4MFPA

The crystal structure of acyltransferase in complex with decanoyl-coa and tei pseudoaglycone
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
323
structure length
323
Chain Sequence
MDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLAVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Transferase/antibiotic
molecule keywords Putative uncharacterized protein tcp24
total genus 110
structure length 323
sequence length 323
ec nomenclature ec 2.3.1.-:
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mfpA02
4MFZA 4MFQA 4MFJA 4Q36A 4MFPA 4Q38A 4MFLA 4MFKA
chains in the Genus database with same CATH superfamily
3R1KA 2PIZA 4RS2A 3D4UA 2QVPA 4C2XA 3SXOA 3N5FA 4B5PA 1MJ9A 2CIJA 5HVFA 1CP7A 2IMOA 1IIDA 1Z4RA 2WPXA 3H5ZA 4HKFA 4IHMA 2KCWA 4MXUA 3OWCA 4F0XA 2NSMA 1P4NA 1LAMA 3RO0A 1QSMA 4XNHB 1R57A 1LAPA 4X3RA 2Q4VA 3FEEA 1J4JA 3QAHA 2Q7BA 3SHPA 2J9AA 2VL1A 2GU2A 4E8OA 1S3ZA 3FXTA 2WYRA 3IWEA 4KOTA 2ZW7A 2V8VA 4NGTA 2OH1A 1RTQA 3T90A 1YVKA 4A31A 1ELLP 2VBQA 2Z3PA 1OZPA 3PB8X 4MCQA 3V8IA 2FS5A 3S9LA 5BWAB 4ZYQA 4H6UA 1R43A 3WABA 3SJFA 4MJ8A 3H8EA 2CF4A 1DE4C 2BUEA 4R9MA 5G22A 4NFRA 5F46A 1BLLE 4CAWA 1LCPA 2HC9A 3PB9X 3TCVA 4MMOA 2ANPA 2AFXA 1Z4EA 1ZLIA 2AFMA 1NSAA 3KHXA 4IF5A 1Y9WA 4K30A 3CDXA 4LQGA 3D7HA 4MY3A 2OR4A 4UBRA 4CYQA 1KUVA 5E96A 5AG6A 4MFPA 1FY7A 3R9GA 1Q7LA 1XMBA 4ZY0A 4J3GA 3B3CA 2ZW6A 1IY7A 1YLOA 4IUSA 3VH9A 1NSLA 2PIYA 3FX6A 5F49A 5F48A 1KZFA 2Z3LA 4RI1A 3MN8A 4A30A 5G1ZA 1XJOA 3GUXA 4YGOA 2ZXVA 4CRYB 3IFEA 3KR5A 4W9YA 4DJLA 5J8CA 2HQYA 2GE3A 5EC4A 3RNZA 4A37A 4FUUA 3ZJ0A 2YNEA 1M4IA 2JEWA 4H2KA 2R98A 3W91A 3SI1A 2ZOGA 1M4GA 3B35A 3KGQA 3KR4A 5THWA 4XPDB 5G20A 3D7DA 4MCRA 5GCNA 5C82A 1Y0YA 2XEFA 2P6GA 4CYPA 3FBUA 3GB0A 2DPTA 3R95A 2Z3KA 4FWUA 2EVNA 3TOAA 4BMHA 2CY2A 5G21A 2G3TA 5AG4A 2Z0ZA 3TC8A 4R7MA 5KTDA 3BI0A 2GLFA 3D68A 3RAMA 3IEHA 2P0WA 4HNWB 4CS0B 3IC1A 3S6HA 2Q44A 2VI7A 2ABZA 5EBVA 2IL4A 4M3SA 3TO6A 3FYNA 5HMNA 3D2MA 5CPAA 3TT2A 1S5KA 2PR8A 4A32A 2EK9A 2PCUA 5JGFA 4UFVA 4KSIA 2ZW4A 1YW6A 4WWVA 4E0AA 5J8FA 3LD2A 2O4HA 5AG5A 4YU9A 4B5OA 1I21A 3JVNA 2NMTA 3PP9A 4P10A 3R9FA 3SI0A 1F2PA 3F5BA 1QMUA 1JQGA 5DWNA 4MBUA 2GFQA 5LRGA 3TFYA 2AJ6A 1H8LA 1PCAA 4M85A 4C2ZA 1F57A 2C6CA 1ZLHA 5IV0A 1Y9KA 1BPNA 5EMIA 5JQ4A 2R8VA 4FD6A 2AFWA 2PJ5A 4A33A 1BOBA 2ZENA 3CZXA 3H8FA 3NFZA 4QVTA 5IB0A 1Q2CA 4EFDA 4XPKA 1ZO0A 3V7ZA 3TE4A 1XRYA 4B11A 2YGWA 2RB7A 2QIRA 3KQXA 1AYEA 4QBJA 4PK2A 2V8HA 4KVOE 4P4EA 3L2NA 3GLJA 2PJ1A 1U6MA 4OC3A 4F0YA 3R96A 4UEZA 3VATA 5F09A 3IIBA 2FT0A 3PB4X 4R87A 2BEIA 1OBRA 2QMLA 4UIBA 2IQ6A 4NF1A 4AVAA 4NGRA 3ZZIA 3ISXA 2FVGA 4KSAA 4BBHA 1IGBA 4UIAA 2BL1A 1KUYA 4A95A 2B4DA 3B8GA 3WC5A 4B13A 2REEA 1UWYA 4KVXA 4ZY1A 4CGMA 4MRIA 1S7KA 5LYFA 4JXRA 2GREA 4MHDA 1RO5A 1BO4A 3EY5A 2B3UA 1LFWA 2PJ0A 3QB8A 1CBXA 4HNXB 3F8KA 4KORA 4KUAA 1ON0A 1Z9UA 1TF8A 3KL9A 1QQ9A 2GLJA 4R57A 4GM5A 4M6HA 4K3NA 4Z65A 4XPDC 2PQ8A 4UCMA 3D7GA 2K5TA 5H86A 5A28A 4KOXA 4F8ZA 2PJ7A 3SI2A 4ZBGA 5IB9A 3K2KA 1Y0RA 2A4NA 2GANA 4U5YA 2PC1A 3EFAA 5I4MA 2OZHA 1SQHA 2PJ4A 2PE3A 3LACA 3S6GA 1YK3A 1I12A 1S7NA 4UEFA 4ZGYB 2PJ2A 1RXTA 4H89A 4NJQA 3NE7A 3BJ8A 4KUBA 1Z5RA 1DTDA 4CGNA 3I9SA 4PK3A 3W6SA 1CX8A 3IWGA 1GYTA 3RZAA 2EUIA 1VHOA 3QNVA 3TTHA 4C7HA 4RUHA 2OZGA 4MHPA 4OC5A 4OC4A 5C88A 1XBUA 1IB1E 5HXDA 4NXYA 4F9UA 3DR8A 3S9MA 4IK2A 4KVME 1YR0A 1TXRA 1CPXA 2AFZA 2BO9A 4MFQA 1YLEA 4P4IA 3CXPA 3BLNA 3MGDA 2ATRA 2VZYA 2P6EA 2ZEDA 1IOIA 3IWWA 4JZ0A 3QAYA 4CAEA 4CRZB 4M6GA 4E2AA 2JBKA 2ZEFA 4A94A 4F6AA 4KLWA 5CNPA 1M4DA 3CXQA 2AFSA 2PJAA 4U9YA 1TKFA 1HEEA 2XEGA 1AMPA 2C6GA 5D29A 3TO9A 4B5PB 3GIUA 1ZG7A 1FT7A 3NH4A 1IICA 2PRQA 4H6ZA 1YVOA 2REFA 4OC2A 4CAVA 3G8WA 4QUSA 4UFXA 2PJBA 4R8FA 1VGYA 4LUAA 2Z3MA 3RYOA 3JTKA 4CYOA 2ZOFA 1XF8A 4LQ6A 2F7VA 3WC7A 5KTAA 2HUZA 4KZTA 2FIWA 1TKHA 5JM6A 4AG9A 2OOTA 4EWTA 3D66A 4P45A 2OB0A 1B6BA 3T8WA 5CBMA 1Z8WA 5I0CA 3D67A 3R9EA 2WUUA 1WWZA 1ZG9A 4ZX9A 4OLLA 5H84A 4B12A 4EMEA 2YNCA 1CP6A 1QSNA 1NE9A 1S7FA 2CTBA 2Q7SA 3PBBA 3BXMA 4PXBA 4UWIA 4MFJA 5K8PA 1YSJA 2Z10A 1TKJA 2DF5A 3G3SA 4MHNA 4GXHA 1LANA 4UA3A 5AGEA 2JLMA 3NA6A 3NH8A 4MI4A 4X2TA 3PFOA 2H5MA 2V8GA 4NCZA 4OIDA 5J1QA 5K8NA 2C27A 1HDUA 2JEVA 4CPAA 2ZEEA 2NYQA 3S6FA 2ZEPA 4A38A 1EE3P 4UWJA 2PJ8A 3D7FA 3IU1A 4MFZA 5LYIA 3BI1A 3I1UA 3IU2A 3LMSA 3D3SA 1QSOA 4KOSA 4AVBA 5K8OA 2Q43A 1VIXA 3JRUA 4AVCA 4OC0A 2EK8A 2HV2A 2EWBA 4QC6A 2PDOA 5F47A 4P4BA 5HH1A 3SJGA 1KWMA 1LOKA 3K9UA 2RFHA 3E0KA 4O23A 1BPMA 2O53A 2QJ8A 2C1CA 1AUGA 3DSBA 2WPWA 1ARMA 1CM0A 2ZELA 4Q36A 4Q38A 1VHSA 3BJ7A 1CPSA 2D4OA 1YW4A 4PSWA 2OZUA 2AFOA 4F9VA 2XEJA 3A9LA 2EBJA 3CPXA 2WZNA 1CG2A 2G3AA 1HDQA 2B4DB 2PSWA 4PV6A 4YFJA 2DEAA 4FD7A 5ISVA 1UFHA 2B5GA 4Y49B 2AFUA 5A27A 1M4LA 2D4PA 4FD4A 4MCPA 3CT9A 3SXNA 2BOAA 4JYWA 1FNOA 2F8HA 5JPHA 4UCNA 2VQYA 3B7IA 4CAFA 1IYKA 3PZJA 1Q2DA 2Z3NA 1CJWA 3DGVA 4KLVA 2OU2A 4X8IA 3EC4A 3NE8A 3PB6X 1Q2YA 4JD6A 4YRHA 2PRBA 5KTCA 1S7LA 4PXEA 4IAVA 5HVGA 3IO1A 1M1DA 1Z8LA 4AXVA 3PGPA 3CPAA 1QSRA 1IOFA 1X10A 2B58A 4UCPA 1I1DA 8CPAA 4NGSA 3KHZA 4X5KA 3EXNA 3K9TA 4P4DA 3GKRA 4KSFA 3B2YA 4GS4A 4CAXA 2B4BA 3IJ3A 4MFLA 2ARHA 3TX8A 3T9YA 4C68A 1PUAA 3PFEA 3SJEA 3C26A 4DUKA 2ZW5A 4MFKA 2PVVA 2YNCC 2JBJA 4WJBA 2P6FA 4OAEA 1R3NA 2I00A 1LRZA 4FD5A 3H8GA 4UEEA 4G1PA 5LYDA 4B10A 4ZI6A 1VKCA 4ZY2A 3FIXA 2ZEMA 4KS9A 3FF3A 3KQZA 4JWPA 3WT4A 4MHYA 3EO4A 6CPAA 1MK4A 4ONWA 3B3TA 4R6TA 3JUWA 2VEZA 2R7HA 4HPSA 4KOWA 2YNDA 1MJBA 3S6KA 2AE6A 4FBEA 4ORFA 1L0CA 3F0AA 2CXAA 1NMTA 3N7ZA 3SJXA 3B3WA 3D2PA 1B87A 4OKOA 5K8MA 4DNCA 4PXCA 3H4QA 3S9NA 2RC4A 4Q7AA 3WC6A 4FAIA 1XE4A 4NGQA 4R76A 1S60A 3FRMA 4XPLA 2B5GB 4C7IA 3KASA 7CPAA 1PU9A 4JJXA 1YGHA 1V0CA 1IU8A 3VWDA 2I3CA 4RN7A 4XNHC 3PB7X 1XIXA 4KOVA 4KOYA 2EO8A 2QECA 4PQAA 2J8MA 4ONUA 1TIQA 4YWYA 3UY5A 5LYLA 4NGMA 2POKA 3TOBA 1JWQA 3IGRA 3LODA 2J8NA 2V8DA 3PRTA 2VXKA 3VARA 2DPSA 2JDCA 2R1IA 2XEIA 2G9DA 3FH4A 1M44A 2Q51A 2Y0MA 1ELMP 1XEBA 2CNMA 3DDDA 3FB3A 3DLJA 3LWUA 4NGPA 4PSXA 4C2YA 5LRKA 2FXFA 4NGNA 2DXQA 2HB6A 1YQEA 2I79A 4LX9A 3W6XA 4AG7A 4BINA 4CYNA 4I49A 4UF4A 5JH9A 4JLYA 5DWMA 4Y49C 1VHEA 1GHEA 2FSRA 2ZEOA 5ELYA 3ISZA 2O28A 1Z2LA 2B3VA 1A2ZA 1K4JA 1XOVA 2PJCA 2FL4A 1WK4A 3D8PA 2F5IA 3KKWA 4NJRA 4PPZA 1XFOA 4MY0A 3P2FA 2CNSA 4OIWA 4P6YA 2WSAA 3P2HA 2ZPAA 4L8AA 1ZG8A 1TF9A 2X7BA 4P44A 4R3LA 4II9A 4PXDA 3MRUA 2PJ3A 4MCSA 2J8RA 2ZEHA 3VWEA 1BAVA 3GY9A 3DNSA 4TNUA 4R3KA 4KOUA 3B3SA 3PBEA 3HUVA 2Q0YA 2V77A 2FCKA 4AB7A 5FVJA 4MHZA 2BCOA 2PR1A 4A39A 5IX3A 3FEDA 3V38A 4OMEA 4HNYB 4B6ZA 4CGPA 2G0BA 2QYVA 3FJUA 3CXSA 3GYAA 3NH5A 3TO7A 3DR6A 5AG7A 4DYOA 2Q04A 4BD9A 2Q4ZA 3BHXA 2PJ6A 4OP4A 1XMTA 4A2ZA 1Y7EA 1Z8XA 2Z11A 4OC1A 2Q4YA 3I3GA 1IYLA 1Z8TA 2JDDA 2PVWA 5HVHA 1MJAA 1Y7RA 3FVLA 1QSTA 1PYTB 4NEXA 4EVYA 4UFWA 5LRJA 3FECA 1KUXA 2ZEGA 3FMCA 1YX0A 2GIVA 2FIAA 3HLPA 3KZWA 1P0HA 3PEIA 2VZZA 4L89A 4M6IA 3WR7A 1YREA 3B3VA 2FE7A 3KI9A 4OADA 4B14A 1N71A 5DS0A 4P4JA 4QB9A 3RBUA 4CGLA 1X12A 1YMEA 3FNCA 4U9ZA 4NSQA 4P4FA 2BSWA 4TWEA 2CNTA 2ODFA 5D8NA 1F2OA 2C6PA 2PJ9A 4JXQA 4ZX8A 4CGOA 2CTCA 2IJZA 1ARLA 2Z3OA
chains in the Genus database with same CATH topology
3R1KA 4RS2A 4C2XA 3SXOA 4B5PA 1MJ9A 1IIDA 1Z4RA 2WPXA 3H5ZA 4HKFA 2KCWA 3OWCA 4F0XA 1P4NA 1QSMA 4XNHB 1R57A 2Q4VA 3QAHA 1J4JA 2Q7BA 3SHPA 4E8OA 1S3ZA 3FXTA 3IWEA 4KOTA 2ZW7A 2OH1A 3T90A 1YVKA 4A31A 2VBQA 2Z3PA 1OZPA 3V8IA 2FS5A 5BWAB 4H6UA 4MJ8A 2BUEA 4R9MA 5G22A 5F46A 4CAWA 3TCVA 1Z4EA 4IF5A 1Y9WA 4K30A 4MY3A 4CYQA 4UBRA 1KUVA 5E96A 5AG6A 4MFPA 1FY7A 3R9GA 4J3GA 2ZW6A 4IUSA 1NSLA 5F48A 5F49A 1KZFA 2Z3LA 4RI1A 4A30A 5G1ZA 4YGOA 2ZXVA 4CRYB 5J8CA 2HQYA 2GE3A 5EC4A 3ZJ0A 2YNEA 1M4IA 2R98A 3W91A 1M4GA 4XPDB 5G20A 5GCNA 5C82A 2P6GA 4CYPA 3FBUA 2DPTA 3R95A 2Z3KA 2EVNA 3TOAA 4BMHA 2CY2A 5G21A 2G3TA 5AG4A 2Z0ZA 5KTDA 2P0WA 4HNWB 4CS0B 3S6HA 2Q44A 2VI7A 5EBVA 2IL4A 4M3SA 3TO6A 3FYNA 5HMNA 3D2MA 3TT2A 1S5KA 2PR8A 4A32A 4UFVA 2ZW4A 4E0AA 5J8FA 3LD2A 5AG5A 4B5OA 1I21A 3JVNA 2NMTA 3PP9A 3R9FA 3F5BA 5DWNA 4MBUA 3TFYA 2AJ6A 4M85A 4C2ZA 5IV0A 1Y9KA 5JQ4A 2R8VA 4FD6A 4A33A 1BOBA 4QVTA 1Q2CA 4XPKA 1ZO0A 3TE4A 4B11A 2YGWA 2QIRA 4QBJA 4PK2A 4KVOE 1U6MA 4F0YA 3R96A 2FT0A 4R87A 2BEIA 2QMLA 4NF1A 4AVAA 3ZZIA 4KSAA 4BBHA 2BL1A 1KUYA 4A95A 2B4DA 3B8GA 4B13A 2REEA 4KVXA 4CGMA 1S7KA 4JXRA 4MHDA 1RO5A 1BO4A 3EY5A 2B3UA 3QB8A 4HNXB 3F8KA 4KORA 4KUAA 1ON0A 1Z9UA 4R57A 4XPDC 2PQ8A 4UCMA 5A28A 2K5TA 5H86A 4KOXA 4ZBGA 2A4NA 2GANA 4U5YA 2PC1A 3EFAA 2OZHA 1SQHA 3S6GA 1YK3A 1I12A 1S7NA 4ZGYB 1RXTA 4H89A 3NE7A 3BJ8A 4KUBA 4CGNA 3I9SA 4PK3A 3W6SA 3IWGA 4C7HA 4CRZB 2EUIA 3TTHA 2OZGA 5C88A 1IB1E 4NXYA 3DR8A 4KVME 1YR0A 4MFQA 1YLEA 3CXPA 3BLNA 3MGDA 2ATRA 2VZYA 2P6EA 4CAEA 4E2AA 4F6AA 4KLWA 5CNPA 1M4DA 3CXQA 4U9YA 4B5PB 3TO9A 4H6ZA 1IICA 1YVOA 2REFA 4CAVA 3G8WA 4QUSA 4UFXA 4LUAA 2Z3MA 3RYOA 3JTKA 4CYOA 1XF8A 5KTAA 2HUZA 4KZTA 2FIWA 4AG9A 2OB0A 1B6BA 5I0CA 3R9EA 2WUUA 1WWZA 5H84A 4OLLA 4B12A 2YNCA 1QSNA 1NE9A 1S7FA 4UWIA 4MFJA 2Z10A 3G3SA 4UA3A 5AGEA 2JLMA 4MI4A 2H5MA 4NCZA 2C27A 2JEVA 3S6FA 4UWJA 3IU1A 4MFZA 3IU2A 3D3SA 1QSOA 4KOSA 4AVBA 4AVCA 4QC6A 2HV2A 5F47A 5HH1A 2PDOA 3K9UA 3E0KA 3DSBA 2WPWA 1CM0A 4Q36A 4Q38A 1VHSA 3BJ7A 2D4OA 4PSWA 2OZUA 3A9LA 2G3AA 2B4DB 2PSWA 4PV6A 4YFJA 4FD7A 5ISVA 1UFHA 2B5GA 4Y49B 5A27A 2D4PA 4FD4A 3SXNA 5JPHA 4UCNA 2VQYA 4CAFA 1IYKA 3PZJA 1Q2DA 2Z3NA 1CJWA 4KLVA 2OU2A 3EC4A 1Q2YA 4JD6A 4YRHA 2PRBA 5KTCA 1S7LA 1M1DA 3PGPA 1QSRA 2B58A 4UCPA 1I1DA 4X5KA 3EXNA 3GKRA 4KSFA 4GS4A 4CAXA 2B4BA 4C68A 2ARHA 3T9YA 1PUAA 3C26A 2ZW5A 4MFKA 2YNCC 2P6FA 4OAEA 5IB0A 2I00A 1LRZA 4FD5A 4B10A 1VKCA 3FIXA 4KS9A 4JWPA 3EO4A 1MK4A 3JUWA 2VEZA 2R7HA 4KOWA 2YNDA 1MJBA 3S6KA 2AE6A 4ORFA 1L0CA 3F0AA 2CXAA 1NMTA 3N7ZA 3D2PA 1B87A 4DNCA 3H4QA 2RC4A 1XE4A 1S60A 3FRMA 4XPLA 2B5GB 4C7IA 1PU9A 4JJXA 1YGHA 1V0CA 3VWDA 4XNHC 1XIXA 4KOVA 4KOYA 2QECA 2J8MA 4ONUA 1TIQA 3UY5A 3TOBA 3IGRA 3LODA 2J8NA 2VXKA 2DPSA 2JDCA 2R1IA 1M44A 2Y0MA 3DDDA 1XEBA 2CNMA 4PSXA 3FB3A 4C2YA 2FXFA 2DXQA 2I79A 4AG7A 4CYNA 4LX9A 3W6XA 4I49A 4JLYA 5DWMA 4Y49C 1GHEA 2FSRA 2B3VA 2O28A 1K4JA 2FL4A 1WK4A 3D8PA 2F5IA 3KKWA 4MY0A 3P2FA 2CNSA 2WSAA 3P2HA 2ZPAA 4L8AA 4R3LA 2X7BA 4II9A 2J8RA 3VWEA 3GY9A 3DNSA 4R3KA 4KOUA 2Q0YA 2FCKA 4AB7A 5FVJA 2PR1A 5IX3A 4CGPA 4EVYA 4HNYB 2G0BA 3GYAA 3CXSA 3TO7A 5AG7A 2Q04A 1XMTA 4A2ZA 2Z11A 2Q4YA 3I3GA 1IYLA 2JDDA 1MJAA 1Y7RA 1QSTA 4NEXA 4UFWA 1KUXA 1YX0A 2GIVA 2FIAA 1P0HA 4L89A 2VZZA 3WR7A 1YREA 2FE7A 4OADA 4B14A 1N71A 4QB9A 4CGLA 3FNCA 4U9ZA 4NSQA 2BSWA 2CNTA 4CGOA 4JXQA 4MFLA 3DR6A 2Z3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFZ A;  4MFQ A;  4MFJ A;  4Q36 A;  4MFP A;  4Q38 A;  4MFL A;  4MFK A; 
#chains in the Genus database with same CATH topology
 3R1K A;  2PIZ A;  4RS2 A;  3D4U A;  2QVP A;  4C2X A;  3SXO A;  3N5F A;  4B5P A;  1MJ9 A;  2CIJ A;  5HVF A;  1CP7 A;  2IMO A;  1IID A;  1Z4R A;  2WPX A;  3H5Z A;  4HKF A;  4IHM A;  2KCW A;  4MXU A;  3OWC A;  4F0X A;  2NSM A;  1P4N A;  1LAM A;  3RO0 A;  1QSM A;  4XNH B;  1R57 A;  1LAP A;  4X3R A;  2Q4V A;  3FEE A;  1J4J A;  3QAH A;  2Q7B A;  3SHP A;  2J9A A;  2VL1 A;  2GU2 A;  4E8O A;  1S3Z A;  3FXT A;  2WYR A;  3IWE A;  4KOT A;  2ZW7 A;  2V8V A;  4NGT A;  2OH1 A;  1RTQ A;  3T90 A;  1YVK A;  4A31 A;  1ELL P;  2VBQ A;  2Z3P A;  1OZP A;  3PB8 X;  4MCQ A;  3V8I A;  2FS5 A;  3S9L A;  5BWA B;  4ZYQ A;  4H6U A;  1R43 A;  3WAB A;  3SJF A;  4MJ8 A;  3H8E A;  2CF4 A;  1DE4 C;  2BUE A;  4R9M A;  5G22 A;  4NFR A;  5F46 A;  1BLL E;  4CAW A;  1LCP A;  2HC9 A;  3PB9 X;  3TCV A;  4MMO A;  2ANP A;  2AFX A;  1Z4E A;  1ZLI A;  2AFM A;  1NSA A;  3KHX A;  4IF5 A;  1Y9W A;  4K30 A;  3CDX A;  4LQG A;  3D7H A;  4MY3 A;  2OR4 A;  4UBR A;  4CYQ A;  1KUV A;  5E96 A;  5AG6 A;  4MFP A;  1FY7 A;  3R9G A;  1Q7L A;  1XMB A;  4ZY0 A;  4J3G A;  3B3C A;  2ZW6 A;  1IY7 A;  1YLO A;  4IUS A;  3VH9 A;  1NSL A;  2PIY A;  3FX6 A;  5F49 A;  5F48 A;  1KZF A;  2Z3L A;  4RI1 A;  3MN8 A;  4A30 A;  5G1Z A;  1XJO A;  3GUX A;  4YGO A;  2ZXV A;  4CRY B;  3IFE A;  3KR5 A;  4W9Y A;  4DJL A;  5J8C A;  2HQY A;  2GE3 A;  5EC4 A;  3RNZ A;  4A37 A;  4FUU A;  3ZJ0 A;  2YNE A;  1M4I A;  2JEW A;  4H2K A;  2R98 A;  3W91 A;  3SI1 A;  2ZOG A;  1M4G A;  3B35 A;  3KGQ A;  3KR4 A;  5THW A;  4XPD B;  5G20 A;  3D7D A;  4MCR A;  5GCN A;  5C82 A;  1Y0Y A;  2XEF A;  2P6G A;  4CYP A;  3FBU A;  3GB0 A;  2DPT A;  3R95 A;  2Z3K A;  4FWU A;  2EVN A;  3TOA A;  4BMH A;  2CY2 A;  5G21 A;  2G3T A;  5AG4 A;  2Z0Z A;  3TC8 A;  4R7M A;  5KTD A;  3BI0 A;  2GLF A;  3D68 A;  3RAM A;  3IEH A;  2P0W A;  4HNW B;  4CS0 B;  3IC1 A;  3S6H A;  2Q44 A;  2VI7 A;  2ABZ A;  5EBV A;  2IL4 A;  4M3S A;  3TO6 A;  3FYN A;  5HMN A;  3D2M A;  5CPA A;  3TT2 A;  1S5K A;  2PR8 A;  4A32 A;  2EK9 A;  2PCU A;  5JGF A;  4UFV A;  4KSI A;  2ZW4 A;  1YW6 A;  4WWV A;  4E0A A;  5J8F A;  3LD2 A;  2O4H A;  5AG5 A;  4YU9 A;  4B5O A;  1I21 A;  3JVN A;  2NMT A;  3PP9 A;  4P10 A;  3R9F A;  3SI0 A;  1F2P A;  3F5B A;  1QMU A;  1JQG A;  5DWN A;  4MBU A;  2GFQ A;  5LRG A;  3TFY A;  2AJ6 A;  1H8L A;  1PCA A;  4M85 A;  4C2Z A;  1F57 A;  2C6C A;  1ZLH A;  5IV0 A;  1Y9K A;  1BPN A;  5EMI A;  5JQ4 A;  2R8V A;  4FD6 A;  2AFW A;  2PJ5 A;  4A33 A;  1BOB A;  2ZEN A;  3CZX A;  3H8F A;  3NFZ A;  4QVT A;  5IB0 A;  1Q2C A;  4EFD A;  4XPK A;  1ZO0 A;  3V7Z A;  3TE4 A;  1XRY A;  4B11 A;  2YGW A;  2RB7 A;  2QIR A;  3KQX A;  1AYE A;  4QBJ A;  4PK2 A;  2V8H A;  4KVO E;  4P4E A;  3L2N A;  3GLJ A;  2PJ1 A;  1U6M A;  4OC3 A;  4F0Y A;  3R96 A;  4UEZ A;  3VAT A;  5F09 A;  3IIB A;  2FT0 A;  3PB4 X;  4R87 A;  2BEI A;  1OBR A;  2QML A;  4UIB A;  2IQ6 A;  4NF1 A;  4AVA A;  4NGR A;  3ZZI A;  3ISX A;  2FVG A;  4KSA A;  4BBH A;  1IGB A;  4UIA A;  2BL1 A;  1KUY A;  4A95 A;  2B4D A;  3B8G A;  3WC5 A;  4B13 A;  2REE A;  1UWY A;  4KVX A;  4ZY1 A;  4CGM A;  4MRI A;  1S7K A;  5LYF A;  4JXR A;  2GRE A;  4MHD A;  1RO5 A;  1BO4 A;  3EY5 A;  2B3U A;  1LFW A;  2PJ0 A;  3QB8 A;  1CBX A;  4HNX B;  3F8K A;  4KOR A;  4KUA A;  1ON0 A;  1Z9U A;  1TF8 A;  3KL9 A;  1QQ9 A;  2GLJ A;  4R57 A;  4GM5 A;  4M6H A;  4K3N A;  4Z65 A;  4XPD C;  2PQ8 A;  4UCM A;  3D7G A;  2K5T A;  5H86 A;  5A28 A;  4KOX A;  4F8Z A;  2PJ7 A;  3SI2 A;  4ZBG A;  5IB9 A;  3K2K A;  1Y0R A;  2A4N A;  2GAN A;  4U5Y A;  2PC1 A;  3EFA A;  5I4M A;  2OZH A;  1SQH A;  2PJ4 A;  2PE3 A;  3LAC A;  3S6G A;  1YK3 A;  1I12 A;  1S7N A;  4UEF A;  4ZGY B;  2PJ2 A;  1RXT A;  4H89 A;  4NJQ A;  3NE7 A;  3BJ8 A;  4KUB A;  1Z5R A;  1DTD A;  4CGN A;  3I9S A;  4PK3 A;  3W6S A;  1CX8 A;  3IWG A;  1GYT A;  3RZA A;  2EUI A;  1VHO A;  3QNV A;  3TTH A;  4C7H A;  4RUH A;  2OZG A;  4MHP A;  4OC5 A;  4OC4 A;  5C88 A;  1XBU A;  1IB1 E;  5HXD A;  4NXY A;  4F9U A;  3DR8 A;  3S9M A;  4IK2 A;  4KVM E;  1YR0 A;  1TXR A;  1CPX A;  2AFZ A;  2BO9 A;  4MFQ A;  1YLE A;  4P4I A;  3CXP A;  3BLN A;  3MGD A;  2ATR A;  2VZY A;  2P6E A;  2ZED A;  1IOI A;  3IWW A;  4JZ0 A;  3QAY A;  4CAE A;  4CRZ B;  4M6G A;  4E2A A;  2JBK A;  2ZEF A;  4A94 A;  4F6A A;  4KLW A;  5CNP A;  1M4D A;  3CXQ A;  2AFS A;  2PJA A;  4U9Y A;  1TKF A;  1HEE A;  2XEG A;  1AMP A;  2C6G A;  5D29 A;  3TO9 A;  4B5P B;  3GIU A;  1ZG7 A;  1FT7 A;  3NH4 A;  1IIC A;  2PRQ A;  4H6Z A;  1YVO A;  2REF A;  4OC2 A;  4CAV A;  3G8W A;  4QUS A;  4UFX A;  2PJB A;  4R8F A;  1VGY A;  4LUA A;  2Z3M A;  3RYO A;  3JTK A;  4CYO A;  2ZOF A;  1XF8 A;  4LQ6 A;  2F7V A;  3WC7 A;  5KTA A;  2HUZ A;  4KZT A;  2FIW A;  1TKH A;  5JM6 A;  4AG9 A;  2OOT A;  4EWT A;  3D66 A;  4P45 A;  2OB0 A;  1B6B A;  3T8W A;  5CBM A;  1Z8W A;  5I0C A;  3D67 A;  3R9E A;  2WUU A;  1WWZ A;  1ZG9 A;  4ZX9 A;  4OLL A;  5H84 A;  4B12 A;  4EME A;  2YNC A;  1CP6 A;  1QSN A;  1NE9 A;  1S7F A;  2CTB A;  2Q7S A;  3PBB A;  3BXM A;  4PXB A;  4UWI A;  4MFJ A;  5K8P A;  1YSJ A;  2Z10 A;  1TKJ A;  2DF5 A;  3G3S A;  4MHN A;  4GXH A;  1LAN A;  4UA3 A;  5AGE A;  2JLM A;  3NA6 A;  3NH8 A;  4MI4 A;  4X2T A;  3PFO A;  2H5M A;  2V8G A;  4NCZ A;  4OID A;  5J1Q A;  5K8N A;  2C27 A;  1HDU A;  2JEV A;  4CPA A;  2ZEE A;  2NYQ A;  3S6F A;  2ZEP A;  4A38 A;  1EE3 P;  4UWJ A;  2PJ8 A;  3D7F A;  3IU1 A;  4MFZ A;  5LYI A;  3BI1 A;  3I1U A;  3IU2 A;  3LMS A;  3D3S A;  1QSO A;  4KOS A;  4AVB A;  5K8O A;  2Q43 A;  1VIX A;  3JRU A;  4AVC A;  4OC0 A;  2EK8 A;  2HV2 A;  2EWB A;  4QC6 A;  2PDO A;  5F47 A;  4P4B A;  5HH1 A;  3SJG A;  1KWM A;  1LOK A;  3K9U A;  2RFH A;  3E0K A;  4O23 A;  1BPM A;  2O53 A;  2QJ8 A;  2C1C A;  1AUG A;  3DSB A;  2WPW A;  1ARM A;  1CM0 A;  2ZEL A;  4Q36 A;  4Q38 A;  1VHS A;  3BJ7 A;  1CPS A;  2D4O A;  1YW4 A;  4PSW A;  2OZU A;  2AFO A;  4F9V A;  2XEJ A;  3A9L A;  2EBJ A;  3CPX A;  2WZN A;  1CG2 A;  2G3A A;  1HDQ A;  2B4D B;  2PSW A;  4PV6 A;  4YFJ A;  2DEA A;  4FD7 A;  5ISV A;  1UFH A;  2B5G A;  4Y49 B;  2AFU A;  5A27 A;  1M4L A;  2D4P A;  4FD4 A;  4MCP A;  3CT9 A;  3SXN A;  2BOA A;  4JYW A;  1FNO A;  2F8H A;  5JPH A;  4UCN A;  2VQY A;  3B7I A;  4CAF A;  1IYK A;  3PZJ A;  1Q2D A;  2Z3N A;  1CJW A;  3DGV A;  4KLV A;  2OU2 A;  4X8I A;  3EC4 A;  3NE8 A;  3PB6 X;  1Q2Y A;  4JD6 A;  4YRH A;  2PRB A;  5KTC A;  1S7L A;  4PXE A;  4IAV A;  5HVG A;  3IO1 A;  1M1D A;  1Z8L A;  4AXV A;  3PGP A;  3CPA A;  1QSR A;  1IOF A;  1X10 A;  2B58 A;  4UCP A;  1I1D A;  8CPA A;  4NGS A;  3KHZ A;  4X5K A;  3EXN A;  3K9T A;  4P4D A;  3GKR A;  4KSF A;  3B2Y A;  4GS4 A;  4CAX A;  2B4B A;  3IJ3 A;  4MFL A;  2ARH A;  3TX8 A;  3T9Y A;  4C68 A;  1PUA A;  3PFE A;  3SJE A;  3C26 A;  4DUK A;  2ZW5 A;  4MFK A;  2PVV A;  2YNC C;  2JBJ A;  4WJB A;  2P6F A;  4OAE A;  1R3N A;  2I00 A;  1LRZ A;  4FD5 A;  3H8G A;  4UEE A;  4G1P A;  5LYD A;  4B10 A;  4ZI6 A;  1VKC A;  4ZY2 A;  3FIX A;  2ZEM A;  4KS9 A;  3FF3 A;  3KQZ A;  4JWP A;  3WT4 A;  4MHY A;  3EO4 A;  6CPA A;  1MK4 A;  4ONW A;  3B3T A;  4R6T A;  3JUW A;  2VEZ A;  2R7H A;  4HPS A;  4KOW A;  2YND A;  1MJB A;  3S6K A;  2AE6 A;  4FBE A;  4ORF A;  1L0C A;  3F0A A;  2CXA A;  1NMT A;  3N7Z A;  3SJX A;  3B3W A;  3D2P A;  1B87 A;  4OKO A;  5K8M A;  4DNC A;  4PXC A;  3H4Q A;  3S9N A;  2RC4 A;  4Q7A A;  3WC6 A;  4FAI A;  1XE4 A;  4NGQ A;  4R76 A;  1S60 A;  3FRM A;  4XPL A;  2B5G B;  4C7I A;  3KAS A;  7CPA A;  1PU9 A;  4JJX A;  1YGH A;  1V0C A;  1IU8 A;  3VWD A;  2I3C A;  4RN7 A;  4XNH C;  3PB7 X;  1XIX A;  4KOV A;  4KOY A;  2EO8 A;  2QEC A;  4PQA A;  2J8M A;  4ONU A;  1TIQ A;  4YWY A;  3UY5 A;  5LYL A;  4NGM A;  2POK A;  3TOB A;  1JWQ A;  3IGR A;  3LOD A;  2J8N A;  2V8D A;  3PRT A;  2VXK A;  3VAR A;  2DPS A;  2JDC A;  2R1I A;  2XEI A;  2G9D A;  3FH4 A;  1M44 A;  2Q51 A;  2Y0M A;  1ELM P;  1XEB A;  2CNM A;  3DDD A;  3FB3 A;  3DLJ A;  3LWU A;  4NGP A;  4PSX A;  4C2Y A;  5LRK A;  2FXF A;  4NGN A;  2DXQ A;  2HB6 A;  1YQE A;  2I79 A;  4LX9 A;  3W6X A;  4AG7 A;  4BIN A;  4CYN A;  4I49 A;  4UF4 A;  5JH9 A;  4JLY A;  5DWM A;  4Y49 C;  1VHE A;  1GHE A;  2FSR A;  2ZEO A;  5ELY A;  3ISZ A;  2O28 A;  1Z2L A;  2B3V A;  1A2Z A;  1K4J A;  1XOV A;  2PJC A;  2FL4 A;  1WK4 A;  3D8P A;  2F5I A;  3KKW A;  4NJR A;  4PPZ A;  1XFO A;  4MY0 A;  3P2F A;  2CNS A;  4OIW A;  4P6Y A;  2WSA A;  3P2H A;  2ZPA A;  4L8A A;  1ZG8 A;  1TF9 A;  2X7B A;  4P44 A;  4R3L A;  4II9 A;  4PXD A;  3MRU A;  2PJ3 A;  4MCS A;  2J8R A;  2ZEH A;  3VWE A;  1BAV A;  3GY9 A;  3DNS A;  4TNU A;  4R3K A;  4KOU A;  3B3S A;  3PBE A;  3HUV A;  2Q0Y A;  2V77 A;  2FCK A;  4AB7 A;  5FVJ A;  4MHZ A;  2BCO A;  2PR1 A;  4A39 A;  5IX3 A;  3FED A;  3V38 A;  4OME A;  4HNY B;  4B6Z A;  4CGP A;  2G0B A;  2QYV A;  3FJU A;  3CXS A;  3GYA A;  3NH5 A;  3TO7 A;  3DR6 A;  5AG7 A;  4DYO A;  2Q04 A;  4BD9 A;  2Q4Z A;  3BHX A;  2PJ6 A;  4OP4 A;  1XMT A;  4A2Z A;  1Y7E A;  1Z8X A;  2Z11 A;  4OC1 A;  2Q4Y A;  3I3G A;  1IYL A;  1Z8T A;  2JDD A;  2PVW A;  5HVH A;  1MJA A;  1Y7R A;  3FVL A;  1QST A;  1PYT B;  4NEX A;  4EVY A;  4UFW A;  5LRJ A;  3FEC A;  1KUX A;  2ZEG A;  3FMC A;  1YX0 A;  2GIV A;  2FIA A;  3HLP A;  3KZW A;  1P0H A;  3PEI A;  2VZZ A;  4L89 A;  4M6I A;  3WR7 A;  1YRE A;  3B3V A;  2FE7 A;  3KI9 A;  4OAD A;  4B14 A;  1N71 A;  5DS0 A;  4P4J A;  4QB9 A;  3RBU A;  4CGL A;  1X12 A;  1YME A;  3FNC A;  4U9Z A;  4NSQ A;  4P4F A;  2BSW A;  4TWE A;  2CNT A;  2ODF A;  5D8N A;  1F2O A;  2C6P A;  2PJ9 A;  4JXQ A;  4ZX8 A;  4CGO A;  2CTC A;  2IJZ A;  1ARL A;  2Z3O A; 
#chains in the Genus database with same CATH homology
 3R1K A;  4RS2 A;  4C2X A;  3SXO A;  4B5P A;  1MJ9 A;  1IID A;  1Z4R A;  2WPX A;  3H5Z A;  4HKF A;  2KCW A;  3OWC A;  4F0X A;  1P4N A;  1QSM A;  4XNH B;  1R57 A;  2Q4V A;  3QAH A;  1J4J A;  2Q7B A;  3SHP A;  4E8O A;  1S3Z A;  3FXT A;  3IWE A;  4KOT A;  2ZW7 A;  2OH1 A;  3T90 A;  1YVK A;  4A31 A;  2VBQ A;  2Z3P A;  1OZP A;  3V8I A;  2FS5 A;  5BWA B;  4H6U A;  4MJ8 A;  2BUE A;  4R9M A;  5G22 A;  5F46 A;  4CAW A;  3TCV A;  1Z4E A;  4IF5 A;  1Y9W A;  4K30 A;  4MY3 A;  4CYQ A;  4UBR A;  1KUV A;  5E96 A;  5AG6 A;  4MFP A;  1FY7 A;  3R9G A;  4J3G A;  2ZW6 A;  4IUS A;  1NSL A;  5F48 A;  5F49 A;  1KZF A;  2Z3L A;  4RI1 A;  4A30 A;  5G1Z A;  4YGO A;  2ZXV A;  4CRY B;  5J8C A;  2HQY A;  2GE3 A;  5EC4 A;  3ZJ0 A;  2YNE A;  1M4I A;  2R98 A;  3W91 A;  1M4G A;  4XPD B;  5G20 A;  5GCN A;  5C82 A;  2P6G A;  4CYP A;  3FBU A;  2DPT A;  3R95 A;  2Z3K A;  2EVN A;  3TOA A;  4BMH A;  2CY2 A;  5G21 A;  2G3T A;  5AG4 A;  2Z0Z A;  5KTD A;  2P0W A;  4HNW B;  4CS0 B;  3S6H A;  2Q44 A;  2VI7 A;  5EBV A;  2IL4 A;  4M3S A;  3TO6 A;  3FYN A;  5HMN A;  3D2M A;  3TT2 A;  1S5K A;  2PR8 A;  4A32 A;  4UFV A;  2ZW4 A;  4E0A A;  5J8F A;  3LD2 A;  5AG5 A;  4B5O A;  1I21 A;  3JVN A;  2NMT A;  3PP9 A;  3R9F A;  3F5B A;  5DWN A;  4MBU A;  3TFY A;  2AJ6 A;  4M85 A;  4C2Z A;  5IV0 A;  1Y9K A;  5JQ4 A;  2R8V A;  4FD6 A;  4A33 A;  1BOB A;  4QVT A;  1Q2C A;  4XPK A;  1ZO0 A;  3TE4 A;  4B11 A;  2YGW A;  2QIR A;  4QBJ A;  4PK2 A;  4KVO E;  1U6M A;  4F0Y A;  3R96 A;  2FT0 A;  4R87 A;  2BEI A;  2QML A;  4NF1 A;  4AVA A;  3ZZI A;  4KSA A;  4BBH A;  2BL1 A;  1KUY A;  4A95 A;  2B4D A;  3B8G A;  4B13 A;  2REE A;  4KVX A;  4CGM A;  1S7K A;  4JXR A;  4MHD A;  1RO5 A;  1BO4 A;  3EY5 A;  2B3U A;  3QB8 A;  4HNX B;  3F8K A;  4KOR A;  4KUA A;  1ON0 A;  1Z9U A;  4R57 A;  4XPD C;  2PQ8 A;  4UCM A;  5A28 A;  2K5T A;  5H86 A;  4KOX A;  4ZBG A;  2A4N A;  2GAN A;  4U5Y A;  2PC1 A;  3EFA A;  2OZH A;  1SQH A;  3S6G A;  1YK3 A;  1I12 A;  1S7N A;  4ZGY B;  1RXT A;  4H89 A;  3NE7 A;  3BJ8 A;  4KUB A;  4CGN A;  3I9S A;  4PK3 A;  3W6S A;  3IWG A;  4C7H A;  4CRZ B;  2EUI A;  3TTH A;  2OZG A;  5C88 A;  1IB1 E;  4NXY A;  3DR8 A;  4KVM E;  1YR0 A;  4MFQ A;  1YLE A;  3CXP A;  3BLN A;  3MGD A;  2ATR A;  2VZY A;  2P6E A;  4CAE A;  4E2A A;  4F6A A;  4KLW A;  5CNP A;  1M4D A;  3CXQ A;  4U9Y A;  4B5P B;  3TO9 A;  4H6Z A;  1IIC A;  1YVO A;  2REF A;  4CAV A;  3G8W A;  4QUS A;  4UFX A;  4LUA A;  2Z3M A;  3RYO A;  3JTK A;  4CYO A;  1XF8 A;  5KTA A;  2HUZ A;  4KZT A;  2FIW A;  4AG9 A;  2OB0 A;  1B6B A;  5I0C A;  3R9E A;  2WUU A;  1WWZ A;  5H84 A;  4OLL A;  4B12 A;  2YNC A;  1QSN A;  1NE9 A;  1S7F A;  4UWI A;  4MFJ A;  2Z10 A;  3G3S A;  4UA3 A;  5AGE A;  2JLM A;  4MI4 A;  2H5M A;  4NCZ A;  2C27 A;  2JEV A;  3S6F A;  4UWJ A;  3IU1 A;  4MFZ A;  3IU2 A;  3D3S A;  1QSO A;  4KOS A;  4AVB A;  4AVC A;  4QC6 A;  2HV2 A;  5F47 A;  5HH1 A;  2PDO A;  3K9U A;  3E0K A;  3DSB A;  2WPW A;  1CM0 A;  4Q36 A;  4Q38 A;  1VHS A;  3BJ7 A;  2D4O A;  4PSW A;  2OZU A;  3A9L A;  2G3A A;  2B4D B;  2PSW A;  4PV6 A;  4YFJ A;  4FD7 A;  5ISV A;  1UFH A;  2B5G A;  4Y49 B;  5A27 A;  2D4P A;  4FD4 A;  3SXN A;  5JPH A;  4UCN A;  2VQY A;  4CAF A;  1IYK A;  3PZJ A;  1Q2D A;  2Z3N A;  1CJW A;  4KLV A;  2OU2 A;  3EC4 A;  1Q2Y A;  4JD6 A;  4YRH A;  2PRB A;  5KTC A;  1S7L A;  1M1D A;  3PGP A;  1QSR A;  2B58 A;  4UCP A;  1I1D A;  4X5K A;  3EXN A;  3GKR A;  4KSF A;  4GS4 A;  4CAX A;  2B4B A;  4C68 A;  2ARH A;  3T9Y A;  1PUA A;  3C26 A;  2ZW5 A;  4MFK A;  2YNC C;  2P6F A;  4OAE A;  5IB0 A;  2I00 A;  1LRZ A;  4FD5 A;  4B10 A;  1VKC A;  3FIX A;  4KS9 A;  4JWP A;  3EO4 A;  1MK4 A;  3JUW A;  2VEZ A;  2R7H A;  4KOW A;  2YND A;  1MJB A;  3S6K A;  2AE6 A;  4ORF A;  1L0C A;  3F0A A;  2CXA A;  1NMT A;  3N7Z A;  3D2P A;  1B87 A;  4DNC A;  3H4Q A;  2RC4 A;  1XE4 A;  1S60 A;  3FRM A;  4XPL A;  2B5G B;  4C7I A;  1PU9 A;  4JJX A;  1YGH A;  1V0C A;  3VWD A;  4XNH C;  1XIX A;  4KOV A;  4KOY A;  2QEC A;  2J8M A;  4ONU A;  1TIQ A;  3UY5 A;  3TOB A;  3IGR A;  3LOD A;  2J8N A;  2VXK A;  2DPS A;  2JDC A;  2R1I A;  1M44 A;  2Y0M A;  3DDD A;  1XEB A;  2CNM A;  4PSX A;  3FB3 A;  4C2Y A;  2FXF A;  2DXQ A;  2I79 A;  4AG7 A;  4CYN A;  4LX9 A;  3W6X A;  4I49 A;  4JLY A;  5DWM A;  4Y49 C;  1GHE A;  2FSR A;  2B3V A;  2O28 A;  1K4J A;  2FL4 A;  1WK4 A;  3D8P A;  2F5I A;  3KKW A;  4MY0 A;  3P2F A;  2CNS A;  2WSA A;  3P2H A;  2ZPA A;  4L8A A;  4R3L A;  2X7B A;  4II9 A;  2J8R A;  3VWE A;  3GY9 A;  3DNS A;  4R3K A;  4KOU A;  2Q0Y A;  2FCK A;  4AB7 A;  5FVJ A;  2PR1 A;  5IX3 A;  4CGP A;  4EVY A;  4HNY B;  2G0B A;  3GYA A;  3CXS A;  3TO7 A;  5AG7 A;  2Q04 A;  1XMT A;  4A2Z A;  2Z11 A;  2Q4Y A;  3I3G A;  1IYL A;  2JDD A;  1MJA A;  1Y7R A;  1QST A;  4NEX A;  4UFW A;  1KUX A;  1YX0 A;  2GIV A;  2FIA A;  1P0H A;  4L89 A;  2VZZ A;  3WR7 A;  1YRE A;  2FE7 A;  4OAD A;  4B14 A;  1N71 A;  4QB9 A;  4CGL A;  3FNC A;  4U9Z A;  4NSQ A;  2BSW A;  2CNT A;  4CGO A;  4JXQ A;  4MFL A;  3DR6 A;  2Z3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...