4 A;  5KTD A;  4NGP A;  2PJ3 A;  4C7H A;  4PSX A;  4JZ0 A;  3GLJ A;  1BO4 A;  4EFD A;  3R96 A;  3G8W A;  1ZG7 A;  4CGP A;  3B35 A;  3SJE A;  4UFX A;  5LYI A;  4LQG A;  4B10 A;  4J3G A;  3V8I A;  2B5G A;  2JBJ A;  2PJ8 A;  2PDO A;  2JDD A;  4FD7 A;  3GYA A;  3N5F A;  3WR7 A;  2PJ6 A;  5K8P A;  2GU2 A;  3NA6 A;  3D66 A;  2B4D B;  4A94 A;  4Y49 B;  2VI7 A;  1F2O A;  1QSO A;  2KCW A;  1EE3 P;  3NFZ A;  4OME A;  3DLJ A;  1Z9U A;  4ZX8 A;  2ZEG A;  4F0Y A;  5IX3 A;  2CY2 A;  1Q7L A;  4IHM A;  5CNP A;  1QSM A;  1MJB A;  1FY7 A;  2ODF A;  5HXD A;  4A2Z A;  1I1D A;  1I12 A;  2YGW A;  2OU2 A;  2Z10 A;  4II9 A;  2Y0M A;  4HNX B;  4CRY B;  3H8E A;  4PXD A;  2ZEP A;  4MHD A;  2NYQ A;  1IB1 E;  3DR8 A;  4MI4 A;  4B5O A;  2EBJ A;  3D68 A;  3FB3 A;  1QSN A;  3JVN A;  3BJ7 A;  3R95 A;  3S6K A;  4OC1 A;  4E8O A;  4AB7 A;  2R1I A;  2PJ5 A;  4ZYQ A;  2CIJ A;  2EK8 A;  1YGH A;  1GHE A;  3FEC A;  4JXR A;  4Z65 A;  5H86 A;  4YRH A;  3EY5 A;  2V8D A;  4QC6 A;  2REE A;  4X5K A;  1F57 A;  2FXF A;  4MXU A;  5BWA B;  4R87 A;  4PXE A;  4NGM A;  5G22 A;  4MMO A;  2ZOG A;  4FWU A;  1WWZ A;  2F8H A;  1YLE A;  1KUV A;  2EVN A;  4DYO A;  3NE7 A;  1CPX A;  3ZJ0 A;  4FD6 A;  4BBH A;  2A4N A;  4UEZ A;  5AGE A;  2PVV A;  4KOU A;  3R9E A;  1XMB A;  3IU2 A;  2V8V A;  2BOA A;  2PJ9 A;  5F46 A;  2XEI A;  2WPX A;  4CGO A;  5JPH A;  1VHO A;  2WSA A;  5JH9 A;  4UCN A;  2CTC A;  2AFM A;  2PQ8 A;  3TO9 A;  4FD5 A;  2G3T A;  5JM6 A;  2Q4Z A;  4UCM A;  2PJB A;  3EO4 A;  5DWN A;  3W6X A;  4A37 A;  4C7I A;  4CGM A;  4RI1 A;  4R7M A;  1ZG9 A;  1BPN A;  1M44 A;  3PZJ A;  3TC8 A;  3BLN A;  4UFW A;  3NH5 A;  4C2X A;  3SJX A;  1KWM A;  1IY7 A;  2OZH A;  3GIU A;  3EFA A;  4Q38 A;  3RAM A;  2QVP A;  4MRI A;  5LYD A;  4M6H A;  2Z3P A;  2ZW6 A;  1CM0 A;  1Z5R A;  4LQ6 A;  5K8O A;  1KZF A;  3IU1 A;  3P2F A;  4JJX A;  5HVG A;  2ZEN A;  4YFJ A;  4JWP A;  2D4P A;  4OIW A;  1AUG A;  3CXP A;  3HUV A;  4NJQ A;  3D2M A;  1P4N A;  3B8G A;  4R9M A;  2X7B A;  3PBB A;  1YME A;  3PRT A;  4MFL A;  3I9S A;  1M4L A;  4AVC A;  1VHS A;  2Z3N A;  3P2H A;  4ONU A;  4NEX A;  2JDC A;  4PPZ A;  3SXO A;  1JQG A;  2DEA A;  5LYF A;  4MHN A;  1FT7 A;  4B5P A;  2OH1 A;  2VQY A;  2G0B A;  2AFX A;  2QYV A;  2C6C A;  1AYE A;  1XF8 A;  4NGT A;  4KOS A;  2V77 A;  4AVB A;  2DF5 A;  1XMT A;  4KSA A;  2Z11 A;  2OR4 A;  1CG2 A;  1VGY A;  5D29 A;  1H8L A;  4DUK A;  1RTQ A;  2XEJ A;  1R3N A;  3H8G A;  1OBR A;  4XNH C;  4Y49 C;  5ELY A;  3S6F A;  4PSW A;  3CPA A;  2I3C A;  4R76 A;  4A32 A;  3V38 A;  1OZP A;  2GRE A;  2Q51 A;  1B6B A;  2Q7S A;  2PR1 A;  5AG4 A;  3KR5 A;  4YWY A;  3S6G A;  2FCK A;  4F9V A;  4HKF A;  1KUX A;  2ABZ A;  2JEV A;  4ZBG A;  1TKJ A;  1Y9W A;  3S6H A;  3RBU A;  1LFW A;  2EUI A;  1IU8 A;  1XOV A;  1F2P A;  1Z8X A;  4HPS A;  4RS2 A;  1A2Z A;  1PYT B;  1XE4 A;  1IOI A;  1MJA A;  1RXT A;  2OB0 A;  2ZW4 A;  3WC5 A;  4CYQ A;  2G3A A;  4RUH A;  2Q44 A;  4NGR A;  4KOR A;  4KUB A;  4NGN A;  4U9Z A;  4DNC A;  5HMN A;  2B5G B;  1XJO A;  4FD4 A;  3VAR A;  2PJC A;  3D7F A;  3FNC A;  5FVJ A;  3TCV A;  2F7V A;  4MHZ A;  5H84 A;  4HNY B;  1QST A;  4M3S A;  4OC2 A;  1CP6 A;  3PFO A;  2CNT A;  1YVK A;  3F5B A;  4OC0 A;  4TNU A;  4KZT A;  4X2T A;  3ZZI A;  5C88 A;  1QSR A;  1NSA A;  4IAV A;  1VIX A;  4NJR A;  4P4J A;  2BO9 A;  4B14 A;  1CP7 A;  3WC6 A;  2AFZ A;  1ELM P;  3C26 A;  2Q04 A;  3KGQ A;  4AG7 A;  2PIY A;  1SQH A;  4XNH B;  5GCN A;  1L0C A;  3IWE A;  6CPA A;  3IWG A;  1S7F A;  2C1C A;  2JEW A;  2Z3K A;  4KOX A;  3D2P A;  2R8V A;  2H5M A;  4O23 A;  3TOA A;  4MJ8 A;  3CPX A;  4A31 A;  4JXQ A;  4A95 A;  3KAS A;  2AE6 A;  4GM5 A;  4UEF A;  2HB6 A;  1YW4 A;  4X8I A;  3FF3 A;  1QQ9 A;  2JLM A;  4R6T A;  5CPA A;  1TKH A;  1HDU A;  3TTH A;  1MK4 A;  2RC4 A;  2J8M A;  2VZZ A;  3FYN A;  4H6U A;  2GFQ A;  4X3R A;  2Q7B A;  1TXR A;  3B2Y A;  1IGB A;  2O4H A;  5F49 A;  5AG7 A;  3PB6 X;  3PFE A;  3RO0 A;  4AVA A;  4K30 A;  2ZOF A;  4NSQ A;  4UEE A;  1HEE A;  2Q43 A;  1TIQ A;  3B3W A;  2J8R A;  2XEF A;  4CAX A;  1Z4R A;  2C6P A;  3BHX A;  1PUA A;  2GE3 A;  4KOY A;  5D8N A;  4OLL A;  5F48 A;  1Q2Y A;  1NMT A;  2VBQ A;  2HC9 A;  3OWC A;  4M85 A;  3NE8 A;  5F47 A;  2WZN A;  4MY0 A;  3WT4 A;  2VL1 A;  2OZU A;  2Z3O A;  5AG6 A;  2BCO A;  2P6G A;  1VHE A;  3IO1 A;  4RN7 A;  2CNS A;  4H6Z A;  1ARL A;  4EME A;  1M1D A;  3VAT A;  3G3S A;  4KLV A;  4OKO A;  4P4I A;  2ANP A;  3D7H A;  4UWJ A;  3QAY A;  4F6A A;  1Q2C A;  2D4O A;  3A9L A;  2R7H A;  3PEI A;  1J4J A;  5KTA A;  4FUU A;  3LOD A;  3GB0 A;  1XFO A;  2PE3 A;  4P4E A;  4IK2 A;  3FBU A;  3GY9 A;  3VWD A;  2CXA A;  2ZEE A;  2AJ6 A;  3DR6 A;  1XBU A;  1NE9 A;  5A27 A;  4B5P B;  2ZW5 A;  3QAH A;  4JD6 A;  2HUZ A;  1M4G A;  4WJB A;  1CX8 A;  2P0W A;  5EBV A;  2AFU A;  4K3N A;  1DTD A;  2DXQ A;  5DWM A;  3KQZ A;  4G1P A;  4L89 A;  5HVH A;  3K2K A;  4I49 A;  5LYL A;  2HV2 A;  1S5K A;  1Z8W A;  1IYL A;  2V8H A;  3IWW A;  3KKW A;  5AG5 A;  4P4B A;  3PB7 X;  1FNO A;  3IGR A;  3PB9 X;  4WWV A;  3CXS A;  3EXN A;  1P0H A;  1RO5 A;  3JUW A;  4ZY0 A;  2VZY A;  3T90 A;  4AG9 A;  1ZLI A;  2WYR A;  5IB0 A;  4P44 A;  2ZEL A;  5THW A;  2I00 A;  1JWQ A;  4R3K A;  3DGV A;  1ELL P;  3TT2 A;  1M4I A;  2QIR A;  1Y9K A;  2ZEF A;  2FS5 A;  4KOT A;  4P10 A;  2PSW A;  3H8F A;  1LCP A;  4B12 A;  3WC7 A;  5J8F A;  1MJ9 A;  4C68 A;  3CXQ A;  7CPA A;  2EWB A;  2BSW A;  2IMO A;  2PRQ A;  2VEZ A;  4CAF A;  1ARM A;  3H5Z A;  4CAV A;  5IB9 A;  2Q4V A;  3TFY A;  4FBE A;  4TWE A;  3D7G A;  2AFO A;  3KHX A;  1XRY A;  3FH4 A;  3CDX A;  1N71 A;  1YK3 A;  1Z2L A;  2IQ6 A;  4MBU A;  4H89 A;  2O53 A;  5DS0 A;  1S7N A;  2FSR A;  1BPM A;  3WAB A;  5LRK A;  4XPK A;  4PV6 A;  1LOK A;  4GS4 A;  1ON0 A;  2I79 A;  2B3U A;  4UIB A;  3RYO A;  3FRM A;  3PGP A;  3KQX A;  3W6S A;  1S7L A;  2GLF A;  2AFS A;  4OC4 A;  1BLL E;  4M6I A;  4MCQ A;  3DSB A;  4QUS A;  2FIA A;  1KUY A;  2PJ1 A;  2PJ2 A;  4MCP A;  3SHP A;  4CPA A;  2QJ8 A;  4P45 A;  1Z8T A;  5I4M A;  2CF4 A;  4MY3 A;  4A39 A;  2FIW A;  4A30 A;  4IUS A;  3DDD A;  2B3V A;  2JBK A;  4OID A;  4NGQ A;  4MFK A;  2ZEM A;  4W9Y A;  2K5T A;  3R9G A;  3TOB A;  2P6F A;  3B3S A;  1YW6 A;  2ZPA A;  3I3G A;  4B6Z A;  2GIV A;  1YSJ A;  1YVO A;  2ARH A;  3IEH A;  2PVW A;  2BL1 A;  3F0A A;  3SJF A;  3TO6 A;  2BEI A;  4F0X A;  2OZG A;  3FIX A;  4F9U A;  1IID A;  2F5I A;  1TF8 A;  2HQY A;  3BXM A;  3MGD A;  4KVO E;  5EMI A;  3NH4 A;  1M4D A;  3LMS A;  2AFW A;  3T9Y A;  1WK4 A;  2Q0Y A;  4HNW B;  5IV0 A;  3TO7 A;  5K8N A;  3VWE A;  4A38 A;  2QEC A;  4NFR A;  2WPW A;  3QNV A;  4P4F A;  1K4J A;  4CS0 B;  3SXN A;  4PQA A;  2CNM A;  3RNZ A;  3KR4 A;  3LWU A;  3RZA A;  3UY5 A;  2ATR A;  3K9T A;  2EK9 A;  1ZO0 A;  2YND A;  3S9M A;  2DPS A;  3IC1 A;  3MN8 A;  4CYN A;  4E0A A;  4R3L A;  5J1Q A;  3QB8 A;  1S3Z A;  5F09 A;  1U6M A;  2ZEO A;  1LAP A;  3T8W A;  3B3C A;  4U5Y A;  4QVT A;  4L8A A;  5EC4 A;  1LRZ A;  4QB9 A;  3SI1 A;  2YNC A;  2PJ7 A;  3FX6 A;  3HLP A;  4NF1 A;  3CT9 A;  3GKR A;  3JRU A;  3VH9 A;  3S9N A;  4KS9 A;  1AMP A;  4PXC A;  3TX8 A;  1IIC A;  5LRJ A;  4M6G A;  5JGF A;  2J8N A;  3B3T A;  4KOW A;  2GAN A;  3B3V A;  4XPL A;  4KSI A;  1Z4E A;  1HDQ A;  2B4D A;  2PRB A;  4R57 A;  4ZY2 A;  4FAI A;  2RB7 A;  3FED A;  2IL4 A;  4MCR A;  4UIA A;  3IJ3 A;  1QMU A;  2DPT A;  4CYO A;  3KZW A;  1Y7R A;  4UCP A;  5G1Z A;  2Q4Y A;  2FVG A;  3KI9 A;  4P6Y A;  2PJ4 A;  4YU9 A;  5G21 A;  3SI0 A;  4AXV A;  3PB8 X;  4CGN A;  4QBJ A;  5G20 A;  8CPA A;  3PP9 A;  4MFJ A;  3SI2 A;  1CBX A;  4JYW A;  4MFP A;  4MFQ A;  4DJL A;  5E96 A;  2XEG A;  4E2A A;  3KHZ A;  1ZG8 A;  3KL9 A;  1XIX A;  3NH8 A;  4KUA A;  2EO8 A;  2P6E A;  2B58 A;  1Y7E A;  2C6G A;  2PR8 A;  1GYT A;  4KSF A;  1YRE A;  5HH1 A;  4CYP A;  5JQ4 A;  4OAE A;  1Y0R A;  2REF A;  4PK3 A;  4F8Z A;  4A33 A;  3BI0 A;  3I1U A;  3LD2 A;  1LAN A;  3FXT A;  4OP4 A;  2WUU A;  3FMC A;  1BOB A;  2BUE A;  4BIN A;  4UWI A;  4EVY A;  4C2Y A;  4CAW A;  4YGO A;  5HVF A;  3L2N A;  2R98 A;  2V8G A;  3E0K A;  3FVL A;  4H2K A;  2OOT A;  4UA3 A;  4XPD C;  4BMH A;  3TE4 A;  4EWT A;  1CJW A;  2B4B A;  3S9L A;  2IJZ A;  2RFH A;  1DE4 C;  4LUA A;  4ONW A;  4CAE A;  3F8K A;  5C82 A;  5K8M A;  2PJ0 A;  2VXK A;  3ISZ A;  3ISX A;  4U9Y A;  4JLY A;  1Z8L A;  4UF4 A;  4B13 A;  3BJ8 A;  1YX0 A;  3H4Q A;  2CTB A;  3GUX A;  3JTK A;  3PB4 X;  4OAD A;  2Z0Z A;  1TF9 A;  4PK2 A;  4KVM E;  3V7Z A;  3D7D A;  2FE7 A;  4ZI6 A;  2NMT A;  2QML A;  4PXB A;  4KLW A;  2ZW7 A;  3R9F A;  2FL4 A;  5LRG A;  2C27 A;  2GLJ A;  1TKF A;  1UWY A;  2FT0 A;  4R8F A;  4C2Z A;  3R1K A;  4Q7A A;  2PCU A;  4Q36 A;  4IF5 A;  4MHP A;  5KTC A;  2PJA A;  2J9A A;  4MHY A;  2YNC C;  4UFV A;  1XEB A;  2O28 A;  3IIB A;  1NSL A;  4CGL A;  1PU9 A;  3FJU A;  3N7Z A;  3FEE A;  4UBR A;  3W91 A;  1R43 A;  1I21 A;  4GXH A;  4MFZ A;  1Q2D A;  4ZY1 A;  2PIZ A;  1VKC A;  4NCZ A;  4KVX A; 
#chains in the Genus database with same CATH homology
 2YNE A;  1V0C A;  1UFH A;  1YR0 A;  4XPD B;  1IYK A;  1S7K A;  2Z3L A;  4LX9 A;  4KOV A;  4ZGY B;  5ISV A;  2PC1 A;  5I0C A;  1S60 A;  4ORF A;  5A28 A;  4NXY A;  3K9U A;  3D8P A;  2Z3M A;  4CRZ B;  3D3S A;  1R57 A;  5J8C A;  1B87 A;  2ZXV A;  4B11 A;  3DNS A;  3EC4 A;  5KTD A;  4C7H A;  4PSX A;  1BO4 A;  3R96 A;  3G8W A;  4CGP A;  4UFX A;  4B10 A;  4J3G A;  3V8I A;  2B5G A;  4FD7 A;  2PDO A;  2JDD A;  3GYA A;  3WR7 A;  2B4D B;  4Y49 B;  2VI7 A;  1QSO A;  2KCW A;  1Z9U A;  4F0Y A;  5IX3 A;  2CY2 A;  5CNP A;  1QSM A;  1MJB A;  1FY7 A;  1I12 A;  1I1D A;  2YGW A;  2OU2 A;  2Z10 A;  4II9 A;  2Y0M A;  4HNX B;  4CRY B;  4MHD A;  3DR8 A;  1IB1 E;  4MI4 A;  4B5O A;  3FB3 A;  3JVN A;  1QSN A;  3R95 A;  3BJ7 A;  3S6K A;  4E8O A;  4AB7 A;  2R1I A;  1YGH A;  1GHE A;  4JXR A;  5H86 A;  4YRH A;  3EY5 A;  4QC6 A;  2REE A;  4X5K A;  2FXF A;  5BWA B;  4R87 A;  5G22 A;  1WWZ A;  1YLE A;  1KUV A;  2EVN A;  3NE7 A;  3ZJ0 A;  4FD6 A;  4BBH A;  2A4N A;  5AGE A;  4KOU A;  3R9E A;  3IU2 A;  5F46 A;  2WPX A;  4CGO A;  5JPH A;  2WSA A;  4UCN A;  2PQ8 A;  3TO9 A;  4FD5 A;  2G3T A;  4UCM A;  3EO4 A;  5DWN A;  3W6X A;  4C7I A;  4CGM A;  4RI1 A;  1M44 A;  3PZJ A;  3BLN A;  4UFW A;  4C2X A;  2OZH A;  3EFA A;  4Q38 A;  2Z3P A;  2ZW6 A;  1CM0 A;  1KZF A;  3IU1 A;  3P2F A;  4JJX A;  4YFJ A;  4JWP A;  2D4P A;  3CXP A;  3D2M A;  1P4N A;  3B8G A;  4R9M A;  2X7B A;  4MFL A;  3I9S A;  4AVC A;  1VHS A;  2Z3N A;  3P2H A;  4ONU A;  4NEX A;  2JDC A;  3SXO A;  4B5P A;  2OH1 A;  2VQY A;  2G0B A;  1XF8 A;  4KOS A;  4AVB A;  1XMT A;  4KSA A;  2Z11 A;  4XNH C;  4Y49 C;  3S6F A;  4PSW A;  4A32 A;  1OZP A;  1B6B A;  2PR1 A;  5AG4 A;  3S6G A;  2FCK A;  4HKF A;  1KUX A;  2JEV A;  4ZBG A;  1Y9W A;  3S6H A;  2EUI A;  4RS2 A;  2OB0 A;  1XE4 A;  1MJA A;  1RXT A;  2ZW4 A;  4CYQ A;  2G3A A;  2Q44 A;  4DNC A;  4KOR A;  4KUB A;  4U9Z A;  5HMN A;  2B5G B;  4FD4 A;  3FNC A;  5FVJ A;  3TCV A;  5H84 A;  4HNY B;  1QST A;  4M3S A;  2CNT A;  1YVK A;  3F5B A;  3ZZI A;  4KZT A;  5C88 A;  1QSR A;  4B14 A;  3C26 A;  2Q04 A;  4AG7 A;  1SQH A;  4XNH B;  5GCN A;  1L0C A;  3IWE A;  3IWG A;  1S7F A;  2Z3K A;  4KOX A;  3D2P A;  2R8V A;  2H5M A;  3TOA A;  4MJ8 A;  4A31 A;  4JXQ A;  4A95 A;  2AE6 A;  2JLM A;  3TTH A;  1MK4 A;  2RC4 A;  2J8M A;  2VZZ A;  3FYN A;  4H6U A;  2Q7B A;  5F49 A;  5AG7 A;  4AVA A;  4K30 A;  4NSQ A;  1TIQ A;  2J8R A;  4CAX A;  1Z4R A;  4KOY A;  1PUA A;  2GE3 A;  4OLL A;  5F48 A;  1Q2Y A;  1NMT A;  2VBQ A;  3OWC A;  4M85 A;  5F47 A;  4MY0 A;  2Z3O A;  2OZU A;  5AG6 A;  2P6G A;  2CNS A;  4H6Z A;  1M1D A;  3G3S A;  4KLV A;  4UWJ A;  4F6A A;  1Q2C A;  2D4O A;  3A9L A;  2R7H A;  1J4J A;  5KTA A;  3LOD A;  3FBU A;  3GY9 A;  3VWD A;  2CXA A;  2AJ6 A;  3DR6 A;  1NE9 A;  5A27 A;  4B5P B;  2ZW5 A;  3QAH A;  4JD6 A;  2HUZ A;  1M4G A;  2P0W A;  5EBV A;  2DXQ A;  5DWM A;  4L89 A;  4I49 A;  2HV2 A;  1S5K A;  1IYL A;  3KKW A;  5AG5 A;  3IGR A;  3CXS A;  3EXN A;  1P0H A;  1RO5 A;  3JUW A;  2VZY A;  3T90 A;  4AG9 A;  5IB0 A;  2I00 A;  3TT2 A;  4R3K A;  1M4I A;  2QIR A;  1Y9K A;  4KOT A;  2FS5 A;  2PSW A;  4B12 A;  5J8F A;  1MJ9 A;  4C68 A;  3CXQ A;  4CAF A;  2BSW A;  2VEZ A;  3H5Z A;  4CAV A;  2Q4V A;  3TFY A;  4MBU A;  1N71 A;  1YK3 A;  4H89 A;  1S7N A;  2FSR A;  4XPK A;  4PV6 A;  4GS4 A;  1ON0 A;  2I79 A;  2B3U A;  3W6S A;  3RYO A;  3FRM A;  3PGP A;  1S7L A;  3DSB A;  4QUS A;  2FIA A;  1KUY A;  3SHP A;  4MY3 A;  2FIW A;  4A30 A;  4IUS A;  3DDD A;  2B3V A;  4MFK A;  2K5T A;  3R9G A;  3TOB A;  2P6F A;  2ZPA A;  3I3G A;  2GIV A;  2ARH A;  1YVO A;  3TO6 A;  4A2Z A;  2BL1 A;  3F0A A;  4F0X A;  2BEI A;  2OZG A;  3FIX A;  1IID A;  2F5I A;  2HQY A;  3MGD A;  4KVO E;  1M4D A;  5IV0 A;  3T9Y A;  1WK4 A;  2Q0Y A;  4HNW B;  3TO7 A;  3VWE A;  2QEC A;  2WPW A;  1K4J A;  4CS0 B;  3SXN A;  2CNM A;  3UY5 A;  2ATR A;  1ZO0 A;  2YND A;  2DPS A;  4CYN A;  4E0A A;  4R3L A;  3QB8 A;  1S3Z A;  1U6M A;  4U5Y A;  4QVT A;  4L8A A;  5EC4 A;  1LRZ A;  4QB9 A;  2YNC A;  4NF1 A;  3GKR A;  4KS9 A;  1IIC A;  2J8N A;  4KOW A;  4XPL A;  2GAN A;  1Z4E A;  2B4D A;  2PRB A;  4R57 A;  2IL4 A;  2DPT A;  4CYO A;  1Y7R A;  4UCP A;  5G1Z A;  2Q4Y A;  5G21 A;  4QBJ A;  4CGN A;  5G20 A;  3PP9 A;  4MFJ A;  4MFP A;  4MFQ A;  5E96 A;  4E2A A;  1XIX A;  4KUA A;  2P6E A;  2B58 A;  5JQ4 A;  4KSF A;  2PR8 A;  5HH1 A;  1YRE A;  4CYP A;  4OAE A;  2REF A;  4PK3 A;  4A33 A;  3LD2 A;  3FXT A;  2WUU A;  1BOB A;  2BUE A;  4EVY A;  4UWI A;  4C2Y A;  4CAW A;  4YGO A;  2R98 A;  3E0K A;  4UA3 A;  4XPD C;  4BMH A;  3TE4 A;  1CJW A;  2B4B A;  4LUA A;  4CAE A;  3F8K A;  5C82 A;  2VXK A;  4U9Y A;  4JLY A;  4B13 A;  3BJ8 A;  1YX0 A;  3H4Q A;  3JTK A;  4OAD A;  2Z0Z A;  4PK2 A;  4KVM E;  2FE7 A;  2NMT A;  2QML A;  4KLW A;  2ZW7 A;  3R9F A;  2FL4 A;  2C27 A;  2FT0 A;  4C2Z A;  3R1K A;  4Q36 A;  4IF5 A;  5KTC A;  4UFV A;  2YNC C;  1XEB A;  2O28 A;  1NSL A;  4CGL A;  1PU9 A;  3N7Z A;  3W91 A;  4UBR A;  1I21 A;  4MFZ A;  1Q2D A;  1VKC A;  4NCZ A;  4KVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...