4MGIR

Selective activation of epac1 and epac2
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
150
Chain Sequence
EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rap guanine nucleotide exchange factor 4
publication title Selective activation of Epac1 and Epac2
rcsb
source organism Mus musculus
molecule tags Signaling protein/gtp-binding protein
total genus 40
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mgiR00
4OJKA 5JHGB 3QXXA 2HJGA 4KYIB 4YONB 2J3EA 2GESA 1S9DA 2QU8A 4NMMA 4ERNA 1N0UA 4JVLA 3RRYA 4C0LA 2ZS9A 3KKNA 2V3CC 4IXMA 1FUKA 3IHWA 2CMKA 2OEPA 2B21A 4OL0A 2F3RA 3THOA 1XZPA 2VHUA 5SZHB 3F0TA 3GLFE 4JL5A 1GAJA 1K5GA 2ECKA 2GCPA 2R6DA 3AUYA 3LVRE 2J59A 1H8HA 2PJZA 4NONA 3AP2A 3HU1A 4G5OA 1COWD 4ZI2A 4JT4A 3NH6A 4Q00A 1N3BA 3LLMA 5JEEA 4L16A 2ZVPX 2W00A 4C0KA 4M0LA 2NMVA 4KFSA 2WHXA 1K8RA 1NLZA 1Z07A 4Q21A 4TMKA 1FX0A 4KVGA 2CLCX 4KFTA 3HU2A 4Z1MA 4CEJB 3KXKA 3TAHA 1KOFA 4LX0A 1N2CE 4PAOA 1CS4C 1KJYA 1IN6A 1SVMA 2BJVA 1XXHA 4MYTA 3MJRA 4TT3A 2P6NA 1FP6A 5FL3A 1EFRD 1ZIOA 4Q9IA 5EXXA 3C8UA 1XNJA 3AUXA 5HE9A 1OH6A 4ABYA 2OCPA 1T3LA 2RGNA 2OHFA 3IPYA 2E9SA 3M0EA 2QTFA 1XEWX 4MQBA 4V0LA 1N0WA 3Q8XB 5C4MA 2XNDD 3Q3JB 2R8RA 1W36D 3CX7A 4ARZB 3K9HA 2CCJA 2H18A 3OIYA 4B3XA 1D8TA 3B8HA 1Z6YA 3IO3A 3BXZA 3DKVA 4L5BA 1KDRA 3SBDA 1T8TA 4WAUA 2ODWA 4GRAA 4D81A 1LF0A 4KLNA 2VBCA 4QXAA 3SYNA 3W8RA 1W4CA 1EK0A 4AKGA 4ILEA 2BWJA 2O8CA 4N0EA 1T0JB 3DVLA 1BYUA 2KJQA 3QKRA 1EGAA 4M1OA 5CJ2A 1WBDA 2XXAA 2D62A 2OFXA 1E0AA 4HB4A 2QL6A 3U4QB 2FMXA 5K8TA 2ZJOA 1TPZA 1GNRA 3KTAB 4FMCB 4DCSA 1ESMA 4MGZR 3L0OA 5HKKA 2ONKA 4URUR 1E9CA 3LLUA 2O8DB 4GL2A 4M9XA 2A78A 3IIJA 4YXWD 4NKRA 1Z47A 3HR7A 2FGKA 4E5UA 2JDID 3GJ3A 1N6HA 2WWYA 4BFZA 1G7RA 5DNYB 1PV4A 1JEDA 2CCGA 1HURA 3W9YA 2GETA 3KKOA 4MKGA 1BS1A 1TUIA 3P1JA 3Q9LA 4DB4A 1RRPA 1RZ3A 2HCBA 4G1UC 4TLDA 3GJ5A 1GRRA 1EFTA 2IUTA 1JQJC 2LKDA 4N3NA 4PC6A 1I4TD 4X8HA 4W5WA 5E7JA 2PCLA 3SQWA 1OJLA 2G6BA 2VP4A 3NHBA 3LA6A 5FOTA 3GJ4A 2PT5A 4P33A 2GF0A 3PCRB 3AVVA 3V00A 5JCPA 2RB4A 1OFIA 2QAGB 1CKEA 1AM4D 1GNPA 4PPFA 4F4IA 4JKIA 5JECA 1V5WA 4FXPA 2GAAA 4TLCA 1JR3D 1R8SA 4DZZA 3C5HA 4LHZA 4DWJA 3SU8A 2D2EA 4Q9JA 1RKBA 4HLCA 4JVMA 4V0ME 2IC5A 2YINC 2A3RA 3T1TA 4TZ6A 4Q4HA 3BGWA 4MH0R 5F98A 1NF3A 2HXSA 4UJ5A 1Z0KA 5L3QB 4MITA 5CIQA 2PX3A 4QRHA 1DBSA 1P9NA 5E4FA 1W48A 1G7SA 4UXHA 4LBVA 2QPTA 2BIFA 1T5IA 2QE7D 4TYQA 4JS0A 4RZ2A 2IUSA 2AR7A 1UEJA 5AUQA 5JS7A 4M9SA 1P5ZB 4P4TA 1G4UR 2OXCA 1ONBA 2H92A 3EIHA 1G64A 2ZYWX 1XPOA 2JATA 3OEHD 5K8IA 5H68A 2YWHA 2BCGY 3QKSB 4QG7A 2QPOA 2IYVA 5LDDC 1X1RA 1Z2CA 2ZS7A 2GZAA 3RDPA 3VX3A 3FHTA 4OI2A 1BIFA 4RVCA 2VHQA 2RGDA 4OK5A 1CR2A 3AGPA 2OG2A 4XSGA 5LBIA 2GXAA 3GLGE 1NL3A 4FMCF 5FOXA 3REGA 5FUXA 1TADA 1S1MA 2FG5A 5DIFA 3CRVA 3EWAA 4FCTA 4QJ3A 3GJ8A 1Q22A 2IT1A 2BBTA 2JLSA 2DFNA 3EC2A 4CEJA 2ODNA 1C4OA 3MG9A 1NMXA 2G88A 2IYTA 4G5QA 3SFZA 1IN4A 2KI5A 2J1LA 3C41J 1DE0A 1GFIA 3A8TA 3AVXA 2O0HA 2FX3A 2FE4A 3QQ5A 2YYZA 1KJWA 3X2SA 3E2IA 2FV8A 2PMKA 2DPXA 3SN6A 1E4VA 1QBKC 2ZJAA 4LY6A 1A82A 1TL7C 4BLRA 3T12A 1J8MF 2PCJA 4G0NA 4WZBE 4ARZA 3GLIB 5DI9A 2P6UA 3W6NA 1ZD9A 3UK6A 2QROA 4QL3A 4DLWA 2QG6A 3GCGA 1G21E 1KO8A 3U3OA 1QVRA 3L8ZA 5B64A 2VHTA 4BFTA 1G5RA 3TKLA 3N2IA 3AQ4A 3DM5A 5J5CA 3T06B 3F3YA 1I4LD 3CB4A 5EZ5A 4AYWA 1U8AA 4ACAA 4GOKA 1P72A 4LSGA 1D9XA 2QP9X 4TYPA 4RKEA 1G9XA 1F6BA 1RRGA 3BFXA 4LV8B 5L3SB 3U4QA 3LDAA 2PZFA 3KTAA 4BASA 4R98A 1AS2A 2C77A 4JLDA 2CL0X 2D06A 4D4JA 3L0SA 3PQCA 3DZ8A 4LJ7A 1W36C 3QXJA 4EPYA 2O8DA 3A37A 4HZUB 5D3MB 2ANCA 5AK0A 3THYB 1W49A 4LHXA 4MDFA 3ZZ0A 3KB2A 2QGNA 1E1QA 1P60A 1YVDA 2OT3B 4OQLA 1SHKA 4WW0A 5JRZA 2NGRA 1P62B 1XMSA 3CNLA 3LRPA 4DHEA 2GXUA 4M2LA 2RGGA 4GP7A 4JKYA 4PXAA 3L8YA 1YR8A 3JZMA 2P0EA 5GADl 4MUBA 2I3BA 1VMAA 3SJAA 1XJQA 4DCUA 3REFA 3FFAA 4GBMA 4EDHA 4XVQA 1W36B 1GL6A 1NN0A 2OBLA 2X2FA 3OAAA 1YHNA 1OXVA 2ZE7A 2RKOA 3F8TA 4LC1A 3QI2A 1R8QA 4NPHA 5JJIA 1KO4A 2QAGA 3IKJA 4KCGA 2C03A 1G17A 2HCJB 3O47A 4Q19A 4KJZA 3MWYW 4LK2A 4R2HA 1NRJB 5DGXA 5EP1A 3A4NA 3ZS8A 1GVNB 4B73A 2WZQA 1W4BA 1O87A 4DCVA 2Q0HA 3TGPA 1OHHD 3EAQA 4Q4JB 4CF7A 1U0HC 5L3QA 3FB4A 4NYIR 1ZC3A 4BEBA 2QRZA 5C2JB 3WHKA 1SVWA 3K0CC 2ODEA 4TYWA 2IYUA 1NLFA 1DOAA 4LRWA 3UMRA 2EFEB 1KAOA 1MO4A 1G6HA 4J0QA 1G4AE 4XIGS 3WP1B 4WIAA 3V4RA 5DYGA 4RZXA 3P4YA 4ZO4A 1KO5A 1CJTC 3BH7A 1DAEA 3IQWA 5FPTA 4DLZA 1E2FA 2X1VA 4YQFA 2CHVA 1MRSA 4AKHA 3QKSA 5AUPB 1KHTA 1NG9A 3FKQA 3IGFA 3FKSA 3W90A 2R6FA 1N6PA 2A7QA 2YHSA 3A4MA 4LI0A 2SHKA 3ICEA 3K53A 5IHPA 1YR6A 1DG1G 4DC9A 1C9KA 3NIBA 2WVJA 3QNUA 4UJ3A 2XJ4A 2DWOA 3PV0A 1E2LA 5FOWA 2F1JA 2P6RA 4CT4B 2WJJA 3LAWA 5FUWA 4C2TA 2ZJ8A 1HQYE 1SXJE 5DLQC 1RRCA 1G20E 2X8AA 4DKXA 4DSTA 3CWQA 4NCNA 2N1BA 4OI1A 1M7GA 1YE8A 2AKAB 2ORIA 4LHWA 3LFUA 3LBIA 3EX7C 1OFHA 2P5TB 1GNQA 2BBOA 3H84A 1J8YF 4NYJQ 821PA 2OAP1 1RYHA 1P75A 2XTNA 1QHGA 2J45A 2MSDB 3DOEA 3WYFA 1L8QA 3HP1A 2WJGA 2QN6A 2GWHA 1J90A 2IYQA 3TW8B 2ZSFA 3IUYA 4DLXA 4K8OA 4LJ6A 2F6RA 4TN1A 2GBLC 5SZJA 5BN3A 4Q7MB 5F2EA 3GLIA 3N5CA 2DY1A 4UQOA 2RMKA 3L0IB 3U44B 4URZR 1P61B 4KBFA 4M1SA 4IFEA 4BQSA 3NBYC 2CLSA 4JYBA 3UMSA 2R6GA 2IS1A 3I5YA 2NO0A 2XGJA 2HEIA 3OESA 4LHYA 4MGYR 3VAAA 2ZUDA 1TEXA 4TZ0A 1WMSA 3NDPA 1T3SA 4JLOA 2WKPA 3LBNA 4HAZA 4A92A 1G8YA 3QBVA 1UADA 3BB3A 4GPTA 1J99A 2D3WA 2NTYC 2V54A 1COWA 4FIDA 4D4KA 4GFDA 4PC3A 1E2JA 5IT5A 3MCAA 5L3SA 4DT1B 2ZRKA 1OXUA 2DWQA 4TLEA 1UKEA 2ZRIA 5J4HA 4YMWA 3K0EA 2QNRA 4RJLA 1XPUA 4GZLA 4LV5B 2HT6A 2RGEA 1PUJA 5D3MA 1Z83A 4F38A 3THYA 3AF2A 2QSYA 2Z4SA 1FP7A 3U60B 3NHAA 1NKTA 1GUAA 1TQDA 1FUUA 1Z3IX 2C96A 2JIZD 1OW3B 1Z0FA 2F55A 1EX7A 3MJHA 3KJHA 3QF4B 4HZIA 3EASA 3A58B 2GF9A 5KPJA 4R71A 1QHXA 2XNDA 2GHIA 4QGFA 2HXYA 4BE7B 2WIBA 2ZSEA 1B0UA 1YZQA 4PSAA 5IRCD 2XTMA 4L4UA 1XTQA 1UF9A 2JGNA 2HJVA 4LJ8A 2OCYC 2WJHA 4JLAA 5JJKA 2IS2A 4EIWA 1ZCAA 3FHCB 2ZRMA 3LW8A 1YZLA 2C99A 3HPRA 3BB4A 3K1JA 1FTSA 5L8VA 2VLIA 4JL6A 1OH8A 2J46A 3MMPA 4NYJR 1GKYA 2VO1A 4Q4JA 1Y63A 4OHZA 4ZI3A 4HDCA 5JMTA 3CW2A 2JEOA 3RAPR 1TAGA 2OXRA 1CR4A 2J0VA 5FFMA 4YXWA 2B7BA 4LYFA 2ZAOA 1OB2A 2JDIA 1SKYE 3TUZC 3I62A 1UPTA 8OHMA 5FI0B 3KUCA 3RRNA 4DEYA 4QBIA 2GZHA 1XTKA 4KSBA 1DELA 3DMNA 4TQUS 3DZDA 2WICA 2Q21A 4RCYA 4B75A 2F1RA 1OF1A 3I92A 4XWKA 1YZGA 1NBMD 5AJWA 1W46A 5HZHA 3AF4A 3D7MA 4GOJA 3AM1A 1LS1A 1E2NA 4E22A 2IK8A 2IHYA 3SS8A 1UDXA 4NYMQ 3SFVA 1F3OA 4BZPA 2V9PA 5FUYA 4BFWA 4HUTA 1F2TB 3W5JA 2WSMA 2RGNC 3FYHA 4E07A 1G18A 2P3SA 2CXXA 1RYFA 1VCMA 3VR5A 3I8SA 1HY3A 4MA4A 4XTRA 3PUYA 1W0KD 1L7VC 3A1WA 3NXSA 3TJZA 2WWIA 1JJ7A 4NE2A 1N5JA 1Z22A 3R9IA 1T6NA 3B60A 2F3TA 1UBCA 3M6AA 3QG5A 5JWOA 2HDNB 2B92A 2VP6A 3H4MA 3CF2A 4ON9A 2PX0A 1KY2A 1VTKA 2FFBA 4XSHA 1G19A 2D2FA 4P0TA 2QORA 4WZAE 1J70A 2QE7A 3TVTA 1D2NA 1W2HA 1US8B 2JLQA 4EQ6B 2OUKA 3PUVA 3RNLA 3KKQA 5J40A 1TMKA 2UZ3A 3U44A 2EWVA 1E94E 4LZZA 3IBGA 1XEWY 1OB5A 4G3XA 3OEHA 3CNOA 4GMDA 1A7JA 1CU1A 4PO8A 4X8OA 5FTKA 1ZYUA 3AF1A 4F91B 1TQ2A 5LD2C 3J81k 2HLDD 2VPPA 4IVRA 1NJFA 3BD9A 3THWB 2JASA 1XB2A 4JLMA 4BGDA 1Z63A 1DO0A 1DAKA 4PO9A 3NDBB 4KSCA 4XVUA 1VDZA 3E5HA 3K0AB 1UKZA 4DT1A 3R7WB 2BDTA 3UXMA 2J87A 4C4PA 1SGWA 4HI0E 4IDOA 3EPKA 2FZLA 3CZPA 2W83A 1GTVA 3BH6A 3U3JA 3X1YA 4AURA 1DAMA 3QIAA 4YLGA 2ZI4A 3L0PA 2JCSA 3EZ6A 3LQQA 5LD2B 5JWHA 2BMJA 1MT0A 2YV5A 4DCNA 2IWHA 4FMBB 2JLRA 2Z6VA 5KSYA 3FHOA 4XVRA 4B74A 2XTZA 2ZI3A 1FMLA 1E1RD 3NEJA 3BFKA 1ZW6A 3GEEA 3DPUA 3QF4A 2FSIA 4D25A 4MGIR 1VHTA 1ZNXA 4PHGA 4RFVA 1EWQA 3BB1A 3GFTA 1F2UB 3NC1C 3AVWA 4Q03A 4NYMR 4FWIB 5AJVB 2IYWA 5E7IA 3QVVA 2MSCB 3DO6A 1Z6GA 3UWKA 5E7MA 5UKDA 3CZQA 1R0WA 1XD2B 521PA 4JLVA 4Q7KA 1ETUA 2ZREA 3NBXX 4LJAA 1PLJA 3FVQA 3RRMA 3P20A 1FTNA 4XWOA 4XTCS 4KODA 1A4RA 2PMDA 2H1LA 2QQEA 1M1YE 4AG6A 1J2JA 1NVVQ 2G9NA 4RD1A 1N0VC 1XTSA 1NMYA 1R5BA 1DS6A 3KQKA 5FOUA 4BRWA 3BH0A 2ZRGA 2VHCA 2FEOA 2J0UB 1OIXA 3EW9A 5TV2A 3QSYA 4RD0A 1U98A 4LJ4A 2JLYA 3Q5DA 4C0QC 1KDOA 3CRQA 5BYKA 4F7WA 4W9MC 4L9WA 4YMUA 1F60A 1WE2A 2C9OA 3PENA 4QBFA 5BWMA 3I32A 4V02A 5GJVC 2V7QD 2PBRA 2V6JA 2ZSDA 1OYYA 1E69A 2QUZA 1AIPA 1UM8A 1E9EA 3Q85A 4ZKEA 1SVIA 3ZGXA 4URVR 2JLVA 1S2MA 1AS3A 3B5JA 3QUSA 1EFHA 3WMGA 4MYHA 4DRZA 5CB8A 4GSYA 5JLJA 1D6JA 1VCOA 1ZINA 4TWZA 1IBRA 1DAHA 1P4SA 2DHRA 2Y8EA 3QJYA 4D0GA 2QTHA 3AV0B 2ZR9A 4IOJA 1ZRHA 1Q20A 3E1SA 3WMEA 4IVQA 1ZD1A 4L9SA 1TF7A 1F2TA 1PUIA 1VYUA 1NN3A 3WBKA 4CT5A 4BFUA 2ZU0C 3VNVA 4A4DA 3VR1A 4URXR 2KWIA 1E9DA 5EXSA 3OIVA 3AKCA 1IXZA 3FWYA 5FPHA 3SJZA 4A8JA 4CEIB 1VIAA 2VSXA 3B9PA 1CR1A 1OV4A 4OI4A 1OHHA 1D9ZA 4L8GA 3TMKA 2NOAA 4A0GA 2ZPTX 5CYPA 1NVUQ 4QGAA 3ZD7A 4A6PA 1G41A 2YWGA 1KI6B 2WPDD 5DH9A 1MRNA 2IX3A 1JEEA 1BO6A 1ODFA 3VNUA 1JR3E 3IHLA 1US8A 2G1JA 5KNDA 3F5FA 1SKQA 2J41A 1P9WA 4Q1CA 4EQ6A 1RPZA 1G3UA 5D3QA 3CRW1 5J47A 3OFND 3B85A 3KXLA 4NZYA 1G8FA 2ZITA 3BORA 2REBA 3CPHA 5KDLA 1I2DA 2W0MA 4BLTA 4OHYA 2VP5A 3HU3A 2GJSA 2BMDA 1QZXA 1IN5A 3FMOB 3I8XA 3K09A 3KL4A 4IHQA 4PFSA 3A1TA 2WM9B 5G3YA 1LB1B 2KBEA 3PXGA 1E9AA 3ZJYA 1SULA 4PC1A 1LTQA 2I4IA 2ZVQX 1NVVR 2F9MA 2XJ9A 4M4SA 3THWA 3SJBA 3ADDA 2P65A 1Q1BA 3M4YA 4X8LA 1QVAA 3K0AA 2ORWA 3MWJA 2AK3A 3WNBA 3EWSA 1A5TA 3I1FA 5EP4A 3R7WA 1EFUA 3VMFA 2VF7A 5CB6A 3EPHA 1M34E 3RS7A 1KAGA 1UBGA 2ZEJA 4UXJA 4PR0A 2QI9C 1CBUA 1IHUA 5CYOA 1P2SA 6Q21A 2QAGC 5EUMA 2D7DA 1KIMA 3B9QA 3KQNA 3C15C 4UNRA 3RYTC 1XBTA 1KNQA 2OAQ1 3K9GA 4C9BA 4QJ4A 3MSXA 2G3YA 4PHFA 2IW3A 1E3MA 3CF0A 4Q1EA 1SVKA 2ZE8A 1TU3A 1JR6A 4A0HA 1XRJA 3KFVA 3B1ZA 2FEMA 2P2LA 3SHFA 2ZI9A 1F2UA 1E6CA 2ZRLA 4JLNA 4UNPA 5B57C 1R0YA 1P73A 2F1IA 4DDUA 3RABA 3RS4A 5TMPA 1VCIA 3U6KA 2GEVA 1XD2A 3LO5A 1X86B 4JL8A 2ZANA 1ZP6A 4BZXA 1KK2A 4PAQA 2DR3A 1BOFA 2X19A 3QE0A 2BM1A 4ZDIA 2AK2A 2XITA 1NP6A 1HE8B 4PX9A 4WA7A 4WBSA 3VHXA 1FNNA 5CITA 4TL9A 2ERYA 1IAQA 3BOSA 2EW1A 4M1TA 5FBLB 2UVQA 5BN5A 2QENA 3TSOA 2J0UA 5TVKA 2CL7X 3O8BA 2R6CA 1N5IA 4Q4AB 4WVFA 4LOAA 4V03A 5KDDA 3MD0A 1WXQA 5AJZA 2ZJZA 4HEJA 4A1FA 1E9FA 2PH1A 4X8MA 2OV2A 4CIDA 4C0HA 1W0JD 2JIZA 4R7ZA 1OKKD 3HPQA 4WOPA 4CRWB 2QT1A 3CONA 4BRUA 2ZYTX 1Z6AA 4O2LA 1UFQA 1WBBA 1CEEA 1II0A 3UMFA 4ASUD 4C0AC 3QVUA 1MV5A 2GJAA 3Q7QA 4KYUA 1MO5A 3ZVMA 1K5DA 4MKHA 4AYXA 1OSNA 3PUXA 4C3ZA 4DSOA 5JWRA 3RS0A 4TQAA 2WMNB 3BFVA 4PHTA 3WRXC 4TL7A 2GJ8A 1QF9A 4N1AA 2Q9CA 3B6EA 4CEIA 1FZQA 1XCPA 3GLHA 1Z0DA 3A36A 4EPXA 1P7CA 1RJ9B 4DJTA 3SI7A 2AD1A 1HA3A 4ZCLA 4A6XA 5JI2E 4S35A 4GZMA 1TQ4A 1XD9A 2ZM5A 1XTJA 4AK9A 2UKDA 3VHLB 1JB1A 3D3QA 3EA5A 1G16A 1KI6A 1YRAA 4DVGA 2E87A 3VKGA 4L15A 2FA9A 3RS2A 4B3DA 1GZSA 4DSNA 1LV7A 4PZLA 1RC8A 1WB9A 3EZ9A 4PZYA 2FNAA 2E1RA 1Q3HA 2FOLA 3BRWD 4NDZA 1KSGA 1UKVY 4QHSA 4XH9B 5AUOB 4TTPA 4HAUA 3TUIC 3B7GA 3ZZUA 4Q1DA 1E96A 1FQKA 1OIWA 1XXHE 2NZ8A 4KI0A 4C7OB 1KZ7B 2G1KA 1IY0A 2MMCA 2OCAA 4AWXA 1NBMA 2VP2A 1DEKA 4B3GA 1PLKA 1GSIA 5DE3A 3NC0C 4ZIRA 4AG5A 3QXSA 1BMFD 2L0XA 1OT3A 2CK3A 4I1VA 1YRBA 2DCUA 4U5XA 3QXHA 3SYLA 1E2DA 3GD7A 1QG4A 4TSFD 4MRVA 2OFOA 2RGAA 1PVOA 3WBJA 2EFHB 3KKPA 2O8BB 3IIMA 1FFHA 3R20A 3UG6A 1XTIA 1ZJ6A 3LD9A 4BFYA 1K6MA 1W0KA 3NEYA 1NN5A 1TF5A 3MFYA 4JMPA 3A1VA 2OSBA 4R9UC 4R2IA 4JZKA 1LVGA 3WHLA 2JA1A 3BIFA 2TMKA 4MGKR 5IDVA 2ZAMA 3SJCA 1Q3TA 4LPSA 4V0KA 3X1ZA 421PA 4Q4LA 3CUEF 2ONJA 2F9LA 4US0R 5SZKB 4IRUB 2DB3A 1AN0A 1E2KA 3UPUA 4V0OA 2NZJA 3OIWA 4OQXA 2WWXA 1FQJA 2FPMA 2HYIC 3K0SA 1LNZA 1TEVA 3T35A 3OHMA 4Q1BA 2OESA 4LYJA 3WMFA 2WSSD 1P2TA 2FU5C 1A2BA 2IWRA 1NI3A 3N70A 1Q1ZA 1A2KC 2GEUA 2BVNA 1G8PA 2RAPA 2YJTD 4PQRA 1XMJA 4JSYA 2HLDA 1S9HA 2X77A 1R0XA 1DVRA 3PITA 4ZDWA 1XJ0A 4HUQB 3RVBA 1S3SA 2ZETA 1OE0A 3CRMA 4ESVA 2CDNA 5G40A 2DYKA 3G82C 3OEED 3T15A 2XOKD 3UIEA 1Z28A 2BMFA 2ZIAA 4B48A 3EIQA 5JCZA 2VIIA 4AKEA 2GRJA 2ZRHA 5K8UA 1VCNA 4Q4AA 4XJXA 5CIWA 1AQUA 1YR7A 4H1VA 1VECA 5EP2A 1I4DD 4Z8XA 3ZDQA 3LWNA 1CRPA 2K5UA 2IYZA 1KZGB 3NKVA 3GLFB 3T61A 3KJEA 2IS4A 1E1RA 3HJNA 2QM8A 3KFXA 3TBKA 2IEZA 1Q0UA 1U0LA 3MAAC 4JLKA 4LYHA 5FOVA 4BFSA 1Q44A 2IYXA 5F9FA 5G53C 4TYNA 2W58A 4EPVA 2Q3HA 1G291 1R4AA 2RCNA 4DDWA 1JNYA 5HCIA 1Q21A 4IXNA 3BE4A 3PIRA 2WJIA 1LW7A 3Q5EA 1DO2A 4M1KA 4OJQA 1GDDA 4PQFA 1R10A 2KB0A 4LYAA 3RWOA 3B78A 4QKQA 3V9PA 5BW8A 1F48A 4Q18A 1LS6A 4EFNA 2ZYUX 3QPUA 1AKEA 4A9AA 3UG7A 4Z54A 1RJ9A 2W0SA 1UKYA 2V6IA 3AF0A 3DM9B 4PANA 4P4SB 4AY2A 1JXOA 3QF7A 2REXB 4M21A 4Q9KA 3CR7A 1LF5A 4B3CA 1KKMA 3ZYCA 4TMVA 2PL3A 1WCV1 4XWAA 5FUVA 4DIDA 3U3KA 4LJ9A 4DEXA 1X8LA 2BKUA 4M9ZA 3D6TB 4MKIA 4Z51A 3VTKA 1KK1A 1BH2A 2V7QA 3TIFA 2W2XA 1T3HA 2VQSA 3BS4A 3L82B 1G8HA 5P21A 3CBQA 3M1IA 4C7OA 2ZU6A 2VP0A 2VL7A 3U7GA 5H70A 3P4XA 5C4GB 3ZZTA 4B44A 1U2RA 4BFVA 4GNKA 3T1VA 3D31A 3C16C 4P3YA 2FDCA 3LBHA 4DBLC 5G41A 5JFGA 4U02A 2IYSA 3QG1A 1VIYA 1EFCA 4U00A 2RHMA 4Y0VA 3RS3A 3U3RA 3T5GA 2O8BA 3IQXA 1M2OB 4RD3A 1HTWA 2ZS8A 4IOKA 3LNCA 2ZI6A 4Q7JB 1JPJA 3EZ7A 1Q57A 4Q1FA 2ORVA 4D4LA 4EPTA 1D2MA 1ZVQA 3P27A 1Z29A 1KDTA 3PUWA 4KAXA 3AVTA 3KUDA 4B3BA 1NKSA 2WWFA 2ZJBA 1IM2A 4B35A 4TQ9A 1RIFA 1E2GA 5DO9A 3TH5A 1YKSA 2H8KA 2WPDA 2JLWA 4KITB 1EXMA 3V4FA 2O0KA 1BKDR 4PPNA 3QPWA 2YC4C 5FL7D 2PLRA 3FTQA 1YU9A 3HWSA 3OFNA 4O25A 2KE5A 2R6AA 4DCTA 1ZUNB 1XZQA 3DL0A 5GJWC 4B76A 1XFAA 4A2QA 3TE6A 1DAGA 4NU0A 1T9HA 3FGNA 5CM9C 4BLOA 1NN1A 2IA5A 2QRNA 1SXJD 1YQTA 3SYKA 1E79D 3KKMA 1ZNZA 2VHJA 2WWWA 1OYWA 3SE0A 1ZMXA 4I81A 1OXTA 5KOYA 3ECCA 4HUQA 4Q01A 2J0QA 4D0LB 4HB2A 4H9GA 4JLBA 2ZRCA 2V4ZA 3KQUA 1ZBDA 2Q6TA 4KU4A 2GA8A 5EE5B 3KQLA 4B43A 3WXMA 2GKSA 3FDIA 5ANRB 1XTRA 3ZQ6A 4Q66C 1U9IA 3IIKA 3A4LA 4A0FA 5FPYA 5L3RA 3L43A 4DSUA 1I2MA 1A1VA 1NMZA 4RSGA 4RKFA 3TR0A 4CDGA 2OBNA 3TVDA 2XZOA 1VG9B 2FSHA 2PZGA 2QA5A 1E9RA 2WWHA 3LVQE 4FW9A 5A0FA 3GLFA 1MKYA 4PO1A 4JVNA 4RZUA 4HLUA 4JJKA 2IEYA 4RCZA 4A8JC 1DPFA 3VKWA 3Q72A 3EZFA 2FSGA 5CK5A 3PG5A 2GJ9A 3ASZA 3GLGB 2CK3D 2CLDX 3SC3A 4QM6A 4LCBA 1IJFA 1TX4B 5HCNA 1VG8A 2EFDB 1CTQA 2GAOA 2DWPA 3LXXA 2ZRAA 5F9HA 1JPNA 4A8JB 4URWR 2C04A 1HE1C 3CWZA 4ZCIA 3H0KA 2IYYA 3ND8A 2WTUA 1KI7A 3K09C 2VF8A 3P26A 3PFIA 4P4SA 2DFKB 1TF2A 4IOMA 5FH9A 1OH7A 4KV9A 1IQPA 3AP1A 5J4YA 2IYRA 1ZM3A 2A9KA 1G8GA 4TTRA 4Y0AA 5FBVB 1ZM9A 1RRFA 1Z5ZA 4TMZA 2RGXA 1EWRA 1QHHB 1W0JA 2G83A 1OKKA 4LJYA 3X1WA 4IOLA 3UWOA 3AKEA 3FE2A 1II8B 2FPLA 5CK4A 3AEZA 1V43A 3CNNA 1ESNA 4LHVA 1XD8A 2DFTA 4ASUA 3UATA 5CM8B 4BWYA 1XCMA 4QBHA 3B13B 4OHXA 4ZKDA 5HR5A 4Q47A 3WNCA 1QDEA 4JBYA 5J4LA 4UNNA 3GLIE 2JLUA 3U7HB 1KI1A 2AKYA 2C2HA 3FMIA 3ZVLA 4K46A 5K8LA 1CJVC 1WP9A 2WOOA 1XMIA 1ZM2A 4NP6A 2EFCB 3O8RA 1II9A 1Z0JA 2NO7A 5IF9A 5JBQA 4DB2A 3R8CA 1ZNWA 4F92B 2CE2X 4I4LA 1Z2AA 4IDPA 4EUNA 2OFWA 1WF3A 2NPFA 1YR9A 4NHOA 4FMDB 3RLFA 5CDFA 2O8EB 4AI6A 5JI3E 1GRQA 2CNWD 4LDJA 1GM5A 3N2EA 1W2GA 1GWNA 2ZRFA 4D82A 1CLUA 1FOEB 1QHNA 1N6NA 2FFHA 2ZI5A 3AKYA 1DTSA 1NG1A 3BC1A 1XCGB 1GILA 3GMTA 4EJSB 1GOTA 3DMDA 3TAUA 3VR4A 3QEOA 2CCKA 2G77B 5A4JA 2FPKA 1E2HA 4PAMA 3W6OA 1UBFA 4EPRA 5EE1A 2GXQA 1Y3AA 4V0MA 2ASEA 3JVVA 3IO5A 4US1R 2NO6A 4DUGD 3ZD6A 2VA8A 5BN4A 4QNMA 1S0UA 4MRNA 5EZ6B 2VYFA 1BMFA 5FR1A 2WV9A 2YKGA 3ZQJA 4TSFA 1ZAKA 2QP4A 1WA5A 4ESHA 1J7KA 1LFDB 1T4GA 2WKQA 3SHWA 1Z8FA 4HAYA 2R9VA 4PQYA 2A5GA 2X2EA 1CJKC 1U8ZA 1UDWA 3MUFA 4FI3C 1QHSA 4DDVA 2A5JA 3U5ZB 4D26A 4HB3A 1OLOA 1KMHB 4XOIA 4IEEA 2G0TA 2QM7A 4AKIA 4M22A 1E2PA 5BXQC 2XSZD 3FPAA 2WMOB 1NY5A 2ATVA 1T0HB 2NIPA 5FTJA 1DADA 4P4UA 4UXIA 3BJIC 3QENA 4TMXA 2CVHA 4RZ3A 3MWKA 5A5GA 3AP3A 2CE7A 2GK7A 2VSFA 2IBMA 1GKIA 2AFIE 5EP3A 5ELXA 2WBLC 1DARA 5KPDA 3SZRA 2WSSA 3HDTA 3GP8A 3TR5A 3GLGA 2H5EA 5TB5A 3GJ6A 1VYTA 3SBEA 4PC7A 5E3HA 2W6ID 1KO1A 1IOZA 4NCJA 1TUEA 5E95A 1X6VA 4B34A 5IK2D 1CP2A 1ZCBA 2C8VA 3VFDA 1SXJB 1MABB 3NBZC 3OF5A 5TDHA 1MH1A 3TQFA 1GRNA 2FZ4A 4F4JA 1IXRC 4QM7A 4CGZA 4MKFA 3QBTA 1CJMA 1CULC 3K0FB 2ANBA 1JBKA 1N5KA 3LH5A 3GLHB 4KFRA 5CLQA 4HSEA 3VQTA 4PC2A 1KMQA 2OLJA 4OK3A 3QEJA 2Z43A 4FMDF 1PJRA 4BLPA 3OEEA 2Q3FA 2XOKA 2OO7A 3AVQA 3QKUA 3KJIA 4YDSA 2V1UA 3JVUA 1NJGA 1U0JA 2BBWA 2C98A 4LPKA 3BAFA 3I4LA 1AK2A 5FTLA 3GFPA 2P5SA 1JJVA 4MRRA 3HYTA 2ZQ5A 3EC1A 4GDFA 3PEWA 1S1CA 2VEDA 3PEUA 3TLXA 2WAXA 1XEFA 3TW4A 4NH0A 2QSZA 2LKCA 4G5SA 2YWEA 4Q5IA 5TARA 2JLZA 1RVDA 1QHHA 2C95A 4FCWA 4BEJA 2MSEB 4JBWA 2ZJ5A 3AF3A 1E2IA 1II8A 1ZU5A 3CIOA 2WKRA 4HLQB 4OBEA 1CIPA 4IDNA 2JJ8A 4I1OA 5B30A 4JJZA 1D5CA 4B3FX 1W1WA 4CVNA 4ZIRB 3SEAA 2HF9A 1IONA 1KI2A 1U81A 4O2RA 1X8JA 1IJEA 4P31A 5KTYA 2YOHA 1KKLA 3C7KA 2C9YA 4DLRA 5DN6D 4ZCMA 2ZXUA 1KSFX 4LWZA 3I61A 2BCJQ 1XMVA 2GCNA 1GG2A 4M53A 2CVFA 2DBYA 1E2QA 4MUAA 3OZXA 2LCFA 2RGCA 4B2PA 1VYVA 3K70D 2CEAA 2CHQA 3VKHA 1OFUX 3JZAA 4OYHA 3SR0A 1UJ2A 4HAWA 2ZE6A 2QMUA 4WZ6A 1ZU4A 4U7DA 1IY2A 4K81B 4B47A 3ADKA 3KXIA 1VG1A 2B6HA 4NCIA 4OHWA 5FBQB 3RSOA 1HT2E 2O8EA 1E9SA 5JRJA 1TTTA 1IXSB 3LX8A 2G0NA 3SDZA 3ZS9A 3GEIA 4A2WA 2W2TA 4HDOB 4AC9A 5JHHB 1R5OA 2ZRJA 3A6PC 1HH4A 3EZ2A 4GT1A 3MGCA 4EJSA 1XX6A 2W6JD 3EXAA 5KSZA 3PEVA 4QJ5A 4NCHA 1YJ5A 4W5HA 5L3VA 2O8FB 1SVOA 2J5XA 1AJEA 3K8YA 5TXGA 3ZVRA 5KYKA 4A15A 1OIVA 2EVWX 5CDFE 3ND9A 2ZUCA 1E0JA 3KDSE 1E98A 1PLLA 2HUPA 4QFMA 1KI4A 5FBRB 4D6PA 2J7PD 2J7KA 2D4HA 3LY5A 1R5NA 1L2TA 1JI0A 3C14C 5JS8A 1U99A 2OLKA 1AQYA 2QQ0A 4OHVA 5B2ZA 4RFSB 1FW6A 2WIAA 1N6RA 2PZEA 1IY1A 1RFLA 2A5YB 4WXRA 4UNQA 2IUUA 1P2UA 1G7TA 1SKYB 4S2EA 4QGGA 2ATXA 3THXB 1KK0A 5AJYA 1VPLA 3U6BA 1KMHA 1QG2A 5TY0A 3P32A 3SQXA 3U7EB 2R62A 2JJ1D 4HAXA 2NO9A 3IILA 4TMWA 4MYUA 1CXZA 2WAYA 5JSZB 4TYYA 3GJ0A 3W5IA 4FWTA 3U7FB 1X1SA 2OZEA 4DLSA 1W4RA 3LX5A 2ZYVX 3RC8A 3WNDA 2D7CA 2B8TA 1E2EA 3KX2A 1BYIA 5EE0A 5FL7A 2AFHE 1NSTA 3W3AA 2QBYB 1R7RA 1Z6TA 2ZE5A 3W8NA 2QAJA 2B8WA 2BMEA 3ADBA 1JQLB 3KB1A 3NBFA 1G3QA 2BHRA 2GEDA 2NO1A 4DLUA 4IDHA 4POAA 4QC2A 3RSLA 2OCBA 1E9BA 1AKYA 1WRBA 3CH4B 2GZDA 2I1QA 1UBEA 3VR3A 4YMVA 4UNSA 2QGZA 1SXJA 1MABA 1E79A 2EWWA 3KJGA 2D74A 3GEHA 4PSVA 1HT1E 4XD7D 3ZIAD 3NH9A 3TQCA 2YZ2A 3SNHA 1XU4A 3K0FA 1NLYA 2GCOB 4NBSA 4YC7A 5DHAA 4HLDA 2AXPA 2FN4A 4IW3B 3CF6R 5GJBA 1ZIPA 1VHLA 4PPQA 3IPXA 3BK7A 4I1UA 5FPKA 2PT7A 3H1TA 3X1XA 2FH5B 4W7SA 2EYUA 1QHIA 3NVAA 2FF7A 1U90A 4HB0A 3SOPA 4V0NA 4TLAA 3X1DA 1G3RA 2IXEA 2WOJA 2EYQA 5GJCA 4JT2A 3CH5A 4I1SA 1WQ1R 2OBMA 4HAVA 1KSJA 4UKDA 5J4KA 3I5XA 1AZSC 1HV8A 1YZKA 1HEIA 3A1UA 4C2UA 4CW7A 1IN8A 1MR3F 1LY1A 2OE2A 3KZ1E 4NYIQ 2UZIR 3TK1A 1MO6A 1Z08A 4I99A 5EE3A 3ICQB 2AX4A 3MLEA 4GP6A 2ZRNA 3U61B 4PZZA 1EX6A 4OQNA 1CJUC 3AVOA 3L2OB 3EARA 2XNSA 2QEQA 3PJRA 4B2IA 1XDBA 2WJVA 4II7A 2PEZA 4IVPA 4B6FA 1ZM7A 5GVSA 1JXMA 2A2ZA 2C9CA 2FSFA 2WWGA 3HR8A 2W2VA 4RD4A 2GVZC 4DIEA 4EKDA 4ZPXA 4PPGA 3T1OA 1NVWQ 4PTLA 3CO5A 4WXPA 5DISB 4D2IA 4MDEA 2C78A 1DG3A 2QMOA 2IS6A 2H57A 1NIPA 4RD2A 4KXFB 2IHBA 3PEYA 3S1AB 1ZC4A 2JJ2D 1N6KA 1NIJA 2O5VA 2DFLA 3BWDD 4W5JA 4ZV4A 1OFTA 3PR1A 2EU8A 2H7VA 2A30A 1ZNYA 1S3GA 4KVAA 2XB2A 1DAIA 1HYQA 1PZNA 4NCKA 4Q02A 3QXCA 4Z8YA 1Z0IA 2CBZA 2Z4RA 1N5LA 3O8DA 4LBYA 2GVDC 1E0SA 4US2R 3WY9A 4JIMA 1X8KA 4BUJA 1D2EA 2J0SA 5HE8A 5KNCA 5DHFA 3RHFA 4DLVA 4NTZA 1UAAA 1YZTA 3QPVA 4IFBA 3CRRA 1HUQA 2O8FA 1U9IC 4A36A 1HQCA 3K70C 4B2LA 2BEKA 5JZVA 3GJ7A 5CLLA 1G3MA 2LWIA 3A1SA 4PSKA 4JYCA 2KBFA 1FMJA 4FCVA 3TUJC 3IEUA 1P6XA 1H8HD 2ZTSA 1ZD8A 3PVSA 2GTPA 4HLUC 2VSOA 2XX3A 4B6EA 4ACBA 1M7BA 3B1WA 4RFSA 4M8NE 4C30A 5KHOC 4MRSA 5FTNA 1SQ5A 2AD5A 3OE7A 2ZRDA 5KO2A 3K9NA 4N0DA 5DI3B 1E0KA 3ZH9B 2IXGA 4TMTA 3K70B 1G7CA 4QBGB 3THXA 4B33A 1Z6XA 3B1YA 1S96A 4Z1MD 2R44A 1FPMA 1KTVA 3C4JA 2BEJA 1W5TA 2Q9AA 1ZUHA 1XJCA 4ZDKA 1M6NA 2QZ4A 5HZKA 5JSZA 2F1HA 4QNRA 1KI9A 1TQ6A 2YWFA 4KFUA 4DXAA 4TT3D 1GIAA 1E2MA 1T91A 5FOSA 5HPYB 2CNWA 4RD6A 4PHHA 1VG0B 2NG1A 1XP8A 3CKLA 3EPJA 3UKDA 2OM2A 3RWMB 2BM0A 3FMFA 5EXTA 2QBYA 1G3IA 1OPXA 2Q9BA 4AIIA 1W4AA 1N6LA 1NVXQ 2PJRA 3B1XA 1EESA 2CL6X 3GQBA 4NL4H 4CZ2A 4EPWA 4TL6A 2Z5FA 2O52A 1F5NA 4DUGA 3T5DA 1P3JA 2ZR0A 1KK3A 1XF9A 3VX4A 2VH5R 5C18A 3AGQA 1KGDA 4YDHB 2GCOA 3LQRA 2XEXA 3E70C 5EJEA 2YNMA 2B7CA 3CPEA 5KSPA 3WYAA 4GI7A 1KJZA 4C0BA 2V1XA 4FD2A 4OK6A 1NSFA 5HTKA 5FTMA 1MO3A 5HKKD 1YZNA 4A2PA 5BQ5A 4YMTA 4P32A 121PA 3RC3A 3CX8A 2I1VB 4JVSB 2CJWB 5LB2A 1XEXB 4EAQA 1AZTA 2N46A 5FPSA 2XSZA 1ZM4A 1H8EA 1N25A 3GLHE 1S8FA 1GL7A 1B23P 1KY3A 2F43B 2IF2A 1JALA 3AH8A 5JJLA 2HT1A 1JAHA 3NTUA 3U3MA 3I72A 3BERA 5KUTA 4A0RA 3DKPA 2AWNA 4LC0A 4DLYA 1GITA 2ZRPA 1Z0AA 2QY9A 4KBGA 2O0JA 2BOVA 2W6IA 3ASYA 2J9RA 5IK2A 2A5FA 4AYTA 4KLZA 1R0ZA 2GILA 4HATA 1M74A 3ONWA 4Q1AA 3ETLA 2RHDA 4EFMA 3B82A 1NBME 2QMEA 1L4UA 1M7HA 1AA9A 3CX6A 4GOXA 4JLJA 4O0MA 3ZLJA 1W5SA 2ZI7A 1E32A 4LBZA 4URYR 5FBWB 3S1AA 1Q12A 4O3MA 2ZSBA 2BJWA 4E09A 4G5GA 1C1YA 4BFXA 5JEDA 2YOFA 3FMPB 4BLSA 1JECA 2QT0A 3TSWA 5H8WA 2IXFA 1KNXA 3ADCA 3DHWC 5G3ZA 2ZSAA 4HZUA 3LV8A 4QOSA 1YZUA 4CEHB 2MMGA 4JBXA 1P9RA 2BV3A 721PA 2XZLA 3OIUA 4F4CA 4YMSA 1ANKA 2KSQA 1G1MA 1EFRA 1G5TA 4IKEA 3R9WA 4CYMA 1G6OA 4FINA 221PA 2R2AA 4M1YA 3KQHA 3EG5A 1O3YA 4RY2A 5C46F 2HF8A 3CR8A 4C0SA 5KDOA 1L4YA 1W47A 2FJUA 4QGHA 5EE9A 5DN6A 4BECA 3NWJA 2BBSA 3LXRA 2ERXA 2V8OA 3EA0A 3CM0A 3CPJB 5EXPA 4EFLA 2XZPA 1KO7A 5DI3A 4BZQA 4B71A 3IDQA 5KU1A 1OXXK 3K9LA 4DLTA 2XAUA 1M8PA 1TU4A 2P67A 5SZIA 3WP0A 3PUZA 1KSHA 1FL9A 1U94A 3VU9B 1W7AA 4Q7LA 4MYCA 4D0NA 5DYIA 1KI3A 2CHGA 2FFAA 2ZJYA 1XPRA 3AB3A 3VR6A 1XWIA 3D8BA 4HDQB 2HV8A 4JLPA 2W6JA 3H86A 4F93B 1Q1QA 3WRYC 4FN5A 3RANA 2GJKA 3H2YA 5KSOA 2REOA 2OILA 4D80A 2IL1A 5GVRA 2FGJA 5F3WB 3IEVA 4OI0A 2A5DA 3R8FA 2C5LA 2ZUBA 4JSTA 3CLVA 3K0CA 1OH5A 4TL8A 1N6IA 2YOGA 3NG1A 2J7PA 5AR1A 3EIEA 1CR0A 1Q1EA 2PLFA 2RH5A 2VTKA 3I73A 5AJXA 5AUNB 4HYYA 1W44A 2EFGA 4E03A 2YC2C 1SVLA 1KI8A 1UEIA 4H1UA 3AVPA 2AL7A 1JR3A 1S4QA 1GL9B 3B1VA 3QOFA 3GPLA 1FX0B 3DOFA 3FOZA 2VRWA 3AVYA 3O8CA 2AWOA 5B58C 2JJ1A 2CJWA 3GFOA 1XEXA 2ODBA 2IF0A 3BBPA 4IDQA 1JAIA 3QY0A 1E1QD 1XXHB 5CJPA 5FR2A 2FWRA 2F43A 4ITRC 4KHZA 3U2QA 5M04A 3R9XA 3AVUA 2JAQA 4LGMA 2VP9A 3W34A 3RS5A 2H16A 3ZVNA 2R65A 1KDPA 3MWLA 1AGRA 1KYIA 3T34A 1QHYA 3TRFA 1E4YA 1SHZA 2NPIA 2Q3MA 3OAAD 5AWFC 2Z0MA 1AGPA 2GDJA 1MOZA 4Q48A 5EQTA 4QHTA 5H1YA 2BKEA 1WDTA 1SZPA 3OE7D 2Z83A 3B2EA 4M1MA 2GNOA 4IJMA 3W3ZB 4Q9HA 4XD7A 3ZIAA 2O8CB 4ZDJA 1GKUB 1CRQA 3QKTA 4EJSC 2ZR7A 2ZROA 3QKRB 3C5CA 1SVSA 2XB4A 2V55B 2ZRBA 5LB4A 2GBLA 2XXAB 1Z06A 2EQBA 4IEIA 4LUCA 2RGBA 2IYLD 2JLXA 2NQ2C 4KO8A 3AKDA 3G0HA 1VKJA 3MRSA 3RRZA 1RE0A 3DEFA 1P2VA 2GK6A 621PA 1CF4A 3IBYA 5C1BA 4OQFA 1T8UA 2H17A 4Q9LA 4D4MA 2BC9A 4DDTA 5DSZA 1X3SA 2QTVB 3W6PA 1R2QA 4CEHA 4C0JA 3FFBA 1ELOA 4QHYA 1G5PA 3TSZA 2QP3A 4BLQA 3GJXC 3HYRA 1H65A 2ZJ2A 4MRPA 5EUQB 4OKSA 4M9QA 1FNMA 1ZUIA 2PEYA 4B32A 5J4VA 5LPNA 4M1WA 1E99A 2HYDA 3FKSD 4AD8A 1DAFA 3VR2A 4TLBA 3WYGA 3LW7A 1U8YA 1N6OA 1NNEA 4OQMA 4LV6A 1RW4A 5BYJA 4G01B 4TTQA 2QPAA 2WJYA 4LBWA 3G5UA 1NY6A 2AHOA 2FFQA 3UANA 3Q7PA 4Q4HB 1OXSC 5FI1B 4G5RA 1TNDA 1H8ED 4LJ5A 2YVUA 3DDCA 1AS0A 2F7SA 1R6BX 1SXJC 2AXNA 1GP2A 2JJ2A 2QMHA 3I3SR 3TNFA 3VU9A 4GMXA 2AN9A 2N42A 3T1QA 4A82A 5KNBA 2GXSA 4BPBA 1EG7A 1QRAA 3EPLA 1T5LA 1IN7A
chains in the Genus database with same CATH superfamily
1L4GA 4BNDA 3KVRA 4B0OA 2RI0A 4YONB 2QU8A 3DOIA 1RWQA 1X2EA 4NMMA 3TKYA 3ZWCA 4JVLA 5LQSA 3ZY2A 3MTIA 5CVJA 4G4GA 3TINA 2Q3CA 2ZS9A 4RA9A 2R1ZA 1WF6A 3DF9A 4RV9A 1FUKA 3IAEA 3MOGA 4TXHA 3CKMA 3GYBA 3OQ1A 1J4AA 2FQYA 4C08A 2F3RA 3THOA 5SZHB 1HSZA 3F0TA 3HDYA 1EK5A 3T3GA 3ISTA 1C1XB 2R6DA 3G68A 3Q10A 5EMHA 1SZDA 4JI8B 4CKXA 4UZFA 3KKEA 4GX1A 1E8DA 1CK4A 5KWVA 4NONA 1RFGE 5IEJA 3HU1A 2EFJA 1COWD 4ZI2A 1DX9A 1UC9A 3LLMA 4M1ZA 4Q00A 2XDAA 5IWCA 4QEKA 3RUHA 1S8AA 1X42A 4HVAA 2ZVDA 3RODA 4CTKA 3ZJ4A 1SOUA 2G71A 1CHNA 2QR2A 2NMVA 4J91A 1YAHA 1V5GA 2WHXA 3GROA 4LNUB 4TMKA 4X97A 3DE5X 4PNHA 1PX2A 1FYDA 1PWEA 1W5BA 4KFTA 3B1JA 1LPSA 4RZQA 3KXKA 1M1NB 4LZNA 4ZOCA 3K9CA 4LX0A 4R2MA 4CEJB 1JHDA 4PAOA 3AL0C 3OI7A 2OVFA 3WGJA 3HMQA 4DCGA 3NC4A 1FXUA 1Z73A 3O4VA 2BJVA 1K3UB 1XXHA 3CLUD 4JQZA 3TTYA 3MJRA 5TPWB 4Z7NB 4OLHA 1FP6A 2VAPA 3FDZA 3LGXA 3TPFA 1N57A 4E46A 4NDAA 1XNJA 3FZNA 4Z2YA 4TZKA 5MGBA 3HLTA 4QUAA 3IPYA 1D1SA 1HO3A 2OHFA 2YVQA 4IINA 5HJ5A 3Q8XB 4M8SA 1W36D 3CX7A 3K9HA 1EVJA 1HDEA 2PRZA 3DWFA 2B3TA 3OIYA 4Q9DA 4QTXA 4B87A 4BNKA 3VXKA 3W5UA 1UMBB 3FYUC 3QTBA 4L5BA 1KDRA 1XK7A 3W1VA 1T8TA 3SF0A 2PXXA 3G5AA 2YZ7A 5I9NA 5JJ5A 5JY1A 2VPWA 1T9ZA 3FCCA 5DGIA 2VBCA 2XW6A 4QXAA 1ENOA 3SYNA 1W4CA 1EK0A 4FGJA 1GTSA 1O0SA 1UFKA 3NYIA 4AKGA 2BWJA 3PQFA 5EIBD 3SZOA 1G38A 2DXIA 1BYUA 3WSWA 3M4ZA 1Z4LA 2JFZA 1KMNA 4Q3OA 4M1OA 1LDBA 2CHFA 4UZSA 4XW2A 1WPGA 3UWPA 3WGMA 4HWPA 4AUEA 2XCUA 1WBDA 4DLKA 2I0FA 2D62A 2XXAA 2JGDB 4DCJA 3K6RA 2VKTA 3RW9A 5KYYB 1GNRA 3K96A 4K9QA 5CD9A 1IBKB 4OMFG 2B3DA 4G0VA 4A8TA 2R8YA 2HA7A 4DMLA 4XQGA 2O8DB 4QDJA 3IUNA 2A78A 2PFGA 4YV2A 4B45A 5JFGA 4TS4A 5EJ4A 2QTVA 3WNVA 5ED0A 4J7UA 4NBLA 1N6HA 4MJLA 1G7RA 1EUYA 1XMQB 2CCGA 4UHHA 4RHUA 5G2OA 1EMDA 4BEVA 2QXTA 3KKOA 4Y6OA 4C21A 1AB6A 2JAWA 1FA9A 3Q9LA 3LHKA 2FDRA 3B2QA 2QQFA 3LKDA 4FDAA 4OBBA 5BNWA 2IUTA 1PP4A 2LKDA 2HMTA 3DTVB 4GGOA 4HGNA 1C3XA 1PBTA 1KZ1A 2CD9A 1YV9A 2PCLA 1D4ZA 1GZUA 3NGLA 4W5WA 3LA6A 5E7JA 4ZVRA 1HNXB 2FK8A 2X23A 3GJRA 4ZAVA 2FRDA 4AKSA 4RTNA 1ONOA 3AO0B 1IVSA 1AM4D 1GNPA 3A04A 3H11A 4ZVPA 4DUYB 3MTJA 5C1IA 2GN4A 2FWIA 1MC4A 1V5WA 3G0BA 4TUYA 1W30A 2LW7A 1HX7A 4TLCA 1IULA 3IVAA 4Q12A 2YYAA 3SU8A 4HLCA 4JVMA 4JBLA 4V0ME 2IC5A 3U13A 2A3RA 2UUBB 4TZ6A 2C00A 3I9MA 3BGWA 4F3NA 1DQYA 3U62A 4G67A 2VWHA 4HPJB 5LJIA 3G5LA 5F98A 1NF3A 1TLTA 1O96A 5LJLA 4L50A 1VZ3A 4UJ5A 1ORRA 1WHTB 2MINA 1MEJA 3H5WA 2JGFA 1EJ6A 1Z0KA 3JQEA 4B6RA 4L85A 4Q3AA 5DLYA 5L3QB 4MWTA 2J32A 1DDGA 1H5QA 1KQGA 1DBSA 4EGJA 1W48A 3MS7A 4CM5A 1G7SA 2EF1A 2XQFA 4LBVA 3DHYA 1QQTA 1LX6A 1ZI9A 4L6CA 2QE7D 4WBXC 5MFPA 1ORDA 1FRQA 3A28A 2NXCA 4FS8A 4XCXA 3UJ8A 3WIOA 3L1UA 4N41A 1T34A 1CFZA 2FPIB 4M9SA 4KTVE 4LJSA 1P5ZB 1DINA 4MS1A 1B0PA 1I36A 2H92A 2IW1A 4H6WA 1QIJA 2P5YA 3FOAA 4G8BA 1JHXA 5H68A 2YWHA 4ALIA 1X1DA 1BD4A 4MULA 3LWDA 1QR6A 5AVKA 4ZVNA 3SDBA 3NETA 1X1RA 2HU5A 3F6EX 3RDPA 3VX3A 2QX9A 3PHBE 1SBTA 3TLGA 4RGVA 5IMSA 2OFPA 4AZWA 1KL7A 5EIOA 3IQFA 4RZHA 3GWGA 2GXAA 4MW1A 5FOXA 4RHTA 1T0PA 2WQ7A 2R85A 7GPBA 2HQOA 1IPHA 2UYOA 1FJ2A 3L7JA 5JD5A 3CRVA 3EWAA 4FCTA 4X85A 3NOQA 3TTTA 4QJ3A 4YH1A 1Q22A 2Q5FA 2BBTA 4QTYA 3R6TA 2DFNA 4JNCA 2VA9A 3E7XA 3R0JA 5A7HA 1XUOA 3VZCA 1WM1A 2WHPA 2B4YA 3HDJA 4NNOA 4OUDA 5EFOA 4H4EA 3R5KA 3TOZA 4BV2A 2G88A 4ZYVA 3SFZA 1J9EA 2X7JA 2Y2VA 2J1LA 3C41J 1DE0A 4DILA 2PSFA 2VJDA 2ZWPA 1V9CA 1NPDA 2YBDA 3Q9UA 3EZXA 1GL3A 2NM0A 5TPZA 5AVSA 5IABA 2O0HA 2FX3A 3X2SA 1YKFA 4YAEA 4ZAGA 5KNDH 1W8IA 3AFOA 3DEZA 3FETA 4H7EA 4M7PA 4LY6A 3I6IA 3ETHA 1A82A 1TL7C 3OMLA 2X8JA 3S7ZA 4GEGA 3GP3A 3ITKA 5L6LB 3UV3A 1T6YA 1AT1A 2HPZA 3GLIB 5DI9A 4AULA 3KIPA 2P6UA 5BT9A 4AWBA 2YS7A 2IIVA 3VR2D 2DUWA 3E9EA 3N9IA 2QG6A 3U19A 3ZJTA 1QP7A 2F8MA 1QVRA 4EHIA 2EGUA 4M54A 4NOJA 2BYTA 3D8TA 1ZW1A 4V24A 3EF1A 1JZTA 3WB2A 3WKAA 4L75A 3TIIA 4NHEA 1RBQA 2C5FA 3FNIA 3N2IA 5J5CA 3W5CA 3MRVA 2LZ0A 1CDOA 4AYWA 3O9VA 1U28A 2BAGA 3PT9A 4GOKA 5DF1A 1EP3B 1QDLB 1XQXA 1D9XA 1XQVA 4FYYA 4MPDA 1DT5A 3JWGA 1F6BA 1MJNA 2G9RA 3BFXA 3L18A 5L3SB 2FDXA 3U4QA 3FSGA 3WMRA 2PZFA 3CG4A 2VJOA 4XAQA 4CKEB 2CL0X 2D06A 2H9YA 1EPUA 3OC6A 4LJ7A 3DZ8A 2GJ4A 4ZT7A 4H7DA 2XT0A 4BU1A 4DBVO 3L5KA 3THYB 4AMGA 1W49A 1DC4A 3W8FA 5LYJA 3PTAA 3ZZ0A 1M72A 1OLSA 1CB7A 1EAYA 1FMCA 1IM5A 4BYMA 1P60A 1P7VA 2XYHA 4I3HA 4OQLA 4WW0A 3SBOA 2Q8NA 4BVFA 3O3CA 1HNZB 2WC1A 3LRPA 1XAHA 3NVMB 4DHEA 3UTDA 1EDBA 4HCJA 1NNLA 2RB5A 3QUQA 4GPAA 2HR1A 4G89A 4Y6GB 1A72A 1VMAA 2BGRA 5DTQA 3A7EA 2EFYA 4MJXA 4EDHA 4JYPA 2OBLA 4FFOA 1VJRA 1BTOA 2X2FA 4RKQA 4RK5A 1NC3A 4NPHA 1UBKS 2RKOA 2A5LA 4CM8B 2HK7A 1UQRA 4ZVQA 3DVRX 5IBQA 3FUWA 3PPYA 2DE0X 5LZ8A 4AXXA 1CW2B 1KQNA 1VJ0A 2WABA 3RTEA 1NRJB 3B52X 2PLAA 1RSZA 3OO1A 2PH7A 2VTDA 1E3DA 4I9GA 5SICE 1UDCA 4BKRA 4B73A 2IUEA 2WZQA 2P90A 2W2MA 2RKWA 1GZ7A 2Z30A 3ABRB 4XYEA 3PXXA 1HDZA 2FSVC 2B2NA 1KEEA 3S8EA 3EQ8A 1IC6A 3IMGA 4GKAA 3TGPA 3BGVA 4CF7A 2BL4A 2IYFA 3H7IA 2YRWA 1H4SA 3AUFA 1U7OA 4EG4A 4AQ7A 3M9LA 3ITNA 4MWBA 2I66A 3D0KA 4BEBA 5JTUA 3EMBA 3OE4A 1PHRA 1JIJA 5DBIA 1AKRA 1LGYA 2LRHA 1DRUA 2VYVD 2ABWA 4LRWA 4D9NA 3DT9A 3UMRA 3AUSA 5CJJA 4AZ3A 4CCAA 4J0QA 1G4AE 3W5BA 1U8EA 3WP1B 2PA0A 3RREA 1RWVA 1VJDA 4QULA 4TVBA 3RHTA 4BJHB 3IBCA 1TECE 3M6FA 1AQ6A 5DYGA 3WGUA 1QX3A 1K06A 5CTAA 4Z6KA 4DLZA 5FPTA 3IP3A 1E2FA 1B3RA 1U2DC 3QW4B 4U0KA 3H5VA 3T7DA 1GU0A 1RC0A 1KWGA 3T9EA 4JXZA 3A1NA 2GRUA 2CLHB 2LPMA 3AI7A 1KVUA 1RRKA 3BBLA 1TGVA 3FKSA 2R6FA 1N6PA 1R0BA 1MJGM 1E1NA 3A4MA 5AH0A 5AKKA 3ICEA 4FT2A 5IHPA 4CM4B 1DG1G 1JQAA 1J20A 1PJTA 4KUEA 4HYQA 1C9KA 2IX9A 3DZIA 3NIBA 3NYQA 1QRRA 1N9GB 1EFPB 1O95C 2AYZA 2FQQA 4FKZA 5KYUA 3W1EA 1BW9B 3WK6A 1T6XA 1E2LA 2X15A 3ZY5A 3WJ2A 1B1CA 3CLSD 1NYLA 5BYBA 5FXMA 1GYPA 2P6RA 3AILA 2WJJA 3RHSA 3OMWA 1SOWA 4C2TA 5DLQC 1YQ9A 3A1FA 4DKXA 1ZICA 2P2ZA 2N1BA 3JQ9A 4LHWA 3ANSA 3LFUA 5B7QA 5C8XA 3EX7C 1WUHS 4W5NA 3L04A 2BBOA 3H84A 5IZCC 1J8YF 1WMEA 2Q3BA 1K2WA 3FOCA 3ZK7A 2XTNA 3ILSA 2MSDB 3DOEA 4RHFA 3T1YB 4XM2A 5J5AA 3G9ZA 3H9CA 5BSRA 3WGLA 1YCFA 2PWPA 4B3RB 2AOUB 2IYQA 1LWOA 3OBBA 1RPAA 1YMQA 4DLXA 1M2FA 1VPTA 2H2DA 1T24A 2Y0EA 4JJ4A 4K8OA 1E3SA 4Q34A 1FSFA 2I80A 1IWOA 4TN1A 1G55A 1K6XA 1LPBB 2D7JA 1I7PA 1PZFA 3C3WA 5F2EA 4RF3A 3N5CA 4TWIA 3BAZA 3L0IB 3L93A 1BWPA 2HJWA 2ZATA 2AEMA 4IFEA 3MUEA 4BQSA 2QRJA 3NBYC 3IODA 2WHEA 3K16A 4OEHA 1PW7A 1H2AS 4JYBA 4PLFA 4E08A 3C4QA 3CUTA 5CCDA 2IS1A 2E3JA 2NO0A 3ZU4A 4HHEA 1H05A 4YYZA 4LMPA 1FYEA 3CO0S 3VAAA 2J6IA 1T3SA 1VZ2A 4HAZA 1G8YA 1PFGA 4OAQA 3PFBA 1KC1A 4YJGA 1ACJA 3ICVA 3L1IA 3QLTA 1HE4A 1COWA 3OA0A 5DKFA 3QTTA 3LX4A 2SKDA 3HXKA 2AG8A 4GFDA 4YRGA 1E2JA 3MCAA 1J0DA 4MQ5A 3GI1A 3H83A 1Z8HA 1BRTA 1OXUA 3A4YA 5D84A 3W9BA 4N9WA 4TLEA 1Q6ZA 2H7XA 3U1VA 4YMWA 3WO0A 3BWXA 1SD1A 2QZSA 5AJTA 2EBFX 1YIOA 3BSYA 4LYDA 5FA8A 1BVHA 3LP6A 3DQPA 4IKPA 4BB9A 5BVHB 1SWVA 3ZCTA 1QUEA 4RJTA 3U60B 1IFXA 4M3NA 1VFPA 2IFTA 1ZOIA 3D2AA 2WI8A 3TRKA 1TQDA 1FUUA 1P1RA 3TIGA 1G2IA 4A91A 4WE3A 3M89A 1Z0FA 4RSHA 4EW1A 4NENB 2F55A 1IH8A 4WOBA 3Q40A 1RWWA 5FNZA 4LG1A 1TKAA 1WKVA 1X1CA 5EMJA 3EASA 4URFA 4BNIA 3P0RA 4R0MA 5C7YA 4F21A 1QHXA 3HO1A 3NASA 1KEWA 2AHRA 1JWLA 3EY4A 1GLNA 3K5WA 4FSDA 3UJNA 1YONA 1YZQA 5HQJA 6ABPA 2ETVA 4DBZA 2JGNA 1UF9A 3GGJA 4PRYA 2LD4A 2VPIA 5AMXA 3NEPX 5JQGF 2WJHA 4JLAA 1SUBA 3D4IA 1LTKA 2JKVA 1O89A 3BXXA 3C3PA 3IUJA 5KTOA 4MQFB 3VAZA 1ECLA 1TM7E 2ZRMA 4F5EA 1WHSA 2J31A 4LF6B 1YJXA 1O0BA 3K73O 1WSWA 1VA4A 3W6UA 3HPRA 2AOVA 1U7PA 1JH8A 5KVCA 1YDEA 1OH8A 1DC5A 2WAMA 2J46A 4DVJA 2O5CA 2RK3A 1WCIA 5DPMA 1GKYA 2VO1A 4HDAA 3M4XA 3FGPA 3ZXUB 4OHZA 3DB2A 4ZI3A 2WFAA 1N3YA 5EY5B 4HDCA 1YBHA 1JEJA 2DBRA 4FC6A 1TMYA 1VC2A 1X7ZB 1XAIA 3LP8A 1T36B 5DVZA 5HMLA 3RAPR 4M6WA 1CUUA 4OX9B 3DBOB 5REQB 2OXRA 2J0VA 4EKDA 2I6GA 2VYCA 3CNQS 4X00A 1QE5A 4MMXB 3HXLA 4UUNA 1USIA 1UPTA 1EK1A 3O1IC 4HGYA 2A4MA 4LWPA 2NW6A 3FPKA 3KUCA 4H7IA 5FQOA 1ZH0A 1LJUA 4DEYA 1NJ1A 4F85A 3F9IA 1ZAYA 4ETWA 5I4CA 1Y98A 3GRPA 4QBIA 4ZXFA 3BXGA 2ZYDA 4KWIA 2JFOA 1GUFA 4TQUS 5KQGA 3GA5A 1EP1B 1D6MA 4RCYA 4LI3X 3BE8A 1YZGA 2ZYGA 4G6ZA 3SVLA 1NBMD 3PNPA 1LA2A 1OA0A 4Q4CA 3GCDA 3BMQB 1W46A 1PW5A 5AJWA 4C4AA 5HZHA 3T5AA 5A6VA 1FDTA 3E1KA 2AF3C 3TSAA 2IHNA 4D9FA 1LS1A 2ZTUA 4LOLA 4E22A 4DV2B 3UJ3X 3SS8A 3ZKWA 1UDXA 4FGZA 1G4HA 3DQQA 3DE1X 4GH5A 4QOHA 5JFOA 5JQGA 1F2TB 3W5JA 1UBUS 3FKJA 2RGNC 3FYHA 4RZIA 1HDYA 1V3TA 3FZYA 3UNXA 3I8SA 1L0BA 4R1SA 2XHZA 7MHTA 3MCTA 4MA4A 3AB7A 4EW6A 1W0KD 1L7VC 3D6AA 3TJZA 3ODGA 4EUFA 3Q8MA 1E5QA 1T6NA 3KKZA 3EPRA 1UBCA 3M6AA 1IK4A 1DC3A 1KJ9A 1XRLA 2HDNB 4OREX 5ADWA 1AHHA 3CF2A 2GEKA 3BSWA 2PX0A 5TIIA 4IEFB 2WIDA 2FFBA 1F8UA 1VTKA 4CLOA 4HPXB 1NI5A 4OHPA 4V38A 2D2FA 4P0TA 3TW8A 3PUHA 3WYDA 3U1TA 2QE7A 4EUEA 4F5DA 4LOKA 1W2HA 1CSEE 2GEBA 1CUIA 1UFRA 2JLQA 2BI4A 3CT6A 1U3CA 5KKAA 3HUDA 3DLIA 3RCBA 3RNLA 5KWIA 3KKQA 5J40A 2Z2ZA 3U44A 2P9BA 3U3ZA 1OZ0A 3SK0A 2E49A 1QOZA 3IBGA 4MUFA 4Z3DA 3I0ZA 4MV6A 1CU1A 4PO8A 4UUPA 3C6MA 3DDHA 3FOBA 3G49A 4KAFA 4MDYA 1JAXA 4MV8A 4RJJA 1U1EA 2IXDA 4Y9DA 2W6CX 4KE8A 3WK4A 4F1JA 1CE8A 4CFSA 3HKEA 4I2VA 4IVRA 2E5FA 4M0FA 5AHRA 1XELA 3MWDA 5I9IA 1UBHS 1XB2A 4TLLB 4IGIA 4XLZA 1J2TA 1YS6A 2CYAA 4WFQA 4YUWA 1Z63A 1DAKA 2CKDA 5DT9A 2OUIA 3E5HA 4LAFA 1JL3A 1GSHA 1NBAA 1UKZA 3CXUA 2W6MA 4FN4A 3WFJA 4TYMA 4DT1A 1K27A 2DG2A 3UXMA 5B5SA 3U26A 3UJ9A 1SGWA 4GUAA 2MTBA 3ZV7A 3CZPA 4B8WA 3FCYA 4E13A 1CRLA 3UO8B 3W5AA 3BTVA 3L1VA 2RARA 3X1YA 4MLPA 1DAMA 1OXMA 2PL1A 1BNCA 7MDHA 2JCSA 5D86A 1SUDA 3NI2A 1R4NA 2AZMA 1EM8A 1PWYE 2CLEB 2GPTA 2NTNA 4FMBB 4I6EA 3HDHA 2IWHA 3WI7A 2Z6VA 3S1LA 1Z39A 1FRFS 2G5GX 3EDRA 4XUCA 1VGVA 1NGSA 4OFZA 1BE1A 1FMLA 1R3DA 1IUNA 2Z08A 3LI2A 1ZW6A 4CTJA 1TC1A 4BQEA 1AZLA 5BV8A 4ARSA 2IJGX 1VHTA 4AO7A 4KHPB 1T4DA 4KAJA 1HRDA 4G1FA 1IBCA 3GFTA 1F2UB 4L3OA 3KBBA 2QD1A 4WBNF 5AJVB 2IYWA 5E7IA 2EATA 3DO6A 1Z7WA 1CVIA 1W88A 3FCOA 1UPFA 4IF6A 3JQ7A 5CNJA 5DMHA 3RSFA 5E7MA 4IR7A 3SKYA 3UWKA 2E82A 1CNMA 2ZREA 4N39A 1QQAA 4CM3A 4JC0A 1KFEB 1PLJA 1R4ZA 4XJSA 3BL6A 1OAKA 2X58A 2F3PA 1EDEA 2Z58A 3KYDB 5CX4A 4ZYYA 1DOZA 3EXIA 3NFYA 5A2QA 3BZUA 1MG5A 4Z53A 4AG6A 2ODPA 1IVYA 4FWBA 1N92A 4GYJA 1JPUA 1N0VC 3AEKB 3CX4A 3EXEB 1NMYA 4JP2A 5TX7A 2B8JA 3SCZA 1EQUA 1R5BA 2GAJA 3DHNA 2PX4A 3I9NA 1AO0A 3KQKA 5FOUA 3LS2A 5CCEA 2VHCA 4KH0A 5AW1A 3PK0A 2XA2A 1WEKA 2VQEB 1E2BA 4RD0A 1P9OA 3FZQA 2I3AA 3EIXA 3I12A 4LJ4A 1DPGA 2HHAA 1JG3A 3CRQA 4F7WA 4W9MC 4YMUA 5FPQA 1E7SA 1BN7A 1F60A 1WE2A 3ENWA 4IIBA 4QELA 1PJZA 2O1WA 4Z4FA 5BWMA 3HSSA 4GKBA 1WETA 4JI6B 1TTQB 1ISFA 1UMKA 1ACMA 1I5RA 1EB8A 3FGZA 2ZSDA 2PBRA 2V6JA 5GJVC 3RS9A 3FYTA 2A9OA 3H17A 3Q85A 1DU4A 3ZGXA 4WACA 3UAGA 4DUZB 4URVR 1DKPA 1XALA 2EDAA 4O3FA 4OXKA 3B5JA 3FVTA 1G9SA 3WMGA 4GSYA 2MYNA 3GLQA 4INJA 5JLAA 3TNJA 2QAIA 1DAHA 2Y8EA 1QAMA 4K9DA 3KQQA 2BEVB 3GR6A 2I7DA 4IJ5A 5CB0A 1GAQA 3PS9A 5JISA 2JD0A 2HIGA 3VVMA 4WBNA 2PMBA 4IQFA 5EEHA 5EWMB 4F9TA 3I9KA 3FX2A 5H4HA 3DW1X 1VE6A 4LZWA 2EZ8A 5HBGA 1XHEA 1L4EA 1AGNA 1NNUA 2PBZA 2W6OA 3PE3A 2C57A 3V4LA 1UXGA 1Z82A 5EPEA 4A8JA 1I1NA 1L5HA 3B9PA 4RIFA 5FULA 5LOVA 2X40A 3BE6A 3I34X 4CTNA 4A0GA 5H02A 3VZDA 3ND7A 1H85A 4C5BA 2Q6LA 1XVVA 3OE1A 2HU7A 2VYVA 3UVEA 2H5JA 2WPDD 3K8ZA 2Y9PB 3ZNNA 1JEEA 1SOAA 2QL7A 2NUPA 3HY6A 1JR3E 3VNUA 2ZSUA 4EQ6A 1P9WA 4Q1CA 2WY2D 5J47A 1RYMA 4MS3A 4RIGA 1MEOA 3KXLA 2GLTA 2I4TA 5TC4A 1F4LA 3ZD8A 2HBQA 2REBA 2WZBA 3B3QA 3NEAA 1Y5LA 2W0MA 3DEHA 4BLTA 4OHYA 4QUKA 3RG2A 3QUTA 4DLNA 2YN4A 3C97A 2VP5A 4AN4A 4R8KA 4L51A 1L5RA 3HU3A 1OLXB 1I4OA 2GJSA 2O2SA 2J3MA 3FMOB 3M5CA 4KDCA 4RK0A 5AHOA 3L7NA 2QVLA 4PFSA 3WMXA 2WM9B 1IE3A 3BXFA 3PA8A 1B7GO 4FNGA 3UV6A 1E9AA 5E6SA 2D13A 4PC1A 4EHHA 4ZI5A 4J16C 2F9MA 3ADDA 5L3ZA 1RI3A 1LBQA 3UT5A 3IXLA 2OV3A 3KNZA 1EUCB 2HWKA 3Q3HA 2VQ6A 4PZPA 1AK1A 1RAGA 4UUMA 3CINA 1A5TA 3D1JA 3EWSA 5DGHA 4AFNA 2BE7A 7REQA 4D3XA 3TFOA 3ZWXA 1EFLA 3LGSA 3F96A 3RS7A 2YIJA 4O0LA 1UBGA 4PU0A 3RFVA 1IHUA 4YWJA 4D5EA 3GJSA 2QD3A 3DF7A 3PX3A 4HQ0A 4UATA 1SQSA 2X6TA 4MUNA 2XNCA 2D7DA 2ZVJA 1Z7BA 5A71A 3KQNA 3RYTC 1XBTA 2ENUA 1KNQA 3I1YA 4TMFA 5JMPA 1PU2A 1XU9A 1ZESA 2VUIB 3TDNA 4C9BA 4CDNA 4PHFA 4HNSA 4AO8A 4CUZA 2GUWA 2VXCA 1E3MA 1SCUB 3LO8A 5KU7A 3VGPA 5K45A 4HEA1 1J5EB 1XFDA 3AR4A 3JQCA 4K6CA 4DLPA 1JR6A 1KH1A 3H3XA 3VR4H 1D03A 1SY7A 1SPXA 2FEMA 3SHFA 5ER9A 5FO1A 4ALJA 2ZRLA 2VPYA 1WLSA 2DTXA 1KETA 3AM5A 4PLHA 4UNPA 1P73A 5E6UA 1NF8A 1OV6A 2O1SA 2XMSA 3OSUA 4F8EA 3H1BA 1NYRA 4RGYA 5FJIA 3RUAA 3A6ZA 4P08A 3M5PA 1XD2A 1JH9A 3LO5A 3BMXA 4OCZA 1KPHA 1EM6A 1IM8A 4KRYA 1ZP6A 3EDMA 3MSCA 4PAQA 4MGHA 5TGDA 2X19A 3DE2X 3JWJA 1GUZA 3OIDA 4LCEA 4EG1A 1ADFA 2PGAA 1UZUA 3D64A 4UBMA 4FOLA 9ATCA 1HE8B 1S8NA 3LT2A 1KRWA 1FQOA 4FYIA 2A84A 1CZNA 4ZJPA 1THGA 1YB4A 1ETHA 2ERYA 4OXYA 3BOSA 3JYLA 1AQNA 5F7XA 4DNQA 2FMTA 4C7BA 2UVQA 1UXKA 4YT8A 1D04A 1IRIA 5CP8A 3O8BA 1A8IA 4CR6A 3CVVA 4LOAA 4P34A 3FF4A 4TKMA 4BVJA 3UMBA 2ZJZA 5IBCA 2FKAA 5LLDA 4DV0B 1OZGA 3K32A 3PGLA 3GPBA 4X8MA 4FPXA 2AEFA 3STVA 1ZJJA 2PUFA 1W0JD 4R7ZA 3N2GA 5B37A 2MIIA 2P2GA 4ANFA 3QEMA 5BWLA 2WTNA 5KEIA 2QT1A 4BRUA 4ZCTA 3EEYA 2KX7A 1Z6AA 2ONCA 1WBBA 1CEEA 1R0LA 1II0A 2JPDA 3M5DA 3V8QA 4AY6A 1VIMA 2OHJA 1JI3A 3QVUA 1YD7A 1MV5A 2PDAA 1Q16A 4Q37A 5TMEA 1MO5A 4D8UA 2RHBA 5C32A 1DMRA 3PE4A 1FFGA 4S12A 1RQGA 2Y71A 4G4SO 4AYXA 1OSNA 4NG5A 3EG9A 3HQ4O 1M6VB 2Z9DA 2OQIA 4NJEA 4DSOA 4W4TA 3QWFA 4KMSA 2WMNB 3BFVA 5TVGA 4BO6A 1X70A 4GYWA 1VRVA 1QF9A 3B6EA 3IC5A 4EA8A 4LIPD 4JXKA 4G0PA 4B46A 1M2GA 4I4IA 5DI3A 1L6RA 5AVWA 1TU0A 1M0EA 3OSZA 1DCTA 5CURA 2GRAA 1NUUA 1P7CA 4N6OA 5F33A 2FHPA 4RQBA 5J9FA 3P9IA 4ZT4A 3SI7A 4DJTA 5JI2E 3D5TA 3A32A 3OUZA 4GZMA 4KGDA 5JSKA 4CPDA 1P9LA 4DM3A 1XTJA 3OFVA 3OOYA 4AK9A 1KRXA 2IOFK 2NXNA 1G16A 4UW9A 1KI6A 4LKRA 2EBHX 3PX7A 1ZWKA 3JZFA 1L7RA 1UJMA 1CCWA 4JROA 5G4KB 5AW9A 3VKGA 2FA9A 3DAFA 1SCDA 3E53A 3RS2A 4J0GA 4A8HA 4HDSB 1YAJA 4YFYA 5GOZA 1EEHA 1I7NA 1FRVA 1ZIXA 2J67A 3ZBQA 1BWRA 5LC1A 5GPBA 1MAVA 3E5MA 3HY3A 4EG6A 3EISA 1NMQA 1D7OA 1JW9B 1L5SA 1X15A 1UKVY 1ZN8A 2FOLA 3HCRA 4Q16A 2IBTA 5M2QA 1C1HA 2FWPA 1OT5A 3PI6A 4C7OB 2EJUA 2X0DA 2BF4A 1D4OA 1KZ7B 2FOIA 2G1KA 4ZOLB 5DSXA 5KVQA 2MMCA 3JD1A 1NBMA 1ODKA 5B6IA 4B3GA 1GNTA 3V4PB 4L07A 5DYYA 5ALSA 4ZIRA 3UBMA 4P7BA 1ECPA 3G2NA 3EC7A 3VU1A 2Z8XA 3KOWA 1N5OX 4HMOA 1JU4A 4I1VA 2DCUA 4UE3S 4XOUA 4PQGA 4MJ7A 4GWKA 1CDDA 3GC6A 3TEFA 3DLBA 3GD7A 4TSFD 2EKLA 4QO8A 3CZCA 1JA0A 4H6VA 3L1KA 4J0KA 1NR7A 1L4LA 4QUHA 1SC4A 1U8UA 3I58A 3IIMA 3KKPA 2VDRB 3R20A 3TQSA 4GI5A 3WKBA 3FPHA 3S70A 1BXGB 4KPFC 2JAOA 1W0KA 1XZ8A 3NEYA 2OXEA 3OOJA 2GYVA 4OH7A 4XPZA 4EB8A 1D0IA 3WHLA 1LVGA 5IDVA 2HV9A 2I99A 2TMKA 5AP9A 4YRJA 5A9RA 2ZUFA 3A4VA 4XWYA 2V0CA 5LDGA 2Z04A 4OLJA 2IZ7A 2W2OA 2R2GA 4KFCA 2DB3A 3DL7A 1T3TA 3NT2A 2P2SA 4UD6A 1I7SB 1M8JA 2R87A 4BCBA 4UM5A 4V0OA 2NZJA 1XRMA 2JKYA 2R4UA 4H7PA 4RLHA 2J6BA 2HYIC 1D4AA 1F9AA 3AIIA 3QEKA 5JCJD 5I4IA 1LNZA 3T35A 4CV1A 2R1TA 5KYWB 2GPNA 1MX1A 4K6HA 2Y1EA 3MN1A 1N1MA 1A2BA 1IG3A 3HRHA 3N6XA 2HMSA 3OQHA 2IV3A 1Y3IA 2JIBA 4JEHA 1A2KC 3PWKA 1CIJA 1TC2A 2YXPX 3DO5A 4RXTA 4V0SA 1PEDA 1F4PA 1HXHA 5ECDA 4BX8A 2JH9A 2VJLA 4E2XA 4DV6B 1U5AA 1Z7EA 4ZQGA 2HHJA 3JQ8A 1RXUA 1V26A 5I7VA 5ITZA 3EZLA 4TVOA 2H11A 2JK1A 3KJXA 1R0XA 4X5OA 2JNWA 1XJ0A 2JGAA 3RVKA 3PHJA 1S02A 3PL5A 3OJLA 2NU9A 3RVBA 4JGBA 2MWMA 5BSFA 1D2CA 2WT4A 3TQOA 4M0UA 3G82C 1YDWA 3OEED 3UIEA 4C4ZA 5EWLA 5IUKC 2DRIA 1Z28A 2DHDA 1J8FA 2J30A 3FR7A 4GP9A 2OQVA 4BEWA 2VIIA 1PR3A 2BFNA 3LNTA 4PRLA 4F12A 3ENKA 1VCNA 2J33A 4MR9A 1PYOA 3Q7TA 1UZMA 2JKZA 2D1QA 3E22A 4KQGA 5CIWA 2BR4A 2HRQA 4H1VA 4ZVUA 1VECA 2UYYA 5BVGA 4Y2QA 3ZDQA 2HU8A 3M1AA 5KYNA 3N7AA 5IAGA 3AKZA 1HFKA 1H6BA 1YVRA 3OJFA 1CRPA 4KR9A 5CHYA 2OR3A 4CG2A 2ZJFA 3TBKA 5HQTA 4GMFA 2UYCA 3VDXA 4BXOA 4G26A 3MAAC 2DPHA 3K2EA 4JP1A 2IYXA 3LUHA 3AFMA 4X7BA 3BQMB 4E2WA 4TYNA 3VSAA 1TM2A 3ZNOA 1CD5A 3A2KA 1DBVO 3BYZA 3PDIA 3VBCA 4DDMA 1OBHA 1R4AA 1QKIA 1TO6A 2PAAA 4WKCA 5GGXA 5H9VA 4DV5B 1GTL1 2DT8A 5IULC 2P3LA 2WJIA 1LW7A 1IZ0A 4M1KA 5LDHA 1RXCA 4MVJI 1VLLA 3JRNA 2AI1A 4K8RB 1VKNA 1L7DA 5JD4A 3ZZMA 1A04A 3PA6A 3RWOA 4ZZ0A 4QKQA 2GA9A 2VWQA 3QP9A 4O2BB 4EG7A 1F48A 4BFCA 1MDBA 3IDFA 4BQPA 5HKOA 2OGSA 1DTEA 4RDHA 1LLCA 1A95A 1SKBA 1A76A 1ZK0A 2P8JA 1O2DA 4ADSG 1RJ9A 1EXNA 5NLLA 4Q6WA 2PGLA 4DRXA 1L9KA 3QGMA 1AMUA 3IRVA 4B3TB 1WPRA 4PANA 1DC8A 4HN4B 4ITUA 1VI5A 3C74A 4KDEA 4P4SB 4RANA 1Q0QA 5BV0A 3JYHA 3QF7A 5F4ZA 4M21A 3GRFA 2F2TA 2QUAA 1P1KA 4I4TB 3PKJA 3AR7A 5K6RA 1CIVA 1LF5A 3KHUA 4WMLA 2IOQA 1C14A 2VPTA 3ZYCA 5LYJF 2PL3A 4EAAA 1Z5GA 4DIDA 1J2YA 3D4PA 4KSYA 5AVOA 4TWAA 2O2HA 3BWYA 3R09A 3J7AC 3ZWQA 1M1UA 4JJ6A 5ERXA 3TIFA 2NACA 3BS4A 5AJHA 4EECA 4C05A 1G8HA 1H2EA 3CBQA 2VP0A 4HNAB 3ZZTA 3F6SA 4GNKA 1X92A 2I3DA 2AN1A 3C16C 2XTAA 2NUBA 4DBLC 4M1QA 1ECGA 2QMYA 3GAMA 2EJVA 3FNGA 1VIYA 2OHVA 4C3OB 4C6TA 1XF1A 1CR6A 1RHJA 2PVCA 3IIEA 2O8BA 4FFDA 1K8YB 1QOQB 3ME5A 4ZT6A 1M2OB 1ISRA 3RU9A 3ZX4A 1RBMA 2ZS8A 4B5KA 4IOKA 3V4ZA 3WZMA 3GPCA 3Q0IA 1CDEA 2IZ0A 2I6XA 2ZWOA 3CVOA 4P9NA 5FNVB 1D2MA 1FDVA 4IS3A 5YASA 3ESXA 2AN3A 1G6KA 2AFRA 3MJFA 4BHTA 1E6MA 1NU6A 4YT2A 4B3BA 1CP3A 4YAUA 5F52A 1RIFA 4DQLA 2IE8A 3P96A 3ZHSA 3HH8A 2OM6A 4X84A 1P0CA 2JLWA 2VBGA 2WPDA 4NJOA 3W78A 1EXMA 3IAS6 2PZMA 3NIFB 3RKUA 4S3MA 3T5BA 3TZEA 1U1IA 3H3JA 4HWKA 4RXMA 4W1SA 1F0PA 5FL7D 2VF5X 4EG0A 5A3RA 1YU9A 1VE5A 4QPDA 5KNCH 4EYQA 3C8MA 2KE5A 1R9JA 4WADA 4MVYA 3ACDA 3HBAA 4DCTA 1EH5A 1YVUA 1ZUNB 3BWCA 4I55B 1HLDA 3LFHA 4B76A 3G79A 4FR2A 2YJGA 4UCXA 4NU0A 1JDTA 2H51A 2CL5A 1SUCA 2Z2KA 1NN1A 4O4HB 3T4EA 3SYKA 1WUIS 4CQJA 5I7SA 2PGXA 2WD7A 1Y7IA 5BN4B 4G63A 2XYRA 5IVDA 3SMVA 4ZALA 2FQXA 3BWEA 3LXMA 4ZQIA 2J0QA 1BDBA 4D0LB 1EK2A 4HB2A 4N65A 1PCXA 4H9GA 3DAPA 2ZRCA 4JLBA 4M0KA 3BD8A 4KX5A 4WVLA 1ZBDA 4B84A 5KHLB 4PWYA 2GA8A 5EE5B 3V1MA 2IYOA 3TJMA 5JNUA 3WXMA 2J3IA 2XE7A 1CQPA 1YNOA 2C5EA 5ANRB 3TTWA 2R0QC 1XTRA 5AI0A 2FPGB 1YDMA 3ZQKA 4BRSA 1PS9A 3IIKA 1I2ZA 5ALWA