4MFPA

The crystal structure of acyltransferase in complex with decanoyl-coa and tei pseudoaglycone
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
323
structure length
323
Chain Sequence
MDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLAVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein tcp24
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Transferase/antibiotic
total genus 110
structure length 323
sequence length 323
ec nomenclature ec 2.3.1.-:
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mfpA02
4MFLA 4Q38A 4Q36A 4MFQA 4MFZA 4MFPA 4MFJA 4MFKA
chains in the Genus database with same CATH superfamily
4C2ZA 1OZPA 2OH1A 2OZGA 4TWEA 3NH5A 4X8IA 2WZNA 4NGPA 5G20A 4B14A 5HXDA 3H8FA 2V77A 4YGOA 4MCSA 4CGMA 5J8CA 1CP7A 4K30A 3K2KA 4GS4A 2ZOGA 2PR1A 4A38A 3B3TA 1VKCA 1H8LA 2J8RA 2Q43A 2JEWA 5EMIA 4B13A 2BCOA 1DTDA 2OZHA 4MFZA 4OC4A 4UBRA 3H8GA 3QNVA 1P0HA 2I3CA 3GYAA 1PUAA 2A4NA 5THWA 1VIXA 3ISXA 1VGYA 3UY5A 2XEJA 1ARLA 4P4JA 4B11A 3SJEA 3LACA 1XOVA 1QSTA 2ZXVA 5LYDA 2P0WA 5JGFA 3R95A 3IJ3A 4XPDB 3KR4A 2PJ2A 3FMCA 4CAEA 5IX3A 5LRKA 4II9A 3BLNA 4AVCA 2C6GA 5JM6A 4OLLA 1NSLA 2OB0A 2VZYA 2JBJA 5DWMA 2V8GA 2PJ3A 1NMTA 4X2TA 4M6HA 2O53A 1YW4A 3SJFA 4NF1A 2GFQA 2EK8A 2C1CA 3EO4A 1M4LA 1Z4RA 2CTCA 1F57A 2FIWA 2D4PA 2DPSA 3D8PA 3NE7A 3L2NA 4MHNA 2QMLA 2VL1A 2Q04A 2YNEA 3NFZA 1AMPA 2P6EA 4HKFA 4KVME 4KSIA 4NEXA 5CNPA 1BLLE 2Z10A 4KOUA 4OIWA 3PRTA 4NGMA 4P10A 1BAVA 2GIVA 1CPSA 2PVVA 3FF3A 1TKHA 1J4JA 3FEDA 3FNCA 5JPHA 3LD2A 2B5GB 2FS5A 2IMOA 2YNCA 4LQGA 3D2MA 4R57A 4X5KA 3WABA 4UCPA 3D3SA 4UIBA 1YW6A 3FXTA 1TIQA 1Y7RA 5HVFA 3S9MA 5F46A 2JDDA 4R9MA 1VHSA 4UCMA 1P4NA 5F09A 4BD9A 3TOAA 3TX8A 3FIXA 2AFWA 3IU1A 4MFLA 3GLJA 3FEEA 3C26A 3B3WA 3K9UA 4MCPA 2DXQA 2ODFA 4A32A 4IHMA 3PZJA 4CGNA 4UIAA 3ISZA 4F0XA 4KS9A 4B10A 1MJ9A 3IWWA 4CYPA 1EE3P 4UFWA 4AVAA 3D68A 3I9SA 4FD4A 5FVJA 5ISVA 4JJXA 4IUSA 5AG6A 4IF5A 3ZZIA 1UWYA 1ARMA 1XE4A 1XIXA 4K3NA 5K8NA 2G3AA 2OOTA 3MGDA 2ARHA 1CBXA 1HEEA 1ON0A 3RO0A 5JQ4A 3TO6A 4KORA 1KZFA 3FYNA 1BO4A 3JUWA 5GCNA 5AGEA 3PB7X 3S6GA 3KQXA 4MHYA 3KR5A 3CXSA 3N5FA 4MCQA 5LRGA 4DYOA 8CPAA 1U6MA 4P4EA 2OU2A 4KSFA 2HC9A 3FRMA 4QBJA 1IYLA 3BI0A 2RC4A 1R3NA 3TO9A 2PC1A 4OIDA 2FT0A 3R9GA 4NGRA 3KKWA 3NE8A 3KI9A 2FXFA 3PGPA 2Z3PA 4NGNA 1A2ZA 3PB6X 4A37A 1ZLHA 2ZEDA 1GYTA 4KOTA 1DE4C 1QSNA 4PPZA 3EFAA 2CIJA 4A30A 2HUZA 2XEFA 1IGBA 4EWTA 2V8DA 1FNOA 3CXQA 2JLMA 1PCAA 1M4GA 5AG4A 2AFXA 4Y49B 1F2OA 1HDUA 3D4UA 2AFZA 2Q0YA 2PQ8A 4P4DA 4PXEA 2PSWA 5H84A 1IYKA 1Y9WA 4P45A 4MRIA 1MK4A 2ZENA 3VWEA 2PCUA 2B4DA 4R76A 2IQ6A 4ZBGA 4BINA 1Y0RA 3V38A 2IJZA 3EXNA 1XMTA 4KOYA 4MHPA 4OAEA 1YK3A 4E0AA 3ZJ0A 4JYWA 2Q4VA 4FAIA 3QB8A 5K8OA 1RO5A 4FD7A 1QMUA 2Z3NA 2CF4A 2REEA 3D2PA 1LAMA 2QJ8A 2DPTA 2G0BA 3PBBA 2XEGA 3I1UA 2ZOFA 4XPDC 4F8ZA 6CPAA 3FVLA 2Q7SA 3R1KA 5LYIA 3S9NA 2DF5A 2CNTA 2PJ1A 3TFYA 3JRUA 3B3CA 1S7KA 5F47A 4ZY0A 4RUHA 5IB0A 2FVGA 1Z8TA 3TO7A 1BOBA 2D4OA 2IL4A 1IY7A 1ZG9A 2BOAA 3WC5A 2Z3KA 2PIZA 2RB7A 4MJ8A 4U5YA 4KVOE 5I0CA 3SI2A 1AYEA 3CZXA 4O23A 3IWEA 3NH4A 3R9EA 4OC3A 3PB8X 3D7GA 4A39A 4C7HA 4WWVA 1QSMA 2AFMA 1MJAA 1GHEA 4ZI6A 2YGWA 2PJ9A 3KASA 3OWCA 4P6YA 4R8FA 4U9ZA 4BMHA 1M4IA 3SXOA 2PJ0A 1ZG7A 3DSBA 2ZW6A 3GKRA 4NGQA 4UCNA 1YX0A 4JLYA 2AJ6A 4P4BA 4NJQA 1TF9A 2QECA 4Q36A 5JH9A 3IU2A 5CBMA 3MN8A 1RTQA 4NCZA 1Y9KA 1XMBA 2Z11A 4NGTA 3SI0A 3R9FA 1N71A 2POKA 3FECA 3D67A 4A95A 1JWQA 4MY3A 4P4IA 3KZWA 2PJ7A 3VARA 4YRHA 4OC5A 1K4JA 4FD6A 4AG7A 3E0KA 4UEEA 3TOBA 2PJAA 1Q2CA 3T90A 4CAWA 5C88A 2VEZA 1MJBA 3FX6A 1I12A 1QSOA 1CPXA 3S6KA 3S9LA 2PJBA 4OC1A 2J9AA 2VQYA 3DDDA 4OC2A 2EO8A 3DR8A 4B5PB 4MFKA 1SQHA 3B3VA 2ZW5A 3F5BA 3PP9A 4KUAA 3CT9A 4A33A 3S6FA 2AFOA 1CM0A 3S6HA 2AFSA 2FL4A 4B6ZA 2RFHA 3W91A 5LRJA 2FE7A 2CNMA 1OBRA 1R43A 1ZG8A 2XEIA 4KOXA 2G9DA 3P2FA 3H4QA 2B4BA 3D7DA 1FT7A 3N7ZA 4KOWA 2JEVA 1IOFA 2DEAA 2ZW4A 4PXDA 4UWJA 3DNSA 3FBUA 3TE4A 1S7LA 3FB3A 4XNHC 1Q2DA 1FY7A 1ELLP 1IIDA 4H2KA 2GREA 1WWZA 4Y49C 2J8MA 5LYFA 1BPMA 4LQ6A 2C27A 3RAMA 4OADA 1KUXA 1YVKA 4R87A 1Y7EA 5IV0A 1IOIA 4CPAA 4PK2A 3WC6A 3SHPA 2ZEEA 4LX9A 3BJ8A 3CPXA 3QAHA 5HH1A 5F48A 4BBHA 4NXYA 1VHOA 2PRBA 4PQAA 1Q7LA 3GY9A 2CXAA 3F8KA 3SI1A 1B87A 2Z3LA 4JZ0A 5KTAA 4RS2A 2R98A 4XPLA 4QUSA 2PJ5A 3PFEA 2PDOA 1Z4EA 2EWBA 2QYVA 4XNHB 1TXRA 2ZPAA 5K8PA 4KLWA 3T8WA 4PSXA 5H86A 2YNCC 3CDXA 4UEZA 1Z8WA 4HNYB 3KQZA 4YU9A 3K9TA 2FIAA 4KVXA 2J8NA 5C82A 4F0YA 4JD6A 1Z8XA 2Q44A 4PXCA 7CPAA 2AFUA 2CNSA 1CJWA 3MRUA 4MMOA 4C7IA 3GUXA 2GLJA 2Z3MA 3JTKA 4E2AA 1NSAA 1XBUA 2B5GA 2F5IA 3HUVA 4UFVA 1XEBA 3B8GA 3VWDA 4UF4A 4C2XA 5DS0A 4MXUA 2WSAA 2V8VA 3CPAA 5CPAA 1KWMA 2WYRA 3EY5A 5G21A 5LYLA 4P4FA 1TKFA 2GE3A 1YR0A 4ONUA 2HV2A 3P2HA 4A31A 3IWGA 4M6IA 4G1PA 4AG9A 1R57A 1VHEA 3PB9X 3PFOA 5HMNA 1Z9UA 4A2ZA 3V7ZA 4OKOA 4ZYQA 1V0CA 2B58A 4MFPA 3BI1A 3BJ7A 3IO1A 2NMTA 3PB4X 3KL9A 4F9UA 1XRYA 2P6FA 3V8IA 1YREA 2KCWA 1LANA 1L0CA 3FJUA 4RN7A 2X7BA 2BSWA 3TC8A 2EBJA 3W6XA 2PR8A 1YLOA 4JXRA 2ZELA 1Z2LA 4PK3A 3WR7A 1CX8A 3B35A 4NFRA 4FBEA 4H89A 3T9YA 5A28A 1TKJA 4MHZA 2R8VA 4HPSA 2NSMA 2ATRA 3H8EA 1PU9A 3G3SA 4M6GA 4FWUA 5D29A 3SXNA 4MY0A 2ZEHA 1LRZA 3B3SA 1YGHA 2AE6A 1LCPA 3LWUA 4L8AA 4M85A 2ANPA 1NE9A 4F6AA 4NSQA 2F8HA 4OP4A 1KUVA 3WC7A 2QVPA 2PJ6A 2P6GA 3DGVA 3VATA 4DJLA 3I3GA 5EC4A 2VZZA 4CAVA 1S7FA 4FUUA 2B3VA 3IC1A 4TNUA 1UFHA 2Q7BA 2ZW7A 2OR4A 1HDQA 4ZY2A 4RI1A 3TT2A 2Y0MA 4KUBA 5HVHA 1M4DA 2CY2A 2PJ8A 1XF8A 4DNCA 1I21A 2JDCA 1YLEA 4U9YA 2PJCA 5HVGA 4Q7AA 2HB6A 4E8OA 3LMSA 3LODA 2EVNA 2PE3A 4UEFA 1YQEA 4I49A 1AUGA 4CYOA 1S60A 3DR6A 4UFXA 2QIRA 4KSAA 5G22A 3D66A 4EFDA 4NGSA 4X3RA 2O28A 1LOKA 4KZTA 1Z5RA 2JBKA 2Q4YA 4H6UA 2VXKA 3KGQA 4R3LA 4CRYB 4ONWA 5I4MA 1LAPA 5IB9A 2K5TA 5J1QA 3RZAA 2ZEPA 1M44A 1Y0YA 1B6BA 1IICA 1YMEA 4ORFA 4B12A 3IEHA 1WK4A 2REFA 2F7VA 4HNXB 3R96A 2B4DB 4A94A 1F2PA 4C68A 3BHXA 1S3ZA 1XFOA 2BUEA 1I1DA 2BL1A 2CTBA 1M1DA 2VBQA 4JXQA 4GXHA 4M3SA 1ELMP 4CAXA 3TTHA 2PVWA 2Q4ZA 3IFEA 5AG7A 3IIBA 4KLVA 4C2YA 3VH9A 1QSRA 4PV6A 2H5MA 3NA6A 3HLPA 1CG2A 4EVYA 2EK9A 3GIUA 2ABZA 3TCVA 2R7HA 4MHDA 3SJXA 4EMEA 1IB1E 5KTDA 2R1IA 4HNWB 2PJ4A 3QAYA 1ZLIA 4L89A 4PXBA 2C6CA 4ZX9A 4WJBA 4CGOA 5K8MA 5ELYA 4OC0A 3D7FA 4CGLA 4AVBA 2EUIA 1Q2YA 3BXMA 4MFQA 5D8NA 3KHXA 3DLJA 1BPNA 2I79A 2FSRA 2HQYA 4UWIA 1QQ9A 2PIYA 4QVTA 1YSJA 1JQGA 3G8WA 1KUYA 3GB0A 2I00A 3RNZA 3B2YA 1ZO0A 3KHZA 4R3KA 3D7HA 3PBEA 4IAVA 5KTCA 3RYOA 4MCRA 1X12A 5J8FA 2GU2A 4JWPA 4CAFA 1TF8A 4OMEA 4ZX8A 4J3GA 4ZGYB 2OZUA 4XPKA 5G1ZA 4P44A 4H6ZA 5F49A 4AXVA 3FH4A 4DUKA 2C6PA 4CS0B 1X10A 2WPXA 2G3TA 4MFJA 2B3UA 1IU8A 2Z3OA 2ZEOA 3EC4A 4QC6A 4Z65A 4W9YA 1S7NA 4KOVA 4ZY1A 1LFWA 2ZEMA 4R7MA 5AG5A 1XJOA 4B5OA 4CGPA 4IK2A 1RXTA 2V8HA 4LUAA 2BEIA 5BWAB 3WT4A 4KOSA 2FCKA 4YFJA 2ZEFA 4Q38A 2GLFA 2VI7A 2ZEGA 4AB7A 4CRZB 5A27A 4MI4A 3W6SA 4CYNA 1PYTB 5DWNA 3H5ZA 4B5PA 4QB9A 2Q51A 1CP6A 4YWYA 2Z0ZA 5EBVA 2GANA 4F9VA 1Z8LA 2O4HA 4R6TA 3IGRA 3CXPA 1YVOA 4UA3A 2NYQA 4FD5A 3SJGA 5E96A 4NJRA 2WUUA 2YNDA 3NH8A 3RBUA 3A9LA 1S5KA 2WPWA 3JVNA 3B7IA 4CYQA 2PRQA 4MBUA 4PSWA 4GM5A 2BO9A 3F0AA 3PEIA
chains in the Genus database with same CATH topology
4C2ZA 1OZPA 2OH1A 2OZGA 4B14A 5G20A 4YGOA 5J8CA 4CGMA 4K30A 4GS4A 2PR1A 1VKCA 2J8RA 4B13A 2OZHA 4MFZA 4UBRA 1P0HA 3GYAA 1PUAA 2A4NA 3UY5A 4B11A 1QSTA 2ZXVA 2P0WA 3R95A 4XPDB 4II9A 4CAEA 5IX3A 3BLNA 4AVCA 4OLLA 1NSLA 2OB0A 2VZYA 5DWMA 1NMTA 4NF1A 3EO4A 2FIWA 1Z4RA 3D8PA 2D4PA 2DPSA 3NE7A 2QMLA 2YNEA 2Q04A 4KVME 4HKFA 2P6EA 5CNPA 4NEXA 2Z10A 4KOUA 2GIVA 1J4JA 3FNCA 5JPHA 3LD2A 2B5GB 2FS5A 2YNCA 3D2MA 4R57A 4X5KA 4UCPA 3D3SA 3FXTA 1TIQA 1Y7RA 5F46A 2JDDA 4R9MA 1VHSA 4UCMA 1P4NA 3TOAA 3FIXA 3IU1A 4MFLA 3K9UA 3C26A 2DXQA 4A32A 4CGNA 3PZJA 4F0XA 4KS9A 4B10A 1MJ9A 4CYPA 4UFWA 4AVAA 3I9SA 4FD4A 5FVJA 5ISVA 4JJXA 4IUSA 5AG6A 4IF5A 3ZZIA 1XE4A 1XIXA 2G3AA 3MGDA 2ARHA 1ON0A 5JQ4A 3TO6A 4KORA 1KZFA 3FYNA 1BO4A 3JUWA 5GCNA 5AGEA 3S6GA 3CXSA 1U6MA 2OU2A 4KSFA 3FRMA 4QBJA 1IYLA 3TO9A 2RC4A 2PC1A 2FT0A 3R9GA 3KKWA 2FXFA 3PGPA 2Z3PA 4KOTA 1QSNA 3EFAA 4A30A 2HUZA 3CXQA 5AG4A 2JLMA 1M4GA 4Y49B 2Q0YA 2PQ8A 2PSWA 5H84A 1IYKA 1Y9WA 1MK4A 3VWEA 2B4DA 4ZBGA 3EXNA 4KOYA 1XMTA 4OAEA 1YK3A 4E0AA 3ZJ0A 2Q4VA 3QB8A 1RO5A 4FD7A 2Z3NA 2REEA 3D2PA 2DPTA 2G0BA 4XPDC 3R1KA 2CNTA 3TFYA 1S7KA 5F47A 5IB0A 3TO7A 1BOBA 2D4OA 2IL4A 2Z3KA 4MJ8A 4U5YA 4KVOE 5I0CA 3IWEA 3R9EA 4C7HA 1QSMA 1MJAA 1GHEA 2YGWA 3OWCA 4U9ZA 4BMHA 1M4IA 3SXOA 3DSBA 2ZW6A 3GKRA 4UCNA 1YX0A 4JLYA 2AJ6A 2QECA 4Q36A 3IU2A 4NCZA 1Y9KA 2Z11A 3R9FA 1N71A 4A95A 4MY3A 4YRHA 1K4JA 4FD6A 4AG7A 3E0KA 3TOBA 3T90A 1Q2CA 4CAWA 5C88A 2VEZA 1MJBA 1I12A 1QSOA 3S6KA 2VQYA 3DDDA 3DR8A 4B5PB 4MFKA 1SQHA 2ZW5A 3F5BA 3PP9A 4KUAA 4A33A 3S6FA 1CM0A 3S6HA 2FL4A 3W91A 2FE7A 2CNMA 4KOXA 3P2FA 3H4QA 2B4BA 3N7ZA 4KOWA 2JEVA 2ZW4A 4UWJA 3DNSA 3FBUA 3TE4A 1S7LA 3FB3A 4XNHC 1Q2DA 1FY7A 1IIDA 1WWZA 4Y49C 2J8MA 2C27A 4OADA 1KUXA 1YVKA 4R87A 5IV0A 4PK2A 3SHPA 4LX9A 3BJ8A 3QAHA 5HH1A 5F48A 4BBHA 4NXYA 2PRBA 3GY9A 2CXAA 3F8KA 1B87A 2Z3LA 5KTAA 4RS2A 2R98A 4XPLA 4QUSA 2PDOA 1Z4EA 4XNHB 2ZPAA 4KLWA 4PSXA 5H86A 2YNCC 4HNYB 2FIAA 4KVXA 2J8NA 5C82A 4F0YA 4JD6A 2Q44A 2CNSA 4E2AA 1CJWA 4C7IA 2Z3MA 3JTKA 2B5GA 2F5IA 4UFVA 1XEBA 3B8GA 3VWDA 4C2XA 2WSAA 3EY5A 5G21A 2GE3A 1YR0A 4ONUA 2HV2A 3P2HA 4A31A 3IWGA 4AG9A 1R57A 5HMNA 1Z9UA 4A2ZA 1V0CA 2B58A 4MFPA 3BJ7A 2NMTA 2P6FA 3V8IA 1YREA 2KCWA 1L0CA 2X7BA 2BSWA 3W6XA 2PR8A 4JXRA 4PK3A 3WR7A 4H89A 3T9YA 5A28A 2R8VA 2ATRA 1PU9A 3G3SA 3SXNA 4MY0A 1LRZA 1YGHA 2AE6A 4L8AA 4M85A 1NE9A 4F6AA 4NSQA 1KUVA 2P6GA 3I3GA 5EC4A 2VZZA 4CAVA 1S7FA 2B3VA 1UFHA 2Q7BA 2ZW7A 3TT2A 4RI1A 2Y0MA 4KUBA 1M4DA 2CY2A 1XF8A 4DNCA 1I21A 2JDCA 1YLEA 4U9YA 4E8OA 3LODA 2EVNA 4I49A 4CYOA 1S60A 3DR6A 4UFXA 2QIRA 4KSAA 5G22A 2O28A 4KZTA 2Q4YA 4H6UA 2VXKA 4R3LA 4CRYB 2K5TA 1M44A 1B6BA 1IICA 4ORFA 4B12A 1WK4A 2REFA 4HNXB 3R96A 2B4DB 4C68A 1S3ZA 2BUEA 1I1DA 2BL1A 4JXQA 1M1DA 2VBQA 4M3SA 4CAXA 3TTHA 5AG7A 4KLVA 4C2YA 1QSRA 4PV6A 2H5MA 4EVYA 3TCVA 2R7HA 4MHDA 1IB1E 5KTDA 2R1IA 4HNWB 4L89A 4CGOA 4CGLA 4AVBA 2EUIA 1Q2YA 4MFQA 2I79A 2FSRA 2HQYA 4UWIA 4QVTA 3G8WA 1KUYA 2I00A 1ZO0A 4R3KA 5KTCA 3RYOA 5J8FA 4JWPA 4CAFA 4J3GA 4ZGYB 2OZUA 4XPKA 5G1ZA 4H6ZA 5F49A 4CS0B 2WPXA 2G3TA 4MFJA 2B3UA 2Z3OA 3EC4A 4QC6A 1S7NA 4KOVA 5AG5A 4B5OA 4CGPA 1RXTA 4LUAA 2BEIA 5BWAB 4KOSA 2FCKA 4YFJA 4Q38A 4AB7A 2VI7A 5A27A 4CRZB 4MI4A 3W6SA 4CYNA 5DWNA 3H5ZA 4B5PA 4QB9A 2Z0ZA 5EBVA 2GANA 3IGRA 3CXPA 1YVOA 4UA3A 4FD5A 5E96A 2WUUA 2YNDA 3A9LA 1S5KA 2WPWA 3JVNA 4CYQA 4PSWA 4MBUA 3F0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFL A;  4Q38 A;  4Q36 A;  4MFQ A;  4MFZ A;  4MFP A;  4MFJ A;  4MFK A; 
#chains in the Genus database with same CATH topology
 4C2Z A;  1OZP A;  2OH1 A;  2OZG A;  4TWE A;  3NH5 A;  4X8I A;  2WZN A;  4NGP A;  5G20 A;  4B14 A;  5HXD A;  3H8F A;  2V77 A;  4YGO A;  4MCS A;  4CGM A;  5J8C A;  1CP7 A;  4K30 A;  3K2K A;  4GS4 A;  2ZOG A;  2PR1 A;  4A38 A;  3B3T A;  1VKC A;  1H8L A;  2J8R A;  2Q43 A;  2JEW A;  5EMI A;  4B13 A;  2BCO A;  1DTD A;  2OZH A;  4MFZ A;  4OC4 A;  4UBR A;  3H8G A;  3QNV A;  1P0H A;  2I3C A;  3GYA A;  1PUA A;  2A4N A;  5THW A;  1VIX A;  3ISX A;  1VGY A;  3UY5 A;  2XEJ A;  1ARL A;  4P4J A;  4B11 A;  3SJE A;  3LAC A;  1XOV A;  1QST A;  2ZXV A;  5LYD A;  2P0W A;  5JGF A;  3R95 A;  3IJ3 A;  4XPD B;  3KR4 A;  2PJ2 A;  3FMC A;  4CAE A;  5IX3 A;  5LRK A;  4II9 A;  3BLN A;  4AVC A;  2C6G A;  5JM6 A;  4OLL A;  1NSL A;  2OB0 A;  2VZY A;  2JBJ A;  5DWM A;  2V8G A;  2PJ3 A;  1NMT A;  4X2T A;  4M6H A;  2O53 A;  1YW4 A;  3SJF A;  4NF1 A;  2GFQ A;  2EK8 A;  2C1C A;  3EO4 A;  1M4L A;  1Z4R A;  2CTC A;  1F57 A;  2FIW A;  2D4P A;  2DPS A;  3D8P A;  3NE7 A;  3L2N A;  4MHN A;  2QML A;  2VL1 A;  2Q04 A;  2YNE A;  3NFZ A;  1AMP A;  2P6E A;  4HKF A;  4KVM E;  4KSI A;  4NEX A;  5CNP A;  1BLL E;  2Z10 A;  4KOU A;  4OIW A;  3PRT A;  4NGM A;  4P10 A;  1BAV A;  2GIV A;  1CPS A;  2PVV A;  3FF3 A;  1TKH A;  1J4J A;  3FED A;  3FNC A;  5JPH A;  3LD2 A;  2B5G B;  2FS5 A;  2IMO A;  2YNC A;  4LQG A;  3D2M A;  4R57 A;  4X5K A;  3WAB A;  4UCP A;  3D3S A;  4UIB A;  1YW6 A;  3FXT A;  1TIQ A;  1Y7R A;  5HVF A;  3S9M A;  5F46 A;  2JDD A;  4R9M A;  1VHS A;  4UCM A;  1P4N A;  5F09 A;  4BD9 A;  3TOA A;  3TX8 A;  3FIX A;  2AFW A;  3IU1 A;  4MFL A;  3GLJ A;  3FEE A;  3C26 A;  3B3W A;  3K9U A;  4MCP A;  2DXQ A;  2ODF A;  4A32 A;  4IHM A;  3PZJ A;  4CGN A;  4UIA A;  3ISZ A;  4F0X A;  4KS9 A;  4B10 A;  1MJ9 A;  3IWW A;  4CYP A;  1EE3 P;  4UFW A;  4AVA A;  3D68 A;  3I9S A;  4FD4 A;  5FVJ A;  5ISV A;  4JJX A;  4IUS A;  5AG6 A;  4IF5 A;  3ZZI A;  1UWY A;  1ARM A;  1XE4 A;  1XIX A;  4K3N A;  5K8N A;  2G3A A;  2OOT A;  3MGD A;  2ARH A;  1CBX A;  1HEE A;  1ON0 A;  3RO0 A;  5JQ4 A;  3TO6 A;  4KOR A;  1KZF A;  3FYN A;  1BO4 A;  3JUW A;  5GCN A;  5AGE A;  3PB7 X;  3S6G A;  3KQX A;  4MHY A;  3KR5 A;  3CXS A;  3N5F A;  4MCQ A;  5LRG A;  4DYO A;  8CPA A;  1U6M A;  4P4E A;  2OU2 A;  4KSF A;  2HC9 A;  3FRM A;  4QBJ A;  1IYL A;  3BI0 A;  2RC4 A;  1R3N A;  3TO9 A;  2PC1 A;  4OID A;  2FT0 A;  3R9G A;  4NGR A;  3KKW A;  3NE8 A;  3KI9 A;  2FXF A;  3PGP A;  2Z3P A;  4NGN A;  1A2Z A;  3PB6 X;  4A37 A;  1ZLH A;  2ZED A;  1GYT A;  4KOT A;  1DE4 C;  1QSN A;  4PPZ A;  3EFA A;  2CIJ A;  4A30 A;  2HUZ A;  2XEF A;  1IGB A;  4EWT A;  2V8D A;  1FNO A;  3CXQ A;  2JLM A;  1PCA A;  1M4G A;  5AG4 A;  2AFX A;  4Y49 B;  1F2O A;  1HDU A;  3D4U A;  2AFZ A;  2Q0Y A;  2PQ8 A;  4P4D A;  4PXE A;  2PSW A;  5H84 A;  1IYK A;  1Y9W A;  4P45 A;  4MRI A;  1MK4 A;  2ZEN A;  3VWE A;  2PCU A;  2B4D A;  4R76 A;  2IQ6 A;  4ZBG A;  4BIN A;  1Y0R A;  3V38 A;  2IJZ A;  3EXN A;  1XMT A;  4KOY A;  4MHP A;  4OAE A;  1YK3 A;  4E0A A;  3ZJ0 A;  4JYW A;  2Q4V A;  4FAI A;  3QB8 A;  5K8O A;  1RO5 A;  4FD7 A;  1QMU A;  2Z3N A;  2CF4 A;  2REE A;  3D2P A;  1LAM A;  2QJ8 A;  2DPT A;  2G0B A;  3PBB A;  2XEG A;  3I1U A;  2ZOF A;  4XPD C;  4F8Z A;  6CPA A;  3FVL A;  2Q7S A;  3R1K A;  5LYI A;  3S9N A;  2DF5 A;  2CNT A;  2PJ1 A;  3TFY A;  3JRU A;  3B3C A;  1S7K A;  5F47 A;  4ZY0 A;  4RUH A;  5IB0 A;  2FVG A;  1Z8T A;  3TO7 A;  1BOB A;  2D4O A;  2IL4 A;  1IY7 A;  1ZG9 A;  2BOA A;  3WC5 A;  2Z3K A;  2PIZ A;  2RB7 A;  4MJ8 A;  4U5Y A;  4KVO E;  5I0C A;  3SI2 A;  1AYE A;  3CZX A;  4O23 A;  3IWE A;  3NH4 A;  3R9E A;  4OC3 A;  3PB8 X;  3D7G A;  4A39 A;  4C7H A;  4WWV A;  1QSM A;  2AFM A;  1MJA A;  1GHE A;  4ZI6 A;  2YGW A;  2PJ9 A;  3KAS A;  3OWC A;  4P6Y A;  4R8F A;  4U9Z A;  4BMH A;  1M4I A;  3SXO A;  2PJ0 A;  1ZG7 A;  3DSB A;  2ZW6 A;  3GKR A;  4NGQ A;  4UCN A;  1YX0 A;  4JLY A;  2AJ6 A;  4P4B A;  4NJQ A;  1TF9 A;  2QEC A;  4Q36 A;  5JH9 A;  3IU2 A;  5CBM A;  3MN8 A;  1RTQ A;  4NCZ A;  1Y9K A;  1XMB A;  2Z11 A;  4NGT A;  3SI0 A;  3R9F A;  1N71 A;  2POK A;  3FEC A;  3D67 A;  4A95 A;  1JWQ A;  4MY3 A;  4P4I A;  3KZW A;  2PJ7 A;  3VAR A;  4YRH A;  4OC5 A;  1K4J A;  4FD6 A;  4AG7 A;  3E0K A;  4UEE A;  3TOB A;  2PJA A;  1Q2C A;  3T90 A;  4CAW A;  5C88 A;  2VEZ A;  1MJB A;  3FX6 A;  1I12 A;  1QSO A;  1CPX A;  3S6K A;  3S9L A;  2PJB A;  4OC1 A;  2J9A A;  2VQY A;  3DDD A;  4OC2 A;  2EO8 A;  3DR8 A;  4B5P B;  4MFK A;  1SQH A;  3B3V A;  2ZW5 A;  3F5B A;  3PP9 A;  4KUA A;  3CT9 A;  4A33 A;  3S6F A;  2AFO A;  1CM0 A;  3S6H A;  2AFS A;  2FL4 A;  4B6Z A;  2RFH A;  3W91 A;  5LRJ A;  2FE7 A;  2CNM A;  1OBR A;  1R43 A;  1ZG8 A;  2XEI A;  4KOX A;  2G9D A;  3P2F A;  3H4Q A;  2B4B A;  3D7D A;  1FT7 A;  3N7Z A;  4KOW A;  2JEV A;  1IOF A;  2DEA A;  2ZW4 A;  4PXD A;  4UWJ A;  3DNS A;  3FBU A;  3TE4 A;  1S7L A;  3FB3 A;  4XNH C;  1Q2D A;  1FY7 A;  1ELL P;  1IID A;  4H2K A;  2GRE A;  1WWZ A;  4Y49 C;  2J8M A;  5LYF A;  1BPM A;  4LQ6 A;  2C27 A;  3RAM A;  4OAD A;  1KUX A;  1YVK A;  4R87 A;  1Y7E A;  5IV0 A;  1IOI A;  4CPA A;  4PK2 A;  3WC6 A;  3SHP A;  2ZEE A;  4LX9 A;  3BJ8 A;  3CPX A;  3QAH A;  5HH1 A;  5F48 A;  4BBH A;  4NXY A;  1VHO A;  2PRB A;  4PQA A;  1Q7L A;  3GY9 A;  2CXA A;  3F8K A;  3SI1 A;  1B87 A;  2Z3L A;  4JZ0 A;  5KTA A;  4RS2 A;  2R98 A;  4XPL A;  4QUS A;  2PJ5 A;  3PFE A;  2PDO A;  1Z4E A;  2EWB A;  2QYV A;  4XNH B;  1TXR A;  2ZPA A;  5K8P A;  4KLW A;  3T8W A;  4PSX A;  5H86 A;  2YNC C;  3CDX A;  4UEZ A;  1Z8W A;  4HNY B;  3KQZ A;  4YU9 A;  3K9T A;  2FIA A;  4KVX A;  2J8N A;  5C82 A;  4F0Y A;  4JD6 A;  1Z8X A;  2Q44 A;  4PXC A;  7CPA A;  2AFU A;  2CNS A;  1CJW A;  3MRU A;  4MMO A;  4C7I A;  3GUX A;  2GLJ A;  2Z3M A;  3JTK A;  4E2A A;  1NSA A;  1XBU A;  2B5G A;  2F5I A;  3HUV A;  4UFV A;  1XEB A;  3B8G A;  3VWD A;  4UF4 A;  4C2X A;  5DS0 A;  4MXU A;  2WSA A;  2V8V A;  3CPA A;  5CPA A;  1KWM A;  2WYR A;  3EY5 A;  5G21 A;  5LYL A;  4P4F A;  1TKF A;  2GE3 A;  1YR0 A;  4ONU A;  2HV2 A;  3P2H A;  4A31 A;  3IWG A;  4M6I A;  4G1P A;  4AG9 A;  1R57 A;  1VHE A;  3PB9 X;  3PFO A;  5HMN A;  1Z9U A;  4A2Z A;  3V7Z A;  4OKO A;  4ZYQ A;  1V0C A;  2B58 A;  4MFP A;  3BI1 A;  3BJ7 A;  3IO1 A;  2NMT A;  3PB4 X;  3KL9 A;  4F9U A;  1XRY A;  2P6F A;  3V8I A;  1YRE A;  2KCW A;  1LAN A;  1L0C A;  3FJU A;  4RN7 A;  2X7B A;  2BSW A;  3TC8 A;  2EBJ A;  3W6X A;  2PR8 A;  1YLO A;  4JXR A;  2ZEL A;  1Z2L A;  4PK3 A;  3WR7 A;  1CX8 A;  3B35 A;  4NFR A;  4FBE A;  4H89 A;  3T9Y A;  5A28 A;  1TKJ A;  4MHZ A;  2R8V A;  4HPS A;  2NSM A;  2ATR A;  3H8E A;  1PU9 A;  3G3S A;  4M6G A;  4FWU A;  5D29 A;  3SXN A;  4MY0 A;  2ZEH A;  1LRZ A;  3B3S A;  1YGH A;  2AE6 A;  1LCP A;  3LWU A;  4L8A A;  4M85 A;  2ANP A;  1NE9 A;  4F6A A;  4NSQ A;  2F8H A;  4OP4 A;  1KUV A;  3WC7 A;  2QVP A;  2PJ6 A;  2P6G A;  3DGV A;  3VAT A;  4DJL A;  3I3G A;  5EC4 A;  2VZZ A;  4CAV A;  1S7F A;  4FUU A;  2B3V A;  3IC1 A;  4TNU A;  1UFH A;  2Q7B A;  2ZW7 A;  2OR4 A;  1HDQ A;  4ZY2 A;  4RI1 A;  3TT2 A;  2Y0M A;  4KUB A;  5HVH A;  1M4D A;  2CY2 A;  2PJ8 A;  1XF8 A;  4DNC A;  1I21 A;  2JDC A;  1YLE A;  4U9Y A;  2PJC A;  5HVG A;  4Q7A A;  2HB6 A;  4E8O A;  3LMS A;  3LOD A;  2EVN A;  2PE3 A;  4UEF A;  1YQE A;  4I49 A;  1AUG A;  4CYO A;  1S60 A;  3DR6 A;  4UFX A;  2QIR A;  4KSA A;  5G22 A;  3D66 A;  4EFD A;  4NGS A;  4X3R A;  2O28 A;  1LOK A;  4KZT A;  1Z5R A;  2JBK A;  2Q4Y A;  4H6U A;  2VXK A;  3KGQ A;  4R3L A;  4CRY B;  4ONW A;  5I4M A;  1LAP A;  5IB9 A;  2K5T A;  5J1Q A;  3RZA A;  2ZEP A;  1M44 A;  1Y0Y A;  1B6B A;  1IIC A;  1YME A;  4ORF A;  4B12 A;  3IEH A;  1WK4 A;  2REF A;  2F7V A;  4HNX B;  3R96 A;  2B4D B;  4A94 A;  1F2P A;  4C68 A;  3BHX A;  1S3Z A;  1XFO A;  2BUE A;  1I1D A;  2BL1 A;  2CTB A;  1M1D A;  2VBQ A;  4JXQ A;  4GXH A;  4M3S A;  1ELM P;  4CAX A;  3TTH A;  2PVW A;  2Q4Z A;  3IFE A;  5AG7 A;  3IIB A;  4KLV A;  4C2Y A;  3VH9 A;  1QSR A;  4PV6 A;  2H5M A;  3NA6 A;  3HLP A;  1CG2 A;  4EVY A;  2EK9 A;  3GIU A;  2ABZ A;  3TCV A;  2R7H A;  4MHD A;  3SJX A;  4EME A;  1IB1 E;  5KTD A;  2R1I A;  4HNW B;  2PJ4 A;  3QAY A;  1ZLI A;  4L89 A;  4PXB A;  2C6C A;  4ZX9 A;  4WJB A;  4CGO A;  5K8M A;  5ELY A;  4OC0 A;  3D7F A;  4CGL A;  4AVB A;  2EUI A;  1Q2Y A;  3BXM A;  4MFQ A;  5D8N A;  3KHX A;  3DLJ A;  1BPN A;  2I79 A;  2FSR A;  2HQY A;  4UWI A;  1QQ9 A;  2PIY A;  4QVT A;  1YSJ A;  1JQG A;  3G8W A;  1KUY A;  3GB0 A;  2I00 A;  3RNZ A;  3B2Y A;  1ZO0 A;  3KHZ A;  4R3K A;  3D7H A;  3PBE A;  4IAV A;  5KTC A;  3RYO A;  4MCR A;  1X12 A;  5J8F A;  2GU2 A;  4JWP A;  4CAF A;  1TF8 A;  4OME A;  4ZX8 A;  4J3G A;  4ZGY B;  2OZU A;  4XPK A;  5G1Z A;  4P44 A;  4H6Z A;  5F49 A;  4AXV A;  3FH4 A;  4DUK A;  2C6P A;  4CS0 B;  1X10 A;  2WPX A;  2G3T A;  4MFJ A;  2B3U A;  1IU8 A;  2Z3O A;  2ZEO A;  3EC4 A;  4QC6 A;  4Z65 A;  4W9Y A;  1S7N A;  4KOV A;  4ZY1 A;  1LFW A;  2ZEM A;  4R7M A;  5AG5 A;  1XJO A;  4B5O A;  4CGP A;  4IK2 A;  1RXT A;  2V8H A;  4LUA A;  2BEI A;  5BWA B;  3WT4 A;  4KOS A;  2FCK A;  4YFJ A;  2ZEF A;  4Q38 A;  2GLF A;  2VI7 A;  2ZEG A;  4AB7 A;  4CRZ B;  5A27 A;  4MI4 A;  3W6S A;  4CYN A;  1PYT B;  5DWN A;  3H5Z A;  4B5P A;  4QB9 A;  2Q51 A;  1CP6 A;  4YWY A;  2Z0Z A;  5EBV A;  2GAN A;  4F9V A;  1Z8L A;  2O4H A;  4R6T A;  3IGR A;  3CXP A;  1YVO A;  4UA3 A;  2NYQ A;  4FD5 A;  3SJG A;  5E96 A;  4NJR A;  2WUU A;  2YND A;  3NH8 A;  3RBU A;  3A9L A;  1S5K A;  2WPW A;  3JVN A;  3B7I A;  4CYQ A;  2PRQ A;  4MBU A;  4PSW A;  4GM5 A;  2BO9 A;  3F0A A;  3PEI A; 
#chains in the Genus database with same CATH homology
 4C2Z A;  1OZP A;  2OH1 A;  2OZG A;  4B14 A;  5G20 A;  4YGO A;  5J8C A;  4CGM A;  4K30 A;  4GS4 A;  2PR1 A;  1VKC A;  2J8R A;  4B13 A;  2OZH A;  4MFZ A;  4UBR A;  1P0H A;  3GYA A;  1PUA A;  2A4N A;  3UY5 A;  4B11 A;  1QST A;  2ZXV A;  2P0W A;  3R95 A;  4XPD B;  4II9 A;  4CAE A;  5IX3 A;  3BLN A;  4AVC A;  4OLL A;  1NSL A;  2OB0 A;  2VZY A;  5DWM A;  1NMT A;  4NF1 A;  3EO4 A;  2FIW A;  1Z4R A;  3D8P A;  2D4P A;  2DPS A;  3NE7 A;  2QML A;  2YNE A;  2Q04 A;  4KVM E;  4HKF A;  2P6E A;  5CNP A;  4NEX A;  2Z10 A;  4KOU A;  2GIV A;  1J4J A;  3FNC A;  5JPH A;  3LD2 A;  2B5G B;  2FS5 A;  2YNC A;  3D2M A;  4R57 A;  4X5K A;  4UCP A;  3D3S A;  3FXT A;  1TIQ A;  1Y7R A;  5F46 A;  2JDD A;  4R9M A;  1VHS A;  4UCM A;  1P4N A;  3TOA A;  3FIX A;  3IU1 A;  4MFL A;  3K9U A;  3C26 A;  2DXQ A;  4A32 A;  4CGN A;  3PZJ A;  4F0X A;  4KS9 A;  4B10 A;  1MJ9 A;  4CYP A;  4UFW A;  4AVA A;  3I9S A;  4FD4 A;  5FVJ A;  5ISV A;  4JJX A;  4IUS A;  5AG6 A;  4IF5 A;  3ZZI A;  1XE4 A;  1XIX A;  2G3A A;  3MGD A;  2ARH A;  1ON0 A;  5JQ4 A;  3TO6 A;  4KOR A;  1KZF A;  3FYN A;  1BO4 A;  3JUW A;  5GCN A;  5AGE A;  3S6G A;  3CXS A;  1U6M A;  2OU2 A;  4KSF A;  3FRM A;  4QBJ A;  1IYL A;  3TO9 A;  2RC4 A;  2PC1 A;  2FT0 A;  3R9G A;  3KKW A;  2FXF A;  3PGP A;  2Z3P A;  4KOT A;  1QSN A;  3EFA A;  4A30 A;  2HUZ A;  3CXQ A;  5AG4 A;  2JLM A;  1M4G A;  4Y49 B;  2Q0Y A;  2PQ8 A;  2PSW A;  5H84 A;  1IYK A;  1Y9W A;  1MK4 A;  3VWE A;  2B4D A;  4ZBG A;  3EXN A;  4KOY A;  1XMT A;  4OAE A;  1YK3 A;  4E0A A;  3ZJ0 A;  2Q4V A;  3QB8 A;  1RO5 A;  4FD7 A;  2Z3N A;  2REE A;  3D2P A;  2DPT A;  2G0B A;  4XPD C;  3R1K A;  2CNT A;  3TFY A;  1S7K A;  5F47 A;  5IB0 A;  3TO7 A;  1BOB A;  2D4O A;  2IL4 A;  2Z3K A;  4MJ8 A;  4U5Y A;  4KVO E;  5I0C A;  3IWE A;  3R9E A;  4C7H A;  1QSM A;  1MJA A;  1GHE A;  2YGW A;  3OWC A;  4U9Z A;  4BMH A;  1M4I A;  3SXO A;  3DSB A;  2ZW6 A;  3GKR A;  4UCN A;  1YX0 A;  4JLY A;  2AJ6 A;  2QEC A;  4Q36 A;  3IU2 A;  4NCZ A;  1Y9K A;  2Z11 A;  3R9F A;  1N71 A;  4A95 A;  4MY3 A;  4YRH A;  1K4J A;  4FD6 A;  4AG7 A;  3E0K A;  3TOB A;  3T90 A;  1Q2C A;  4CAW A;  5C88 A;  2VEZ A;  1MJB A;  1I12 A;  1QSO A;  3S6K A;  2VQY A;  3DDD A;  3DR8 A;  4B5P B;  4MFK A;  1SQH A;  2ZW5 A;  3F5B A;  3PP9 A;  4KUA A;  4A33 A;  3S6F A;  1CM0 A;  3S6H A;  2FL4 A;  3W91 A;  2FE7 A;  2CNM A;  4KOX A;  3P2F A;  3H4Q A;  2B4B A;  3N7Z A;  4KOW A;  2JEV A;  2ZW4 A;  4UWJ A;  3DNS A;  3FBU A;  3TE4 A;  1S7L A;  3FB3 A;  4XNH C;  1Q2D A;  1FY7 A;  1IID A;  1WWZ A;  4Y49 C;  2J8M A;  2C27 A;  4OAD A;  1KUX A;  1YVK A;  4R87 A;  5IV0 A;  4PK2 A;  3SHP A;  4LX9 A;  3BJ8 A;  3QAH A;  5HH1 A;  5F48 A;  4BBH A;  4NXY A;  2PRB A;  3GY9 A;  2CXA A;  3F8K A;  1B87 A;  2Z3L A;  5KTA A;  4RS2 A;  2R98 A;  4XPL A;  4QUS A;  2PDO A;  1Z4E A;  4XNH B;  2ZPA A;  4KLW A;  4PSX A;  5H86 A;  2YNC C;  4HNY B;  2FIA A;  4KVX A;  2J8N A;  5C82 A;  4F0Y A;  4JD6 A;  2Q44 A;  2CNS A;  4E2A A;  1CJW A;  4C7I A;  2Z3M A;  3JTK A;  2B5G A;  2F5I A;  4UFV A;  1XEB A;  3B8G A;  3VWD A;  4C2X A;  2WSA A;  3EY5 A;  5G21 A;  2GE3 A;  1YR0 A;  4ONU A;  2HV2 A;  3P2H A;  4A31 A;  3IWG A;  4AG9 A;  1R57 A;  5HMN A;  1Z9U A;  4A2Z A;  1V0C A;  2B58 A;  4MFP A;  3BJ7 A;  2NMT A;  2P6F A;  3V8I A;  1YRE A;  2KCW A;  1L0C A;  2X7B A;  2BSW A;  3W6X A;  2PR8 A;  4JXR A;  4PK3 A;  3WR7 A;  4H89 A;  3T9Y A;  5A28 A;  2R8V A;  2ATR A;  1PU9 A;  3G3S A;  3SXN A;  4MY0 A;  1LRZ A;  1YGH A;  2AE6 A;  4L8A A;  4M85 A;  1NE9 A;  4F6A A;  4NSQ A;  1KUV A;  2P6G A;  3I3G A;  5EC4 A;  2VZZ A;  4CAV A;  1S7F A;  2B3V A;  1UFH A;  2Q7B A;  2ZW7 A;  3TT2 A;  4RI1 A;  2Y0M A;  4KUB A;  1M4D A;  2CY2 A;  1XF8 A;  4DNC A;  1I21 A;  2JDC A;  1YLE A;  4U9Y A;  4E8O A;  3LOD A;  2EVN A;  4I49 A;  4CYO A;  1S60 A;  3DR6 A;  4UFX A;  2QIR A;  4KSA A;  5G22 A;  2O28 A;  4KZT A;  2Q4Y A;  4H6U A;  2VXK A;  4R3L A;  4CRY B;  2K5T A;  1M44 A;  1B6B A;  1IIC A;  4ORF A;  4B12 A;  1WK4 A;  2REF A;  4HNX B;  3R96 A;  2B4D B;  4C68 A;  1S3Z A;  2BUE A;  1I1D A;  2BL1 A;  4JXQ A;  1M1D A;  2VBQ A;  4M3S A;  4CAX A;  3TTH A;  5AG7 A;  4KLV A;  4C2Y A;  1QSR A;  4PV6 A;  2H5M A;  4EVY A;  3TCV A;  2R7H A;  4MHD A;  1IB1 E;  5KTD A;  2R1I A;  4HNW B;  4L89 A;  4CGO A;  4CGL A;  4AVB A;  2EUI A;  1Q2Y A;  4MFQ A;  2I79 A;  2FSR A;  2HQY A;  4UWI A;  4QVT A;  3G8W A;  1KUY A;  2I00 A;  1ZO0 A;  4R3K A;  5KTC A;  3RYO A;  5J8F A;  4JWP A;  4CAF A;  4J3G A;  4ZGY B;  2OZU A;  4XPK A;  5G1Z A;  4H6Z A;  5F49 A;  4CS0 B;  2WPX A;  2G3T A;  4MFJ A;  2B3U A;  2Z3O A;  3EC4 A;  4QC6 A;  1S7N A;  4KOV A;  5AG5 A;  4B5O A;  4CGP A;  1RXT A;  4LUA A;  2BEI A;  5BWA B;  4KOS A;  2FCK A;  4YFJ A;  4Q38 A;  4AB7 A;  2VI7 A;  5A27 A;  4CRZ B;  4MI4 A;  3W6S A;  4CYN A;  5DWN A;  3H5Z A;  4B5P A;  4QB9 A;  2Z0Z A;  5EBV A;  2GAN A;  3IGR A;  3CXP A;  1YVO A;  4UA3 A;  4FD5 A;  5E96 A;  2WUU A;  2YND A;  3A9L A;  1S5K A;  2WPW A;  3JVN A;  4CYQ A;  4PSW A;  4MBU A;  3F0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...