4MFQA

The crystal structure of acyltransferase in complex with coa and 10c-teicoplanin
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
323
structure length
323
Chain Sequence
MDPETVRIALGLEERTAAWLTELDELGPPAEPVRLPRGEEARDLLRRLEVPELDAEEIVAAAPDPDRDPALWWLLERTHHAIVRHMGDHRAKPRGGPPLPYEGGAAARYFHVYVFLATVPAVRRFHAERGIPDEVGWETLTQLGELVAIHRRKYGQGGMNMQWWTTYHLRGILYRLGRLQFSLATGKDGTPHLGLAVPEWGGPLLPKAYDESLHRARPFFDRHFPEHGARVAWGSSWMLDPQLEEYLTEDSNIIQLARFWTLTDSAPEPGNADGDSSILEFVFRYNGQPLDELPQRSSLERAVIAHLKAGRHWHMRTGFVKLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiple complexes of long aliphatic N-acyltransferases lead to synthesis of 2,6-diacylated/2-acyl-substituted glycopeptide antibiotics, effectively killing vancomycin-resistant enterococcus
pubmed doi rcsb
source organism Actinoplanes teichomyceticus
molecule tags Transferase/antibiotic
molecule keywords Putative uncharacterized protein tcp24
total genus 109
structure length 323
sequence length 323
ec nomenclature ec 2.3.1.-:
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18082 DUF5596 Domain of unknown function (DUF5596)
A PF18164 GNAT_C GNAT-like C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.120 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mfqA02
4MFKA 4MFQA 4MFLA 4Q38A 4MFJA 4Q36A 4MFPA 4MFZA
chains in the Genus database with same CATH superfamily
3D68A 1ELMP 4ONUA 1S5KA 4U5YA 3SHPA 1B87A 3T90A 1S7FA 2ZW7A 4CS0B 2JLMA 2EO8A 4E8OA 4NEXA 1VHEA 1IYLA 2VBQA 3S9MA 2R7HA 4L89A 4OC0A 3R9FA 5AGEA 3IU2A 4A39A 1OZPA 1WWZA 1RO5A 1Q2DA 2G0BA 4R3LA 3K9TA 3FB3A 1ON0A 2I3CA 3D7FA 1QSNA 2B58A 4NGNA 5AG6A 3SI0A 1TF8A 2C6CA 2PRBA 5F49A 1EE3P 2JDDA 2NMTA 5A27A 3S6KA 4P45A 2HV2A 1AMPA 4KUBA 4CPAA 2P0WA 2PJ4A 4NJQA 4FWUA 2BCOA 4WWVA 4MCRA 3GB0A 3KASA 3MRUA 3RO0A 4IAVA 2YNDA 4IUSA 1S3ZA 2GE3A 1L0CA 3CPXA 3PBBA 4R3KA 2R98A 4NF1A 4OIDA 4OP4A 3TTHA 4BBHA 5C82A 1Z8WA 3MGDA 3EY5A 4B11A 2P6GA 4UF4A 4ZY1A 4G1PA 5K8MA 3GIUA 4ZX8A 4A2ZA 3NA6A 2GFQA 3LD2A 3LODA 2YGWA 3KI9A 5BWAB 2YNEA 2C6PA 3B35A 2RFHA 3I1UA 2ZEGA 2FE7A 2YNCC 3PB4X 4NGRA 2BSWA 2P6EA 3B3VA 4CAWA 1YLOA 4F9VA 1XMTA 4M85A 5HH1A 1QSTA 1ZLIA 2HB6A 4KOYA 4K3NA 3IWGA 4U9YA 4B13A 4C68A 3TOAA 4UCNA 1NSLA 3GLJA 2ODFA 4YU9A 1R43A 2Y0MA 1FNOA 2ZEDA 3G8WA 4PPZA 4MCQA 3IWWA 4KZTA 2GREA 4MI4A 3H5ZA 4KOSA 4XNHC 2QJ8A 2ZEMA 3KKWA 4FD4A 3IWEA 2CNTA 4OAEA 2ZW6A 5CNPA 5THWA 3WABA 2F7VA 2OZHA 2PJAA 2ATRA 2DPTA 4JXRA 3GKRA 3T9YA 4IF5A 4CYNA 2PJ7A 1YW6A 1CG2A 3FBUA 3EC4A 1CP7A 4KVME 6CPAA 1QQ9A 2EWBA 4A31A 1ZG9A 4UEFA 3WR7A 2AFOA 1LCPA 3V8IA 2H5MA 4RN7A 2DXQA 1Y9WA 4XNHB 1S60A 2ZELA 4AXVA 1IGBA 1MJBA 2J8RA 4ZI6A 2PIZA 2IMOA 2HC9A 2V77A 2AJ6A 4PQAA 4FAIA 1CM0A 4KOTA 1YGHA 3B3CA 3WC7A 4EFDA 5JM6A 3S6FA 1HEEA 2OOTA 1IY7A 4IK2A 3F0AA 2ZXVA 1XF8A 5LRKA 2Z3PA 1XE4A 3KQZA 1PUAA 3K9UA 3PRTA 1Y9KA 1RXTA 2FSRA 2HUZA 5H86A 3R9GA 3KQXA 4MXUA 3SJGA 4H2KA 2ZW5A 3BJ7A 5I4MA 2V8DA 4P4DA 4UFWA 3NH8A 5IX3A 4FD7A 5JPHA 5JGFA 3H4QA 3D3SA 3EFAA 4MRIA 1BOBA 2DF5A 1DE4C 3E0KA 2Z3NA 4MHPA 4B6ZA 4UEEA 1LAPA 1P0HA 5D29A 3D4UA 2Q4YA 4DNCA 1BAVA 1CJWA 2REFA 2Z11A 2ZOGA 3G3SA 4B14A 2OR4A 2GIVA 1B6BA 2V8VA 4AVAA 4FD6A 4CAVA 5KTDA 1XRYA 2BEIA 4NCZA 4CAFA 5JQ4A 3TE4A 2B3UA 4UCPA 2QYVA 4RUHA 1Y0YA 1BO4A 5G22A 2Q04A 2Z3LA 2Z3OA 3DSBA 2AFUA 2PVWA 3PB8X 3IC1A 4UCMA 4ORFA 2K5TA 4JD6A 3NH4A 4QB9A 3UY5A 4KUAA 4A33A 2B4BA 3V38A 4BD9A 1ZLHA 1S7NA 2J9AA 3RNZA 4MFLA 1QSRA 3CZXA 3PGPA 2XEGA 2AE6A 2WYRA 3IGRA 3SJEA 2FS5A 1XMBA 5HMNA 3BI0A 2FIWA 2PIYA 5G1ZA 2F8HA 3JTKA 2EUIA 2CNSA 3VWDA 5E96A 4ZY0A 1J4JA 4L8AA 1ELLP 3BJ8A 5JH9A 2PJ3A 1TKJA 5HXDA 2GANA 2CXAA 2I00A 3CXPA 2J8NA 4KLWA 1X12A 3ZZIA 4F8ZA 4CYPA 4HNWB 1XOVA 4LQGA 1I12A 4GXHA 5D8NA 3RZAA 2GLFA 4DJLA 2FXFA 4OMEA 1Z2LA 2ZEFA 1KZFA 4M6IA 3BXMA 1QSMA 3SXNA 1R57A 1M4DA 4R76A 2VQYA 4Q36A 3D67A 4RI1A 5AG5A 2F5IA 2WPWA 2C27A 4C2YA 3HUVA 1Y7EA 2XEIA 3R1KA 4C7HA 3PBEA 3S6HA 1IOIA 4U9ZA 2PDOA 2PR1A 2JDCA 4NGMA 4OIWA 3TO9A 1IICA 2Z3MA 2PJ9A 1YVOA 1AUGA 5H84A 3FECA 4A95A 1IB1E 3I9SA 1Y7RA 4MCSA 3DR6A 4OC1A 8CPAA 5J8CA 1Q2CA 2JBKA 5ISVA 2CIJA 3S9NA 1U6MA 4UIAA 5F48A 1IU8A 1YVKA 2WUUA 2V8HA 1S7KA 3QB8A 5G20A 3ZJ0A 5IB0A 1TIQA 4MMOA 5DS0A 3LACA 3BHXA 1ARLA 1NMTA 1IYKA 3I3GA 4P4IA 2PJBA 1MJAA 3N5FA 4HKFA 4OC2A 1PYTB 4CRYB 1K4JA 2PRQA 3FX6A 2B4DA 3D7HA 1M4LA 2PJ0A 4NXYA 4ONWA 4Z65A 5LYFA 4BINA 1F2PA 2EBJA 2G3TA 4P4JA 2B5GB 1CPXA 4UIBA 4GM5A 4EWTA 2Q0YA 2P6FA 3BI1A 4PXBA 7CPAA 2OH1A 2WZNA 4UFVA 4B5OA 3WT4A 3T8WA 3SXOA 1JQGA 1XFOA 3IIBA 2XEJA 1PU9A 2ANPA 4PSWA 4M6GA 5ELYA 2PCUA 3PZJA 4KOVA 4LQ6A 4Q7AA 1KUXA 1M4IA 4IHMA 2A4NA 4MBUA 1XIXA 3V7ZA 2HQYA 2B3VA 5I0CA 2PJ8A 1LANA 2Q4VA 3SJFA 1S7LA 2ZEHA 4DYOA 3W91A 4OLLA 3CXQA 5LYDA 4NGTA 4KOUA 4KOWA 3S6GA 1YLEA 2WSAA 3H8GA 3WC6A 3PEIA 3R95A 2RC4A 3DLJA 2AFZA 1P4NA 1Z8XA 2ZENA 3C26A 1NE9A 4P6YA 4OADA 3HLPA 2PJ5A 1FT7A 2YNCA 3CT9A 3FMCA 4OC5A 2VEZA 3R96A 3FYNA 4KVXA 1CX8A 3L2NA 4M3SA 4NSQA 2PJ1A 2PQ8A 5EBVA 4AB7A 4MHDA 1YX0A 2VXKA 3TT2A 3KL9A 1KUYA 3NE8A 3FF3A 4JLYA 2PJ6A 5AG7A 2R8VA 1HDUA 4H6UA 3PB9X 4KSIA 4X3RA 5G21A 1LRZA 1MJ9A 1LAMA 5CBMA 4P4FA 1NSAA 2EVNA 2FCKA 2QECA 3D7GA 1TKFA 3IO1A 4PXCA 4A32A 4YWYA 4CGMA 4F0XA 5IB9A 1V0CA 3W6SA 2BO9A 2CF4A 1M4GA 3PFEA 2QIRA 2Z3KA 3ISZA 5C88A 4PK3A 3IFEA 4KS9A 2RB7A 4ZYQA 4KLVA 3S9LA 1HDQA 2OZGA 1BPMA 3CXSA 1MK4A 3RBUA 4YRHA 3D7DA 3KGQA 4AG9A 1XEBA 3GY9A 3TOBA 1TXRA 1IIDA 4CGPA 4EMEA 3PFOA 4TWEA 1CP6A 2GU2A 4PK2A 4QBJA 1XBUA 2PC1A 3LWUA 1X10A 2PR8A 4X2TA 1LFWA 2DEAA 2B5GA 2KCWA 1FY7A 2ZEEA 3TC8A 4FBEA 5KTCA 4B5PA 3PB6X 4PXEA 3VH9A 4JJXA 1Z5RA 4JXQA 4FD5A 3FVLA 1OBRA 2POKA 4UA3A 2BL1A 3FNCA 1Z4RA 2PVVA 3K2KA 3MN8A 4A94A 2Q7SA 3D2PA 4GS4A 3FIXA 4A38A 1LOKA 1VKCA 4UWJA 2J8MA 3B8GA 2CTBA 4CYOA 4H89A 1Z8TA 2PJCA 4ZBGA 5HVGA 3TFYA 1M44A 2CTCA 3FH4A 4UBRA 2O53A 2NYQA 4ZY2A 1VIXA 3TO6A 2Q4ZA 1VHSA 4AVCA 5K8OA 2AFWA 3B3SA 3JVNA 1CBXA 2FL4A 4XPDC 4E0AA 2XEFA 3RAMA 4MFJA 2CNMA 4LX9A 4MFZA 4QC6A 5LYLA 1YREA 2VI7A 4NGSA 3DNSA 4MCPA 3TO7A 4CGLA 2Z0ZA 1M1DA 4W9YA 3BLNA 2ZEPA 1YK3A 3WC5A 2Q44A 3FEEA 3B3WA 4JZ0A 4XPDB 2PE3A 1F2OA 2AFMA 3NE7A 4YFJA 4Y49C 4O23A 4AVBA 4F0YA 3OWCA 1KWMA 1XJOA 3TX8A 4R87A 4NGPA 5DWNA 3P2HA 1Q7LA 2FIAA 3FXTA 4KVOE 2Q51A 4NJRA 4R6TA 3EO4A 3F8KA 3FRMA 4JWPA 4KOXA 1YSJA 2CY2A 2PJ2A 2QVPA 4K30A 1QMUA 1YQEA 3TCVA 3D66A 4R7MA 1ZG8A 4C2ZA 4OKOA 3W6XA 3IJ3A 4MHYA 2D4OA 4H6ZA 1ZO0A 3CPAA 4M6HA 2NSMA 4NGQA 4Y49B 5LRGA 5AG4A 2D4PA 2BOAA 2G3AA 3B7IA 4R8FA 4UEZA 3IEHA 1QSOA 1IOFA 2EK9A 3A9LA 2O4HA 1ZG7A 5GCNA 1F57A 3NFZA 5LRJA 1R3NA 4II9A 4A30A 2OB0A 2VZZA 3KR5A 3NH5A 1GHEA 3QAHA 2OZUA 2BUEA 4XPLA 3N7ZA 2JEWA 2GLJA 3PP9A 4F6AA 4KSAA 4MJ8A 2G9DA 4R9MA 1YW4A 2C1CA 2ZPAA 2WPXA 4UFXA 3SJXA 4I49A 3RYOA 1WK4A 4XPKA 4AG7A 4CYQA 4ZX9A 1H8LA 4HNYB 3FEDA 4MHNA 5DWMA 5LYIA 3VARA 3KHXA 4P10A 1N71A 1Z8LA 3DR8A 3KZWA 4QVTA 4R57A 4OC4A 1ARMA 2Q7BA 3SI1A 4PXDA 2ZOFA 4B5PB 5KTAA 3H8EA 4YGOA 4HNXB 2O28A 5J8FA 3R9EA 3F5BA 1UFHA 3PB7X 1TF9A 4UWIA 2JBJA 4DUKA 3D2MA 1Y0RA 4B12A 2OU2A 3KHZA 2PSWA 3CDXA 4FUUA 4BMHA 2Q43A 3B2YA 3JRUA 2FVGA 4Q38A 5EC4A 1Z4EA 5HVFA 4CRZB 2Z10A 3D8PA 1JWQA 2I79A 3VWEA 5CPAA 5F46A 3IU1A 1I21A 4F9UA 1VHOA 3EXNA 3GYAA 1BPNA 1PCAA 3DGVA 5J1QA 4MFQA 2QMLA 4A37A 2C6GA 1DTDA 3QAYA 2EK8A 4HPSA 4P44A 4CAXA 4QUSA 2ABZA 4CGNA 5A28A 3VATA 4RS2A 3B3TA 4CGOA 5IV0A 2AFXA 4OC3A 4C7IA 4X8IA 4ZGYB 4C2XA 1VGYA 4MFPA 5F47A 2REEA 2ZW4A 4KORA 1Q2YA 4PSXA 4X5KA 3SI2A 1Z9UA 4MFKA 5F09A 1YMEA 4CAEA 1A2ZA 5FVJA 1AYEA 3GUXA 2VZYA 1TKHA 1RTQA 3LMSA 4KSFA 3FJUA 2IJZA 2ZEOA 5K8NA 1CPSA 2X7BA 2IQ6A 2IL4A 4MY3A 2ARHA 1I1DA 4J3GA 3DDDA 5K8PA 2JEVA 5HVHA 2DPSA 1KUVA 1GYTA 4E2AA 4MHZA 4EVYA 4JYWA 2AFSA 4B10A 2R1IA 4WJBA 3QNVA 2B4DB 2FT0A 2V8GA 3JUWA 4P4BA 4LUAA 4MY0A 4PV6A 3KR4A 3P2FA 5EMIA 1YR0A 4NFRA 2VL1A 1BLLE 1UWYA 4P4EA 3H8FA 4TNUA 3ISXA 1SQHA
chains in the Genus database with same CATH topology
4ONUA 1S5KA 4U5YA 3SHPA 1B87A 3T90A 1S7FA 2ZW7A 4CS0B 2JLMA 4E8OA 4NEXA 1IYLA 2VBQA 2R7HA 4L89A 3R9FA 5AGEA 3IU2A 1OZPA 1WWZA 1RO5A 1Q2DA 2G0BA 4R3LA 3FB3A 1ON0A 1QSNA 2B58A 5AG6A 2PRBA 5F49A 5A27A 2JDDA 2NMTA 3S6KA 2HV2A 4KUBA 2P0WA 2YNDA 4IUSA 1S3ZA 2GE3A 1L0CA 4R3KA 3TTHA 2R98A 4NF1A 4BBHA 5C82A 3MGDA 3EY5A 4B11A 2P6GA 4A2ZA 3LD2A 3LODA 2YGWA 5BWAB 2YNEA 2FE7A 2YNCC 2BSWA 2P6EA 4CAWA 1XMTA 4M85A 5HH1A 1QSTA 4KOYA 3IWGA 4U9YA 4B13A 4C68A 3TOAA 4UCNA 1NSLA 2Y0MA 3G8WA 4KZTA 4MI4A 3H5ZA 4KOSA 4XNHC 3KKWA 4FD4A 4OAEA 3IWEA 2CNTA 5CNPA 2ZW6A 2OZHA 2ATRA 2DPTA 4JXRA 3GKRA 3T9YA 4IF5A 4CYNA 4KVME 3FBUA 3EC4A 4A31A 3WR7A 3V8IA 2H5MA 2DXQA 1Y9WA 4XNHB 1S60A 1MJBA 2J8RA 2AJ6A 1CM0A 4KOTA 1YGHA 3S6FA 3F0AA 2ZXVA 1XF8A 2Z3PA 1XE4A 3K9UA 1PUAA 5H86A 1Y9KA 1RXTA 2FSRA 2HUZA 3R9GA 2ZW5A 3BJ7A 5IX3A 4UFWA 4FD7A 5JPHA 3H4QA 3D3SA 3EFAA 1BOBA 3E0KA 2Z3NA 1P0HA 4DNCA 2Q4YA 1CJWA 2REFA 2Z11A 4B14A 3G3SA 2GIVA 1B6BA 4AVAA 4FD6A 4CAVA 5KTDA 4NCZA 2BEIA 4CAFA 5JQ4A 3TE4A 2B3UA 4UCPA 1BO4A 5G22A 2Q04A 2Z3LA 2Z3OA 3DSBA 4UCMA 4ORFA 2K5TA 4JD6A 4QB9A 3UY5A 4A33A 4KUAA 2B4BA 1S7NA 4MFLA 1QSRA 3PGPA 2AE6A 3IGRA 2FS5A 5HMNA 2FIWA 5G1ZA 3JTKA 2EUIA 2CNSA 3VWDA 5E96A 1J4JA 4L8AA 3BJ8A 2GANA 2CXAA 2I00A 3CXPA 2J8NA 4KLWA 3ZZIA 4CYPA 4HNWB 1I12A 2FXFA 1KZFA 3SXNA 1QSMA 1R57A 1M4DA 2VQYA 4Q36A 4RI1A 5AG5A 2F5IA 2WPWA 2C27A 4C2YA 3R1KA 4C7HA 3S6HA 4U9ZA 2PDOA 2PR1A 2JDCA 3TO9A 1IICA 2Z3MA 1YVOA 5H84A 4A95A 1IB1E 3I9SA 1Y7RA 3DR6A 5J8CA 1Q2CA 5ISVA 1U6MA 5F48A 1YVKA 2WUUA 1S7KA 3QB8A 5G20A 3ZJ0A 5IB0A 1TIQA 1NMTA 1IYKA 3I3GA 1MJAA 4HKFA 4CRYB 1K4JA 2B4DA 4NXYA 2G3TA 2B5GB 2Q0YA 2P6FA 2OH1A 4B5OA 4UFVA 3SXOA 1PU9A 4PSWA 3PZJA 4KOVA 1KUXA 1M4IA 4MBUA 2A4NA 1XIXA 2HQYA 2B3VA 5I0CA 2Q4VA 1S7LA 3W91A 4OLLA 3CXQA 4KOUA 4KOWA 3S6GA 1YLEA 2WSAA 3R95A 2RC4A 1P4NA 3C26A 1NE9A 4OADA 2YNCA 3R96A 2VEZA 3FYNA 4KVXA 4M3SA 4NSQA 2PQ8A 5EBVA 4AB7A 4MHDA 1YX0A 2VXKA 3TT2A 1KUYA 4JLYA 5AG7A 2R8VA 4H6UA 5G21A 1LRZA 1MJ9A 2EVNA 2FCKA 2QECA 4CGMA 4A32A 4F0XA 1V0CA 3W6SA 1M4GA 2QIRA 2Z3KA 5C88A 4PK3A 4KS9A 4KLVA 2OZGA 3CXSA 1MK4A 4YRHA 4AG9A 1XEBA 3GY9A 3TOBA 1IIDA 4CGPA 4PK2A 4QBJA 2PC1A 2PR8A 2KCWA 2B5GA 1FY7A 5KTCA 4B5PA 4JJXA 4JXQA 4FD5A 4UA3A 2BL1A 3FNCA 1Z4RA 3D2PA 4GS4A 3FIXA 1VKCA 4UWJA 2J8MA 3B8GA 4CYOA 4H89A 4ZBGA 3TFYA 1M44A 4UBRA 3TO6A 1VHSA 4AVCA 3JVNA 2FL4A 4XPDC 4E0AA 4MFJA 2CNMA 4LX9A 4MFZA 4QC6A 1YREA 2VI7A 3DNSA 3TO7A 4CGLA 2Z0ZA 1M1DA 3BLNA 1YK3A 2Q44A 4XPDB 3NE7A 4YFJA 4Y49C 4AVBA 4F0YA 3OWCA 4R87A 5DWNA 3P2HA 2FIAA 3FXTA 4KVOE 3EO4A 3F8KA 3FRMA 4JWPA 4KOXA 4K30A 2CY2A 3TCVA 4C2ZA 3W6XA 2D4OA 4H6ZA 1ZO0A 4Y49B 5AG4A 2D4PA 2G3AA 1QSOA 3A9LA 5GCNA 4II9A 4A30A 2OB0A 2VZZA 3QAHA 1GHEA 2OZUA 2BUEA 4XPLA 3N7ZA 3PP9A 4F6AA 4KSAA 4MJ8A 4R9MA 2ZPAA 2WPXA 4UFXA 4AG7A 4I49A 3RYOA 1WK4A 4XPKA 4CYQA 4HNYB 5DWMA 1N71A 4QVTA 3DR8A 2Q7BA 4R57A 4B5PB 5KTAA 4YGOA 4HNXB 2O28A 5J8FA 3R9EA 3F5BA 1UFHA 4UWIA 3D2MA 4B12A 2OU2A 2PSWA 4BMHA 5EC4A 4Q38A 1Z4EA 4CRZB 2Z10A 3D8PA 2I79A 3VWEA 5F46A 3IU1A 1I21A 3EXNA 3GYAA 4MFQA 2QMLA 4CAXA 4QUSA 4CGNA 5A28A 4CGOA 4RS2A 5IV0A 4C7IA 4ZGYB 4C2XA 4MFPA 5F47A 2REEA 2ZW4A 4KORA 1Q2YA 4PSXA 4X5KA 1Z9UA 4MFKA 4CAEA 5FVJA 2VZYA 4KSFA 2X7BA 2IL4A 4MY3A 2ARHA 1I1DA 4J3GA 3DDDA 2JEVA 2DPSA 1KUVA 4E2AA 4EVYA 4B10A 2R1IA 2B4DB 2FT0A 3JUWA 4LUAA 4MY0A 4PV6A 3P2FA 1YR0A 1SQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFK A;  4MFQ A;  4MFL A;  4Q38 A;  4MFJ A;  4Q36 A;  4MFP A;  4MFZ A; 
#chains in the Genus database with same CATH topology
 3D68 A;  1ELM P;  4ONU A;  1S5K A;  4U5Y A;  3SHP A;  1B87 A;  3T90 A;  1S7F A;  2ZW7 A;  4CS0 B;  2JLM A;  2EO8 A;  4E8O A;  4NEX A;  1VHE A;  1IYL A;  2VBQ A;  3S9M A;  2R7H A;  4L89 A;  4OC0 A;  3R9F A;  5AGE A;  3IU2 A;  4A39 A;  1OZP A;  1WWZ A;  1RO5 A;  1Q2D A;  2G0B A;  4R3L A;  3K9T A;  3FB3 A;  1ON0 A;  2I3C A;  3D7F A;  1QSN A;  2B58 A;  4NGN A;  5AG6 A;  3SI0 A;  1TF8 A;  2C6C A;  2PRB A;  5F49 A;  1EE3 P;  2JDD A;  2NMT A;  5A27 A;  3S6K A;  4P45 A;  2HV2 A;  1AMP A;  4KUB A;  4CPA A;  2P0W A;  2PJ4 A;  4NJQ A;  4FWU A;  2BCO A;  4WWV A;  4MCR A;  3GB0 A;  3KAS A;  3MRU A;  3RO0 A;  4IAV A;  2YND A;  4IUS A;  1S3Z A;  2GE3 A;  1L0C A;  3CPX A;  3PBB A;  4R3K A;  2R98 A;  4NF1 A;  4OID A;  4OP4 A;  3TTH A;  4BBH A;  5C82 A;  1Z8W A;  3MGD A;  3EY5 A;  4B11 A;  2P6G A;  4UF4 A;  4ZY1 A;  4G1P A;  5K8M A;  3GIU A;  4ZX8 A;  4A2Z A;  3NA6 A;  2GFQ A;  3LD2 A;  3LOD A;  2YGW A;  3KI9 A;  5BWA B;  2YNE A;  2C6P A;  3B35 A;  2RFH A;  3I1U A;  2ZEG A;  2FE7 A;  2YNC C;  3PB4 X;  4NGR A;  2BSW A;  2P6E A;  3B3V A;  4CAW A;  1YLO A;  4F9V A;  1XMT A;  4M85 A;  5HH1 A;  1QST A;  1ZLI A;  2HB6 A;  4KOY A;  4K3N A;  3IWG A;  4U9Y A;  4B13 A;  4C68 A;  3TOA A;  4UCN A;  1NSL A;  3GLJ A;  2ODF A;  4YU9 A;  1R43 A;  2Y0M A;  1FNO A;  2ZED A;  3G8W A;  4PPZ A;  4MCQ A;  3IWW A;  4KZT A;  2GRE A;  4MI4 A;  3H5Z A;  4KOS A;  4XNH C;  2QJ8 A;  2ZEM A;  3KKW A;  4FD4 A;  3IWE A;  2CNT A;  4OAE A;  2ZW6 A;  5CNP A;  5THW A;  3WAB A;  2F7V A;  2OZH A;  2PJA A;  2ATR A;  2DPT A;  4JXR A;  3GKR A;  3T9Y A;  4IF5 A;  4CYN A;  2PJ7 A;  1YW6 A;  1CG2 A;  3FBU A;  3EC4 A;  1CP7 A;  4KVM E;  6CPA A;  1QQ9 A;  2EWB A;  4A31 A;  1ZG9 A;  4UEF A;  3WR7 A;  2AFO A;  1LCP A;  3V8I A;  2H5M A;  4RN7 A;  2DXQ A;  1Y9W A;  4XNH B;  1S60 A;  2ZEL A;  4AXV A;  1IGB A;  1MJB A;  2J8R A;  4ZI6 A;  2PIZ A;  2IMO A;  2HC9 A;  2V77 A;  2AJ6 A;  4PQA A;  4FAI A;  1CM0 A;  4KOT A;  1YGH A;  3B3C A;  3WC7 A;  4EFD A;  5JM6 A;  3S6F A;  1HEE A;  2OOT A;  1IY7 A;  4IK2 A;  3F0A A;  2ZXV A;  1XF8 A;  5LRK A;  2Z3P A;  1XE4 A;  3KQZ A;  1PUA A;  3K9U A;  3PRT A;  1Y9K A;  1RXT A;  2FSR A;  2HUZ A;  5H86 A;  3R9G A;  3KQX A;  4MXU A;  3SJG A;  4H2K A;  2ZW5 A;  3BJ7 A;  5I4M A;  2V8D A;  4P4D A;  4UFW A;  3NH8 A;  5IX3 A;  4FD7 A;  5JPH A;  5JGF A;  3H4Q A;  3D3S A;  3EFA A;  4MRI A;  1BOB A;  2DF5 A;  1DE4 C;  3E0K A;  2Z3N A;  4MHP A;  4B6Z A;  4UEE A;  1LAP A;  1P0H A;  5D29 A;  3D4U A;  2Q4Y A;  4DNC A;  1BAV A;  1CJW A;  2REF A;  2Z11 A;  2ZOG A;  3G3S A;  4B14 A;  2OR4 A;  2GIV A;  1B6B A;  2V8V A;  4AVA A;  4FD6 A;  4CAV A;  5KTD A;  1XRY A;  2BEI A;  4NCZ A;  4CAF A;  5JQ4 A;  3TE4 A;  2B3U A;  4UCP A;  2QYV A;  4RUH A;  1Y0Y A;  1BO4 A;  5G22 A;  2Q04 A;  2Z3L A;  2Z3O A;  3DSB A;  2AFU A;  2PVW A;  3PB8 X;  3IC1 A;  4UCM A;  4ORF A;  2K5T A;  4JD6 A;  3NH4 A;  4QB9 A;  3UY5 A;  4KUA A;  4A33 A;  2B4B A;  3V38 A;  4BD9 A;  1ZLH A;  1S7N A;  2J9A A;  3RNZ A;  4MFL A;  1QSR A;  3CZX A;  3PGP A;  2XEG A;  2AE6 A;  2WYR A;  3IGR A;  3SJE A;  2FS5 A;  1XMB A;  5HMN A;  3BI0 A;  2FIW A;  2PIY A;  5G1Z A;  2F8H A;  3JTK A;  2EUI A;  2CNS A;  3VWD A;  5E96 A;  4ZY0 A;  1J4J A;  4L8A A;  1ELL P;  3BJ8 A;  5JH9 A;  2PJ3 A;  1TKJ A;  5HXD A;  2GAN A;  2CXA A;  2I00 A;  3CXP A;  2J8N A;  4KLW A;  1X12 A;  3ZZI A;  4F8Z A;  4CYP A;  4HNW B;  1XOV A;  4LQG A;  1I12 A;  4GXH A;  5D8N A;  3RZA A;  2GLF A;  4DJL A;  2FXF A;  4OME A;  1Z2L A;  2ZEF A;  1KZF A;  4M6I A;  3BXM A;  1QSM A;  3SXN A;  1R57 A;  1M4D A;  4R76 A;  2VQY A;  4Q36 A;  3D67 A;  4RI1 A;  5AG5 A;  2F5I A;  2WPW A;  2C27 A;  4C2Y A;  3HUV A;  1Y7E A;  2XEI A;  3R1K A;  4C7H A;  3PBE A;  3S6H A;  1IOI A;  4U9Z A;  2PDO A;  2PR1 A;  2JDC A;  4NGM A;  4OIW A;  3TO9 A;  1IIC A;  2Z3M A;  2PJ9 A;  1YVO A;  1AUG A;  5H84 A;  3FEC A;  4A95 A;  1IB1 E;  3I9S A;  1Y7R A;  4MCS A;  3DR6 A;  4OC1 A;  8CPA A;  5J8C A;  1Q2C A;  2JBK A;  5ISV A;  2CIJ A;  3S9N A;  1U6M A;  4UIA A;  5F48 A;  1IU8 A;  1YVK A;  2WUU A;  2V8H A;  1S7K A;  3QB8 A;  5G20 A;  3ZJ0 A;  5IB0 A;  1TIQ A;  4MMO A;  5DS0 A;  3LAC A;  3BHX A;  1ARL A;  1NMT A;  1IYK A;  3I3G A;  4P4I A;  2PJB A;  1MJA A;  3N5F A;  4HKF A;  4OC2 A;  1PYT B;  4CRY B;  1K4J A;  2PRQ A;  3FX6 A;  2B4D A;  3D7H A;  1M4L A;  2PJ0 A;  4NXY A;  4ONW A;  4Z65 A;  5LYF A;  4BIN A;  1F2P A;  2EBJ A;  2G3T A;  4P4J A;  2B5G B;  1CPX A;  4UIB A;  4GM5 A;  4EWT A;  2Q0Y A;  2P6F A;  3BI1 A;  4PXB A;  7CPA A;  2OH1 A;  2WZN A;  4UFV A;  4B5O A;  3WT4 A;  3T8W A;  3SXO A;  1JQG A;  1XFO A;  3IIB A;  2XEJ A;  1PU9 A;  2ANP A;  4PSW A;  4M6G A;  5ELY A;  2PCU A;  3PZJ A;  4KOV A;  4LQ6 A;  4Q7A A;  1KUX A;  1M4I A;  4IHM A;  2A4N A;  4MBU A;  1XIX A;  3V7Z A;  2HQY A;  2B3V A;  5I0C A;  2PJ8 A;  1LAN A;  2Q4V A;  3SJF A;  1S7L A;  2ZEH A;  4DYO A;  3W91 A;  4OLL A;  3CXQ A;  5LYD A;  4NGT A;  4KOU A;  4KOW A;  3S6G A;  1YLE A;  2WSA A;  3H8G A;  3WC6 A;  3PEI A;  3R95 A;  2RC4 A;  3DLJ A;  2AFZ A;  1P4N A;  1Z8X A;  2ZEN A;  3C26 A;  1NE9 A;  4P6Y A;  4OAD A;  3HLP A;  2PJ5 A;  1FT7 A;  2YNC A;  3CT9 A;  3FMC A;  4OC5 A;  2VEZ A;  3R96 A;  3FYN A;  4KVX A;  1CX8 A;  3L2N A;  4M3S A;  4NSQ A;  2PJ1 A;  2PQ8 A;  5EBV A;  4AB7 A;  4MHD A;  1YX0 A;  2VXK A;  3TT2 A;  3KL9 A;  1KUY A;  3NE8 A;  3FF3 A;  4JLY A;  2PJ6 A;  5AG7 A;  2R8V A;  1HDU A;  4H6U A;  3PB9 X;  4KSI A;  4X3R A;  5G21 A;  1LRZ A;  1MJ9 A;  1LAM A;  5CBM A;  4P4F A;  1NSA A;  2EVN A;  2FCK A;  2QEC A;  3D7G A;  1TKF A;  3IO1 A;  4PXC A;  4A32 A;  4YWY A;  4CGM A;  4F0X A;  5IB9 A;  1V0C A;  3W6S A;  2BO9 A;  2CF4 A;  1M4G A;  3PFE A;  2QIR A;  2Z3K A;  3ISZ A;  5C88 A;  4PK3 A;  3IFE A;  4KS9 A;  2RB7 A;  4ZYQ A;  4KLV A;  3S9L A;  1HDQ A;  2OZG A;  1BPM A;  3CXS A;  1MK4 A;  3RBU A;  4YRH A;  3D7D A;  3KGQ A;  4AG9 A;  1XEB A;  3GY9 A;  3TOB A;  1TXR A;  1IID A;  4CGP A;  4EME A;  3PFO A;  4TWE A;  1CP6 A;  2GU2 A;  4PK2 A;  4QBJ A;  1XBU A;  2PC1 A;  3LWU A;  1X10 A;  2PR8 A;  4X2T A;  1LFW A;  2DEA A;  2B5G A;  2KCW A;  1FY7 A;  2ZEE A;  3TC8 A;  4FBE A;  5KTC A;  4B5P A;  3PB6 X;  4PXE A;  3VH9 A;  4JJX A;  1Z5R A;  4JXQ A;  4FD5 A;  3FVL A;  1OBR A;  2POK A;  4UA3 A;  2BL1 A;  3FNC A;  1Z4R A;  2PVV A;  3K2K A;  3MN8 A;  4A94 A;  2Q7S A;  3D2P A;  4GS4 A;  3FIX A;  4A38 A;  1LOK A;  1VKC A;  4UWJ A;  2J8M A;  3B8G A;  2CTB A;  4CYO A;  4H89 A;  1Z8T A;  2PJC A;  4ZBG A;  5HVG A;  3TFY A;  1M44 A;  2CTC A;  3FH4 A;  4UBR A;  2O53 A;  2NYQ A;  4ZY2 A;  1VIX A;  3TO6 A;  2Q4Z A;  1VHS A;  4AVC A;  5K8O A;  2AFW A;  3B3S A;  3JVN A;  1CBX A;  2FL4 A;  4XPD C;  4E0A A;  2XEF A;  3RAM A;  4MFJ A;  2CNM A;  4LX9 A;  4MFZ A;  4QC6 A;  5LYL A;  1YRE A;  2VI7 A;  4NGS A;  3DNS A;  4MCP A;  3TO7 A;  4CGL A;  2Z0Z A;  1M1D A;  4W9Y A;  3BLN A;  2ZEP A;  1YK3 A;  3WC5 A;  2Q44 A;  3FEE A;  3B3W A;  4JZ0 A;  4XPD B;  2PE3 A;  1F2O A;  2AFM A;  3NE7 A;  4YFJ A;  4Y49 C;  4O23 A;  4AVB A;  4F0Y A;  3OWC A;  1KWM A;  1XJO A;  3TX8 A;  4R87 A;  4NGP A;  5DWN A;  3P2H A;  1Q7L A;  2FIA A;  3FXT A;  4KVO E;  2Q51 A;  4NJR A;  4R6T A;  3EO4 A;  3F8K A;  3FRM A;  4JWP A;  4KOX A;  1YSJ A;  2CY2 A;  2PJ2 A;  2QVP A;  4K30 A;  1QMU A;  1YQE A;  3TCV A;  3D66 A;  4R7M A;  1ZG8 A;  4C2Z A;  4OKO A;  3W6X A;  3IJ3 A;  4MHY A;  2D4O A;  4H6Z A;  1ZO0 A;  3CPA A;  4M6H A;  2NSM A;  4NGQ A;  4Y49 B;  5LRG A;  5AG4 A;  2D4P A;  2BOA A;  2G3A A;  3B7I A;  4R8F A;  4UEZ A;  3IEH A;  1QSO A;  1IOF A;  2EK9 A;  3A9L A;  2O4H A;  1ZG7 A;  5GCN A;  1F57 A;  3NFZ A;  5LRJ A;  1R3N A;  4II9 A;  4A30 A;  2OB0 A;  2VZZ A;  3KR5 A;  3NH5 A;  1GHE A;  3QAH A;  2OZU A;  2BUE A;  4XPL A;  3N7Z A;  2JEW A;  2GLJ A;  3PP9 A;  4F6A A;  4KSA A;  4MJ8 A;  2G9D A;  4R9M A;  1YW4 A;  2C1C A;  2ZPA A;  2WPX A;  4UFX A;  3SJX A;  4I49 A;  3RYO A;  1WK4 A;  4XPK A;  4AG7 A;  4CYQ A;  4ZX9 A;  1H8L A;  4HNY B;  3FED A;  4MHN A;  5DWM A;  5LYI A;  3VAR A;  3KHX A;  4P10 A;  1N71 A;  1Z8L A;  3DR8 A;  3KZW A;  4QVT A;  4R57 A;  4OC4 A;  1ARM A;  2Q7B A;  3SI1 A;  4PXD A;  2ZOF A;  4B5P B;  5KTA A;  3H8E A;  4YGO A;  4HNX B;  2O28 A;  5J8F A;  3R9E A;  3F5B A;  1UFH A;  3PB7 X;  1TF9 A;  4UWI A;  2JBJ A;  4DUK A;  3D2M A;  1Y0R A;  4B12 A;  2OU2 A;  3KHZ A;  2PSW A;  3CDX A;  4FUU A;  4BMH A;  2Q43 A;  3B2Y A;  3JRU A;  2FVG A;  4Q38 A;  5EC4 A;  1Z4E A;  5HVF A;  4CRZ B;  2Z10 A;  3D8P A;  1JWQ A;  2I79 A;  3VWE A;  5CPA A;  5F46 A;  3IU1 A;  1I21 A;  4F9U A;  1VHO A;  3EXN A;  3GYA A;  1BPN A;  1PCA A;  3DGV A;  5J1Q A;  4MFQ A;  2QML A;  4A37 A;  2C6G A;  1DTD A;  3QAY A;  2EK8 A;  4HPS A;  4P44 A;  4CAX A;  4QUS A;  2ABZ A;  4CGN A;  5A28 A;  3VAT A;  4RS2 A;  3B3T A;  4CGO A;  5IV0 A;  2AFX A;  4OC3 A;  4C7I A;  4X8I A;  4ZGY B;  4C2X A;  1VGY A;  4MFP A;  5F47 A;  2REE A;  2ZW4 A;  4KOR A;  1Q2Y A;  4PSX A;  4X5K A;  3SI2 A;  1Z9U A;  4MFK A;  5F09 A;  1YME A;  4CAE A;  1A2Z A;  5FVJ A;  1AYE A;  3GUX A;  2VZY A;  1TKH A;  1RTQ A;  3LMS A;  4KSF A;  3FJU A;  2IJZ A;  2ZEO A;  5K8N A;  1CPS A;  2X7B A;  2IQ6 A;  2IL4 A;  4MY3 A;  2ARH A;  1I1D A;  4J3G A;  3DDD A;  5K8P A;  2JEV A;  5HVH A;  2DPS A;  1KUV A;  1GYT A;  4E2A A;  4MHZ A;  4EVY A;  4JYW A;  2AFS A;  4B10 A;  2R1I A;  4WJB A;  3QNV A;  2B4D B;  2FT0 A;  2V8G A;  3JUW A;  4P4B A;  4LUA A;  4MY0 A;  4PV6 A;  3KR4 A;  3P2F A;  5EMI A;  1YR0 A;  4NFR A;  2VL1 A;  1BLL E;  1UWY A;  4P4E A;  3H8F A;  4TNU A;  3ISX A;  1SQH A; 
#chains in the Genus database with same CATH homology
 4ONU A;  1S5K A;  4U5Y A;  3SHP A;  1B87 A;  3T90 A;  1S7F A;  2ZW7 A;  4CS0 B;  2JLM A;  4E8O A;  4NEX A;  1IYL A;  2VBQ A;  2R7H A;  4L89 A;  3R9F A;  5AGE A;  3IU2 A;  1OZP A;  1WWZ A;  1RO5 A;  1Q2D A;  2G0B A;  4R3L A;  3FB3 A;  1ON0 A;  1QSN A;  2B58 A;  5AG6 A;  2PRB A;  5F49 A;  5A27 A;  2JDD A;  2NMT A;  3S6K A;  2HV2 A;  4KUB A;  2P0W A;  2YND A;  4IUS A;  1S3Z A;  2GE3 A;  1L0C A;  4R3K A;  3TTH A;  2R98 A;  4NF1 A;  4BBH A;  5C82 A;  3MGD A;  3EY5 A;  4B11 A;  2P6G A;  4A2Z A;  3LD2 A;  3LOD A;  2YGW A;  5BWA B;  2YNE A;  2FE7 A;  2YNC C;  2BSW A;  2P6E A;  4CAW A;  1XMT A;  4M85 A;  5HH1 A;  1QST A;  4KOY A;  3IWG A;  4U9Y A;  4B13 A;  4C68 A;  3TOA A;  4UCN A;  1NSL A;  2Y0M A;  3G8W A;  4KZT A;  4MI4 A;  3H5Z A;  4KOS A;  4XNH C;  3KKW A;  4FD4 A;  4OAE A;  3IWE A;  2CNT A;  5CNP A;  2ZW6 A;  2OZH A;  2ATR A;  2DPT A;  4JXR A;  3GKR A;  3T9Y A;  4IF5 A;  4CYN A;  4KVM E;  3FBU A;  3EC4 A;  4A31 A;  3WR7 A;  3V8I A;  2H5M A;  2DXQ A;  1Y9W A;  4XNH B;  1S60 A;  1MJB A;  2J8R A;  2AJ6 A;  1CM0 A;  4KOT A;  1YGH A;  3S6F A;  3F0A A;  2ZXV A;  1XF8 A;  2Z3P A;  1XE4 A;  3K9U A;  1PUA A;  5H86 A;  1Y9K A;  1RXT A;  2FSR A;  2HUZ A;  3R9G A;  2ZW5 A;  3BJ7 A;  5IX3 A;  4UFW A;  4FD7 A;  5JPH A;  3H4Q A;  3D3S A;  3EFA A;  1BOB A;  3E0K A;  2Z3N A;  1P0H A;  4DNC A;  2Q4Y A;  1CJW A;  2REF A;  2Z11 A;  4B14 A;  3G3S A;  2GIV A;  1B6B A;  4AVA A;  4FD6 A;  4CAV A;  5KTD A;  4NCZ A;  2BEI A;  4CAF A;  5JQ4 A;  3TE4 A;  2B3U A;  4UCP A;  1BO4 A;  5G22 A;  2Q04 A;  2Z3L A;  2Z3O A;  3DSB A;  4UCM A;  4ORF A;  2K5T A;  4JD6 A;  4QB9 A;  3UY5 A;  4A33 A;  4KUA A;  2B4B A;  1S7N A;  4MFL A;  1QSR A;  3PGP A;  2AE6 A;  3IGR A;  2FS5 A;  5HMN A;  2FIW A;  5G1Z A;  3JTK A;  2EUI A;  2CNS A;  3VWD A;  5E96 A;  1J4J A;  4L8A A;  3BJ8 A;  2GAN A;  2CXA A;  2I00 A;  3CXP A;  2J8N A;  4KLW A;  3ZZI A;  4CYP A;  4HNW B;  1I12 A;  2FXF A;  1KZF A;  3SXN A;  1QSM A;  1R57 A;  1M4D A;  2VQY A;  4Q36 A;  4RI1 A;  5AG5 A;  2F5I A;  2WPW A;  2C27 A;  4C2Y A;  3R1K A;  4C7H A;  3S6H A;  4U9Z A;  2PDO A;  2PR1 A;  2JDC A;  3TO9 A;  1IIC A;  2Z3M A;  1YVO A;  5H84 A;  4A95 A;  1IB1 E;  3I9S A;  1Y7R A;  3DR6 A;  5J8C A;  1Q2C A;  5ISV A;  1U6M A;  5F48 A;  1YVK A;  2WUU A;  1S7K A;  3QB8 A;  5G20 A;  3ZJ0 A;  5IB0 A;  1TIQ A;  1NMT A;  1IYK A;  3I3G A;  1MJA A;  4HKF A;  4CRY B;  1K4J A;  2B4D A;  4NXY A;  2G3T A;  2B5G B;  2Q0Y A;  2P6F A;  2OH1 A;  4B5O A;  4UFV A;  3SXO A;  1PU9 A;  4PSW A;  3PZJ A;  4KOV A;  1KUX A;  1M4I A;  4MBU A;  2A4N A;  1XIX A;  2HQY A;  2B3V A;  5I0C A;  2Q4V A;  1S7L A;  3W91 A;  4OLL A;  3CXQ A;  4KOU A;  4KOW A;  3S6G A;  1YLE A;  2WSA A;  3R95 A;  2RC4 A;  1P4N A;  3C26 A;  1NE9 A;  4OAD A;  2YNC A;  3R96 A;  2VEZ A;  3FYN A;  4KVX A;  4M3S A;  4NSQ A;  2PQ8 A;  5EBV A;  4AB7 A;  4MHD A;  1YX0 A;  2VXK A;  3TT2 A;  1KUY A;  4JLY A;  5AG7 A;  2R8V A;  4H6U A;  5G21 A;  1LRZ A;  1MJ9 A;  2EVN A;  2FCK A;  2QEC A;  4CGM A;  4A32 A;  4F0X A;  1V0C A;  3W6S A;  1M4G A;  2QIR A;  2Z3K A;  5C88 A;  4PK3 A;  4KS9 A;  4KLV A;  2OZG A;  3CXS A;  1MK4 A;  4YRH A;  4AG9 A;  1XEB A;  3GY9 A;  3TOB A;  1IID A;  4CGP A;  4PK2 A;  4QBJ A;  2PC1 A;  2PR8 A;  2KCW A;  2B5G A;  1FY7 A;  5KTC A;  4B5P A;  4JJX A;  4JXQ A;  4FD5 A;  4UA3 A;  2BL1 A;  3FNC A;  1Z4R A;  3D2P A;  4GS4 A;  3FIX A;  1VKC A;  4UWJ A;  2J8M A;  3B8G A;  4CYO A;  4H89 A;  4ZBG A;  3TFY A;  1M44 A;  4UBR A;  3TO6 A;  1VHS A;  4AVC A;  3JVN A;  2FL4 A;  4XPD C;  4E0A A;  4MFJ A;  2CNM A;  4LX9 A;  4MFZ A;  4QC6 A;  1YRE A;  2VI7 A;  3DNS A;  3TO7 A;  4CGL A;  2Z0Z A;  1M1D A;  3BLN A;  1YK3 A;  2Q44 A;  4XPD B;  3NE7 A;  4YFJ A;  4Y49 C;  4AVB A;  4F0Y A;  3OWC A;  4R87 A;  5DWN A;  3P2H A;  2FIA A;  3FXT A;  4KVO E;  3EO4 A;  3F8K A;  3FRM A;  4JWP A;  4KOX A;  4K30 A;  2CY2 A;  3TCV A;  4C2Z A;  3W6X A;  2D4O A;  4H6Z A;  1ZO0 A;  4Y49 B;  5AG4 A;  2D4P A;  2G3A A;  1QSO A;  3A9L A;  5GCN A;  4II9 A;  4A30 A;  2OB0 A;  2VZZ A;  3QAH A;  1GHE A;  2OZU A;  2BUE A;  4XPL A;  3N7Z A;  3PP9 A;  4F6A A;  4KSA A;  4MJ8 A;  4R9M A;  2ZPA A;  2WPX A;  4UFX A;  4AG7 A;  4I49 A;  3RYO A;  1WK4 A;  4XPK A;  4CYQ A;  4HNY B;  5DWM A;  1N71 A;  4QVT A;  3DR8 A;  2Q7B A;  4R57 A;  4B5P B;  5KTA A;  4YGO A;  4HNX B;  2O28 A;  5J8F A;  3R9E A;  3F5B A;  1UFH A;  4UWI A;  3D2M A;  4B12 A;  2OU2 A;  2PSW A;  4BMH A;  5EC4 A;  4Q38 A;  1Z4E A;  4CRZ B;  2Z10 A;  3D8P A;  2I79 A;  3VWE A;  5F46 A;  3IU1 A;  1I21 A;  3EXN A;  3GYA A;  4MFQ A;  2QML A;  4CAX A;  4QUS A;  4CGN A;  5A28 A;  4CGO A;  4RS2 A;  5IV0 A;  4C7I A;  4ZGY B;  4C2X A;  4MFP A;  5F47 A;  2REE A;  2ZW4 A;  4KOR A;  1Q2Y A;  4PSX A;  4X5K A;  1Z9U A;  4MFK A;  4CAE A;  5FVJ A;  2VZY A;  4KSF A;  2X7B A;  2IL4 A;  4MY3 A;  2ARH A;  1I1D A;  4J3G A;  3DDD A;  2JEV A;  2DPS A;  1KUV A;  4E2A A;  4EVY A;  4B10 A;  2R1I A;  2B4D B;  2FT0 A;  3JUW A;  4LUA A;  4MY0 A;  4PV6 A;  3P2F A;  1YR0 A;  1SQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...