4MFQA

The crystal structure of acyltransferase in complex with coa and 10c-teicoplanin
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
323
structure length
323
Chain Sequence
MDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLAVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein tcp24
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Transferase/antibiotic
total genus 109
structure length 323
sequence length 323
ec nomenclature ec 2.3.1.-:
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mfqA02
4MFLA 4MFJA 4MFQA 4MFKA 4Q38A 4MFPA 4MFZA 4Q36A
chains in the Genus database with same CATH superfamily
4QC6A 4AB7A 4NF1A 1KUYA 4OC1A 2B4DA 4H6UA 4CRZB 4OC2A 1XRYA 1KUXA 4AVAA 2Y0MA 2ZEPA 3D3SA 3LD2A 4GS4A 1Y0YA 2PJAA 4RS2A 3F0AA 2ABZA 4QB9A 2WYRA 3PB8X 3PRTA 1IGBA 1YGHA 3L2NA 2Z3PA 3KQZA 4OC3A 3NFZA 2WSAA 1CP6A 2IMOA 4UBRA 4F9UA 3LMSA 2XEGA 2V8HA 1I1DA 2CNTA 5ISVA 1YSJA 2ZELA 3BJ8A 4KUBA 4KSAA 4EWTA 5HVFA 2CNMA 5K8PA 4CAVA 3V8IA 2DXQA 2C6GA 2CY2A 3DDDA 3E0KA 1IYKA 1LFWA 1Z8LA 2DPSA 2J8MA 3NE8A 3R1KA 4GM5A 3S6HA 4B13A 2IQ6A 4CS0B 3VARA 2R8VA 2ZEDA 2AE6A 1IB1E 3CXQA 2JEWA 1R3NA 2GREA 2QIRA 5AG7A 4YGOA 4UFVA 1Y0RA 3DSBA 3IWGA 4KUAA 4BMHA 3JRUA 2AFOA 1S7NA 3KHXA 3IWEA 4MHZA 4EVYA 4JWPA 4FD6A 3CZXA 1TXRA 3TOBA 1P0HA 3GIUA 1CM0A 2WPXA 2ARHA 2AFMA 1ZG7A 4Z65A 1YK3A 2GIVA 2G9DA 3PB7X 4KOWA 4KZTA 5JM6A 4BINA 4M6HA 1SQHA 5F49A 3WC5A 1QSRA 5LYFA 2JDCA 4B5PB 3CT9A 3R95A 3D7GA 3T8WA 4KLVA 4CPAA 1ON0A 2EK9A 5J8CA 2VXKA 3H8GA 4OC0A 3ZZIA 2ZEGA 2QMLA 3F8KA 4IUSA 3IFEA 1KUVA 2BUEA 1NSLA 3T90A 3HUVA 3D66A 2C1CA 3TCVA 2FSRA 4MHPA 3H8FA 2XEFA 1F57A 4GXHA 4MY0A 3TO7A 4MFLA 2P6FA 4NGQA 5A28A 3P2FA 1AMPA 4LQ6A 1TKJA 4WJBA 4FAIA 1Y9WA 1Z8WA 2CIJA 4P44A 4NFRA 2G3TA 1H8LA 4NSQA 1XF8A 4R8FA 2EUIA 2EO8A 2RB7A 4ONUA 4OMEA 4U5YA 4MJ8A 4Q7AA 1RO5A 1QSTA 2CF4A 1JWQA 3QB8A 5CNPA 4IHMA 4YRHA 2PJ9A 2ANPA 2PC1A 3FMCA 4ZX8A 2P6EA 1VIXA 1XMTA 2VBQA 3N7ZA 4OC4A 5D29A 1CBXA 3JVNA 4H2KA 2PJ4A 4DNCA 1Q2YA 1ZG9A 3NE7A 1QSMA 2VZZA 4MFJA 1M4DA 1KWMA 1ZG8A 2VQYA 5G22A 3B2YA 1GHEA 2BCOA 2G3AA 5CBMA 4JXQA 3H8EA 2V8DA 3JUWA 3B7IA 1XIXA 3EY5A 1S7LA 1CPSA 3PZJA 7CPAA 3EFAA 3G3SA 1WK4A 5I0CA 2Z10A 5K8OA 3RBUA 2PSWA 1Z8TA 2IL4A 2OH1A 4LQGA 2CXAA 3PBEA 4OLLA 2C27A 4E8OA 4JJXA 3SJGA 3CDXA 2A4NA 2V8GA 3EO4A 4MFPA 3D67A 4X2TA 1UWYA 2Q4YA 5G21A 3FB3A 3KQXA 2PJ2A 2Q44A 2CTCA 1Z4EA 3FYNA 4JZ0A 5FVJA 2YNCC 3WR7A 5DWMA 4OADA 3MRUA 4PXBA 5JH9A 3FBUA 1LANA 4F6AA 4ZX9A 4KSIA 1WWZA 4NJRA 4NGNA 3F5BA 4F0XA 2PDOA 3KI9A 3S9NA 5K8MA 1AUGA 2PR8A 1ZLHA 4A32A 1B6BA 2PVVA 5IB0A 2PR1A 2ZEFA 3IEHA 1YW4A 2OU2A 4NGMA 4C2YA 4ZGYB 5LRKA 3SI2A 3RYOA 4M3SA 1XOVA 3B3TA 2VI7A 4HNWB 3GKRA 4XPDB 4MI4A 3JTKA 2JDDA 4C2XA 3I1UA 4R3LA 2OZUA 4MRIA 3D8PA 4EMEA 4NJQA 2CNSA 3D7FA 5C82A 2FIWA 3A9LA 3B8GA 3PP9A 4KVOE 4NXYA 4OKOA 1Z9UA 2Z3LA 2Q51A 4IAVA 2PRBA 1V0CA 3TTHA 2AFXA 1LAMA 2WZNA 2ATRA 2FVGA 2P6GA 4MY3A 4NGTA 5LYIA 3NH5A 3KL9A 4B6ZA 1VHEA 1I21A 2Z3MA 1CJWA 5F46A 2PJ3A 1F2OA 2ZW5A 3K2KA 2Z0ZA 5K8NA 3SI1A 1L0CA 1S5KA 4Q36A 2HUZA 4OP4A 2Z3OA 5HH1A 4Q38A 3D7HA 4UCPA 3W91A 1Q7LA 1TKFA 2ZOGA 4I49A 4KOUA 4AXVA 4KORA 2AFUA 2Z3NA 1Y7RA 4IF5A 3PB6X 3IJ3A 2EK8A 1KZFA 4MHYA 2OZHA 3S6GA 2PRQA 1A2ZA 3VH9A 4PK2A 3D2PA 4CYOA 1CG2A 3R96A 1Q2DA 2EBJA 2PJ6A 3VATA 5HMNA 2I00A 3EC4A 4CYQA 4B14A 2O4HA 3W6SA 3IC1A 3VWDA 4UCMA 2GFQA 3SJEA 2REEA 3WABA 3I9SA 1ARMA 4Y49B 2YNDA 4BD9A 3IO1A 4XPLA 4JLYA 1X12A 4X5KA 2VEZA 4B10A 3IU1A 4HNXB 1ELLP 1EE3P 5JGFA 1IY7A 4A38A 4XNHB 3IIBA 2HQYA 1LAPA 3V38A 4FD5A 2O28A 2PIYA 5F47A 4ORFA 3B3SA 3C26A 4MMOA 2Q4ZA 4P4EA 3FF3A 2KCWA 4NGSA 4A31A 4NEXA 2AFSA 4UEFA 3IGRA 4ZY1A 4A39A 2OB0A 2HC9A 1NMTA 3QNVA 4OIDA 6CPAA 4L8AA 2Q43A 4BBHA 3FJUA 4P45A 3S6FA 4C7IA 3FVLA 3HLPA 3KR4A 4KOVA 4XPKA 1VHOA 2C6PA 3EXNA 2FT0A 1BLLE 4YU9A 5D8NA 2IJZA 4PPZA 2BL1A 3DR8A 4FD4A 5THWA 2R1IA 3ISZA 1FT7A 2R98A 2JLMA 2VL1A 3PB9X 4RN7A 4UFXA 5J8FA 1X10A 3LWUA 1Z4RA 2GU2A 4PXDA 4UIAA 2Q7BA 4CYNA 4A33A 2Q7SA 3V7ZA 2FXFA 2QYVA 4JYWA 4NCZA 2RC4A 2PJ1A 3K9TA 2I3CA 1CP7A 1PCAA 3H4QA 2PIZA 1S7KA 5LRJA 3GUXA 4XPDC 4O23A 4KOXA 3D4UA 4EFDA 2AFZA 2V77A 4HKFA 2AJ6A 2B4DB 3D68A 3QAYA 5EC4A 1PYTB 2VZYA 1LCPA 5AG6A 1M4LA 3FIXA 4KLWA 5E96A 4CGMA 1S3ZA 1YVKA 2PVWA 4YFJA 4P10A 1YW6A 4QVTA 4CAXA 4FBEA 2PE3A 4UWIA 5H86A 5G20A 3TO9A 2HB6A 4KOYA 1XE4A 3CPAA 4PK3A 3RZAA 1QQ9A 1YVOA 2B4BA 3PGPA 4UCNA 5H84A 2O53A 2DEAA 4MFKA 3RAMA 3MN8A 1VGYA 4UWJA 1AYEA 4CAWA 4J3GA 4E2AA 2NYQA 2FS5A 4MCPA 2BOAA 3SI0A 2JBKA 2ODFA 4AVCA 1QSNA 4R3KA 4UFWA 3FECA 4FD7A 5AGEA 3N5FA 4PXCA 4UA3A 3WC7A 2ZW4A 4A30A 3BLNA 2K5TA 2QJ8A 3MGDA 1M44A 1Y9KA 5AG5A 1TF8A 5JQ4A 4MXUA 4QBJA 4P6YA 4NGRA 1NSAA 3TE4A 2YGWA 1R57A 4A37A 3FX6A 4CAFA 5DS0A 1XBUA 2ZEEA 1JQGA 2J9AA 1VKCA 2V8VA 3GY9A 4Y49C 5C88A 1MJBA 4R7MA 1YQEA 8CPAA 2GANA 3SJFA 3NH4A 4P4BA 4PSWA 4WWVA 1OZPA 3BJ7A 1IICA 4ZYQA 3IU2A 4XNHC 3GLJA 4UEZA 4RUHA 5F09A 4FUUA 3B3WA 2D4OA 4P4JA 5LRGA 4UEEA 5J1QA 2BO9A 1P4NA 1TF9A 3FEDA 1B87A 3DR6A 3FH4A 3S9MA 2WPWA 4H89A 4X3RA 2ZXVA 1IIDA 2FL4A 3WC6A 4A94A 2AFWA 1R43A 3KGQA 5CPAA 3K9UA 4M6IA 5DWNA 1CX8A 3DGVA 2ZEMA 4HPSA 1RTQA 4IK2A 3B3VA 2J8NA 3FEEA 4ONWA 4P4IA 2PJ8A 4F8ZA 1S60A 3BI0A 1XJOA 4F9VA 5KTCA 3KZWA 2ZW7A 3IWWA 4PV6A 4E0AA 3GB0A 3OWCA 4F0YA 2JEVA 3CPXA 1YLEA 3KHZA 1S7FA 3S6KA 4B12A 2B5GA 2GE3A 1YX0A 4UIBA 4ZBGA 3LACA 1XMBA 2POKA 2G0BA 3R9EA 2JBJA 2F8HA 4P4DA 4B11A 4CGOA 4KS9A 1FNOA 1TKHA 2OR4A 2PJ7A 3D2MA 1Q2CA 4DUKA 1LRZA 1CPXA 4MCQA 5I4MA 3DLJA 4U9ZA 1RXTA 2FCKA 1QMUA 4R9MA 3TT2A 4W9YA 3W6XA 4R87A 3KKWA 4CAEA 4G1PA 4U9YA 1PU9A 2F5IA 2HV2A 5HVGA 5HXDA 4MCSA 4H6ZA 5BWAB 1HDQA 2RFHA 1FY7A 4X8IA 1MJ9A 2EWBA 2PCUA 1DTDA 3P2HA 3R9GA 2XEIA 4MHDA 1M4GA 5KTAA 4CGLA 3PEIA 2GLFA 2PJ0A 3H5ZA 4PSXA 4R57A 1VHSA 4NGPA 1F2PA 4MFZA 3ZJ0A 2PJ5A 4OIWA 5HVHA 3ISXA 3NH8A 4C68A 1YR0A 2YNEA 2J8RA 3PFEA 2F7VA 3TC8A 3GYAA 3QAHA 3TX8A 1XEBA 4PXEA 1J4JA 2ZEHA 4OC5A 5ELYA 4ZY2A 3FNCA 2H5MA 2DF5A 4AVBA 3NA6A 2Z11A 4TWEA 1HDUA 4C2ZA 3PBBA 2Q4VA 2Z3KA 1HEEA 1ELMP 2ZENA 4MHNA 3FXTA 2WUUA 3DNSA 5F48A 3CXPA 1PUAA 1M4IA 2OOTA 4FWUA 2PJCA 4P4FA 4A2ZA 5AG4A 1ZLIA 4K3NA 5EMIA 4RI1A 1GYTA 2X7BA 5JPHA 3B35A 1Z2LA 2P0WA 4R6TA 2ZW6A 4JXRA 3WT4A 4AG9A 4OAEA 4MCRA 4AG7A 4K30A 3RNZA 4MFQA 3B3CA 4KVXA 3TOAA 5LYDA 2YNCA 2Q04A 2BSWA 4II9A 2REFA 1I12A 3LODA 4M6GA 2PJBA 4L89A 4HNYB 4DJLA 2DPTA 3TO6A 3SHPA 2BEIA 5IX3A 2B3VA 1XFOA 3CXSA 1M1DA 5GCNA 1U6MA 1IOIA 1UFHA 5IV0A 1BAVA 2C6CA 3D7DA 1ARLA 1Z8XA 1IOFA 3KASA 3PFOA 2D4PA 4A95A 2ZPAA 4KVME 4MBUA 3RO0A 4KOTA 4B5PA 3T9YA 1DE4C 2PQ8A 2CTBA 2ZEOA 3I3GA 1N71A 1YLOA 1QSOA 3TFYA 4TNUA 4CRYB 1K4JA 1TIQA 4QUSA 2B5GB 2QECA 4CYPA 3SXNA 3VWEA 4UF4A 3KR5A 4DYOA 5IB9A 2OZGA 4CGNA 2R7HA 2QVPA 4LX9A 4M85A 1IU8A 1YMEA 2B3UA 1OBRA 4R76A 4YWYA 4JD6A 4KOSA 1Y7EA 3PB4X 4ZI6A 4LUAA 2B58A 3G8WA 3SXOA 2FIAA 1MK4A 2I79A 4C7HA 2XEJA 3FRMA 4B5OA 2FE7A 4KSFA 4PQAA 1NE9A 5G1ZA 5EBVA 1BO4A 1MJAA 3UY5A 5KTDA 2ZOFA 3R9FA 3BI1A 3SJXA 3BHXA 1Z5RA 1BPNA 3BXMA 4CGPA 4ZY0A 5LYLA 2NSMA 2NMTA 2Q0YA 1ZO0A 1LOKA 1YREA 1BPMA 1BOBA 5A27A 2EVNA 1IYLA 2GLJA 3S9LA
chains in the Genus database with same CATH topology
4QC6A 4AB7A 4NF1A 1KUYA 2B4DA 4H6UA 4CRZB 1KUXA 4AVAA 2Y0MA 3D3SA 3LD2A 4GS4A 4RS2A 3F0AA 4QB9A 1YGHA 2Z3PA 2WSAA 4UBRA 1I1DA 2CNTA 5ISVA 4KUBA 3BJ8A 4KSAA 2CNMA 4CAVA 3V8IA 2DXQA 3E0KA 2CY2A 3DDDA 3R1KA 1IYKA 2J8MA 4CRYB 2DPSA 3S6HA 4B13A 4CS0B 2R8VA 2AE6A 1IB1E 3CXQA 5AG7A 4YGOA 2QIRA 4UFVA 4KUAA 3DSBA 3IWGA 4BMHA 1S7NA 3IWEA 4EVYA 4JWPA 4FD6A 3TOBA 1P0HA 1CM0A 2WPXA 2ARHA 1YK3A 2GIVA 4KOWA 4KZTA 1SQHA 5F49A 1QSRA 2JDCA 4B5PB 3R95A 4KLVA 1ON0A 5J8CA 2VXKA 3ZZIA 3F8KA 2QMLA 4IUSA 1KUVA 2BUEA 1NSLA 3T90A 3TCVA 2FSRA 4MY0A 3TO7A 4MFLA 2P6FA 5A28A 3P2FA 1Y9WA 2G3TA 4NSQA 1XF8A 2EUIA 4ONUA 4U5YA 4MJ8A 1RO5A 1QSTA 3QB8A 5CNPA 4YRHA 2PC1A 2P6EA 1XMTA 2VBQA 3N7ZA 3JVNA 4DNCA 1Q2YA 3NE7A 1QSMA 2VZZA 4MFJA 1M4DA 5G22A 2VQYA 1GHEA 2G3AA 4JXQA 3JUWA 1XIXA 3EY5A 1S7LA 3PZJA 3EFAA 3G3SA 1WK4A 5I0CA 2Z10A 2PSWA 4E8OA 2IL4A 2OH1A 2CXAA 4OLLA 2C27A 4JJXA 4MFPA 2A4NA 3EO4A 2Q4YA 5G21A 3FB3A 2Q44A 1Z4EA 3FYNA 5FVJA 2YNCC 3WR7A 5DWMA 4OADA 3FBUA 4F6AA 1WWZA 3F5BA 4F0XA 2PDOA 2PR8A 4A32A 1B6BA 5IB0A 2PR1A 4ZGYB 4C2YA 2OU2A 3RYOA 4M3SA 4HNWB 2VI7A 3GKRA 4XPDB 4MI4A 3JTKA 2JDDA 4C2XA 4R3LA 2OZUA 3D8PA 2CNSA 5C82A 2FIWA 3A9LA 3B8GA 3PP9A 4KVOE 4NXYA 1Z9UA 2Z3LA 2PRBA 1V0CA 3TTHA 2ATRA 2P6GA 4MY3A 2Z3MA 1I21A 5F46A 1CJWA 2ZW5A 2Z0ZA 1S5KA 1L0CA 4Q36A 2HUZA 2Z3OA 5HH1A 4Q38A 4UCPA 3W91A 4KOUA 4I49A 4KORA 4IF5A 2Z3NA 1Y7RA 1KZFA 2OZHA 3S6GA 4PK2A 3D2PA 4CYOA 3R96A 1Q2DA 2I00A 3EC4A 4CYQA 4B14A 3W6SA 3VWDA 4UCMA 2REEA 3I9SA 4Y49B 2YNDA 4XPLA 4JLYA 4X5KA 2VEZA 4B10A 3IU1A 4HNXB 4XNHB 2HQYA 4FD5A 2O28A 5F47A 4ORFA 3C26A 4A31A 2KCWA 4NEXA 3IGRA 2OB0A 1NMTA 4L8AA 4BBHA 3S6FA 4C7IA 4KOVA 4XPKA 3EXNA 2FT0A 2BL1A 3DR8A 4FD4A 2R1IA 2R98A 2JLMA 4UFXA 5J8FA 1Z4RA 2Q7BA 4CYNA 4A33A 2FXFA 4NCZA 2RC4A 3H4QA 1S7KA 4XPDC 4KOXA 4HKFA 2AJ6A 2B4DB 5EC4A 2VZYA 5AG6A 4KLWA 3FIXA 5E96A 4CGMA 1S3ZA 1YVKA 4YFJA 4QVTA 4CAXA 4UWIA 5H86A 5G20A 3TO9A 4KOYA 1XE4A 4PK3A 3PGPA 1YVOA 2B4BA 4UCNA 5H84A 5HMNA 4MFKA 4UWJA 4CAWA 4J3GA 4E2AA 2FS5A 4AVCA 1QSNA 4R3KA 4UFWA 4FD7A 5AGEA 4UA3A 2ZW4A 4A30A 3BLNA 2K5TA 3MGDA 1M44A 1Y9KA 5AG5A 5JQ4A 4QBJA 3TE4A 2YGWA 1R57A 4CAFA 1VKCA 3GY9A 5C88A 4Y49C 1MJBA 2GANA 4PSWA 1OZPA 3BJ7A 1IICA 3IU2A 4XNHC 2D4OA 1P4NA 1B87A 3DR6A 2WPWA 4H89A 2ZXVA 1IIDA 2FL4A 3K9UA 5DWNA 2J8NA 1S60A 5KTCA 2ZW7A 4PV6A 4E0AA 4F0YA 3OWCA 2JEVA 1YLEA 1S7FA 3S6KA 4B12A 2B5GA 2GE3A 1YX0A 4ZBGA 2G0BA 3R9EA 4B11A 4CGOA 4KS9A 3D2MA 1Q2CA 1LRZA 4U9ZA 3TT2A 1RXTA 2FCKA 4R9MA 3W6XA 4R87A 3KKWA 4CAEA 4U9YA 1PU9A 2F5IA 2HV2A 4H6ZA 5BWAB 1FY7A 1MJ9A 3P2HA 3R9GA 4MHDA 5KTAA 1M4GA 4CGLA 4PSXA 3H5ZA 4R57A 1VHSA 4MFZA 3ZJ0A 4C68A 1YR0A 2YNEA 2J8RA 3GYAA 3QAHA 1XEBA 1J4JA 3FNCA 2H5MA 4AVBA 2Z11A 4C2ZA 2Q4VA 2Z3KA 3FXTA 2WUUA 3DNSA 5F48A 3CXPA 1PUAA 1M4IA 4A2ZA 5AG4A 4RI1A 2X7BA 5JPHA 2P0WA 2ZW6A 4JXRA 4AG7A 4AG9A 4OAEA 4K30A 4MFQA 4KVXA 3TOAA 2YNCA 2Q04A 2BSWA 4II9A 2REFA 1I12A 3LODA 4L89A 4HNYB 2DPTA 3TO6A 3SHPA 2BEIA 5IX3A 2B3VA 3CXSA 1M1DA 5GCNA 1U6MA 1UFHA 5IV0A 2D4PA 4A95A 2ZPAA 4KVME 4MBUA 4KOTA 4B5PA 3T9YA 2PQ8A 3I3GA 1N71A 1QSOA 3TFYA 1K4JA 1TIQA 4QUSA 2B5GB 2QECA 4CYPA 3SXNA 3VWEA 2OZGA 4CGNA 2R7HA 4LX9A 4M85A 2B3UA 4JD6A 4KOSA 4LUAA 2B58A 3G8WA 3SXOA 2FIAA 1MK4A 2I79A 4C7HA 3FRMA 4B5OA 2FE7A 4KSFA 5G1ZA 1NE9A 5EBVA 1BO4A 1MJAA 3UY5A 5KTDA 3R9FA 4CGPA 2Q0YA 2NMTA 1ZO0A 1YREA 1BOBA 5A27A 2EVNA 1IYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFL A;  4MFJ A;  4MFQ A;  4MFK A;  4Q38 A;  4MFP A;  4MFZ A;  4Q36 A; 
#chains in the Genus database with same CATH topology
 4QC6 A;  4AB7 A;  4NF1 A;  1KUY A;  4OC1 A;  2B4D A;  4H6U A;  4CRZ B;  4OC2 A;  1XRY A;  1KUX A;  4AVA A;  2Y0M A;  2ZEP A;  3D3S A;  3LD2 A;  4GS4 A;  1Y0Y A;  2PJA A;  4RS2 A;  3F0A A;  2ABZ A;  4QB9 A;  2WYR A;  3PB8 X;  3PRT A;  1IGB A;  1YGH A;  3L2N A;  2Z3P A;  3KQZ A;  4OC3 A;  3NFZ A;  2WSA A;  1CP6 A;  2IMO A;  4UBR A;  4F9U A;  3LMS A;  2XEG A;  2V8H A;  1I1D A;  2CNT A;  5ISV A;  1YSJ A;  2ZEL A;  3BJ8 A;  4KUB A;  4KSA A;  4EWT A;  5HVF A;  2CNM A;  5K8P A;  4CAV A;  3V8I A;  2DXQ A;  2C6G A;  2CY2 A;  3DDD A;  3E0K A;  1IYK A;  1LFW A;  1Z8L A;  2DPS A;  2J8M A;  3NE8 A;  3R1K A;  4GM5 A;  3S6H A;  4B13 A;  2IQ6 A;  4CS0 B;  3VAR A;  2R8V A;  2ZED A;  2AE6 A;  1IB1 E;  3CXQ A;  2JEW A;  1R3N A;  2GRE A;  2QIR A;  5AG7 A;  4YGO A;  4UFV A;  1Y0R A;  3DSB A;  3IWG A;  4KUA A;  4BMH A;  3JRU A;  2AFO A;  1S7N A;  3KHX A;  3IWE A;  4MHZ A;  4EVY A;  4JWP A;  4FD6 A;  3CZX A;  1TXR A;  3TOB A;  1P0H A;  3GIU A;  1CM0 A;  2WPX A;  2ARH A;  2AFM A;  1ZG7 A;  4Z65 A;  1YK3 A;  2GIV A;  2G9D A;  3PB7 X;  4KOW A;  4KZT A;  5JM6 A;  4BIN A;  4M6H A;  1SQH A;  5F49 A;  3WC5 A;  1QSR A;  5LYF A;  2JDC A;  4B5P B;  3CT9 A;  3R95 A;  3D7G A;  3T8W A;  4KLV A;  4CPA A;  1ON0 A;  2EK9 A;  5J8C A;  2VXK A;  3H8G A;  4OC0 A;  3ZZI A;  2ZEG A;  2QML A;  3F8K A;  4IUS A;  3IFE A;  1KUV A;  2BUE A;  1NSL A;  3T90 A;  3HUV A;  3D66 A;  2C1C A;  3TCV A;  2FSR A;  4MHP A;  3H8F A;  2XEF A;  1F57 A;  4GXH A;  4MY0 A;  3TO7 A;  4MFL A;  2P6F A;  4NGQ A;  5A28 A;  3P2F A;  1AMP A;  4LQ6 A;  1TKJ A;  4WJB A;  4FAI A;  1Y9W A;  1Z8W A;  2CIJ A;  4P44 A;  4NFR A;  2G3T A;  1H8L A;  4NSQ A;  1XF8 A;  4R8F A;  2EUI A;  2EO8 A;  2RB7 A;  4ONU A;  4OME A;  4U5Y A;  4MJ8 A;  4Q7A A;  1RO5 A;  1QST A;  2CF4 A;  1JWQ A;  3QB8 A;  5CNP A;  4IHM A;  4YRH A;  2PJ9 A;  2ANP A;  2PC1 A;  3FMC A;  4ZX8 A;  2P6E A;  1VIX A;  1XMT A;  2VBQ A;  3N7Z A;  4OC4 A;  5D29 A;  1CBX A;  3JVN A;  4H2K A;  2PJ4 A;  4DNC A;  1Q2Y A;  1ZG9 A;  3NE7 A;  1QSM A;  2VZZ A;  4MFJ A;  1M4D A;  1KWM A;  1ZG8 A;  2VQY A;  5G22 A;  3B2Y A;  1GHE A;  2BCO A;  2G3A A;  5CBM A;  4JXQ A;  3H8E A;  2V8D A;  3JUW A;  3B7I A;  1XIX A;  3EY5 A;  1S7L A;  1CPS A;  3PZJ A;  7CPA A;  3EFA A;  3G3S A;  1WK4 A;  5I0C A;  2Z10 A;  5K8O A;  3RBU A;  2PSW A;  1Z8T A;  2IL4 A;  2OH1 A;  4LQG A;  2CXA A;  3PBE A;  4OLL A;  2C27 A;  4E8O A;  4JJX A;  3SJG A;  3CDX A;  2A4N A;  2V8G A;  3EO4 A;  4MFP A;  3D67 A;  4X2T A;  1UWY A;  2Q4Y A;  5G21 A;  3FB3 A;  3KQX A;  2PJ2 A;  2Q44 A;  2CTC A;  1Z4E A;  3FYN A;  4JZ0 A;  5FVJ A;  2YNC C;  3WR7 A;  5DWM A;  4OAD A;  3MRU A;  4PXB A;  5JH9 A;  3FBU A;  1LAN A;  4F6A A;  4ZX9 A;  4KSI A;  1WWZ A;  4NJR A;  4NGN A;  3F5B A;  4F0X A;  2PDO A;  3KI9 A;  3S9N A;  5K8M A;  1AUG A;  2PR8 A;  1ZLH A;  4A32 A;  1B6B A;  2PVV A;  5IB0 A;  2PR1 A;  2ZEF A;  3IEH A;  1YW4 A;  2OU2 A;  4NGM A;  4C2Y A;  4ZGY B;  5LRK A;  3SI2 A;  3RYO A;  4M3S A;  1XOV A;  3B3T A;  2VI7 A;  4HNW B;  3GKR A;  4XPD B;  4MI4 A;  3JTK A;  2JDD A;  4C2X A;  3I1U A;  4R3L A;  2OZU A;  4MRI A;  3D8P A;  4EME A;  4NJQ A;  2CNS A;  3D7F A;  5C82 A;  2FIW A;  3A9L A;  3B8G A;  3PP9 A;  4KVO E;  4NXY A;  4OKO A;  1Z9U A;  2Z3L A;  2Q51 A;  4IAV A;  2PRB A;  1V0C A;  3TTH A;  2AFX A;  1LAM A;  2WZN A;  2ATR A;  2FVG A;  2P6G A;  4MY3 A;  4NGT A;  5LYI A;  3NH5 A;  3KL9 A;  4B6Z A;  1VHE A;  1I21 A;  2Z3M A;  1CJW A;  5F46 A;  2PJ3 A;  1F2O A;  2ZW5 A;  3K2K A;  2Z0Z A;  5K8N A;  3SI1 A;  1L0C A;  1S5K A;  4Q36 A;  2HUZ A;  4OP4 A;  2Z3O A;  5HH1 A;  4Q38 A;  3D7H A;  4UCP A;  3W91 A;  1Q7L A;  1TKF A;  2ZOG A;  4I49 A;  4KOU A;  4AXV A;  4KOR A;  2AFU A;  2Z3N A;  1Y7R A;  4IF5 A;  3PB6 X;  3IJ3 A;  2EK8 A;  1KZF A;  4MHY A;  2OZH A;  3S6G A;  2PRQ A;  1A2Z A;  3VH9 A;  4PK2 A;  3D2P A;  4CYO A;  1CG2 A;  3R96 A;  1Q2D A;  2EBJ A;  2PJ6 A;  3VAT A;  5HMN A;  2I00 A;  3EC4 A;  4CYQ A;  4B14 A;  2O4H A;  3W6S A;  3IC1 A;  3VWD A;  4UCM A;  2GFQ A;  3SJE A;  2REE A;  3WAB A;  3I9S A;  1ARM A;  4Y49 B;  2YND A;  4BD9 A;  3IO1 A;  4XPL A;  4JLY A;  1X12 A;  4X5K A;  2VEZ A;  4B10 A;  3IU1 A;  4HNX B;  1ELL P;  1EE3 P;  5JGF A;  1IY7 A;  4A38 A;  4XNH B;  3IIB A;  2HQY A;  1LAP A;  3V38 A;  4FD5 A;  2O28 A;  2PIY A;  5F47 A;  4ORF A;  3B3S A;  3C26 A;  4MMO A;  2Q4Z A;  4P4E A;  3FF3 A;  2KCW A;  4NGS A;  4A31 A;  4NEX A;  2AFS A;  4UEF A;  3IGR A;  4ZY1 A;  4A39 A;  2OB0 A;  2HC9 A;  1NMT A;  3QNV A;  4OID A;  6CPA A;  4L8A A;  2Q43 A;  4BBH A;  3FJU A;  4P45 A;  3S6F A;  4C7I A;  3FVL A;  3HLP A;  3KR4 A;  4KOV A;  4XPK A;  1VHO A;  2C6P A;  3EXN A;  2FT0 A;  1BLL E;  4YU9 A;  5D8N A;  2IJZ A;  4PPZ A;  2BL1 A;  3DR8 A;  4FD4 A;  5THW A;  2R1I A;  3ISZ A;  1FT7 A;  2R98 A;  2JLM A;  2VL1 A;  3PB9 X;  4RN7 A;  4UFX A;  5J8F A;  1X10 A;  3LWU A;  1Z4R A;  2GU2 A;  4PXD A;  4UIA A;  2Q7B A;  4CYN A;  4A33 A;  2Q7S A;  3V7Z A;  2FXF A;  2QYV A;  4JYW A;  4NCZ A;  2RC4 A;  2PJ1 A;  3K9T A;  2I3C A;  1CP7 A;  1PCA A;  3H4Q A;  2PIZ A;  1S7K A;  5LRJ A;  3GUX A;  4XPD C;  4O23 A;  4KOX A;  3D4U A;  4EFD A;  2AFZ A;  2V77 A;  4HKF A;  2AJ6 A;  2B4D B;  3D68 A;  3QAY A;  5EC4 A;  1PYT B;  2VZY A;  1LCP A;  5AG6 A;  1M4L A;  3FIX A;  4KLW A;  5E96 A;  4CGM A;  1S3Z A;  1YVK A;  2PVW A;  4YFJ A;  4P10 A;  1YW6 A;  4QVT A;  4CAX A;  4FBE A;  2PE3 A;  4UWI A;  5H86 A;  5G20 A;  3TO9 A;  2HB6 A;  4KOY A;  1XE4 A;  3CPA A;  4PK3 A;  3RZA A;  1QQ9 A;  1YVO A;  2B4B A;  3PGP A;  4UCN A;  5H84 A;  2O53 A;  2DEA A;  4MFK A;  3RAM A;  3MN8 A;  1VGY A;  4UWJ A;  1AYE A;  4CAW A;  4J3G A;  4E2A A;  2NYQ A;  2FS5 A;  4MCP A;  2BOA A;  3SI0 A;  2JBK A;  2ODF A;  4AVC A;  1QSN A;  4R3K A;  4UFW A;  3FEC A;  4FD7 A;  5AGE A;  3N5F A;  4PXC A;  4UA3 A;  3WC7 A;  2ZW4 A;  4A30 A;  3BLN A;  2K5T A;  2QJ8 A;  3MGD A;  1M44 A;  1Y9K A;  5AG5 A;  1TF8 A;  5JQ4 A;  4MXU A;  4QBJ A;  4P6Y A;  4NGR A;  1NSA A;  3TE4 A;  2YGW A;  1R57 A;  4A37 A;  3FX6 A;  4CAF A;  5DS0 A;  1XBU A;  2ZEE A;  1JQG A;  2J9A A;  1VKC A;  2V8V A;  3GY9 A;  4Y49 C;  5C88 A;  1MJB A;  4R7M A;  1YQE A;  8CPA A;  2GAN A;  3SJF A;  3NH4 A;  4P4B A;  4PSW A;  4WWV A;  1OZP A;  3BJ7 A;  1IIC A;  4ZYQ A;  3IU2 A;  4XNH C;  3GLJ A;  4UEZ A;  4RUH A;  5F09 A;  4FUU A;  3B3W A;  2D4O A;  4P4J A;  5LRG A;  4UEE A;  5J1Q A;  2BO9 A;  1P4N A;  1TF9 A;  3FED A;  1B87 A;  3DR6 A;  3FH4 A;  3S9M A;  2WPW A;  4H89 A;  4X3R A;  2ZXV A;  1IID A;  2FL4 A;  3WC6 A;  4A94 A;  2AFW A;  1R43 A;  3KGQ A;  5CPA A;  3K9U A;  4M6I A;  5DWN A;  1CX8 A;  3DGV A;  2ZEM A;  4HPS A;  1RTQ A;  4IK2 A;  3B3V A;  2J8N A;  3FEE A;  4ONW A;  4P4I A;  2PJ8 A;  4F8Z A;  1S60 A;  3BI0 A;  1XJO A;  4F9V A;  5KTC A;  3KZW A;  2ZW7 A;  3IWW A;  4PV6 A;  4E0A A;  3GB0 A;  3OWC A;  4F0Y A;  2JEV A;  3CPX A;  1YLE A;  3KHZ A;  1S7F A;  3S6K A;  4B12 A;  2B5G A;  2GE3 A;  1YX0 A;  4UIB A;  4ZBG A;  3LAC A;  1XMB A;  2POK A;  2G0B A;  3R9E A;  2JBJ A;  2F8H A;  4P4D A;  4B11 A;  4CGO A;  4KS9 A;  1FNO A;  1TKH A;  2OR4 A;  2PJ7 A;  3D2M A;  1Q2C A;  4DUK A;  1LRZ A;  1CPX A;  4MCQ A;  5I4M A;  3DLJ A;  4U9Z A;  1RXT A;  2FCK A;  1QMU A;  4R9M A;  3TT2 A;  4W9Y A;  3W6X A;  4R87 A;  3KKW A;  4CAE A;  4G1P A;  4U9Y A;  1PU9 A;  2F5I A;  2HV2 A;  5HVG A;  5HXD A;  4MCS A;  4H6Z A;  5BWA B;  1HDQ A;  2RFH A;  1FY7 A;  4X8I A;  1MJ9 A;  2EWB A;  2PCU A;  1DTD A;  3P2H A;  3R9G A;  2XEI A;  4MHD A;  1M4G A;  5KTA A;  4CGL A;  3PEI A;  2GLF A;  2PJ0 A;  3H5Z A;  4PSX A;  4R57 A;  1VHS A;  4NGP A;  1F2P A;  4MFZ A;  3ZJ0 A;  2PJ5 A;  4OIW A;  5HVH A;  3ISX A;  3NH8 A;  4C68 A;  1YR0 A;  2YNE A;  2J8R A;  3PFE A;  2F7V A;  3TC8 A;  3GYA A;  3QAH A;  3TX8 A;  1XEB A;  4PXE A;  1J4J A;  2ZEH A;  4OC5 A;  5ELY A;  4ZY2 A;  3FNC A;  2H5M A;  2DF5 A;  4AVB A;  3NA6 A;  2Z11 A;  4TWE A;  1HDU A;  4C2Z A;  3PBB A;  2Q4V A;  2Z3K A;  1HEE A;  1ELM P;  2ZEN A;  4MHN A;  3FXT A;  2WUU A;  3DNS A;  5F48 A;  3CXP A;  1PUA A;  1M4I A;  2OOT A;  4FWU A;  2PJC A;  4P4F A;  4A2Z A;  5AG4 A;  1ZLI A;  4K3N A;  5EMI A;  4RI1 A;  1GYT A;  2X7B A;  5JPH A;  3B35 A;  1Z2L A;  2P0W A;  4R6T A;  2ZW6 A;  4JXR A;  3WT4 A;  4AG9 A;  4OAE A;  4MCR A;  4AG7 A;  4K30 A;  3RNZ A;  4MFQ A;  3B3C A;  4KVX A;  3TOA A;  5LYD A;  2YNC A;  2Q04 A;  2BSW A;  4II9 A;  2REF A;  1I12 A;  3LOD A;  4M6G A;  2PJB A;  4L89 A;  4HNY B;  4DJL A;  2DPT A;  3TO6 A;  3SHP A;  2BEI A;  5IX3 A;  2B3V A;  1XFO A;  3CXS A;  1M1D A;  5GCN A;  1U6M A;  1IOI A;  1UFH A;  5IV0 A;  1BAV A;  2C6C A;  3D7D A;  1ARL A;  1Z8X A;  1IOF A;  3KAS A;  3PFO A;  2D4P A;  4A95 A;  2ZPA A;  4KVM E;  4MBU A;  3RO0 A;  4KOT A;  4B5P A;  3T9Y A;  1DE4 C;  2PQ8 A;  2CTB A;  2ZEO A;  3I3G A;  1N71 A;  1YLO A;  1QSO A;  3TFY A;  4TNU A;  4CRY B;  1K4J A;  1TIQ A;  4QUS A;  2B5G B;  2QEC A;  4CYP A;  3SXN A;  3VWE A;  4UF4 A;  3KR5 A;  4DYO A;  5IB9 A;  2OZG A;  4CGN A;  2R7H A;  2QVP A;  4LX9 A;  4M85 A;  1IU8 A;  1YME A;  2B3U A;  1OBR A;  4R76 A;  4YWY A;  4JD6 A;  4KOS A;  1Y7E A;  3PB4 X;  4ZI6 A;  4LUA A;  2B58 A;  3G8W A;  3SXO A;  2FIA A;  1MK4 A;  2I79 A;  4C7H A;  2XEJ A;  3FRM A;  4B5O A;  2FE7 A;  4KSF A;  4PQA A;  1NE9 A;  5G1Z A;  5EBV A;  1BO4 A;  1MJA A;  3UY5 A;  5KTD A;  2ZOF A;  3R9F A;  3BI1 A;  3SJX A;  3BHX A;  1Z5R A;  1BPN A;  3BXM A;  4CGP A;  4ZY0 A;  5LYL A;  2NSM A;  2NMT A;  2Q0Y A;  1ZO0 A;  1LOK A;  1YRE A;  1BPM A;  1BOB A;  5A27 A;  2EVN A;  1IYL A;  2GLJ A;  3S9L A; 
#chains in the Genus database with same CATH homology
 4QC6 A;  4AB7 A;  4NF1 A;  1KUY A;  2B4D A;  4H6U A;  4CRZ B;  1KUX A;  4AVA A;  2Y0M A;  3D3S A;  3LD2 A;  4GS4 A;  4RS2 A;  3F0A A;  4QB9 A;  1YGH A;  2Z3P A;  2WSA A;  4UBR A;  1I1D A;  2CNT A;  5ISV A;  4KUB A;  3BJ8 A;  4KSA A;  2CNM A;  4CAV A;  3V8I A;  2DXQ A;  3E0K A;  2CY2 A;  3DDD A;  3R1K A;  1IYK A;  2J8M A;  4CRY B;  2DPS A;  3S6H A;  4B13 A;  4CS0 B;  2R8V A;  2AE6 A;  1IB1 E;  3CXQ A;  5AG7 A;  4YGO A;  2QIR A;  4UFV A;  4KUA A;  3DSB A;  3IWG A;  4BMH A;  1S7N A;  3IWE A;  4EVY A;  4JWP A;  4FD6 A;  3TOB A;  1P0H A;  1CM0 A;  2WPX A;  2ARH A;  1YK3 A;  2GIV A;  4KOW A;  4KZT A;  1SQH A;  5F49 A;  1QSR A;  2JDC A;  4B5P B;  3R95 A;  4KLV A;  1ON0 A;  5J8C A;  2VXK A;  3ZZI A;  3F8K A;  2QML A;  4IUS A;  1KUV A;  2BUE A;  1NSL A;  3T90 A;  3TCV A;  2FSR A;  4MY0 A;  3TO7 A;  4MFL A;  2P6F A;  5A28 A;  3P2F A;  1Y9W A;  2G3T A;  4NSQ A;  1XF8 A;  2EUI A;  4ONU A;  4U5Y A;  4MJ8 A;  1RO5 A;  1QST A;  3QB8 A;  5CNP A;  4YRH A;  2PC1 A;  2P6E A;  1XMT A;  2VBQ A;  3N7Z A;  3JVN A;  4DNC A;  1Q2Y A;  3NE7 A;  1QSM A;  2VZZ A;  4MFJ A;  1M4D A;  5G22 A;  2VQY A;  1GHE A;  2G3A A;  4JXQ A;  3JUW A;  1XIX A;  3EY5 A;  1S7L A;  3PZJ A;  3EFA A;  3G3S A;  1WK4 A;  5I0C A;  2Z10 A;  2PSW A;  4E8O A;  2IL4 A;  2OH1 A;  2CXA A;  4OLL A;  2C27 A;  4JJX A;  4MFP A;  2A4N A;  3EO4 A;  2Q4Y A;  5G21 A;  3FB3 A;  2Q44 A;  1Z4E A;  3FYN A;  5FVJ A;  2YNC C;  3WR7 A;  5DWM A;  4OAD A;  3FBU A;  4F6A A;  1WWZ A;  3F5B A;  4F0X A;  2PDO A;  2PR8 A;  4A32 A;  1B6B A;  5IB0 A;  2PR1 A;  4ZGY B;  4C2Y A;  2OU2 A;  3RYO A;  4M3S A;  4HNW B;  2VI7 A;  3GKR A;  4XPD B;  4MI4 A;  3JTK A;  2JDD A;  4C2X A;  4R3L A;  2OZU A;  3D8P A;  2CNS A;  5C82 A;  2FIW A;  3A9L A;  3B8G A;  3PP9 A;  4KVO E;  4NXY A;  1Z9U A;  2Z3L A;  2PRB A;  1V0C A;  3TTH A;  2ATR A;  2P6G A;  4MY3 A;  2Z3M A;  1I21 A;  5F46 A;  1CJW A;  2ZW5 A;  2Z0Z A;  1S5K A;  1L0C A;  4Q36 A;  2HUZ A;  2Z3O A;  5HH1 A;  4Q38 A;  4UCP A;  3W91 A;  4KOU A;  4I49 A;  4KOR A;  4IF5 A;  2Z3N A;  1Y7R A;  1KZF A;  2OZH A;  3S6G A;  4PK2 A;  3D2P A;  4CYO A;  3R96 A;  1Q2D A;  2I00 A;  3EC4 A;  4CYQ A;  4B14 A;  3W6S A;  3VWD A;  4UCM A;  2REE A;  3I9S A;  4Y49 B;  2YND A;  4XPL A;  4JLY A;  4X5K A;  2VEZ A;  4B10 A;  3IU1 A;  4HNX B;  4XNH B;  2HQY A;  4FD5 A;  2O28 A;  5F47 A;  4ORF A;  3C26 A;  4A31 A;  2KCW A;  4NEX A;  3IGR A;  2OB0 A;  1NMT A;  4L8A A;  4BBH A;  3S6F A;  4C7I A;  4KOV A;  4XPK A;  3EXN A;  2FT0 A;  2BL1 A;  3DR8 A;  4FD4 A;  2R1I A;  2R98 A;  2JLM A;  4UFX A;  5J8F A;  1Z4R A;  2Q7B A;  4CYN A;  4A33 A;  2FXF A;  4NCZ A;  2RC4 A;  3H4Q A;  1S7K A;  4XPD C;  4KOX A;  4HKF A;  2AJ6 A;  2B4D B;  5EC4 A;  2VZY A;  5AG6 A;  4KLW A;  3FIX A;  5E96 A;  4CGM A;  1S3Z A;  1YVK A;  4YFJ A;  4QVT A;  4CAX A;  4UWI A;  5H86 A;  5G20 A;  3TO9 A;  4KOY A;  1XE4 A;  4PK3 A;  3PGP A;  1YVO A;  2B4B A;  4UCN A;  5H84 A;  5HMN A;  4MFK A;  4UWJ A;  4CAW A;  4J3G A;  4E2A A;  2FS5 A;  4AVC A;  1QSN A;  4R3K A;  4UFW A;  4FD7 A;  5AGE A;  4UA3 A;  2ZW4 A;  4A30 A;  3BLN A;  2K5T A;  3MGD A;  1M44 A;  1Y9K A;  5AG5 A;  5JQ4 A;  4QBJ A;  3TE4 A;  2YGW A;  1R57 A;  4CAF A;  1VKC A;  3GY9 A;  5C88 A;  4Y49 C;  1MJB A;  2GAN A;  4PSW A;  1OZP A;  3BJ7 A;  1IIC A;  3IU2 A;  4XNH C;  2D4O A;  1P4N A;  1B87 A;  3DR6 A;  2WPW A;  4H89 A;  2ZXV A;  1IID A;  2FL4 A;  3K9U A;  5DWN A;  2J8N A;  1S60 A;  5KTC A;  2ZW7 A;  4PV6 A;  4E0A A;  4F0Y A;  3OWC A;  2JEV A;  1YLE A;  1S7F A;  3S6K A;  4B12 A;  2B5G A;  2GE3 A;  1YX0 A;  4ZBG A;  2G0B A;  3R9E A;  4B11 A;  4CGO A;  4KS9 A;  3D2M A;  1Q2C A;  1LRZ A;  4U9Z A;  3TT2 A;  1RXT A;  2FCK A;  4R9M A;  3W6X A;  4R87 A;  3KKW A;  4CAE A;  4U9Y A;  1PU9 A;  2F5I A;  2HV2 A;  4H6Z A;  5BWA B;  1FY7 A;  1MJ9 A;  3P2H A;  3R9G A;  4MHD A;  5KTA A;  1M4G A;  4CGL A;  4PSX A;  3H5Z A;  4R57 A;  1VHS A;  4MFZ A;  3ZJ0 A;  4C68 A;  1YR0 A;  2YNE A;  2J8R A;  3GYA A;  3QAH A;  1XEB A;  1J4J A;  3FNC A;  2H5M A;  4AVB A;  2Z11 A;  4C2Z A;  2Q4V A;  2Z3K A;  3FXT A;  2WUU A;  3DNS A;  5F48 A;  3CXP A;  1PUA A;  1M4I A;  4A2Z A;  5AG4 A;  4RI1 A;  2X7B A;  5JPH A;  2P0W A;  2ZW6 A;  4JXR A;  4AG7 A;  4AG9 A;  4OAE A;  4K30 A;  4MFQ A;  4KVX A;  3TOA A;  2YNC A;  2Q04 A;  2BSW A;  4II9 A;  2REF A;  1I12 A;  3LOD A;  4L89 A;  4HNY B;  2DPT A;  3TO6 A;  3SHP A;  2BEI A;  5IX3 A;  2B3V A;  3CXS A;  1M1D A;  5GCN A;  1U6M A;  1UFH A;  5IV0 A;  2D4P A;  4A95 A;  2ZPA A;  4KVM E;  4MBU A;  4KOT A;  4B5P A;  3T9Y A;  2PQ8 A;  3I3G A;  1N71 A;  1QSO A;  3TFY A;  1K4J A;  1TIQ A;  4QUS A;  2B5G B;  2QEC A;  4CYP A;  3SXN A;  3VWE A;  2OZG A;  4CGN A;  2R7H A;  4LX9 A;  4M85 A;  2B3U A;  4JD6 A;  4KOS A;  4LUA A;  2B58 A;  3G8W A;  3SXO A;  2FIA A;  1MK4 A;  2I79 A;  4C7H A;  3FRM A;  4B5O A;  2FE7 A;  4KSF A;  5G1Z A;  1NE9 A;  5EBV A;  1BO4 A;  1MJA A;  3UY5 A;  5KTD A;  3R9F A;  4CGP A;  2Q0Y A;  2NMT A;  1ZO0 A;  1YRE A;  1BOB A;  5A27 A;  2EVN A;  1IYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...