4MFQA

The crystal structure of acyltransferase in complex with coa and 10c-teicoplanin
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
323
structure length
323
Chain Sequence
MDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLAVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein tcp24
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Transferase/antibiotic
total genus 109
structure length 323
sequence length 323
ec nomenclature ec 2.3.1.-:
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mfqA02
4MFPA 4MFKA 4MFJA 4MFLA 4Q38A 4MFZA 4Q36A 4MFQA
chains in the Genus database with same CATH superfamily
1TF9A 1P0HA 3H8GA 4PXDA 4TWEA 1QMUA 4MFZA 1CPSA 2PJ7A 2JBJA 1BPMA 4X5KA 3PRTA 2ZEHA 4KSIA 2EUIA 5AG5A 4B12A 3IO1A 3B3VA 3SXNA 2AFMA 3GUXA 2V8DA 4M6IA 3PEIA 4MCPA 3P2HA 1LRZA 3ISXA 3NE7A 4CYPA 4NF1A 4MHZA 2J8RA 2Q44A 3B7IA 4CGLA 4H6ZA 4I49A 4P4JA 1YR0A 4HNYB 2JEWA 2ODFA 4P10A 4A30A 2KCWA 3BJ7A 4UBRA 5AG4A 4JD6A 2PQ8A 2R8VA 4NJQA 5F46A 5K8NA 1KUVA 3B3WA 2JLMA 2ZOFA 4KSAA 3WC7A 4C2ZA 1ELLP 5CPAA 3R95A 4KZTA 1ZO0A 4UFXA 4F6AA 4A31A 4KVME 4PK3A 3FVLA 2G9DA 2PSWA 4IHMA 1IGBA 4UIAA 4KOYA 4BD9A 1P4NA 4MCSA 5J1QA 2HQYA 4GS4A 1YREA 1VHEA 3K2KA 2EWBA 1MJBA 1MJ9A 1PUAA 1Z8TA 1B87A 2QYVA 3C26A 4FUUA 4Q38A 4A38A 1NSLA 5FVJA 4U9YA 4KOTA 4C7IA 4E0AA 4BMHA 2JEVA 2ZENA 4NCZA 3FBUA 3D66A 3N5FA 1LANA 2EO8A 3RYOA 3BI1A 4NSQA 2OH1A 1CG2A 2V77A 3TT2A 3FB3A 4M6HA 4K3NA 4UCMA 4ZBGA 3GIUA 2B58A 2AE6A 2H5MA 2I79A 1FT7A 2IMOA 2FSRA 1SQHA 2ZPAA 4MFPA 3PZJA 2FE7A 3IGRA 4F8ZA 2OR4A 3FX6A 4UA3A 3FH4A 2B5GB 4Y49C 2REEA 4MFQA 4AG9A 3KI9A 2GLFA 4FAIA 4ZY2A 1IB1E 3GYAA 1QSMA 4NGNA 4JYWA 3SJEA 3TOAA 3S6HA 5LRKA 4B13A 3FEDA 2ZW6A 4OLLA 4XPLA 5I0CA 2PIYA 4NJRA 4XPDC 2FVGA 1VKCA 2X7BA 2Z3OA 1UFHA 1JWQA 3I9SA 4P4EA 4E8OA 2B3UA 3NE8A 4O23A 5JM6A 1HDQA 2AFZA 2O53A 3R1KA 2CTCA 5LRGA 4MMOA 1BAVA 3WABA 1ZG7A 4CAVA 4OC5A 4OC2A 1KUYA 3BHXA 4Y49B 4CS0B 5KTAA 5AG7A 4CYOA 3PFOA 4JZ0A 3SXOA 4Z65A 2ZEMA 3IEHA 1X10A 4PXEA 4FBEA 5BWAB 1H8LA 3CPAA 3MGDA 4R3LA 1Y0RA 4UWJA 3VWDA 4ONWA 3DDDA 4UEFA 4C68A 3CZXA 2ZEGA 1M4DA 6CPAA 1F2OA 1PYTB 1R57A 2B5GA 3H8EA 4UCNA 3RAMA 2QJ8A 4FWUA 4M6GA 4NEXA 4PK2A 5A27A 2R98A 3VARA 2ZEEA 2DEAA 1IIDA 3DLJA 2J8NA 4IUSA 4MXUA 2JBKA 5KTDA 1Y9KA 4E2AA 5IV0A 3F0AA 2PR8A 3EY5A 1YVKA 2ARHA 4OKOA 5C82A 1KZFA 2F5IA 3R9FA 4AG7A 4JXQA 4H89A 4A95A 3V8IA 1GYTA 3FXTA 4LQ6A 2OZHA 4R3KA 3W6XA 4EWTA 3NA6A 3EC4A 4IF5A 5JPHA 1AMPA 1F2PA 2CY2A 3BXMA 4KOUA 2VZZA 3H8FA 4MJ8A 2BOAA 5JGFA 3SI2A 3W6SA 3CXSA 1AYEA 2PR1A 4U9ZA 2Z10A 1CJWA 4XNHC 4KORA 2Q4YA 3S9LA 2Q0YA 1JQGA 4R9MA 1XOVA 2CXAA 2JDDA 5I4MA 2XEIA 4G1PA 1UWYA 2O28A 3IU1A 2PJ1A 1Y9WA 2FCKA 4CRZB 3BLNA 4UIBA 3FEEA 4MY3A 1VHSA 2CIJA 5DWNA 2C6PA 4X8IA 1F57A 4OP4A 4UWIA 3S6KA 1ARLA 1XRYA 1XFOA 4OC0A 1RTQA 3DNSA 1TKJA 5IB0A 3JUWA 2G0BA 2EVNA 3FRMA 4MFLA 2PJAA 5EC4A 1S7KA 1QSRA 3FNCA 1DTDA 1V0CA 2AFUA 2Y0MA 4XNHB 2FL4A 3QAHA 3FF3A 2CNMA 1XEBA 3D4UA 1M4IA 3A9LA 1YW6A 4UFWA 2QVPA 4MBUA 4PV6A 2B4DB 4OIDA 1FNOA 1TXRA 2Z11A 4KUBA 2WUUA 3NH4A 2FXFA 1IYKA 3B3CA 3ISZA 4KOSA 4WJBA 3KR5A 2HUZA 4H6UA 3UY5A 3PB8X 3VH9A 3R96A 1QSOA 4BINA 4KVXA 3LACA 2BL1A 2B4BA 5C88A 2YGWA 3PB9X 4R6TA 3ZZIA 4B5OA 1R3NA 3S6FA 3EXNA 3B35A 4P45A 4U5YA 5LYIA 1CX8A 3LD2A 4MY0A 4KS9A 1Z2LA 2YNCA 4L8AA 5HH1A 1OBRA 2VXKA 4ZGYB 4ZY0A 4PXCA 5G1ZA 4B14A 1PU9A 3WC6A 4PPZA 4ORFA 4QBJA 2PVWA 4P4FA 2GE3A 4QB9A 2YNDA 3DSBA 2Q51A 4TNUA 2DF5A 2DXQA 1YLEA 2QECA 4NFRA 4DJLA 3FECA 3PBBA 2ZEDA 2G3TA 3D8PA 3SJGA 2GANA 2Z3NA 5EBVA 4AVCA 5HMNA 3OWCA 2R7HA 1LOKA 2IJZA 2B4DA 2D4OA 1I1DA 2PJ9A 3KHZA 3B3TA 4P6YA 5F49A 3PBEA 3GY9A 2Q04A 4H2KA 1BLLE 5J8FA 2Q4ZA 2FIWA 2OB0A 2PJBA 3NH8A 4MRIA 1Q2CA 4KUAA 3IIBA 4C7HA 3KKWA 2Q7BA 4A39A 4CGOA 1CPXA 2P6EA 5EMIA 2J8MA 2POKA 5K8OA 5A28A 2GLJA 3PFEA 3FYNA 2PJ8A 4UEEA 2ZOGA 3SJXA 3PB6X 5THWA 3RZAA 2ANPA 2WPWA 2AFWA 3G3SA 1VHOA 1XF8A 4M3SA 1J4JA 4MHPA 2F7VA 4RN7A 3V7ZA 4CGPA 2I3CA 1VGYA 2JDCA 3B3SA 3TC8A 2AFOA 5HVGA 1Z5RA 2VEZA 3IC1A 1Q2DA 3D68A 3L2NA 2FS5A 4KOVA 4CGMA 3R9GA 4CYQA 5IX3A 1PCAA 2RB7A 4XPDB 3BJ8A 2CTBA 2V8VA 3MN8A 2ATRA 1EE3P 1IY7A 4DYOA 4CAEA 3TO7A 2NSMA 2PCUA 4F9UA 4CRYB 4NGSA 4Q7AA 2EK8A 4KOWA 3KL9A 4ONUA 4MHDA 5D8NA 4MCQA 5LYFA 4KLVA 1IOIA 1LAMA 5AGEA 2Q4VA 5H84A 1TIQA 3RNZA 3TE4A 2Q7SA 1Z4EA 2FT0A 3W91A 2GREA 1YMEA 2VBQA 2PJ2A 4AXVA 4RS2A 3DR6A 3T8WA 2ZEOA 3N7ZA 1DE4C 3NFZA 3V38A 4IAVA 4GXHA 5LYLA 1BO4A 1Z8WA 4LX9A 1ZG8A 3I3GA 3GLJA 3K9UA 4UFVA 3FMCA 1IYLA 1MK4A 4AVAA 5JH9A 2RFHA 2YNEA 3TOBA 5HVHA 1M4GA 2AFSA 1YW4A 2GU2A 1CP6A 1ON0A 3D7GA 4R57A 5HVFA 2WZNA 4DUKA 3PB7X 4K30A 1I21A 1YQEA 2PJ3A 3GB0A 2V8GA 3TX8A 2PDOA 2PIZA 2WSAA 2XEGA 3SJFA 3NH5A 5F48A 2ZW4A 2AFXA 4OC3A 3MRUA 4RUHA 1YK3A 1CM0A 2WPXA 2NYQA 2FIAA 4QUSA 3WR7A 7CPAA 1B6BA 4YFJA 2Z0ZA 3KQXA 2HV2A 3I1UA 5ELYA 1QQ9A 4CAXA 5D29A 2DPSA 1A2ZA 2ABZA 3IWGA 2GIVA 2ZEPA 3P2FA 2NMTA 4P44A 3KGQA 2OOTA 4B10A 2CNSA 3QAYA 1RXTA 4X3RA 4HNXB 4IK2A 1XBUA 2PRBA 4F0YA 1TKFA 3KZWA 4YGOA 4KSFA 5J8CA 3JTKA 4PSXA 5DS0A 1L0CA 1Z8LA 3S9MA 2DPTA 1YLOA 1NE9A 1CBXA 4NGRA 4MI4A 4PQAA 4ZX9A 3CXPA 4OAEA 4QVTA 1HDUA 2C6GA 3QB8A 4EFDA 1MJAA 2D4PA 8CPAA 2OZGA 1TF8A 1XE4A 2OU2A 5K8MA 3D7FA 4OADA 4EMEA 3E0KA 3DGVA 5GCNA 2RC4A 3EO4A 2A4NA 4AB7A 1LFWA 4NGPA 3RO0A 4MHYA 4B5PB 4LQGA 2OZUA 1YSJA 3G8WA 4FD4A 4UCPA 2PJ0A 5F47A 4C2YA 1YVOA 2PJ5A 3IWWA 4FD5A 1WWZA 1ZLHA 2VQYA 4PSWA 1XMBA 2AJ6A 4MFJA 4W9YA 4J3GA 4ZI6A 5JQ4A 1U6MA 4HPSA 4CPAA 1S7FA 4R76A 1QSTA 3R9EA 4A33A 1TKHA 2ZW7A 2R1IA 4R7MA 4QC6A 3KR4A 4MHNA 3IJ3A 1I12A 2PJCA 1IOFA 3LODA 1OZPA 1KWMA 2CF4A 2Q43A 2HB6A 4NGQA 1Z8XA 3PGPA 1XJOA 2F8HA 1LAPA 2REFA 2K5TA 1RO5A 4AVBA 4WWVA 3F5BA 4A37A 2P6FA 1Y7RA 2G3AA 2PE3A 3T90A 3D2PA 4ZYQA 2BEIA 1BOBA 2EK9A 2Z3PA 3WT4A 1Y0YA 3VWEA 2V8HA 3CDXA 3KQZA 4KLWA 2P6GA 4NGTA 2BO9A 2Z3KA 4NGMA 4PXBA 4B5PA 2PRQA 3LMSA 2VI7A 3CPXA 3PP9A 2CNTA 3CXQA 5DWMA 3IWEA 3QNVA 2BCOA 2IQ6A 3H4QA 4R8FA 1BPNA 4KOXA 4RI1A 5H86A 1NSAA 4OC1A 4A2ZA 4P4IA 1S5KA 2EBJA 4JJXA 3TTHA 1IICA 2HC9A 2PJ6A 4A94A 4CAWA 4F0XA 2BUEA 4P4DA 3CT9A 5CNPA 4II9A 2B3VA 3D3SA 3FJUA 3JVNA 1GHEA 1XIXA 4OIWA 4HNWB 4BBHA 2WYRA 1Y7EA 2ZELA 4YRHA 4GM5A 3TCVA 4ZY1A 1R43A 1S7NA 1YX0A 4LUAA 3SHPA 4OMEA 4B6ZA 4CGNA 2GFQA 4YU9A 3TFYA 5AG6A 1IU8A 4C2XA 5ISVA 1M44A 1WK4A 1ZG9A 2I00A 2XEFA 2PC1A 4FD7A 4Q36A 4ZX8A 4CAFA 2XEJA 2BSWA 4OC4A 4L89A 3BI0A 1AUGA 3H5ZA 1XMTA 3D7HA 3EFAA 1Q2YA 1HEEA 1M1DA 3HUVA 4HKFA 4MCRA 1FY7A 2VZYA 2Z3MA 4P4BA 1ARMA 1X12A 2QIRA 4XPKA 5G22A 2PVVA 2J9AA 3IU2A 4M85A 4B11A 3HLPA 4FD6A 3KASA 3IFEA 5E96A 2P0WA 1KUXA 4UEZA 2IL4A 2ZW5A 3GKRA 2PJ4A 3VATA 3K9TA 5KTCA 1QSNA 4MFKA 5CBMA 4KVOE 3S6GA 2VL1A 5G20A 4CYNA 1ZLIA 1S7LA 3SI0A 3SI1A 3ZJ0A 2Z3LA 2ZXVA 4JWPA 5IB9A 2C27A 1Z4RA 4JXRA 3TO6A 2QMLA 3D67A 1S3ZA 4DNCA 1CP7A 1Q7LA 2C1CA 4F9VA 5F09A 2ZEFA 2C6CA 1YGHA 1Z9UA 4JLYA 3TO9A 5K8PA 2YNCC 4X2TA 3B2YA 3D2MA 3WC5A 1S60A 2O4HA 4NXYA 3KHXA 3DR8A 3F8KA 5G21A 3LWUA 3S9NA 4YWYA 3T9YA 3RBUA 5LYDA 3B8GA 1ELMP 3D7DA 3FIXA 3JRUA 5HXDA 1K4JA 4R87A 4UF4A 4EVYA 1VIXA 1LCPA 1NMTA 3PB4X 5LRJA 4A32A 1M4LA 1N71A
chains in the Genus database with same CATH topology
1P0HA 4MFZA 4X5KA 2EUIA 5AG5A 4B12A 3SXNA 3P2HA 1LRZA 3NE7A 4CYPA 4NF1A 2J8RA 2Q44A 4CGLA 4H6ZA 4I49A 1YR0A 4HNYB 4A30A 2KCWA 3BJ7A 4UBRA 5AG4A 4JD6A 2PQ8A 2R8VA 5F46A 1KUVA 2JLMA 4KSAA 4C2ZA 3R95A 4KZTA 1ZO0A 4UFXA 4F6AA 4A31A 4KVME 4PK3A 2PSWA 4KOYA 1P4NA 2HQYA 4GS4A 1YREA 1MJBA 1MJ9A 1PUAA 1B87A 3C26A 4Q38A 1NSLA 5FVJA 4U9YA 4KOTA 4C7IA 4E0AA 4BMHA 2JEVA 4NCZA 3FBUA 3RYOA 4NSQA 2OH1A 3TT2A 3FB3A 4UCMA 4ZBGA 2B58A 2AE6A 2H5MA 2I79A 2FSRA 1SQHA 2ZPAA 4MFPA 3PZJA 2FE7A 3IGRA 4UA3A 2B5GB 4Y49C 2REEA 4MFQA 4AG9A 1IB1E 3GYAA 1QSMA 3TOAA 3S6HA 4B13A 2ZW6A 4OLLA 4XPLA 5I0CA 4XPDC 1VKCA 2X7BA 2Z3OA 1UFHA 3I9SA 4E8OA 2B3UA 3R1KA 4CAVA 1KUYA 4CS0B 4Y49B 5KTAA 5AG7A 4CYOA 3SXOA 5BWAB 4R3LA 4UWJA 3VWDA 3DDDA 4C68A 1M4DA 1R57A 2B5GA 4UCNA 4NEXA 4PK2A 5A27A 2R98A 1IIDA 2J8NA 4IUSA 5KTDA 1Y9KA 4E2AA 5IV0A 3F0AA 2PR8A 3EY5A 1YVKA 2ARHA 5C82A 1KZFA 2F5IA 3R9FA 4AG7A 4JXQA 4H89A 4A95A 3V8IA 3FXTA 2OZHA 4R3KA 3W6XA 5JPHA 3EC4A 4IF5A 2CY2A 4KOUA 2VZZA 4MJ8A 3W6SA 3CXSA 2PR1A 4U9ZA 2Z10A 1CJWA 4XNHC 4KORA 2Q4YA 2Q0YA 4R9MA 2CXAA 2JDDA 2O28A 3IU1A 1Y9WA 2FCKA 4CRZB 3BLNA 4MY3A 1VHSA 5DWNA 4UWIA 3S6KA 3DNSA 5IB0A 3JUWA 2G0BA 2EVNA 3FRMA 4MFLA 5EC4A 1S7KA 1QSRA 3FNCA 1V0CA 2Y0MA 4XNHB 2FL4A 3QAHA 2CNMA 1XEBA 1M4IA 3A9LA 4UFWA 4MBUA 4PV6A 2B4DB 2Z11A 4KUBA 2WUUA 4KOSA 1IYKA 2FXFA 4H6UA 2HUZA 3R96A 1QSOA 4KVXA 2BL1A 2B4BA 5C88A 2YGWA 3ZZIA 4B5OA 3S6FA 3EXNA 4U5YA 3LD2A 4MY0A 4KS9A 2YNCA 4L8AA 5HH1A 2VXKA 4ZGYB 5G1ZA 4B14A 1PU9A 4ORFA 4QBJA 2GE3A 4QB9A 2YNDA 3DSBA 2DXQA 1YLEA 2QECA 2G3TA 3D8PA 2GANA 2Z3NA 5EBVA 4AVCA 5HMNA 3OWCA 2R7HA 2B4DA 2D4OA 1I1DA 5F49A 3GY9A 2Q04A 5J8FA 2FIWA 2OB0A 1Q2CA 4KUAA 4C7HA 3KKWA 2Q7BA 4CGOA 2P6EA 2J8MA 5A28A 3FYNA 2WPWA 3G3SA 4M3SA 1XF8A 1J4JA 4CGPA 2JDCA 2VEZA 1Q2DA 2FS5A 4KOVA 4CGMA 3R9GA 4CYQA 5IX3A 4XPDB 3BJ8A 2ATRA 4CAEA 3TO7A 4CRYB 4KOWA 4ONUA 4MHDA 4KLVA 5AGEA 2Q4VA 5H84A 1TIQA 3TE4A 1Z4EA 2FT0A 3W91A 2VBQA 4RS2A 3DR6A 3N7ZA 1BO4A 4LX9A 4UFVA 3I3GA 3K9UA 4AVAA 1IYLA 1MK4A 2YNEA 3TOBA 1M4GA 1ON0A 4R57A 4K30A 1I21A 2PDOA 2WSAA 5F48A 2ZW4A 1YK3A 1CM0A 2WPXA 2FIAA 4QUSA 3WR7A 1B6BA 4YFJA 2Z0ZA 2HV2A 4CAXA 2DPSA 3IWGA 2GIVA 3P2FA 2NMTA 4B10A 2CNSA 1RXTA 4HNXB 2PRBA 4F0YA 4YGOA 4KSFA 5J8CA 3JTKA 4PSXA 1L0CA 2DPTA 1NE9A 4MI4A 3CXPA 4OAEA 4QVTA 3QB8A 1MJAA 2D4PA 2OZGA 1XE4A 2OU2A 4OADA 3E0KA 5GCNA 2RC4A 3EO4A 2A4NA 4AB7A 4B5PB 2OZUA 3G8WA 4FD4A 4C2YA 4UCPA 5F47A 1YVOA 4FD5A 4PSWA 1WWZA 2VQYA 2AJ6A 4MFJA 4J3GA 5JQ4A 1U6MA 1S7FA 1QSTA 3R9EA 4A33A 2ZW7A 2R1IA 4QC6A 1I12A 3LODA 1OZPA 3PGPA 2REFA 2K5TA 1RO5A 4AVBA 3F5BA 2P6FA 1Y7RA 2G3AA 3T90A 3D2PA 2BEIA 1BOBA 2Z3PA 3VWEA 4KLWA 2P6GA 2Z3KA 4B5PA 2VI7A 3PP9A 2CNTA 3CXQA 5DWMA 3IWEA 3H4QA 4KOXA 4RI1A 5H86A 4A2ZA 1S5KA 4JJXA 3TTHA 1IICA 4CAWA 4F0XA 2BUEA 5CNPA 4II9A 2B3VA 3D3SA 3JVNA 4BBHA 1GHEA 1XIXA 4HNWB 4YRHA 3TCVA 1S7NA 1YX0A 4LUAA 3SHPA 4CGNA 3TFYA 5AG6A 4C2XA 5ISVA 1M44A 1WK4A 2I00A 4CAFA 4FD7A 2PC1A 4Q36A 2BSWA 4L89A 3MGDA 3H5ZA 3UY5A 1XMTA 3EFAA 1Q2YA 1M1DA 4HKFA 1FY7A 2VZYA 2Z3MA 2QIRA 5G22A 4XPKA 4M85A 4B11A 3IU2A 4FD6A 5E96A 2P0WA 1KUXA 2IL4A 2ZW5A 3GKRA 5KTCA 1QSNA 4MFKA 4KVOE 3S6GA 5G20A 4CYNA 1S7LA 3ZJ0A 2Z3LA 2ZXVA 4JWPA 2C27A 1Z4RA 4JXRA 3TO6A 2QMLA 4DNCA 1S3ZA 1YGHA 1Z9UA 4JLYA 3TO9A 2YNCC 3D2MA 1S60A 4NXYA 5G21A 3DR8A 3F8KA 3T9YA 3B8GA 3FIXA 1K4JA 4R87A 4EVYA 1NMTA 4A32A 1N71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFP A;  4MFK A;  4MFJ A;  4MFL A;  4Q38 A;  4MFZ A;  4Q36 A;  4MFQ A; 
#chains in the Genus database with same CATH topology
 1TF9 A;  1P0H A;  3H8G A;  4PXD A;  4TWE A;  1QMU A;  4MFZ A;  1CPS A;  2PJ7 A;  2JBJ A;  1BPM A;  4X5K A;  3PRT A;  2ZEH A;  4KSI A;  2EUI A;  5AG5 A;  4B12 A;  3IO1 A;  3B3V A;  3SXN A;  2AFM A;  3GUX A;  2V8D A;  4M6I A;  3PEI A;  4MCP A;  3P2H A;  1LRZ A;  3ISX A;  3NE7 A;  4CYP A;  4NF1 A;  4MHZ A;  2J8R A;  2Q44 A;  3B7I A;  4CGL A;  4H6Z A;  4I49 A;  4P4J A;  1YR0 A;  4HNY B;  2JEW A;  2ODF A;  4P10 A;  4A30 A;  2KCW A;  3BJ7 A;  4UBR A;  5AG4 A;  4JD6 A;  2PQ8 A;  2R8V A;  4NJQ A;  5F46 A;  5K8N A;  1KUV A;  3B3W A;  2JLM A;  2ZOF A;  4KSA A;  3WC7 A;  4C2Z A;  1ELL P;  5CPA A;  3R95 A;  4KZT A;  1ZO0 A;  4UFX A;  4F6A A;  4A31 A;  4KVM E;  4PK3 A;  3FVL A;  2G9D A;  2PSW A;  4IHM A;  1IGB A;  4UIA A;  4KOY A;  4BD9 A;  1P4N A;  4MCS A;  5J1Q A;  2HQY A;  4GS4 A;  1YRE A;  1VHE A;  3K2K A;  2EWB A;  1MJB A;  1MJ9 A;  1PUA A;  1Z8T A;  1B87 A;  2QYV A;  3C26 A;  4FUU A;  4Q38 A;  4A38 A;  1NSL A;  5FVJ A;  4U9Y A;  4KOT A;  4C7I A;  4E0A A;  4BMH A;  2JEV A;  2ZEN A;  4NCZ A;  3FBU A;  3D66 A;  3N5F A;  1LAN A;  2EO8 A;  3RYO A;  3BI1 A;  4NSQ A;  2OH1 A;  1CG2 A;  2V77 A;  3TT2 A;  3FB3 A;  4M6H A;  4K3N A;  4UCM A;  4ZBG A;  3GIU A;  2B58 A;  2AE6 A;  2H5M A;  2I79 A;  1FT7 A;  2IMO A;  2FSR A;  1SQH A;  2ZPA A;  4MFP A;  3PZJ A;  2FE7 A;  3IGR A;  4F8Z A;  2OR4 A;  3FX6 A;  4UA3 A;  3FH4 A;  2B5G B;  4Y49 C;  2REE A;  4MFQ A;  4AG9 A;  3KI9 A;  2GLF A;  4FAI A;  4ZY2 A;  1IB1 E;  3GYA A;  1QSM A;  4NGN A;  4JYW A;  3SJE A;  3TOA A;  3S6H A;  5LRK A;  4B13 A;  3FED A;  2ZW6 A;  4OLL A;  4XPL A;  5I0C A;  2PIY A;  4NJR A;  4XPD C;  2FVG A;  1VKC A;  2X7B A;  2Z3O A;  1UFH A;  1JWQ A;  3I9S A;  4P4E A;  4E8O A;  2B3U A;  3NE8 A;  4O23 A;  5JM6 A;  1HDQ A;  2AFZ A;  2O53 A;  3R1K A;  2CTC A;  5LRG A;  4MMO A;  1BAV A;  3WAB A;  1ZG7 A;  4CAV A;  4OC5 A;  4OC2 A;  1KUY A;  3BHX A;  4Y49 B;  4CS0 B;  5KTA A;  5AG7 A;  4CYO A;  3PFO A;  4JZ0 A;  3SXO A;  4Z65 A;  2ZEM A;  3IEH A;  1X10 A;  4PXE A;  4FBE A;  5BWA B;  1H8L A;  3CPA A;  3MGD A;  4R3L A;  1Y0R A;  4UWJ A;  3VWD A;  4ONW A;  3DDD A;  4UEF A;  4C68 A;  3CZX A;  2ZEG A;  1M4D A;  6CPA A;  1F2O A;  1PYT B;  1R57 A;  2B5G A;  3H8E A;  4UCN A;  3RAM A;  2QJ8 A;  4FWU A;  4M6G A;  4NEX A;  4PK2 A;  5A27 A;  2R98 A;  3VAR A;  2ZEE A;  2DEA A;  1IID A;  3DLJ A;  2J8N A;  4IUS A;  4MXU A;  2JBK A;  5KTD A;  1Y9K A;  4E2A A;  5IV0 A;  3F0A A;  2PR8 A;  3EY5 A;  1YVK A;  2ARH A;  4OKO A;  5C82 A;  1KZF A;  2F5I A;  3R9F A;  4AG7 A;  4JXQ A;  4H89 A;  4A95 A;  3V8I A;  1GYT A;  3FXT A;  4LQ6 A;  2OZH A;  4R3K A;  3W6X A;  4EWT A;  3NA6 A;  3EC4 A;  4IF5 A;  5JPH A;  1AMP A;  1F2P A;  2CY2 A;  3BXM A;  4KOU A;  2VZZ A;  3H8F A;  4MJ8 A;  2BOA A;  5JGF A;  3SI2 A;  3W6S A;  3CXS A;  1AYE A;  2PR1 A;  4U9Z A;  2Z10 A;  1CJW A;  4XNH C;  4KOR A;  2Q4Y A;  3S9L A;  2Q0Y A;  1JQG A;  4R9M A;  1XOV A;  2CXA A;  2JDD A;  5I4M A;  2XEI A;  4G1P A;  1UWY A;  2O28 A;  3IU1 A;  2PJ1 A;  1Y9W A;  2FCK A;  4CRZ B;  3BLN A;  4UIB A;  3FEE A;  4MY3 A;  1VHS A;  2CIJ A;  5DWN A;  2C6P A;  4X8I A;  1F57 A;  4OP4 A;  4UWI A;  3S6K A;  1ARL A;  1XRY A;  1XFO A;  4OC0 A;  1RTQ A;  3DNS A;  1TKJ A;  5IB0 A;  3JUW A;  2G0B A;  2EVN A;  3FRM A;  4MFL A;  2PJA A;  5EC4 A;  1S7K A;  1QSR A;  3FNC A;  1DTD A;  1V0C A;  2AFU A;  2Y0M A;  4XNH B;  2FL4 A;  3QAH A;  3FF3 A;  2CNM A;  1XEB A;  3D4U A;  1M4I A;  3A9L A;  1YW6 A;  4UFW A;  2QVP A;  4MBU A;  4PV6 A;  2B4D B;  4OID A;  1FNO A;  1TXR A;  2Z11 A;  4KUB A;  2WUU A;  3NH4 A;  2FXF A;  1IYK A;  3B3C A;  3ISZ A;  4KOS A;  4WJB A;  3KR5 A;  2HUZ A;  4H6U A;  3UY5 A;  3PB8 X;  3VH9 A;  3R96 A;  1QSO A;  4BIN A;  4KVX A;  3LAC A;  2BL1 A;  2B4B A;  5C88 A;  2YGW A;  3PB9 X;  4R6T A;  3ZZI A;  4B5O A;  1R3N A;  3S6F A;  3EXN A;  3B35 A;  4P45 A;  4U5Y A;  5LYI A;  1CX8 A;  3LD2 A;  4MY0 A;  4KS9 A;  1Z2L A;  2YNC A;  4L8A A;  5HH1 A;  1OBR A;  2VXK A;  4ZGY B;  4ZY0 A;  4PXC A;  5G1Z A;  4B14 A;  1PU9 A;  3WC6 A;  4PPZ A;  4ORF A;  4QBJ A;  2PVW A;  4P4F A;  2GE3 A;  4QB9 A;  2YND A;  3DSB A;  2Q51 A;  4TNU A;  2DF5 A;  2DXQ A;  1YLE A;  2QEC A;  4NFR A;  4DJL A;  3FEC A;  3PBB A;  2ZED A;  2G3T A;  3D8P A;  3SJG A;  2GAN A;  2Z3N A;  5EBV A;  4AVC A;  5HMN A;  3OWC A;  2R7H A;  1LOK A;  2IJZ A;  2B4D A;  2D4O A;  1I1D A;  2PJ9 A;  3KHZ A;  3B3T A;  4P6Y A;  5F49 A;  3PBE A;  3GY9 A;  2Q04 A;  4H2K A;  1BLL E;  5J8F A;  2Q4Z A;  2FIW A;  2OB0 A;  2PJB A;  3NH8 A;  4MRI A;  1Q2C A;  4KUA A;  3IIB A;  4C7H A;  3KKW A;  2Q7B A;  4A39 A;  4CGO A;  1CPX A;  2P6E A;  5EMI A;  2J8M A;  2POK A;  5K8O A;  5A28 A;  2GLJ A;  3PFE A;  3FYN A;  2PJ8 A;  4UEE A;  2ZOG A;  3SJX A;  3PB6 X;  5THW A;  3RZA A;  2ANP A;  2WPW A;  2AFW A;  3G3S A;  1VHO A;  1XF8 A;  4M3S A;  1J4J A;  4MHP A;  2F7V A;  4RN7 A;  3V7Z A;  4CGP A;  2I3C A;  1VGY A;  2JDC A;  3B3S A;  3TC8 A;  2AFO A;  5HVG A;  1Z5R A;  2VEZ A;  3IC1 A;  1Q2D A;  3D68 A;  3L2N A;  2FS5 A;  4KOV A;  4CGM A;  3R9G A;  4CYQ A;  5IX3 A;  1PCA A;  2RB7 A;  4XPD B;  3BJ8 A;  2CTB A;  2V8V A;  3MN8 A;  2ATR A;  1EE3 P;  1IY7 A;  4DYO A;  4CAE A;  3TO7 A;  2NSM A;  2PCU A;  4F9U A;  4CRY B;  4NGS A;  4Q7A A;  2EK8 A;  4KOW A;  3KL9 A;  4ONU A;  4MHD A;  5D8N A;  4MCQ A;  5LYF A;  4KLV A;  1IOI A;  1LAM A;  5AGE A;  2Q4V A;  5H84 A;  1TIQ A;  3RNZ A;  3TE4 A;  2Q7S A;  1Z4E A;  2FT0 A;  3W91 A;  2GRE A;  1YME A;  2VBQ A;  2PJ2 A;  4AXV A;  4RS2 A;  3DR6 A;  3T8W A;  2ZEO A;  3N7Z A;  1DE4 C;  3NFZ A;  3V38 A;  4IAV A;  4GXH A;  5LYL A;  1BO4 A;  1Z8W A;  4LX9 A;  1ZG8 A;  3I3G A;  3GLJ A;  3K9U A;  4UFV A;  3FMC A;  1IYL A;  1MK4 A;  4AVA A;  5JH9 A;  2RFH A;  2YNE A;  3TOB A;  5HVH A;  1M4G A;  2AFS A;  1YW4 A;  2GU2 A;  1CP6 A;  1ON0 A;  3D7G A;  4R57 A;  5HVF A;  2WZN A;  4DUK A;  3PB7 X;  4K30 A;  1I21 A;  1YQE A;  2PJ3 A;  3GB0 A;  2V8G A;  3TX8 A;  2PDO A;  2PIZ A;  2WSA A;  2XEG A;  3SJF A;  3NH5 A;  5F48 A;  2ZW4 A;  2AFX A;  4OC3 A;  3MRU A;  4RUH A;  1YK3 A;  1CM0 A;  2WPX A;  2NYQ A;  2FIA A;  4QUS A;  3WR7 A;  7CPA A;  1B6B A;  4YFJ A;  2Z0Z A;  3KQX A;  2HV2 A;  3I1U A;  5ELY A;  1QQ9 A;  4CAX A;  5D29 A;  2DPS A;  1A2Z A;  2ABZ A;  3IWG A;  2GIV A;  2ZEP A;  3P2F A;  2NMT A;  4P44 A;  3KGQ A;  2OOT A;  4B10 A;  2CNS A;  3QAY A;  1RXT A;  4X3R A;  4HNX B;  4IK2 A;  1XBU A;  2PRB A;  4F0Y A;  1TKF A;  3KZW A;  4YGO A;  4KSF A;  5J8C A;  3JTK A;  4PSX A;  5DS0 A;  1L0C A;  1Z8L A;  3S9M A;  2DPT A;  1YLO A;  1NE9 A;  1CBX A;  4NGR A;  4MI4 A;  4PQA A;  4ZX9 A;  3CXP A;  4OAE A;  4QVT A;  1HDU A;  2C6G A;  3QB8 A;  4EFD A;  1MJA A;  2D4P A;  8CPA A;  2OZG A;  1TF8 A;  1XE4 A;  2OU2 A;  5K8M A;  3D7F A;  4OAD A;  4EME A;  3E0K A;  3DGV A;  5GCN A;  2RC4 A;  3EO4 A;  2A4N A;  4AB7 A;  1LFW A;  4NGP A;  3RO0 A;  4MHY A;  4B5P B;  4LQG A;  2OZU A;  1YSJ A;  3G8W A;  4FD4 A;  4UCP A;  2PJ0 A;  5F47 A;  4C2Y A;  1YVO A;  2PJ5 A;  3IWW A;  4FD5 A;  1WWZ A;  1ZLH A;  2VQY A;  4PSW A;  1XMB A;  2AJ6 A;  4MFJ A;  4W9Y A;  4J3G A;  4ZI6 A;  5JQ4 A;  1U6M A;  4HPS A;  4CPA A;  1S7F A;  4R76 A;  1QST A;  3R9E A;  4A33 A;  1TKH A;  2ZW7 A;  2R1I A;  4R7M A;  4QC6 A;  3KR4 A;  4MHN A;  3IJ3 A;  1I12 A;  2PJC A;  1IOF A;  3LOD A;  1OZP A;  1KWM A;  2CF4 A;  2Q43 A;  2HB6 A;  4NGQ A;  1Z8X A;  3PGP A;  1XJO A;  2F8H A;  1LAP A;  2REF A;  2K5T A;  1RO5 A;  4AVB A;  4WWV A;  3F5B A;  4A37 A;  2P6F A;  1Y7R A;  2G3A A;  2PE3 A;  3T90 A;  3D2P A;  4ZYQ A;  2BEI A;  1BOB A;  2EK9 A;  2Z3P A;  3WT4 A;  1Y0Y A;  3VWE A;  2V8H A;  3CDX A;  3KQZ A;  4KLW A;  2P6G A;  4NGT A;  2BO9 A;  2Z3K A;  4NGM A;  4PXB A;  4B5P A;  2PRQ A;  3LMS A;  2VI7 A;  3CPX A;  3PP9 A;  2CNT A;  3CXQ A;  5DWM A;  3IWE A;  3QNV A;  2BCO A;  2IQ6 A;  3H4Q A;  4R8F A;  1BPN A;  4KOX A;  4RI1 A;  5H86 A;  1NSA A;  4OC1 A;  4A2Z A;  4P4I A;  1S5K A;  2EBJ A;  4JJX A;  3TTH A;  1IIC A;  2HC9 A;  2PJ6 A;  4A94 A;  4CAW A;  4F0X A;  2BUE A;  4P4D A;  3CT9 A;  5CNP A;  4II9 A;  2B3V A;  3D3S A;  3FJU A;  3JVN A;  1GHE A;  1XIX A;  4OIW A;  4HNW B;  4BBH A;  2WYR A;  1Y7E A;  2ZEL A;  4YRH A;  4GM5 A;  3TCV A;  4ZY1 A;  1R43 A;  1S7N A;  1YX0 A;  4LUA A;  3SHP A;  4OME A;  4B6Z A;  4CGN A;  2GFQ A;  4YU9 A;  3TFY A;  5AG6 A;  1IU8 A;  4C2X A;  5ISV A;  1M44 A;  1WK4 A;  1ZG9 A;  2I00 A;  2XEF A;  2PC1 A;  4FD7 A;  4Q36 A;  4ZX8 A;  4CAF A;  2XEJ A;  2BSW A;  4OC4 A;  4L89 A;  3BI0 A;  1AUG A;  3H5Z A;  1XMT A;  3D7H A;  3EFA A;  1Q2Y A;  1HEE A;  1M1D A;  3HUV A;  4HKF A;  4MCR A;  1FY7 A;  2VZY A;  2Z3M A;  4P4B A;  1ARM A;  1X12 A;  2QIR A;  4XPK A;  5G22 A;  2PVV A;  2J9A A;  3IU2 A;  4M85 A;  4B11 A;  3HLP A;  4FD6 A;  3KAS A;  3IFE A;  5E96 A;  2P0W A;  1KUX A;  4UEZ A;  2IL4 A;  2ZW5 A;  3GKR A;  2PJ4 A;  3VAT A;  3K9T A;  5KTC A;  1QSN A;  4MFK A;  5CBM A;  4KVO E;  3S6G A;  2VL1 A;  5G20 A;  4CYN A;  1ZLI A;  1S7L A;  3SI0 A;  3SI1 A;  3ZJ0 A;  2Z3L A;  2ZXV A;  4JWP A;  5IB9 A;  2C27 A;  1Z4R A;  4JXR A;  3TO6 A;  2QML A;  3D67 A;  1S3Z A;  4DNC A;  1CP7 A;  1Q7L A;  2C1C A;  4F9V A;  5F09 A;  2ZEF A;  2C6C A;  1YGH A;  1Z9U A;  4JLY A;  3TO9 A;  5K8P A;  2YNC C;  4X2T A;  3B2Y A;  3D2M A;  3WC5 A;  1S60 A;  2O4H A;  4NXY A;  3KHX A;  3DR8 A;  3F8K A;  5G21 A;  3LWU A;  3S9N A;  4YWY A;  3T9Y A;  3RBU A;  5LYD A;  3B8G A;  1ELM P;  3D7D A;  3FIX A;  3JRU A;  5HXD A;  1K4J A;  4R87 A;  4UF4 A;  4EVY A;  1VIX A;  1LCP A;  1NMT A;  3PB4 X;  5LRJ A;  4A32 A;  1M4L A;  1N71 A; 
#chains in the Genus database with same CATH homology
 1P0H A;  4MFZ A;  4X5K A;  2EUI A;  5AG5 A;  4B12 A;  3SXN A;  3P2H A;  1LRZ A;  3NE7 A;  4CYP A;  4NF1 A;  2J8R A;  2Q44 A;  4CGL A;  4H6Z A;  4I49 A;  1YR0 A;  4HNY B;  4A30 A;  2KCW A;  3BJ7 A;  4UBR A;  5AG4 A;  4JD6 A;  2PQ8 A;  2R8V A;  5F46 A;  1KUV A;  2JLM A;  4KSA A;  4C2Z A;  3R95 A;  4KZT A;  1ZO0 A;  4UFX A;  4F6A A;  4A31 A;  4KVM E;  4PK3 A;  2PSW A;  4KOY A;  1P4N A;  2HQY A;  4GS4 A;  1YRE A;  1MJB A;  1MJ9 A;  1PUA A;  1B87 A;  3C26 A;  4Q38 A;  1NSL A;  5FVJ A;  4U9Y A;  4KOT A;  4C7I A;  4E0A A;  4BMH A;  2JEV A;  4NCZ A;  3FBU A;  3RYO A;  4NSQ A;  2OH1 A;  3TT2 A;  3FB3 A;  4UCM A;  4ZBG A;  2B58 A;  2AE6 A;  2H5M A;  2I79 A;  2FSR A;  1SQH A;  2ZPA A;  4MFP A;  3PZJ A;  2FE7 A;  3IGR A;  4UA3 A;  2B5G B;  4Y49 C;  2REE A;  4MFQ A;  4AG9 A;  1IB1 E;  3GYA A;  1QSM A;  3TOA A;  3S6H A;  4B13 A;  2ZW6 A;  4OLL A;  4XPL A;  5I0C A;  4XPD C;  1VKC A;  2X7B A;  2Z3O A;  1UFH A;  3I9S A;  4E8O A;  2B3U A;  3R1K A;  4CAV A;  1KUY A;  4CS0 B;  4Y49 B;  5KTA A;  5AG7 A;  4CYO A;  3SXO A;  5BWA B;  4R3L A;  4UWJ A;  3VWD A;  3DDD A;  4C68 A;  1M4D A;  1R57 A;  2B5G A;  4UCN A;  4NEX A;  4PK2 A;  5A27 A;  2R98 A;  1IID A;  2J8N A;  4IUS A;  5KTD A;  1Y9K A;  4E2A A;  5IV0 A;  3F0A A;  2PR8 A;  3EY5 A;  1YVK A;  2ARH A;  5C82 A;  1KZF A;  2F5I A;  3R9F A;  4AG7 A;  4JXQ A;  4H89 A;  4A95 A;  3V8I A;  3FXT A;  2OZH A;  4R3K A;  3W6X A;  5JPH A;  3EC4 A;  4IF5 A;  2CY2 A;  4KOU A;  2VZZ A;  4MJ8 A;  3W6S A;  3CXS A;  2PR1 A;  4U9Z A;  2Z10 A;  1CJW A;  4XNH C;  4KOR A;  2Q4Y A;  2Q0Y A;  4R9M A;  2CXA A;  2JDD A;  2O28 A;  3IU1 A;  1Y9W A;  2FCK A;  4CRZ B;  3BLN A;  4MY3 A;  1VHS A;  5DWN A;  4UWI A;  3S6K A;  3DNS A;  5IB0 A;  3JUW A;  2G0B A;  2EVN A;  3FRM A;  4MFL A;  5EC4 A;  1S7K A;  1QSR A;  3FNC A;  1V0C A;  2Y0M A;  4XNH B;  2FL4 A;  3QAH A;  2CNM A;  1XEB A;  1M4I A;  3A9L A;  4UFW A;  4MBU A;  4PV6 A;  2B4D B;  2Z11 A;  4KUB A;  2WUU A;  4KOS A;  1IYK A;  2FXF A;  4H6U A;  2HUZ A;  3R96 A;  1QSO A;  4KVX A;  2BL1 A;  2B4B A;  5C88 A;  2YGW A;  3ZZI A;  4B5O A;  3S6F A;  3EXN A;  4U5Y A;  3LD2 A;  4MY0 A;  4KS9 A;  2YNC A;  4L8A A;  5HH1 A;  2VXK A;  4ZGY B;  5G1Z A;  4B14 A;  1PU9 A;  4ORF A;  4QBJ A;  2GE3 A;  4QB9 A;  2YND A;  3DSB A;  2DXQ A;  1YLE A;  2QEC A;  2G3T A;  3D8P A;  2GAN A;  2Z3N A;  5EBV A;  4AVC A;  5HMN A;  3OWC A;  2R7H A;  2B4D A;  2D4O A;  1I1D A;  5F49 A;  3GY9 A;  2Q04 A;  5J8F A;  2FIW A;  2OB0 A;  1Q2C A;  4KUA A;  4C7H A;  3KKW A;  2Q7B A;  4CGO A;  2P6E A;  2J8M A;  5A28 A;  3FYN A;  2WPW A;  3G3S A;  4M3S A;  1XF8 A;  1J4J A;  4CGP A;  2JDC A;  2VEZ A;  1Q2D A;  2FS5 A;  4KOV A;  4CGM A;  3R9G A;  4CYQ A;  5IX3 A;  4XPD B;  3BJ8 A;  2ATR A;  4CAE A;  3TO7 A;  4CRY B;  4KOW A;  4ONU A;  4MHD A;  4KLV A;  5AGE A;  2Q4V A;  5H84 A;  1TIQ A;  3TE4 A;  1Z4E A;  2FT0 A;  3W91 A;  2VBQ A;  4RS2 A;  3DR6 A;  3N7Z A;  1BO4 A;  4LX9 A;  4UFV A;  3I3G A;  3K9U A;  4AVA A;  1IYL A;  1MK4 A;  2YNE A;  3TOB A;  1M4G A;  1ON0 A;  4R57 A;  4K30 A;  1I21 A;  2PDO A;  2WSA A;  5F48 A;  2ZW4 A;  1YK3 A;  1CM0 A;  2WPX A;  2FIA A;  4QUS A;  3WR7 A;  1B6B A;  4YFJ A;  2Z0Z A;  2HV2 A;  4CAX A;  2DPS A;  3IWG A;  2GIV A;  3P2F A;  2NMT A;  4B10 A;  2CNS A;  1RXT A;  4HNX B;  2PRB A;  4F0Y A;  4YGO A;  4KSF A;  5J8C A;  3JTK A;  4PSX A;  1L0C A;  2DPT A;  1NE9 A;  4MI4 A;  3CXP A;  4OAE A;  4QVT A;  3QB8 A;  1MJA A;  2D4P A;  2OZG A;  1XE4 A;  2OU2 A;  4OAD A;  3E0K A;  5GCN A;  2RC4 A;  3EO4 A;  2A4N A;  4AB7 A;  4B5P B;  2OZU A;  3G8W A;  4FD4 A;  4C2Y A;  4UCP A;  5F47 A;  1YVO A;  4FD5 A;  4PSW A;  1WWZ A;  2VQY A;  2AJ6 A;  4MFJ A;  4J3G A;  5JQ4 A;  1U6M A;  1S7F A;  1QST A;  3R9E A;  4A33 A;  2ZW7 A;  2R1I A;  4QC6 A;  1I12 A;  3LOD A;  1OZP A;  3PGP A;  2REF A;  2K5T A;  1RO5 A;  4AVB A;  3F5B A;  2P6F A;  1Y7R A;  2G3A A;  3T90 A;  3D2P A;  2BEI A;  1BOB A;  2Z3P A;  3VWE A;  4KLW A;  2P6G A;  2Z3K A;  4B5P A;  2VI7 A;  3PP9 A;  2CNT A;  3CXQ A;  5DWM A;  3IWE A;  3H4Q A;  4KOX A;  4RI1 A;  5H86 A;  4A2Z A;  1S5K A;  4JJX A;  3TTH A;  1IIC A;  4CAW A;  4F0X A;  2BUE A;  5CNP A;  4II9 A;  2B3V A;  3D3S A;  3JVN A;  4BBH A;  1GHE A;  1XIX A;  4HNW B;  4YRH A;  3TCV A;  1S7N A;  1YX0 A;  4LUA A;  3SHP A;  4CGN A;  3TFY A;  5AG6 A;  4C2X A;  5ISV A;  1M44 A;  1WK4 A;  2I00 A;  4CAF A;  4FD7 A;  2PC1 A;  4Q36 A;  2BSW A;  4L89 A;  3MGD A;  3H5Z A;  3UY5 A;  1XMT A;  3EFA A;  1Q2Y A;  1M1D A;  4HKF A;  1FY7 A;  2VZY A;  2Z3M A;  2QIR A;  5G22 A;  4XPK A;  4M85 A;  4B11 A;  3IU2 A;  4FD6 A;  5E96 A;  2P0W A;  1KUX A;  2IL4 A;  2ZW5 A;  3GKR A;  5KTC A;  1QSN A;  4MFK A;  4KVO E;  3S6G A;  5G20 A;  4CYN A;  1S7L A;  3ZJ0 A;  2Z3L A;  2ZXV A;  4JWP A;  2C27 A;  1Z4R A;  4JXR A;  3TO6 A;  2QML A;  4DNC A;  1S3Z A;  1YGH A;  1Z9U A;  4JLY A;  3TO9 A;  2YNC C;  3D2M A;  1S60 A;  4NXY A;  5G21 A;  3DR8 A;  3F8K A;  3T9Y A;  3B8G A;  3FIX A;  1K4J A;  4R87 A;  4EVY A;  1NMT A;  4A32 A;  1N71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...