4MGIR

Selective activation of epac1 and epac2
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
162
structure length
150
Chain Sequence
b'EYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVQCMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLAFLESSAKSKINVNEIFYDLVRQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Rap guanine nucleotide exchange factor 4
publication title Selective activation of Epac1 and Epac2
rcsb
source organism Mus musculus
molecule tags Signaling protein/gtp-binding protein
total genus 40
structure length 150
sequence length 162
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
R PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4mgiR00
1L7VC 2J7KA 3THWB 5JEEA 1E99A 1KNXA 2FPMA 2BMFA 4F92B 4BPBA 5FTJA 5EP2A 3X1ZA 2YHSA 1EK0A 1YKSA 4IXNA 4D4KA 1MT0A 2NMVA 2QTHA 3QE0A 4G5RA 2XJ9A 2C95A 2R65A 4GPTA 1U90A 2VPPA 4EJSC 6Q21A 1SKQA 2D74A 3PR1A 4G5QA 2CCKA 3GEHA 4A4DA 1G8FA 1SXJB 3BJIC 1ZM7A 1KI6B 1E2PA 1N5IA 1YE8A 3R8FA 3BERA 1EFUA 4TMTA 2GKSA 4NH0A 4Q02A 4F4IA 3AP3A 4US0R 1VPLA 4BZQA 1T3SA 3H86A 3B1ZA 4I1OA 1X6VA 3QKSA 1E69A 2CLCX 4ZDWA 2CHVA 4GDFA 4R2HA 3DO6A 5FUYA 1GKUB 2FMXA 2XTZA 4BECA 2OLJA 1D5CA 4HUQA 4LWZA 1UDXA 4KFSA 1NN0A 4QKQA 2A9KA 4TQAA 1ZD9A 2PX3A 2XTNA 3AP1A 4RKFA 4Q4JA 5AWFC 1O87A 5G41A 4QBFA 4LOAA 1RVDA 3IIKA 3QF4A 2PLFA 2CHQA 1Z29A 2PLRA 1KHTA 3I4LA 2Z83A 2O5VA 1GDDA 3WP1B 1DO2A 1GZSA 1YRBA 4P3YA 4M1KA 1SVWA 1HH4A 2GEVA 3IBYA 4MYHA 4HAZA 1JI0A 3L0PA 3OE7D 4YDSA 4B3BA 3T35A 1SXJD 2JJ1D 2ZITA 5DGXA 3JVVA 4M8NE 1GL6A 4JVSB 2YOGA 1G7TA 4IEEA 2ZSFA 4N1AA 2R9VA 1CR4A 5TMPA 2X2EA 3A1SA 2ORVA 4JLJA 1AK2A 4LC1A 2ZRNA 5L3QA 1TF2A 1M7BA 2Q3HA 3SN6A 4Y0VA 2IEZA 5AJXA 1QDEA 3IO5A 3PEVA 1U9IC 2R6GA 2WIAA 1W4BA 2YC2C 1EWQA 4PPNA 2AXPA 1XZPA 2A7QA 5F9HA 4B3DA 3VU9A 1XDBA 5EUQB 2ZU0C 4OI2A 3ZD6A 1IN7A 1IY1A 1II0A 3OFND 1Z0KA 2O8BA 2GBLC 4F93B 4JBXA 2ODBA 5JSZA 2ZRHA 1UF9A 3D3QA 2E9SA 2QM8A 4DCSA 3SBEA 2GJKA 2ZE5A 4HYYA 5C1BA 1NMZA 4LHVA 4V03A 2XAUA 2ZSAA 2V4ZA 2IW3A 2DYKA 4M1OA 1G20E 5E3HA 2QEQA 1A5TA 5GJVC 1BMFD 5FPSA 2JJ2D 1U8ZA 1CU1A 3GJXC 2EWVA 5HPYB 4BZPA 1IN5A 1SULA 4X8LA 4QOSA 2GAAA 3QKUA 4TL7A 4HLQB 2ZRFA 5JWHA 4A6XA 1NVVR 1W5TA 3BIFA 1M74A 3QXXA 1LTQA 4MDEA 1EG7A 2YOFA 2ZSBA 4PHHA 3G82C 1QHXA 3BB3A 3C8UA 4AWXA 2O8FB 4NDZA 1R8QA 4Z8XA 4B35A 2XITA 4Q00A 1HYQA 3RS2A 2IBMA 2ZJAA 1WB9A 1LS6A 5IHPA 3LLUA 2IXFA 4NONA 1G9XA 3A4LA 3QI2A 2YYZA 5H70A 4IKEA 4KO8A 4OK3A 2ZRPA 3U44A 3QPWA 4URUR 1Q22A 2FU5C 5FI0B 3AF4A 4TMVA 2C98A 1T9HA 1QHHB 2CE2X 1E4VA 1NVWQ 5FL3A 3TSWA 3X1DA 5FOXA 4YXWD 1J99A 2J7PA 3Q85A 4HB4A 2IS4A 1TL7C 1TQ4A 3HDTA 2XNDA 2EFHB 2ZE8A 4W7SA 1KK0A 2AD1A 5JHHB 5FFMA 4V0ME 3MWLA 1K5DA 2VH5R 3RLFA 3TQFA 2B8WA 2HLDD 3DVLA 5C4MA 2P6UA 2IS2A 4LBZA 2OUKA 4KI0A 4LJYA 4YONB 4RD4A 3TR5A 3C5CA 2ZR7A 5JFGA 1ZC3A 4HLDA 1W46A 5FBQB 1S9HA 1CP2A 5IRCD 2QRNA 2IYWA 4HLUA 3UKDA 3QBTA 1KJZA 2ZJ5A 2PH1A 2OAP1 1Q0UA 4JVMA 3IGFA 2IUSA 4U00A 1RC8A 2JATA 2WMNB 4LHZA 5KNCA 4HDCA 2BJWA 3M0EA 3R8CA 4D2IA 3RYTC 2WJHA 3OESA 2C8VA 2C9OA 1IXZA 1D9ZA 1N6LA 2QMUA 3U4QA 4ZDIA 1GIAA 5HZKA 3MWKA 4N0EA 5C2JB 2C9YA 1D2MA 1DOAA 3A8TA 4MA4A 2WV9A 2RH5A 1WF3A 3VNUA 2J0UB 2UVQA 5CDFA 1BYIA 2QM7A 2ZRLA 1L4YA 3AEZA 4ZV4A 1FZQA 2R6CA 2BMJA 1MABB 3LX8A 4IJMA 4Y0AA 4Q7LA 3RSOA 3RWOA 4O2RA 4CEIB 1Z6AA 4KYIB 1KDPA 4EFMA 2FA9A 2ODWA 2VHUA 3FGNA 2H18A 2ZYVX 4IOJA 2GJ9A 1P4SA 4WVFA 4XTCS 4BFZA 2I1QA 2AWOA 3DMDA 4FWIB 2IYSA 4B48A 1OHHD 3W5IA 2KBFA 4GP7A 1N6IA 4ESVA 3WYFA 4O3MA 1XXHE 3TBKA 1DO0A 1ANKA 3AV0B 3OIWA 2VP6A 3T5GA 1NLYA 5J4VA 3SYNA 1FUUA 4K8OA 4M1TA 1DELA 5HKKD 4MRPA 4P31A 1SVMA 4YMSA 4NCJA 4FCTA 4R71A 1J8YF 5FTMA 2BM0A 4PC1A 3U6BA 1F5NA 2FPLA 2B6HA 1W36D 5D3QA 2VRWA 2ZVQX 3BFXA 5BN5A 1KNQA 5AK0A 4JYCA 2D62A 3NDBB 4EJSB 2QROA 3GLIE 2IEYA 1FQKA 2VHTA 3P26A 1E2DA 4CVNA 4J0QA 3SE0A 1E6CA 3VR2A 3GCGA 3LX5A 5DISB 5JI3E 1F48A 5BXQC 4FMCB 2CVFA 1A4RA 3OAAD 4PAQA 4FMCF 1NY5A 1CXZA 1RKBA 4MKHA 5SZJA 1DAIA 1H8HD 1HE8B 3JVUA 1TU4A 2QY9A 1YU9A 1CIPA 3OEEA 2AX4A 3UWKA 5JBQA 4XVRA 3K9NA 3I3SR 4MRVA 3PENA 1F60A 5P21A 4POAA 1KTVA 2HEIA 4QFMA 3THYB 1EX7A 3R7WA 5C18A 1XJ0A 1P2UA 4RD6A 4TTQA 1E2GA 1TX4B 4PHGA 3AB3A 3T61A 4B47A 4AURA 1EFRD 2IF0A 1M7HA 5LDDC 4RZXA 1FP6A 2ERYA 2W2VA 1GM5A 1YZNA 2HXSA 4FCWA 2F9LA 5KUTA 4FINA 2ZUDA 1XXHB 2ZEJA 4BE7B 2ZXUA 2NO6A 1LV7A 2Y8EA 2YVUA 5M04A 2QMOA 3RANA 1ZM9A 2Q9CA 4KCGA 4B73A 2RGBA 3B13B 1US8A 2OSBA 1DVRA 5IF9A 5LD2B 1MOZA 4L4UA 4LJ6A 4BLRA 3LBHA 3JZMA 1E2LA 2BVNA 1E2NA 4OQXA 4OYHA 4K46A 2QE7D 3KKQA 5DIFA 4EQ6A 3LQRA 3GLIB 2F3RA 2RGDA 1GUAA 4KITB 1VHLA 2E1RA 2A78A 3WBKA 2FSFA 4XD7D 2PL3A 2WHXA 1FW6A 5JJKA 1QG4A 1QHNA 3TH5A 5JEDA 1JAIA 1ONBA 3EZ6A 1GTVA 1KKLA 1G19A 1Z6GA 3GD7A 3SBDA 1U8YA 1RW4A 4NHOA 4Q1CA 4C3ZA 4LJAA 3AGQA 1Q1QA 1R10A 1S9DA 1P9NA 3SDZA 3OE7A 3OIUA 2G9NA 2H92A 1OFUX 1EX6A 3TK1A 3SQXA 5KPJA 1UPTA 3CWZA 4JLBA 1W44A 2VYFA 4JYBA 3UATA 5GVSA 2WTUA 1TNDA 1YQTA 2IYVA 4Q47A 4TSFD 1RIFA 3QG1A 1F2UB 1MO5A 4II7A 5FR1A 3ZZ0A 4TMKA 4NCNA 4DLXA 5JECA 3KXLA 3EPKA 3EXAA 3FB4A 4Q18A 4QXAA 4DT1A 1NL3A 4IDPA 3QJYA 5TARA 1E9AA 1Z07A 5JZVA 2J0SA 3BXZA 2QAGB 5FPHA 4YMUA 1P9RA 5J4YA 3CF2A 4URZR 3NC0C 1E2FA 2QQEA 2BMDA 2Z6VA 3WRXC 3ZVNA 3AVQA 4M22A 1QVAA 4BLQA 3PUZA 4K81B 3ZZTA 3D8BA 3LAWA 1KMQA 3WXMA 4JSTA 1UBFA 1U0HC 1WE2A 3VHXA 4M2LA 4TZ6A 4A0RA 1RZ3A 4ZKDA 1AS2A 4DLWA 5TDHA 4BFYA 1SXJC 3CPJB 4ZIRB 3QXCA 1AJEA 3EC2A 3CUEF 4B2IA 2C03A 2EU8A 3B1VA 2W2XA 4PSKA 4V0NA 3FFAA 3LQQA 4MUBA 3FDIA 1XNJA 1DAEA 1X8KA 2ZRKA 1BMFA 4RFVA 1D9XA 1ZM3A 2HCBA 3LXRA 4O0MA 1M7GA 3MG9A 4M1MA 4TLAA 3A1WA 3IHLA 2AXNA 3H1TA 1DPFA 3T1OA 1R0YA 2IK8A 4Q7JB 3J81k 1Q21A 3E2IA 5EXTA 1G7SA 3EZFA 3F5FA 1HV8A 3U60B 4XOIA 4D0GA 3EZ9A 2VP4A 3I1FA 5HZHA 2AN9A 3BB4A 4CEJA 4E07A 4BEBA 3HP1A 3C14C 1E0JA 2VHCA 3OHMA 1BO6A 4KFTA 3M4YA 4WA7A 4NP6A 4UQOA 1W2HA 2ZVPX 1AQYA 1R7RA 2C99A 2D2EA 2FNAA 1ETUA 4JLDA 1GRNA 1T5IA 4HZUA 4PC2A 4JLPA 4MKGA 2MMGA 1I2DA 4G0NA 1W7AA 2WJIA 1ZBDA 3W8NA 2OHFA 1G16A 2O0KA 3CPEA 4WBSA 1T8TA 2AKYA 2VO1A 4PO8A 3ZD7A 5BW8A 4EPTA 2AFIE 2MMCA 2VSFA 1DARA 4JLMA 3QIAA 4OK6A 2GESA 2V9PA 1YR8A 3A1UA 1W4AA 3TLXA 2L0XA 2D4HA 5H8WA 2X1VA 4P4SA 4NCIA 1FMLA 3NHAA 1II9A 1KO7A 3W3ZB 2NIPA 4D81A 4LI0A 4F91B 4QHYA 4WIAA 3RABA 4BRWA 3AVXA 3CIOA 5JS8A 4Q19A 1NKSA 3LLMA 5GJWC 4Q1AA 2J59A 3M6AA 4RZUA 4QG7A 1XF9A 1LNZA 3IEUA 3ZS9A 5JRZA 2ZR0A 1G291 1HY3A 1S8FA 1XD2B 1XMIA 4PO9A 1KK1A 2BWJA 1GILA 2HJGA 2LKDA 2Q9BA 5KTYA 3U7FB 1COWD 3KL4A 1TADA 4C4PA 3HR8A 4RFSA 4ESHA 4IRUB 2DFKB 1T3HA 1DAGA 4Q48A 2I4IA 1LF0A 1IJFA 4LV6A 1K6MA 1MH1A 2P5SA 2P65A 2IHYA 3CH5A 1VYUA 3BGWA 1WCV1 1NMXA 2P6NA 2WSSD 4QM7A 1VCOA 3W9YA 2QL6A 2ZS9A 4EKDA 1C1YA 2WWFA 3N70A 2A30A 2ZJ2A 5GADl 1UDWA 1Q44A 2DPXA 2W2TA 2OFOA 2QG6A 4YMTA 3CX6A 3BOSA 3ZJYA 2J1LA 4GZMA 2FGKA 2N46A 4JLVA 4MITA 4BLOA 2IYXA 5BN3A 2ZJYA 4PANA 3I61A 2W6ID 2GTPA 5CJPA 4US2R 1KO1A 3U61B 2VSOA 2Q9AA 1P60A 4JLNA 1FP7A 1OHHA 2NG1A 1E9RA 2YWFA 3IIJA 4H9GA 2QT0A 3GQBA 3K0SA 4LJ7A 4D0LB 4UJ5A 1KAGA 4XJXA 4AC9A 2E87A 2KSQA 1G18A 3CRQA 3MWYW 4HB3A 1NF3A 4A36A 3WMGA 4Z1MD 4DRZA 4B74A 4LHYA 2D3WA 4HB0A 3O47A 3QUSA 2J41A 1ZYUA 4M0LA 2IUTA 4DLRA 5TVKA 3W6OA 2RGEA 2Z4RA 3C5HA 3KJIA 4B76A 2CDNA 1DG1G 1NKTA 1DAMA 1S2MA 1UKZA 2EFGA 2VP9A 3DKVA 2GK6A 4MGZR 1QG2A 5AUOB 3EPLA 1CR1A 1OXSC 1XCMA 2GEUA 2P0EA 4TN1A 1QHGA 5E4FA 1RRCA 1YJ5A 1KI1A 4DJTA 1NY6A 2G88A 5L8VA 3PIRA 2CL6X 2W00A 1V43A 1VYTA 1YZLA 1P61B 1SZPA 1UBGA 4KFUA 4AK9A 4B34A 4D6PA 4EFLA 5FH9A 4D82A 4V02A 3Q72A 1R0ZA 4CEIA 2XZLA 2W0SA 1AS3A 1MO3A 2XNSA 2QNRA 2OEPA 3RHFA 4ABYA 4UXIA 2AKAB 4DCTA 2GHIA 4IDOA 2QPAA 4RD0A 3CH4B 2GEDA 3HPRA 2NQ2C 4M1YA 3BH0A 3EIHA 1P2SA 4QHSA 4TLBA 2BBSA 1TPZA 4V0MA 3RDPA 3RC3A 2HV8A 5FTKA 4ZCMA 4PTLA 4PPQA 3EWAA 3ASYA 5F3WB 2IS6A 1WBBA 4XSGA 1GKYA 2JCSA 1GKIA 4HAYA 4Q03A 4NYIQ 1SVIA 4D4JA 4MYCA 3MLEA 3SU8A 4AY2A 1S4QA 4QRHA 3ICQB 1Q12A 1DAHA 2IYRA 2QU8A 2ZRAA 5LPNA 2ASEA 3QEOA 5DI3A 3TIFA 4EJSA 2Z0MA 3REFA 1CJKC 1VG9B 4A92A 4D80A 2GF9A 2G0TA 3A4NA 5FI1B 4JIMA 4TYQA 2F1JA 4DDTA 5L3SB 1ZU4A 4EPYA 1PV4A 4LJ9A 2CLDX 1RYFA 1Z6YA 2UZIR 3GJ3A 4A8JB 4NYJR 4DLZA 1IY0A 3CKLA 1E2EA 2IYUA 5HE9A 3SJCA 2CXXA 1UADA 2PEYA 4F4JA 1G3RA 1XB2A 2F6RA 1XMSA 3E5HA 3IPYA 2PZFA 4BWYA 3EPJA 4B3GA 3N2EA 3PV0A 1E9CA 3I32A 2D7CA 1VHTA 3V4FA 4NPHA 2BM1A 4HAVA 4F4CA 3EX7C 1E9FA 1UKYA 1JPNA 1GSIA 4S2EA 2H17A 5EZ5A 1VMAA 4OI4A 2TMKA 3T12A 2GXAA 1KI8A 1IY2A 1N3BA 1YHNA 3HYTA 1TTTA 3VTKA 1UFQA 5GJBA 2XXAA 4FW9A 3SQWA 3A6PC 4WXRA 3LRPA 2DFLA 1OJLA 4UJ3A 2VF7A 3DOFA 4BUJA 1OW3B 3FHCB 3BS4A 3NC1C 3NH6A 2ZJ8A 3A1TA 4CEHB 4CW7A 1HEIA 4E03A 3W6NA 1FMJA 1TUEA 3TUJC 3VR5A 3FFBA 1NN1A 3BORA 4G1UC 1DBSA 3NDPA 3ND9A 1U9IA 3KFVA 1N0VC 1G3IA 4L9SA 1LB1B 2Z5FA 1E79D 1KY2A 3IQXA 3HU2A 4M4SA 4H1UA 1R0WA 4PAMA 2HYIC 2RHMA 5CITA 3CRMA 3CM0A 4DVGA 2GBLA 1II8B 4C0LA 2ZJZA 4ASUA 4O25A 4CIDA 2J3EA 3KQHA 1OIVA 3GFOA 3FE2A 1AKEA 1JAHA 5LD2C 1KJYA 2DWQA 4Q7KA 4PQRA 2F43A 4Q9LA 4NCKA 3LH5A 4QC2A 5B58C 4Q1DA 4C0SA 2JEOA 2AFHE 3TNFA 4AYWA 5JRJA 3QKRB 2YZ2A 2W58A 3THXB 3TMKA 1ZNWA 5E7JA 4YMWA 4LZZA 2V7QD 4ZDKA 3BBPA 1KOFA 1JJ7A 3LWNA 2OFXA 4A0GA 1U8AA 2ZRDA 2ZYTX 2OCPA 1XFAA 3BD9A 3NBZC 4LDJA 2HT1A 1QVRA 1KK3A 1L4UA 2OG2A 1Z8FA 1Z0IA 2GILA 4C7OB 5EUMA 1ZUHA 3DZDA 1OXUA 1YRAA 2VF8A 1HQCA 4KSBA 1RJ9B 4KODA 4M9XA 4ARZB 4LPKA 1YZKA 2WM9B 2XZPA 3CRW1 4LHXA 4PC7A 4GL2A 2WIBA 3KJEA 2R62A 3SZRA 2OAQ1 3L82B 3PEYA 3CZQA 2O8DB 2VHJA 2WWXA 4W9MC 2JLUA 2CEAA 4O2LA 3AUXA 2QBYB 1U0LA 1XEXA 4TYNA 3WMFA 1JQJC 2AD5A 1ZUNB 1H8ED 3QENA 2JDID 3HYRA 4P4UA 4BLTA 2ZETA 1ELOA 4YMVA 2EW1A 2BCGY 2ZAOA 2QAGC 1MV5A 2NO7A 5CK4A 3ZQ6A 1E94E 4B2LA 2AK2A 2JAQA 3CR8A 3O8RA 3T5DA 2G83A 5KPDA 2JA1A 1R0XA 4MQBA 2ZRCA 4I99A 2YWGA 1COWA 5FUWA 5CJ2A 3U7EB 3P32A 1KK2A 1UEIA 1CR2A 3IPXA 3ADDA 4TL6A 3QY0A 3K0AB 3VMFA 2WVJA 5KSYA 1MRNA 2OE2A 1VDZA 4JL8A 1YR7A 4UXHA 4B2PA 2DB3A 3K0FB 1KDRA 1OKKD 4OL0A 4Q1BA 3ND8A 2G0NA 2ERXA 3GLFE 2EVWX 3UG6A 3OEHD 1G3UA 3MSXA 2CJWB 3HWSA 1NBMA 3PUVA 4OHVA 3AKYA 4Q4HB 2PT5A 3ZYCA 1C4OA 1KO4A 1CBUA 4V0KA 5G53C 3U3RA 2VSXA 4AYTA 1YZGA 2YOHA 5F9FA 4IVPA 2O8EA 2A3RA 3WMEA 4G5GA 3VKGA 4DIDA 2YJTD 1KSFX 2QUZA 2V6JA 1V5WA 2C04A 3LD9A 3T1QA 1GRRA 5GJCA 1EWRA 5DN6A 1XD2A 1CJMA 3PEUA 4JJKA 3V9PA 3F8TA 3UMSA 4UNSA 4BFTA 4TLEA 1XPRA 4RZ3A 4XVUA 1A2BA 3R9IA 1XU4A 4HDOB 4IFBA 1RRGA 2B21A 1OXVA 2JLQA 4A2WA 3SHFA 3QXSA 4JT4A 1AIPA 1VG1A 5DLQC 4HZIA 4RD3A 4W5WA 5FUXA 4DUGD 2A5JA 3FKSD 3NG1A 4B33A 3P27A 1ZCAA 4CYMA 1N6OA 5EZ6B 4RD1A 1T5LA 2MSEB 4JMPA 2VTKA 1N5LA 2BV3A 4LJ8A 4YDHB 3T06B 1GNRA 2OV2A 3BB1A 5SZKB 5JHGB 1KKMA 3KTAB 5JS7A 1X3SA 4TYPA 4AYXA 1D2NA 2WKPA 2ZRIA 1Q1ZA 3TJZA 2VBCA 4OJQA 4BFXA 1G64A 3UIEA 1IXSB 1Z2AA 5BYJA 1XTSA 3GLHA 3AKEA 1E2HA 1JECA 2IYLD 2NO9A 1LY1A 2A5YB 1E0SA 4PQYA 3KUCA 4KVAA 4BLSA 2GA8A 2OCBA 2A5DA 1QHSA 2J9RA 3DZ8A 5L3VA 1FTSA 4LPSA 1CR0A 1DE0A 4D4MA 1HUQA 4P33A 1ESMA 2IYTA 1GFIA 2PX0A 4A9AA 4GP6A 3ZS8A 4OQMA 4JZKA 2FSIA 4XWOA 1AKYA 1BH2A 2FEOA 721PA 4MKIA 3TW8B 5A4JA 3AF2A 1W49A 3V00A 1SGWA 1G3MA 2J45A 1PLLA 3AUYA 3FMPB 3KQNA 2VHQA 1J90A 1SVKA 5ELXA 1JNYA 3EPHA 5A5GA 1TF5A 4A0HA 5FR2A 3LDAA 2RGAA 1CRQA 2IWRA 5BYKA 1NNEA 2DFTA 3TVDA 3X1YA 4ZPXA 3O8BA 1R2QA 3CW2A 5EE3A 4NMMA 1CRPA 1Z28A 2DBYA 3AVOA 5J5CA 1N6PA 1E9DA 2J0VA 3GJ0A 4CT5A 2W6JD 1FX0B 4EPVA 5JCPA 4ZDJA 3EIQA 1AQUA 2IYYA 1B0UA 4QGFA 1MO6A 5E95A 4C9BA 1FPMA 5FOUA 4FN5A 1OH6A 4LC0A 4YC7A 5D3MA 4AG5A 3X2SA 1ZRHA 2RGNA 4AG6A 1UBCA 3C16C 1TQDA 2P6RA 5JJLA 2WWWA 4CDGA 4LYHA 1RPZA 1R5NA 1K8RA 1OLOA 2Q21A 1G4AE 4TWZA 4M21A 4QBHA 5EE1A 4LYJA 2ZS7A 3K8YA 2EYQA 4KJZA 1I4DD 1GNPA 2PZEA 5FL7D 3GLGA 4A2PA 1X1SA 2ODEA 3GPLA 2GZDA 2A5GA 4GSYA 1S0UA 2PZGA 2W0MA 1E2IA 5G3YA 3LW8A 4A82A 3KKOA 2FZ4A 3IDQA 1ZIPA 4Q7MB 2B8TA 2OBNA 2VA8A 2D7DA 4GFDA 2GCOA 3VX3A 3EZ2A 4TLDA 4HB2A 2J46A 2CK3D 1ZD8A 3TAUA 3QXHA 4A6PA 3DOEA 4DZZA 3T1TA 2REBA 4B3XA 4Q1FA 1NG9A 2OM2A 1VG8A 2RGNC 2F55A 1E79A 1NI3A 3THWA 3BFVA 1I4TD 2ORWA 3NWJA 2KI5A 5E7MA 5HCNA 1XTIA 5JCZA 1AGRA 3SI7A 2JLVA 4RVCA 1WXQA 3AVWA 2YWHA 2X2FA 3OIVA 2YNMA 1OXXK 2N42A 4X8OA 1GL7A 2RHDA 3TVTA 3W5JA 3QKSB 3BK7A 4C0AC 1SXJA 2JJ1A 1CJUC 2FV8A 1A82A 4EIWA 3QNUA 1KI6A 2N1BA 3RS0A 3Q9LA 1SQ5A 3FMOB 2OESA 4BFSA 4HUQB 1J7KA 1ZU5A 4XSHA 4JBWA 2WJJA 4FD2A 5DYIA 4DLSA 2FFHA 3MGCA 2H16A 2QZ4A 3EAQA 1YZQA 4CEHA 4QBIA 4A8JC 3P4YA 3FWYA 5TV2A 3LA6A 4EUNA 3FTQA 3K70B 2UZ3A 3R9XA 3U3OA 4TLCA 3BE4A 3LBIA 5KOYA 3IBGA 2BBTA 2RGCA 4QBGB 4QJ4A 4DDUA 5FTLA 4PQFA 1UAAA 3VNVA 2ZJBA 1P5ZB 3P1JA 3OFNA 3K9HA 4URYR 2FEMA 1QBKC 1E96A 4G5OA 4B3FX 2KE5A 4MKFA 1QF9A 2VIIA 3ONWA 1S1CA 4JSYA 5L3QB 3EA0A 1P9WA 4MGKR 5ANRB 3LW7A 4IOKA 2ZSDA 4BRUA 4HAWA 3CONA 1U0JA 2KBEA 2R6DA 1S3GA 3F3YA 4YLGA 3RS7A 3TR0A 2QMHA 3BRWD 3K09C 1WDTA 4TYWA 4X8HA 1OH7A 3L8ZA 3EW9A 2JJ2A 5JWRA 1J2JA 5EP4A 121PA 1KAOA 3CNNA 3QKRA 2Q0HA 1E9SA 1FFHA 1PLJA 2VP5A 2NPIA 3B60A 4LBVA 4Q21A 4QNRA 3VU9B 3W90A 3ZQJA 4JT2A 5AJVB 1NJFA 2O8BB 1MO4A 4D26A 5JSZB 3K70D 3B78A 1E0KA 2XB4A 3RS5A 2QTVB 2FSHA 2LCFA 2B92A 4DSUA 1Z6TA 2ORIA 5DO9A 2RKOA 2VQSA 3AVPA 4KSCA 4URWR 2R6FA 2ZE7A 4Z51A 2Z43A 3B9PA 1UM8A 221PA 1E9BA 1J70A 1P62B 1DEKA 1NJGA 3SS8A 1TF7A 1TEVA 3UMRA 1F6BA 4ARZA 2OXCA 2LKCA 1GP2A 1M2OB 3MMPA 1N6NA 3W8RA 3I62A 2WAXA 4RCZA 3FPAA 2QA5A 2O8DA 3KKMA 4NL4H 1IOZA 3LY5A 4LSGA 4DB4A 3IILA 3U3JA 4YXWA 5LBIA 2QBYA 2NOAA 4GOKA 2PCJA 3DDCA 2Q3FA 4RCYA 4DXAA 5AUPB 4DLUA 3RSLA 3THOA 3NBFA 4JL5A 3RS4A 1IM2A 1IXRC 4FI3C 2HLDA 4KLNA 3TSOA 2EFEB 2YKGA 3KX2A 1YR6A 2WAYA 1OXTA 1IN6A 3IIMA 4LK2A 2GXQA 3SC3A 4ON9A 3WNBA 4DLTA 3U6KA 4FWTA 4B3CA 1Z06A 1KDTA 2A2ZA 2ZQ5A 5AR1A 3U44B 2O8FA 3DHWC 4R98A 4BASA 5CDFE 1VCMA 5K8UA 4HEJA 4M9SA 2XZOA 1G7RA 1W0JD 2QP3A 4P4TA 4R7ZA 4UXJA 3SFVA 1N25A 2BEJA 2C9CA 1GL9B 1JPJA 3B2EA 5CYOA 5GVRA 2WWHA 3ADCA 5BQ5A 3B6EA 3IUYA 1T0JB 2LWIA 3DM5A 3LFUA 5AJZA 5IK2D 3FKSA 1QHHA 4MYUA 4TTRA 4DDVA 4BEJA 2CJWA 1YZTA 4HUTA 1FNMA 1ZD1A 4IEIA 1OIXA 3KFXA 1NMYA 3KUDA 3LBNA 2OO7A 4LUCA 1OIWA 1LS1A 5EE9A 3U7GA 4QGHA 1KZ7B 1XWIA 2ANBA 2GXUA 4FMDB 1ZC4A 1EXMA 5FBWB 1JQLB 4DSTA 2IYQA 3TSZA 2P67A 1E1RD 4Q9JA 2QSYA 1D2EA 2KJQA 4PPFA 3CWQA 3D31A 4PHFA 5HCIA 2OFWA 1L2TA 1OT3A 2OZEA 1XCPA 3T34A 3VR1A 4AD8A 4FCVA 1NIJA 4WZ6A 1E98A 3QQ5A 1CJTC 3RAPR 3T15A 2GJAA 3GJ5A 4PSAA 3U4QB 4QJ5A 3W3AA 2FFBA 4BFVA 5CB6A 1XP8A 4V0OA 4TZ0A 5J4LA 2GF0A 4MYTA 1KMHB 2GDJA 2J7PD 4TL9A 4E5UA 2OBMA 5HKKA 4U7DA 4C0HA 4F7WA 1KY3A 3K0CA 5EP1A 3SEAA 4EDHA 2QORA 3WHLA 2IX3A 1BKDR 3HR7A 4PZLA 4W5HA 4DSOA 1EFCA 1OPXA 1SHKA 1T6NA 2CE7A 3U5ZB 2QP9X 2RGGA 3QPUA 2O0JA 2J0UA 1OB5A 3SHWA 1R5OA 1Q20A 2JIZD 2REOA 4PFSA 3QSYA 4WXPA 4R2IA 3ZVRA 2YV5A 1KZGB 3Q8XB 3VX4A 1MABA 2WSMA 1QZXA 2WBLC 3PUWA 4IOMA 3L43A 2XJ4A 5KSPA 3MRSA 5K8LA 2GRJA 5K8IA 3ZIAD 3OAAA 2W6JA 4LGMA 1KI2A 2NO0A 4I4LA 2XB2A 1GOTA 1H8HA 4DDWA 4B44A 3ZGXA 2ECKA 3AVVA 4WZAE 2XEXA 4KFRA 2JLXA 1UBEA 3BWDD 2JGNA 2IL1A 3E1SA 4IHQA 3KQKA 2ZTSA 3A58B 2WMOB 1MR3F 2XTMA 3GEIA 4NTZA 3VHLB 3S1AB 1VIAA 2FSGA 3KXIA 3LO5A 3MJHA 1EFRA 2RCNA 3K0CC 3QXJA 1ZIOA 3AKCA 1NVVQ 2AL7A 1G8GA 2WWIA 5FL7A 1XBTA 2ZUBA 3NHBA 2WKRA 4HAXA 2AWNA 3TQCA 3I92A 4PSVA 4LV8B 1KGDA 2ZM5A 3EASA 1E4YA 2G1KA 4LJ4A 4FIDA 3QPVA 1E0AA 3OIYA 2OCAA 3AGPA 4LY6A 2X77A 1X1RA 1XJCA 4MH0R 3FHOA 3TW4A 4I81A 5CM9C 4Q5IA 3CF6R 4LBWA 3KJGA 1KO5A 4OHZA 1G21E 1W4CA 2CL0X 2QE7A 3CNLA 2V1UA 4Q1EA 1P6XA 2KWIA 3ZLJA 4Q9IA 3TE6A 1VTKA 2BBOA 2FOLA 3UPUA 4XD7A 1SKYE 2ZI3A 4C2TA 1H65A 1NN3A 4Q9KA 4C0KA 1FNNA 4G5SA 2HF9A 2X8AA 3I73A 3P4XA 4JLOA 3THYA 4X8MA 4KV9A 2Q3MA 2F1RA 2HCJB 5FPYA 1CF4A 3NBYC 4ACAA 4DBLC 3KXKA 3L2OB 4L5BA 1US8B 4YQFA 3CBQA 1I4LD 1JEEA 3NVAA 1XTJA 1Z3IX 1XXHA 4DCVA 4QHTA 1G6HA 4UNRA 2BKUA 2CBZA 2SHKA 3WHKA 1XRJA 2H57A 2UKDA 621PA 3PJRA 2BC9A 3OEED 4TSFA 4Q66C 3W34A 3C7KA 5KSZA 3K0EA 1GAJA 4QL3A 1FTNA 2GETA 2QTFA 2OLKA 4ZI3A 2ZANA 1N5KA 2ZI9A 2H5EA 1OF1A 3QOFA 3B1WA 1FOEB 1ZNZA 4BZXA 5KDOA 1BS1A 1G1MA 1KO8A 4HI0E 3GLIA 5FUVA 3FMFA 1G3QA 1G5PA 3F0TA 2CCJA 4GZLA 1U2RA 5FOTA 3AQ4A 3M1IA 4I1UA 1XEFA 5DH9A 4Q4LA 3EZ7A 5JI2E 1IHUA 3PUYA 3NEYA 1ZW6A 4TMWA 3V4RA 4FXPA 2YC4C 2F3TA 3CX8A 5KO2A 1RE0A 3SJZA 3Q7PA 1NG1A 1DAFA 2GAOA 5DSZA 2ONJA 1SKYB 1G6OA 1RYHA 1R4AA 5IDVA 3DM9B 4H1VA 1PUJA 1Z0AA 3OF5A 3HJNA 4PAOA 1VKJA 1E2KA 4TQ9A 4DEXA 3AKDA 5C4GB 3ZDQA 4DT1B 1Z47A 2ZS8A 4OQNA 2F7SA 3Q5EA 2AK3A 2IT1A 2P2LA 1F2UA 3WY9A 4C0QC 2GJSA 4CGZA 5JLJA 4BFUA 4WZBE 1XTKA 2JLSA 5UKDA 3RRZA 2V8OA 2WPDD 1XCGB 5HTKA 2CVHA 4PHTA 5SZHB 3PXGA 4PC6A 3FHTA 2MSDB 1T4GA 3O8DA 4EFNA 1X86B 1DAKA 1RFLA 2QAGA 5CB8A 4US1R 1M34E 1DTSA 5EE0A 1FUKA 2JLRA 3CB4A 4LHWA 4B6EA 4ZCIA 1EFTA 3PVSA 4PPGA 1ODFA 1T3LA 1AM4D 3X1WA 3IEVA 3ADKA 3NKVA 2QMEA 1VIYA 2G77B 2GXSA 1Q1EA 2QP4A 1P73A 2ZI5A 4GOJA 4U5XA 3I8XA 1MKYA 3NH9A 3TGPA 2ATVA 2ANCA 4OHWA 1GRQA 4RKEA 4DLVA 1OYWA 4NKRA 4ZIRA 1XTRA 1F2TB 2GNOA 4ITRC 2B7BA 4JKYA 4P32A 1JR3E 1DADA 1G8HA 4KAXA 3RNLA 4GMDA 1UJ2A 2CL7X 4TT3D 1WRBA 2IA5A 4GOXA 5KNBA 5KYKA 2REXB 1LF5A 2IF2A 4CEJB 4JVLA 3SJAA 4DCNA 3FMIA 3K70C 1TMKA 4HZUB 4HATA 1KYIA 4C30A 1FQJA 1W0JA 1X8LA 5F2EA 2WOJA 3HU3A 3RC8A 1OSNA 2NTYC 4RSGA 5HE8A 5H68A 1PUIA 3HPQA 2BKEA 4AKHA 3KKNA 4CRWB 3AP2A 1KI9A 2NZJA 5IK2A 4F38A 2F9MA 1WBDA 4NYIR 1OE0A 1AN0A 4P4SB 3L0OA 4AKEA 4PO1A 3SYLA 1R5BA 2GZHA 1ZM2A 2WSSA 3AF3A 2HYDA 4NCHA 1OH8A 4JLAA 1MRSA 2ZRGA 2OBLA 3TUIC 5KHOC 4MGIR 3VR3A 2FWRA 3AF0A 1WQ1R 1A1VA 1E2JA 2ATXA 4NZYA 1EFHA 1JXMA 2YWEA 5A0FA 1NVXQ 1JEDA 1BOFA 3A37A 3N5CA 1F3OA 1T0HB 3B85A 1E1RA 5B2ZA 4N0DA 2BJVA 3N2IA 4XIGS 4CF7A 4TMZA 3SOPA 5B57C 3KZ1E 4Q4AB 2CNWD 1K5GA 2IHBA 2W6IA 3VAAA 4RFSB 3U3MA 1DS6A 2RGXA 1CULC 2K5UA 5EXPA 2EFCB 1HT1E 2FH5B 1RRPA 3LV8A 5AUNB 4C0JA 2WKQA 1BIFA 4MRSA 5DYGA 5FOWA 4OQLA 3WYGA 5AJWA 3A1VA 1TUIA 2ZPTX 3ZH9B 4Z1MA 3UMFA 4GRAA 4IXMA 5FTNA 3L8YA 1SVSA 3WNCA 1NIPA 1KIMA 1OYYA 4KU4A 2A5FA 2DCUA 2WZQA 3UANA 2QSZA 3KB1A 3G5UA 3QEJA 1IN4A 2O52A 1U94A 4IFEA 2DY1A 2PJZA 2IS1A 5J4HA 2QRZA 3AH8A 3AVTA 3O8CA 1W4RA 1VECA 2GCPA 2JIZA 4Z8YA 2XGJA 2O8CB 4B43A 1GG2A 3BAFA 3H4MA 3L0SA 4B32A 5F98A 2H1LA 4RZ2A 1N0UA 1GNQA 3ZIAA 4UKDA 3R9WA 2DHRA 1RRFA 3MCAA 3PCRB 1JR3D 2ZIAA 3GLFB 1JJVA 3I72A 4OJKA 4PX9A 3TRFA 3H84A 2BOVA 4M9ZA 4RD2A 4QJ3A 1WMSA 2DR3A 3IO3A 3KB2A 4NU0A 2FFQA 1C9KA 1E1QD 1HTWA 1KSJA 3EARA 4QGGA 1NSTA 2ZUCA 1CLUA 3H0KA 3PUXA 1W36B 2WJGA 1KMHA 2NGRA 3AM1A 3NEJA 3FYHA 5TB5A 4PXAA 3QVUA 4ACBA 3KQUA 4AKGA 3MAAC 2J5XA 3RWMB 4E22A 3GP8A 2PEZA 4OK5A 5KSOA 1ZJ6A 3TUZC 3GJ7A 4B71A 2C78A 2MSCB 1AS0A 1G8PA 2GWHA 4LBYA 2XSZD 4Z54A 1JB1A 4EAQA 3C15C 4DKXA 4HLUC 1KI4A 1PLKA 1Z22A 2RMKA 4HSEA 5FBRB 3RRMA 1YVDA 3C41J 1N2CE 2XOKD 1UEJA 2ZAMA 2B7CA 2ZI7A 4OKSA 5FBVB 5EXSA 4C2UA 3JZAA 1HURA 3CF0A 3NTUA 2ZRMA 4L9WA 2OILA 2QI9C 5FPKA 4UNQA 2R44A 4Q9HA 1E32A 1UKVY 3EA5A 1Z0FA 1IONA 4URVR 2VP0A 1AA9A 3S1AA 1N6HA 2V55B 5DI3B 3L0IB 1PVOA 5TXGA 2WOOA 3B1XA 4CT4B 5J47A 2ZE6A 1E2MA 2JLYA 2F1IA 3D7MA 4M53A 1OFIA 2C77A 1OFTA 2ZRBA 5DI9A 3FOZA 1WP9A 1G7CA 4OHYA 1W48A 4LX0A 4NBSA 5BWMA 1NP6A 4JLKA 1NRJB 3SFZA 1UKEA 1IQPA 4JS0A 5DHFA 5LB2A 4XWKA 3SR0A 4UNPA 3IQWA 4GNKA 3GFPA 1PZNA 5KU1A 4XTRA 3DEFA 4A15A 1S1MA 4DCUA 4ZO4A 2EFDB 2J0QA 3K9LA 2WJYA 5L3SA 2WWYA 2EWWA 3U2QA 4M1WA 1QHYA 1KI7A 1G4UR 5EJEA 3AVUA 4A8JA 1LFDB 2ZI4A 3MWJA 4WAUA 2WICA 4DEYA 3WP0A 1XEWX 2JASA 4OI1A 1ZMXA 4MRNA 4MGYR 2W83A 2OCYC 4R9UC 2F1HA 3DMNA 3U7HB 2GK7A 2XXAB 2FX3A 4IDQA 4JVNA 3SNHA 1JR6A 3CR7A 2R6AA 1ZVQA 2WWGA 4JKIA 3ADBA 4OHXA 3U3KA 1J8MF 2QGNA 4IVQA 2BDTA 3VKWA 2ZROA 3I5XA 3EIEA 4HAUA 1EGAA 4A1FA 3ECCA 1G17A 1A7JA 3SYKA 2XX3A 3ASZA 3BH7A 2PT7A 3K09A 5EP3A 8OHMA 2WPDA 4FMBB 1W0KD 4M9QA 2Z4SA 1NVUQ 4I1VA 5H1YA 5SZIA 1U81A 4Q4JB 1XPUA 4D25A 1Z5ZA 1TEXA 2V7QA 2GZAA 3D6TB 3EWSA 3QF4B 2FZLA 4WOPA 3CLVA 1NLFA 1ZCBA 3LVRE 3SJBA 1Q3TA 1YZUA 3NBXX 2DFNA 3WNDA 4PZZA 4E09A 2GVDC 3QF7A 2F43B 3RRNA 4CZ2A 2I3BA 3IHWA 4N3NA 2PMKA 1II8A 1O3YA 1Z08A 2FGJA 4P0TA 4LCBA 4QM6A 5L3RA 4U02A 4NE2A 1SHZA 1TQ6A 2H7VA 3FVQA 4TT3A 4OQFA 4WW0A 1P7CA 1R6BX 4NYMQ 3CRRA 4ILEA 4TYYA 4GI7A 3UWOA 1WA5A 1H8EA 3W6PA 3MJRA 2BMEA 2GCNA 3HU1A 2JDIA 5CM8B 1XPOA 2ZRJA 3EG5A 2BIFA 5DNYB 4I1SA 4ZCLA 2D2FA 1LVGA 1QRAA 1P2VA 2IXEA 3TKLA 3P20A 3THXA 1SVLA 2HUPA 5E7IA 3WBJA 4A2QA 2ZREA 5CLLA 4AI6A 2ZU6A 4IVRA 1NBME 1JBKA 1HQYE 3VFDA 1Z6XA 1IN8A 1BYUA 4EPRA 3DPUA 4ASUD 4DIEA 3VR6A 3GJ4A 4KXFB 4B75A 3CO5A 5CK5A 3K53A 3EC1A 4C7OA 1S3SA 1VG0B 4HDQB 2WJVA 3PITA 1TU3A 3B7GA 4XH9B 2ZYUX 3GJ8A 3RRYA 4GMXA 1NN5A 1RJ9A 4BLPA 1XEXB 1S96A 3ZVLA 1F2TA 4L8GA 1Y3AA 4IOLA 1CKEA 1XJQA 1OKKA 3TAHA 1A2KC 2CCGA 2HF8A 4IDHA 3KKPA 3OEHA 2IWHA 1JALA 1M8PA 2QT1A 1CJVC 1Z0DA 2V54A 3R20A 4DLYA 5KNDA 1GITA 2G6BA 4NYJQ 4TTPA 2EYUA 4QGAA 1PJRA 4LV5B 1N5JA 5DHAA 421PA 1E9EA 1EESA 4AKIA 2KB0A 2PCLA 2G3YA 2QPTA 4LJ5A 1YR9A 4DSNA 2CNWA 5AJYA 3VQTA 4KBGA 3RVBA 3B5JA 4JJZA 3E70C 5K8TA 1XTQA 4BGDA 1G5RA 3CX7A 3Q5DA 4AIIA 3G0HA 2VL7A 3PFIA 4XWAA 1ZNYA 3GMTA 5IT5A 3I5YA 3CPHA 5J4KA 5FPTA 2CMKA 2CHGA 3T1VA 1G8YA 1ZM4A 1KJWA 2QENA 5J40A 3IKJA 5FOSA 4PC3A 3K1JA 2HDNB 3K0AA 1CS4C 1I2MA 3ZZUA 4DHEA 2NZ8A 3LXXA 1D8TA 4UNNA 1ZP6A 2D06A 3QBVA 3K0FA 2JJ8A 2ZYWX 3OZXA 1Z2CA 1XMVA 2IC5A 3GLHE 2YINC 4DUGA 3KJHA 3PEWA 1W1WA 1U98A 2ONKA 1TQ2A 1X8JA 3GJ6A 4DC9A 4ZI2A 2O8EB 3MD0A 4D0NA 4KVGA 2QGZA 4KLZA 1HA3A 1N6RA 4Q4HA 4MUAA 4MDFA 1XX6A 3DL0A 2C5LA 5KDLA 2ZR9A 4ZKEA 4G3XA 2JLWA 2FG5A 2R8RA 1Q1BA 3WRYC 1JR3A 4Q4AA 1DG3A 2VLIA 3VKHA 4OBEA 4FMDF 4B6FA 3AF1A 1R8SA 4C0BA 5CIQA 4OI0A 4JL6A 3C4JA 3PQCA 1E1QA 1HT2E 1ZUIA 2P3SA 1B23P 3GEEA 2BBWA 1VCIA 4LRWA 3WYAA 3QKTA 4V0LA 1T8UA 2QQ0A 4BFWA 3CZPA 4KBFA 4TL8A 1CTQA 1OFHA 2ZJOA 4TQUS 3NIBA 1NBMD 4TMXA 5G40A 2DWOA 1G41A 4ERNA 4IDNA 5C46F 4BQSA 5FBLB 2FF7A 1P3JA 2XNDD 5DE3A 3RS3A 2IUUA 1QHIA 1P2TA 1KDOA 1ZINA 3B82A 3DKPA 1XEWY 1KI3A 4MRRA 1Z0JA 2O8CA 2I1VB 2XSZA 3AVYA 1XD8A 2V1XA 4W5JA 5FOVA 1ZAKA 3GFTA 2XOKA 1E2QA 5DN6D 3KTAA 5AUQA 4LYAA 3PG5A 2EQBA 4GBMA 4DB2A 2P5TB 3A4MA 3GLHB 3MFYA 5BN4A 4QNMA 3GLFA 1KSHA 1TAGA 1FL9A 1XZQA 3CRVA 4JBYA 1N6KA 4URXR 1M6NA 3ETLA 3QVVA 5EE5B 3UG7A 3GLGE 3ICEA 1W47A 3X1XA 1M1YE 2BEKA 1L8QA 1AZTA 1LW7A 3QG5A 1IJEA 2V6IA 4M1SA 3I8SA 1T91A 2X19A 2PJRA 1NSFA 4D4LA 2FPKA 1IBRA 1P72A 5TY0A 1HE1C 4DWJA 4G01B 1KSGA 1AGPA 1N0WA 1NLZA 2DWPA 1Q3HA 3K9GA 1VYVA 3REGA 2AR7A 3Q3JB 2OXRA 4A0FA 2FJUA 2O0HA 2HT6A 2QN6A 3UK6A 2G1JA 2PBRA 3B1YA 2NPFA 4PR0A 5KDDA 5HR5A 4XVQA 4IW3B 1E3MA 2BCJQ 1XMJA 1Z83A 2HJVA 2R2AA 2BHRA 1Q57A 2QAJA 2RAPA 3ZVMA 3LVQE 3CNOA 1CEEA 5B30A 4NYMR 2H8KA 5JJIA 3VR4A 4EPWA 2ODNA 1W5SA 2GJ8A 5B64A 4S35A 2OT3B 5CIWA 5D3MB 2QPOA 1Z63A 1P75A 1SXJE 1W2GA 3B9QA 3BH6A 4L15A 2HXYA 3FKQA 3BFKA 4PZYA 1FX0A 1SVOA 2ZSEA 4KYUA 3R7WB 2NO1A 1OV4A 4RJLA 2J87A 1W36C 4EPXA 2CK3A 5JWOA 3KQLA 1G5TA 1AZSC 1D6JA 2V3CC 3NXSA 1XD9A 2C96A 2FFAA 1GVNB 1OH5A 2RB4A 5CLQA 2CLSA 3MUFA 1ESNA 1ZNXA 5JMTA 3GLGB 3A36A 521PA 4Q01A 1U99A 1VCNA 2ZI6A 4KHZA 2C2HA 1OB2A 3KDSE 5CYPA 4LYFA 5EXXA 2PMDA 2FE4A 3UXMA 4RY2A 3H2YA 1GWNA 3LNCA 4HLCA 2GVZC 1JXOA 2VP2A 3Q7QA 2Q6TA 2FN4A 5G3ZA 2GCOB 2IYZA 5LB4A 4EQ6B 2JLZA 2VEDA 1Y63A 2AHOA 3BC1A 5EQTA 1IAQA 3B8HA 821PA 2FDCA 4GT1A 1W0KA 2IXGA 4L16A
chains in the Genus database with same CATH superfamily
1HNXB 2Q5CA 2IHTA 2ZAIA 1RKQA 3IIEA 3NX4A 2R6ZA 3B5IA 4UC0A 1QRRA 1RTTA 2COKA 3FD8A 3CMCO 4NNOA 5A7GA 4GNRA 3RODA 1MT0A 1WCWA 4D57A 4D4KA 5B1EA 3GEBA 4G5RA 5E4YA 3B7PA 2JKZA 4BS9A 1ZN2A 4AUMA 2Z09A 2CSUA 4GPTA 2HNBA 3KQUA 2AXEA 2JH8A 1IYZA 1UC8A 2D74A 3PR1A 3TGWA 1J9GA 3OFVA 1YB7A 1GU1A 1SKAA 5J59A 3BJIC 1ZM7A 3BFJA 1KI6B 1ORHA 2FWIA 4IV0A 1DKUA 1T0PA 3G7UA 3JATB 1WXIA 2IYEA 2ZIFA 4BNNA 1JJFA 4D9JA 2Q4TA 4YACA 1YQQA 4WKOA 4F4IA 3OIFA 1VPLA 3DYIA 3OCZA 2AQIA 3B1ZA 3IDSA 1E69A 4PONA 1JU4A 2C9BA 2CLCX 4ZDWA 2P4HX 1K08A 3HR4A 7ABPA 4GDFA 3K4QA 4RQTA 4YAJA 3EUWA 3IE0A 2VJQA 3DO6A 2XTZA 2Q8PA 1MU0A 3IFSA 2I4NA 3LGAA 4E6EA 3UGJA 4LWZA 4WFQA 1KGSA 4I55A 1T6XA 2HMVA 4YT5A 4S04A 5E8JA 2QOEA 3OJWA 5AWFC 1MB2A 3H2IA 1O87A 1N2IA 1Y3HA 3TGLA 4OHPA 3LYUA 3QF4A 4ARBA 2CHQA 1Z29A 1GPKA 2PLRA 4LZOA 1KHTA 4XGNA 3LCRA 1B41A 2I1WA 2Z83A 1GDDA 1NXVA 2J0EA 3ZCPA 2CL5A 2W4QA 3GA5A 1O94A 2GEVA 4HJRA 4I4CA 3L4KA 1Z4QA 1SUSA 4MYHA 5DHSA 1RBYA 2R8EA 2VDNB 3OE7D 4HAZA 4U7FA 3R75A 3UJ8A 1QYWA 2PRZA 2ZITA 2OYCA 1IC6A 4ED9A 2PH3A 4E7OA 3KYCA 1QK4A 4KXVA 1R0KA 4N1AA 3EXG1 2WB2A 3UMBA 2N1MA 2VH2A 2NU9B 4BMDA 4KZPA 4JLJA 4DE5A 3LO8A 4YFYA 2QRJA 1V7QA 1ISJA 1NPTO 2FG6C 4LC1A 5DFAA 4PHCA 1TF2A 2FK7A 3OPYA 3S55A 4XOUA 1MW9X 1LWOA 3PT5A 3TNLA 5AJXA 4DGSA 1M8GA 4W5RA 2RBKA 4ES6A 3IO5A 2W2PA 3HBJA 2OPBA 4OXIA 2W70A 4QTTB 1GLVA 2DF8A 2R6GA 1FW8A 2YC2C 4FKMA 2XUFA 1EWQA 3BCRA 4D6XA 1XZPA 2A7QA 1FSPA 2CXTA 1ZCZA 1EYZA 3PNMA 4L2IB 1Q7CA 4B3DA 2ZWOA 4F5DA 5EUQB 2YMPA 2V9ZA 5CNJA 1P4RA 1ZX1A 1IN7A 2ACVA 1D2RA 3AILA 4U7PB 2OORC 4I4TF 4U2BA 1V1JA 2ODBA 2CBGA 3HWRA 1UF9A 3D3QA 2D0PB 1CJCA 1JQDA 2BGKA 5H80A 1LPPA 2B99A 2VDWB 3A4TA 3TBFA 1P29A 3M6LA 3KJXA 5K6AA 1F51E 1RCTE 1ZPDA 2EQAA 3B6KA 1AKUA 2PKCA 2VUTA 3Q1KA 4X6LA 3HJBA 3RROA 5LNK6 4IYRA 2ZSAA 4G0XA 3BRCA 1JILA 4G1BA 5JCJA 2P1ZA 1YZYA 3AI2A 3LXMA 2QD2A 3LDGA 5CUQA 4ZOLF 4CN8A 4HUJA 5JJCA 5KVCA 3EEOA 3COYA 2W6OA 5AXCA 1M2OA 4IY1A 1EXVA 3LCUA 4NDNE 4ZP1A 2EWVA 4TX1A 3TJRA 3NAQA 1F8GA 1KP2A 1MJHA 3KU1A 5CTJA 1GSHA 1P5HA 1PR9A 4NS1A 4A6XA 1L3CA 3RAFC 1W5TA 4HXYA 1M74A 1Y7HA 4PLGA 4Y2JA 1Y48E 3ZWNA 1EG7A 3IELA 4W99A 3N86A 1Z13A 1V47A 1TKRA 2F48A 4G89A 1UBJS 1BHJA 2HDOA 2CW5A 3C8UA 5MFPA 2O8FB 4Z49A 5IDXA 5JDCA 5ILOA 1JAXA 4B35A 4KAJA 1ATIA 2WU4A 4Q00A 4HG2A 1N3LA 3RS2A 1T2CA 3DFKA 4LMAA 3URKA 5BSVA 3EXHA 1WB9A 3LLUA 5H59A 3RREA 2FUEA 1E3JA 1G9XA 2LZ0A 3A4LA 4GMFA 4NONA 4CLDA 3BMNB 5F76A 5H70A 4KR7A 3AJ8A 1RXSA 2Z3ZA 1AF4A 3LM8A 1J5EB 1Q22A 4OOFA 3D0RA 5FI0B 2AVNA 5G0VA 4CF3A 2OWDA 5FD8A 1T9HA 5JLAA 1QHHB 1TO2E 3RJ9A 2CE2X 2E0IA 3FOFC 3Q3IA 1GAQA 2VATA 1QC5B 5REQB 2H1CA 3E81A 2NACA 4PFQA 5FWNA 2O2EA 2J7PA 3Q85A 3M4NA 4HB4A 4KXLA 4RK1A 4O6VA 4EJMA 2XNDA 2A3NA 5IAOA 2AQHA 4LW8A 2ZT6A 3OTWA 2VCYA 4HGQA 2IY7A 4QYMA 3MWLA 4B4WA 5IEJA 4ZTZB 2X7XA 1V3QE 2VH5R 4B0OA 5JV5A 1C9YA 1VMIA 1A7AA 5F7ZA 1TK2A 1ULZA 2ACEA 3PGJA 2HLDD 4R01A 5C4MA 5M29A 2FAXA 5KYGA 3JYNA 1UKCA 4FFOA 4RDHA 1NONA 2ZR7A 3ZOKA 2JGLA 3EQ8A 1PN3A 1ZC3A 4HLDA 5FBQB 4PWYA 1DPGA 1XQ9A 1E5VA 2QRNA 3UKDA 4C1NA 1A95A 2ZUUA 5JALA 3QBTA 1FYEA 2ZJ5A 5LP6A 1DJOA 1QMGA 2OAP1 1HZZC 1GSOA 2WMNB 3UT6A 4HDCA 2BJWA 2WAAA 4YROA 3LC7O 4D2IA 1V37A 2WJHA 2IP2A 4BO3A 4HNVA 5KYNA 4RTQA 1RXWA 2C8VA 4EYSA 4MUJA 5F52A 5LC1A 3T1HB 1T9KA 1N6LA 2I7CA 1QFJA 3KYBA 3H1FA 4FOPA 4UUBA 5AJUA 5DNEA 1KDZA 3MWKA 3L7IA 4YO8A 4ZDIA 2FPIB 3F2IA 1D2MA 1KYVA 3A8TA 3MRXA 3UM9A 2RH5A 1WF3A 2J0UB 3E61A 1Q1GA 3G0OA 3KO8A 4TQGA 4DTIA 2ZRLA 1L4YA 2IE0A 2Q1UA 3EXIA 1AH2A 4PO3X 2BMJA 2D6FA 1R6TA 3PHIA 3LX8A 1JJIA 1NATA 4O2RA 1BXZA 4CMIB 4LF8B 3UUEA 4RDXA 3PNOA 4BQOA 3NPMA 2H18A 2ZYVX 4IOJA 4WVFA 2RKWA 3HN6A 3T9CA 3W7BA 1E18A 4KGVA 4FWIB 1JG7A 1ZMTA 1FYVA 2IYSA 1JF8A 3BL5A 3NHFA 1OC2A 2KBFA 3GG9A 1NR5A 2NVUB 1RHMA 4XWYA 2H8GA 5DMXA 4W5OA 1FQOA 3EZLA 3V46A 1XXHE 4W9NA 1DO0A 3WYFA 3OIWA 3AV0B 4M83A 3ZHRA 3DLCA 1BVUA 5E8RA 1B3BA 3T5PA 5HKKD 5J3JA 4NCJA 4FCTA 1G2OA 1QZTA 2PGNA 1J8YF 4MUGA 1IOVA 5EQJB 1U1FA 3I76A 1NBAA 2QN9A 2B6HA 5D3QA 2VRWA 1IHDA 2DQ4A 3WL3A 2HQBA 5A5EA 5BP7A 4JYCA 3H65A 3ZPXA 1UQTA 3GLIE 2HRQA 1LDGA 3G2KA 1I36A 4DBZA 3RGWS 1KMIY 2CEKA 1ZWLA 2VHTA 1NSYA 4W63A 4J0QA 1L5GB 3SE0A 3SX2A 1UT6A 3T4PA 3VR2A 5AICA 5BPHA 4O1HA 1F48A 1QFMA 4LGYA 2HPHA 2J3MA 3V34A 3W0LB 4C4TA 1NY5A 1OV6A 5DYWA 3GK3A 4MKHA 2HLHA 1DAIA 1H8HD 3JVUA 4ZA2A 5JXHA 2Q6IA 3VZBA 1YU9A 3G5AA 3OEEA 3FUUA 4RZHA 3LUBA 2YJ6A 3EPPA 2MSNA 2XUQA 3UWKA 4XVRA 3K9NA 1QIHA 1QOZA 1HETA 5DX1A 1F60A 1JW9B 5KC9A 2HEIA 5CFMA 5GGYA 1UM9A 1H5UA 1V71A 4MO9A 2NP7A 3RC2A 2RD2A 3PWTA 3O4GA 5AW4A 1E2GA 1B8NA 1BNCA 1TB4A 2IXAA 3AB3A 4B47A 3DB2A 3JQGA 4ROTA 4AURA 1RFGE 5F2NA 3KVVA 2PX8A 3O90A 3OA2A 1E1KA 2ERYA 4IQ8A 4H6XA 2PTGA 3X44A 4EVQA 3TLAA 3MJSA 1HLGA 3O4VA 4RHUA 1A9RA 2VJBA 3NTRA 4FINA 4I6JA 1I3CA 1XXHB 1EVEA 2ZEJA 3O9VA 1THMA 2UU9B 1Q0LA 4S0ZA 3NHLA 4ZVNA 4LNUB 2DLCX 1ZDMA 3DWGA 3GLSA 5AI6A 2R7AA 3T7SA 5BSEA 1C3XA 2Q9CA 2OCIA 1TJNA 1TD1A 2HU7A 2RGBA 3R3JA 1US8A 2A0WA 1DVRA 4ZAXA 4B73A 1U9ZA 2VJOA 5I4IA 5LD2B 4Z0TA 2NZWA 3C6ZA 4ZCTA 4BLRA 7AT1A 5DF1A 3BQNB 5E9AA 3SHVA 4UPEA 1GPH1 2P4EA 3JZMA 4IFIA 3VXKA 3WK5A 1E2LA 4DWWA 4EY3A 1XYVA 2QE7D 3KKQA 4Z0NA 1Y4SA 1NYTA 4L02A 3GLIB 3C8ZA 1H4VB 5FV4A 2YRXA 4EK9A 2J67A 1RC1A 1VHLA 3AJ9A 1YQXA 2E1RA 3L06A 1SA0A 2FSFA 1Y7PA 5L9AA 2WHXA 5CLFA 4YAGA 3QEBZ 2NU7A 4J2OA 4BJ6A 1WY5A 2X9LA 3L07A 5EY5B 3WRXA 5AFSA 1JAIA 1ONBA 3AX6A 2XHEA 1X7YA 3EZ6A 3P2EA 4Q9AA 2VN8A 3RIMA 1KKLA 1G19A 3R0XA 3ZBPA 1T2EA 2CDRA 2B4QA 4CMEA 1OVMA 1QSGA 3AGQA 2W2QA 1SHLA 1YRHA 1Q1QA 2Q46A 4AL4A 3OE7A 5A3JA 2H92A 4RO0A 1EX6A 1WOMA 3A25A 3TK1A 4BZZA 3L6CA 4OLAA 4BNZA 4RVHA 1UPTA 2V45A 1MF7A 3NFYA 3OICA 4H0NA 4U0KA 5KX5A 1ZH2A 2VYFA 3E9DA 1T3ZA 2VSQA 3UPTA 4N39A 1CUHA 3U1TA 1C41A 3ZHYA 2WHPB 3ORSA 2C4UA 4Q47A 3D02A 3Q7SA 4ICIA 1RAEA 1NV8A 2P11A 1CRLA 1RZVA 3TL2A 4TWJA 3ZZ0A 4DM3A 4TMKA 3TQTA 2XUHA 5ALUA 2QM0A 4FYXA 4NE7A 5DM2A 5I9MA 5HNKA 2GNAA 2VJCA 1AOXA 4LOLA 4QXAA 4KJXA 4RXTA 5TARA 1YCGA 2HSGA 2JBWA 3N2YA 3URMA 4KC0A 2J0SA 3OH8A 4KRYA 3LE8A 1P9RA 1L5HB 3CF2A 1CB7A 3NC0C 1E2FA 2QQEA 2Z6VA 3IS3A 3CO0S 1AHPA 4P7GA 1KMCA 1WNFA 1QVAA 3N87A 2G7ZA 1V8DA 2OKCA 4ITUA 4YRRA 5E6RA 5BQOA 3D8BA 1ZJYA 3WXMA 4AP5A 2X22A 1A9SA 2GJ4A 2Q6VA 1IE3A 2H4ZA 3OT1A 2GKOA 4UEKA 4ZKDA 3JRXA 3R5KA 5TDHA 4OREX 1SXJC 1D2CA 1T5SA 3B6JA 3M4JA 4YMLA 4UDOA 2Z2XA 3QXCA 4QPNA 4WQMA 3EC2A 4ZAZA 3LRTA 2E1PA 2EU8A 1RSZA 3GRZA 4QXOA 1AQIA 1HE4A 3BXPA 3LQQA 4IS3A 4K05A 3N2GB 4G36A 1Z4MA 4JENA 4QRDA 4CV3A 3IP9A 1VYHA 2HCBA 2VKQA 4O0MA 4TS3A 3O0TA 2IKQA 2B1GA 1UBMS 3DOJA 3H1TA 3ET5A 2XUZA 2IK8A 4Q7JB 1ML4A 1TCAA 1DJLA 1KWGA 3LJKA 4II2A 2VS1A 2P2SA 1AA6A 4FXOA 4R83A 4AZTA 3L0YA 1VHWA 3WKDA 4BU1A 1UBRS 5HWSA 1LNSA 5HZHA 3MILA 4BN4A 4DWVA 3GPLA 2IW1A 3L4SO 5KVSA 4BEBA 4KFTA 3C14C 3OHMA 4ENSA 1HRKA 4G8BA 3M4YA 1OAOC 4RAOA 4WA7A 4O2AB 3H3JA 2Q29A 1W2HA 2E49A 2ZVPX 2D2EA 1R7RA 2FNAA 3JXEA 4HN2A 3BXOA 3WRYA 4DRXB 3H1GA 1T5IA 2FRVA 1G2IA 4RHFA 5B1SA 5KMGA 4PC2A 1ZHFA 3STTA 1JWAB 2IRWA 5JSQA 1I2DA 1U8CB 2QN1A 5FEMA 1O5IA 4FHEA 2EKQA 2A9RA 1WKCA 4J0EA 2WJIA 4LYEA 4LZLA 1W2WB 1ZBDA 1Z62A 4V2IA 3RFFA 1Y1LA 1G16A 2O0KA 4JJAA 4WBSA 3BHIA 2AKYA 3B9RA 2G82A 3W04A 4CE6A 5KKCA 3EHEA 2HL6A 2B2XA 3GRFA 3KEMA 2JK0A 4WFIA 3QIAA 3O21A 3IQEA 1ZQ9A 1YR8A 3HH8A 3Q12A 5D86A 4HXGA 2YN2A 2P9GA 4WOCA 1QDUA 3REOA 3TLXA 5B3KA 4UD2A 3QLVC 1FMLA 1R9NA 4Q93A 1KQPA 3W3ZB 2B34A 2YY7A 3MTJA 2NUPA 1FP4A 2WILA 4D81A 1GGFA 3NHUA 4LI0A 2V0CA 4G1MB 2QX7A 1MB3A 1NQ5A 4BRWA 3CIOA 4Q19A 2HJSA 2P7HA 1XL1A 1T6YA 4ZJYA 3TLKA 3TM4A 2Q6LA 3U4CA 1XF9A 2KLBA 4NWIA 1C14A 3VC7A 4BLUA 3ZJVA 4ISBA 1XNQB 1KEPA 2CXNA 4YA6A 5CVEA 3VU1A 5TS2A 4NXMB 3DDSA 4AUKA 1HY3A 3P71T 3INYA 5BMVA 3HB1A 5TSDA 1T8WA 1GILA 2LKDA 2XDQA 2R60A 3UGKA 4L9RA 3WE7A 5KTYA 4N5NA 3RS9A 3KL4A 4HQFA 4EH1A 1YV9A 1N2EA 1CQZA 4ESHA 2IH2A 1KFKB 1T3HA 2Y71A 3PVCA 3DMTA 2PRKA 4DV7B 1Q50A 1IJFA 4LV6A 1K6MA 1XALA 2FQXA 2QZSA 3MCUA 4ZYTA 1XRMA 2GBFA 3M6MD 4O08A 3QWBA 4PSDA 3WTBA 1TQ8A 2P6NA 2FRDA 4XM2A 1I30A 2ZYGA 1JTFA 3OQIA 4QM7A 3DFUA 2OUIA 4OP2A 4L3WA 3TB6A 4A8TA 4O4IA 2ADMA 4RIHA 2NYUA 2WWFA 3ZGVA 1OAAA 3N70A 4M37A 2B8EA 2ZJ2A 3ZKWB 3QRWA 4BQRA 1TKBA 4F9FA 2W2TA 5DEIA 2QG6A 5D5QA 4DCGA 3OJCA 3CX6A 4EGSA 3JQBA 3X0DA 1QONA 2J1LA 3ON5A 2PG3A 3CYFA 4LECA 1NPDA 2FGKA 4CDRA 1DHRA 1L4KA 2IYOA 3QZUA 3PPXA 4C4AA 2IYXA 4CU5A 5BN3A 4PANA 2GPYA 1DC6A 3VVMA 4XB1A 3I61A 3ZHXA 4N3BA 2GTPA 3O3MB 1KO1A 3QX7A 1OWMA 3HWWA 3OZVA 4KZKA 1FP7A 1E9RA 4JXJA 1WPQA 4JYPA 1JDNA 3KFLA 3LYLA 2KSQA 2VH1A 3UWMA 4CTMA 2Q50A 3PD7A 1LCIA 1NF3A 2JI9A 2NW6A 4A36A 3AKZA 4Z1MD 1HDIA 1WL8A 1BFKA 2ZAGA 4ENVA 5AVTA 3NYIA 2FVXA 4H4CA 1XRSB 4P34A 3QWAA 5DNDA 4D4HA 5AVRA 5IVKA 1C2TA 3BXFA 2OTCA 5FBHA 3L7KA 5JAPA 2A14A 4H18A 1JHVA 4UNIA 2W8ZA 2Z4RA 3F6SA 3M6VA 2CDNA 2MHCA 3QVLA 4CMHA 1K6EA 3DKVA 2CT8A 2VWGA 1E7MA 1XXLA 3OLCX 4XM1A 2A0YA 3PGKA 3E18A 1GPLA 5A0VA 1PFGA 7MHTA 1WSAA 1S6YA 4E33A 2V97A 1RRCA 3EF3A 4DJTA 1GFSA 1NY6A 5BRAA 3PU6A 5HKOA 1LU9A 1NQXA 1EB8A 2CL6X 1Z8DA 2MIIA 2W00A 1V43A 2XB9A 2XMQA 3EDMA 5FWDA 1P61B 2EJTA 4D6PA 4B34A 3IKTA 4DMLA 4D82A 4DNPA 5CA0B 3AO0B 5A4AA 3ELUA 1A7UA 3H8WA 4G1CA 4UXIA 2GHIA 2WIKA 1VE9A 2FPPA 4NARA 4RD0A 1K7YA 4KQ1A 2X9NA 3ZG6A 8ADHA 2H1RA 5EMHA 2OAEA 3PXAA 4W6QA 3ANSA 4J03A 2BBSA 1W76A 2XYGA 4DR6B 1VIVA 2HV8A 1NVGA 3T95A 4Q3KA 2D1RA 2PMBA 3HVIA 3ASYA 3DFFA 3DKIA 5F3WB 1PS8A 3HABA 4GOND 4AZWA 4F85A 1KJIA 1K2VN 5LU8A 4XSGA 1GKYA 1WBBA 3GUCA 3PS9A 1NRXA 4JGGA 5BNWA 3ELDA 4GXNA 4H7EA 1EE9A 1GGEA 3I64A 4FW8A 1S4QA 4I6EA 2B30A 4QRHA 1K63A 5B4TA 3ICQB 2YR0A 2A9QA 2ZIZA 2AUNA 4CM9A 2XWJI 1DAHA 5AVSA 4NMLA 1RWOA 3IPLA 2OV1A 1G4HA 4WBXC 3SM3A 1TKCA 2G09A 1T5BA 1UZLA 4EHFA 1VG9B 1RMTA 4D80A 2EBHX 4AF8A 2HDHA 4BTLA 5JSYA 3HBMA 3T5MA 3WKEA 4D45A 2BEVB 1IJBA 3AWIA 3LSYA 2E18A 1OTHA 2PD4A 1EM8B 3HL0A 5B3AA 3GBPA 2QN8A 3H9UA 4KXYA 3NHKA 3HVHA 1EU1A 4JIMA 3UMVA 3BWMA 2B1JA 2F1JA 1YJQA 3BWEA 4G56A 1BU5A 3F47A 3V8NA 1P2GA 1PF7E 3DEAA 1EA7A 4CR7A 3E8XA 3I01A 4UHBA 4KO3S 2L18A 4LJ9A 5KTTA 1Y9AA 3NOOA 4IKOA 5A2QA 1ZJ4A 1MEEA 3BSFA 1Z6YA 1RQ2A 3RJZA 1DEOA 6LDHA 4CKCB 5I7OA 3TF5A 4PLWA 4DDMA 1UADA 4ZAYA 5EIEA 1K3TA 4F4JA 2F6RA 4MIYA 5GONA 3E5HA 3RYHA 1YL5A 2PZFA 4B3GA 4X44A 2I2AA 1RAFA 4ZYVA 1TVMA 2E21A 5IM4A 1N2CA 2QX8A 4BCDA 3MNFA 4WKNA 2B3DA 4BX2A 2BFCA 3K1ZA 4PYMA 2ZBFA 4JI2B 1JPNA 3K94A 4HXEB 1GSIA 3BZUA 2H17A 2VZLA 3U3DA 1DMSA 4KE7A 5FNVF 3RK4A 3T12A 2WE8A 3U13A 4EHJA 4R8KA 3HYTA 2I2CA 2HADA 8GPBA 4FW9A 1D03A 2YXPX 2XRFA 1ZRMA 4WXRA 3B3QA 1U8UA 2DFLA 3OJ0A 2VF7A 3ZD9A 3DC7A 1E1MA 3WQBA 5FUMA 4AB1A 3CUTA 4ZHQB 1FRFS 3FHCB 2M6LA 4BBPA 3NH6A 3A1TA 1TYEB 4CEHB 2O6LA 4MYSA 1CUDA 1HDYA 1HEIA 4RA6B 5AH0A 2G9VA 2XBLA 4X91A 1TUEA 3ISJA 4DM7A 3LCJA 4HWSA 4ZVLA 4BVLA 3R40A 1PL7A 3ND9A 4N7JA 5LYJB 4IIGA 4FZVA 3E3OA 1G3IA 3SF8A 1D09A 2Z5FA 2Z95A 2XCOA 4HK4A 1KY2A 1JHYA 1YIOA 1OI7A 1U2DC 2RKBA 2UYOA 2HMAA 4M4SA 4PGFA 2PGOA 2Q5OA 4BO5A 2BUCA 3V1TC 4E46A 2ORYA 3H5RA 2GCEA 3EMKA 2VZ0A 2AJ8A 3GIWA 3MXTA 4YJ2A 1FXWA 1O6BA 3I5UA 1II8B 4HYEA 3WGQA 2ZJZA 4WJZA 3ACCA 3BX1A 4O25A 4ASUA 1GPNA 1J0CA 3ZW8A 2X4IA 1HYEA 5B6IA 1TLTA 3JQFC 4AJPA 1JAHA 2ZBEA 1RJWA 2DWQA 1E58A 4Q9LA 3ZE1B 1I32A 1MIHA 3HXPA 4QC2A 4RTKA 4XGIA 4GUDA 4MDHA 3IULA 2JJQA 3N3BC 3F9CA 5JRJA 2OCKA 2YZ2A 3K32A 5LZ7A 3TMKA 5E7JA 4UOQA 3WYNA 3NOVA 1O58A 1Y1SA 3ZLTA 1Y98A 4FONA 1RHQA 3LBYA 2AS0A 2V7QD 4YJFA 4BX9A 2ZWAA 5HA5A 4LFAB 3L0BA 5BV7A 3LWNA 1JKJA 1OPRA 2YHIA 2CYCA 1EDBA 4G2NA 4UEQA 5JAQA 4A0GA 3D43A 1L5KA 1PD0A 3MZ0A 4AICA 2HT1A 1KVTA 1LPAB 1PQPA 1OX4A 1Z5NA 3CA8A 3DL7A 3FJOA 1Z0IA 1T9GR 3FPFA 3GT0A 3LCCA 1ZUHA 2VPQA 3FHLA 4K86A 4HEA1 2FEXA 5LUBA 1HQCA 3DMHA 4JIGA 1RJDA 4M9XA 2JAPA 2RIRA 3ZEIA 4MW4A 2SKDA 3A0UA 2XZPA 1XP5A 4GL2A 2EZTA 3C1UA 2BT4A 2R62A 4BXOB 1Q11A 3SZRA 3PEYA 3B6MA 2BSAA 1M2HA 4R3UC 1LQTA 3A1FA 1W88B 3MRVA 4EG1A 4CLOB 1JQEA 2C97A 2JLUA 2FSVC 4YMHA 1O5OA 2O2DA 3JASB 4TYNA 5CFNA 5KCMA 1U0EA 1ZUNB 2AD5A 3IUNA 3JQ7A 4ITVA 1YDWA 2NTNA 2JDID 2XD9A 5K0FA 1FCJA 2VXOA 3OM9A 4BLTA 1ELOA 1YDEA 2EW1A 3RRJA 3ZV6A 4YMVA 5DM4A 2PD3A 4L75A 2OD9A 1HOTA 2QAGC 1KFEB 1MV5A 3F3KA 4ND1A 4YK7A 1TZCA 3VNSA 2WNHA 4G0QA 5AI0A 3ZQ6A 1F1BA 2C2YA 2AN3A 2ADOA 1E94E 2R8BA 2AK2A 2XVZA 3AIMA 5DVZA 1ODLA 2JAQA 1MNAA 3CR8A 1FFAA 1VPTA 4KNWA 4OBXA 3O8RA 4RW0A 1FFYA 4BO6A 2YDYA 1CVLA 2O3TA 2ZRCA 1J33A 1JE0A 1P6UA 4I99A 4WERA 1I0IA 5ER6A 1SCNE 2H4JA 5LKAA 5L4NA 2FN3A 4JR1A 4PRYA 5CJ2A 5HJ7A 3QXGA 4QICA 2O4UX 3ADDA 1CR2A 3WQHA 2C84A 3JWGA 2CLIB 2XMRA 3GFSA 3QY0A 3K0AB 3IB3A 3FYDA 3OBBA 3OT4A 3P2JA 2HXGA 1HZZA 3NR2A 2OE2A 4WNYA 1P4JA 3HB7A 1YR7A 3WZLA 1STOA 2G08A 2R1TA 2GUGA 4HWOA 4Q1BA 1GQOA 1XHLA 2X4DA 4Y6QA 2O3QA 2ERXA 5KS2A 1OI2A 4L74A 3UG6A 3VR0A 5L4SA 3DW3X 4JQOA 3QSGA 3S5JA 2AEFA 5BWLA 4PNHA 4NJEA 3HS3A 2B6NA 1X9HA 3PUVA 4F3CA 5BYBA 4ZMSA 3ZYCA 2VCEA 1CBUA 4PX5A 1JXAA 1Y3BE 5I7SA 3D0KA 3M82A 4EG0A 1LNQA 1YZGA 4PNPA 4RA9B 3H6GA 4AYTA 4YRZA 2YTZA 4ZICA 2OHGA 2O8EA 2A3RA 4HGZA 1DAOA 1KSFX 2YJTD 2V6JA 3PDWA 1IK6A 1OAKA 4MLZA 3LD9A 4WOBA 1DOHA 1GRRA 3AERA 5EWJA 5BT9A 3T1QA 5BVGA 2H2IA 1CJMA 2I7DA 3QKIA 3M3PA 3V9PA 1U4NA 2QPLA 4IIJF 3KB8A 3PRYA 4TLEA 4KIJA 2FKAA 1XKTA 2ZYAA 4JDPA 1TVEA 4DEVA 2QR2A 2Z3WA 1CZNA 1A2BA 5JSKA 1DXYA 2O3UA 3VNAA 5JS6A 3FFXA 2O7SA 4R2MA 3FVRA 4TMYA 4P2GA 3TS1A 1M75A 1GCUA 2AMFA 4JT4A 1SWWA 1G5QA 4MQ4A 1BCSB 4R9SA 3NG1A 4HNTA 2H9AA 3WNZA 1S3FA 3Q2IA 2PVCA 4ZOCA 3DD5A 4B33A 4XIFA 1BSVA 3TMAA 1Q0RA 1JZQA 1R12A 1V1RB 4GQAA 4NQZA 4O2BB 3P0JA 3RR2A 2C2KA 1FYDA 2HSDA 3IJRA 3RVOA 4U2EA 3D4PA 5BV8A 1GNRA 2P2DA 4J29A 3RTEA 3BB1A 2PRSA 3WIBA 2NSYA 4AQYB 1KKMA 2C3MA 3KTAB 5FBKA 2NTVA 3OOHA 2JIPA 2AOTB 3GD5A 5D01A 3ZE6A 4P8RA 4AYXA 5ELLA 2ZRIA 3TLGA 1KR5A 2HO4A 3N0XA 5C3UA 3TJZA 3TRKA 4CM6A 4OJQA 3HU5A 3MC1A 1SNYA 1J0EA 2CXRA 2VWQA 3HE3A 3PK0A 4ADSG 3L8GA 5HUJA 5IASA 2H7XA 3ETGA 5BYJA 3WGIA 3PNBA 1JT9A 2ODPA 2PMCA 3ZUPA 3IJ5A 2RK6A 2UYQA 3NHMA 5CBPA 4PRKA 5IWAB 3RBVA 1E2HA 3FFWA 2XT6A 4LF4B 1DU4A 1TFRA 2A5YB 2X7HA 2PHZA 4PQYA 4REMA 4BLSA 4C14A 4WOJA 2OCBA 2J9RA 3L5KA 3VSCA 2H2FA 5U1PA 1FTSA 2CFSA 1CR0A 4Y6LA 1MV8A 4YPVA 5HZGA 4A9AA 3HLYA 1GFIA 1LPNA 2HJ9A 4NI5A 4TWIA 5IKMA 1LVUA 2IIBA 1GTG1 2FEOA 2Q2NA 4JU8A 1WEKA 4BGUA 721PA 1VL6A 1W49A 4RNDB 4F1KA 4EI8A 3KQNA 2YMMA 1J90A 1SVKA 5KC8A 3E3AA 2WUGA 4KKXB 3OF3A 5LQMA 3OQBA 2IWRA 1DBRA 3AUJB 1NNEA 4G24A 3TVDA 3OQVA 3X1YA 4A26A 1HFEL 2FR0A 4WY5A 3CW2A 3DAHA 5EE3A 4RTPA 1UBUS 1TA9A 3PC7A 1L9KA 4RS4A 2RJNA 1Z28A 2DBYA 3AVOA 5J5CA 3W05A 1CRPA 2NWQA 4FS8A 3W7AA 5HM6A 5F1PA 3UGTA 2B37A 2WPNA 4ZO6A 5JCPA 4RGVA 5ECGC 4UE2A 1JJBA 4MVJI 1WXFA 1AXRA 1ESDA 4C9BA 1R6UA 4FS3A 5FPQA 5EZYA 1IM5A 3DYBA 2JVKA 2PKXA 1BN6A 1VLLA 4N0MA 4RC9A 1JEYB 4HVCA 4IHKA 2SKEA 4F46A 3LU1A 1UBCA 3PYXA 4RJ2A 2WWWA 1ZK4A 4ZVPA 2CSXA 1A9YA 4LYHA 1KDVA 5B5SA 1K8RA 3ZE0B 2VPWA 3G8YA 4PLPA 3N6XA 3TZEA 4TWZA 4B6QA 1NUPA 4QBHA 2HWXA 1UPUA 5EE1A 3UAZA 1N33B 3FVVA 5F5LA 2A0FA 3BMCB 3K8YA 4JQSA 1BU8A 1XJWA 4DR2B 3Q1LA 5I4CA 1XE3A 2O2SA 4PG5A 3RUCA 1AHHA 3GLGA 3ZBUA 3AEUA 3T0IA 5FLXA 1M1YA 3CGWA 2EHJA 2PGXA 2ODEA 3EEQA 3GLRA 1F8YA 1P7PA 2A5GA 1J20A 1S0UA 3D4LA 2TSYB 1EGQA 4GSYA 4A3SA 1Y3FE 5I7VA 3SC2A 1M5UA 4FEGA 1HFJA 2WUVA 2Y1DA 2W0MA 3ML1A 5DCYA 5LM3A 3EDQA 4HEHA 3IDQA 4QDZA 2YFKA 2B8TA 1Q0HA 1Y8QA 4MZDA 5E0KB 3ABQB 4LDNA 2BRUC 4H7KA 2NUAB 4G0PA 4L95C 3EUFA 4GOOD 1B8PA 1Y5NA 3TIXB 4H0CA 3ZLBA 2DTEA 4FIZA 4MPRA 4DZZA 4F0JA 4B3XA 1IQUA 5EXEA 2G28A 2OM2A 4QJIA 3RUPA 4OA5A 3BA1A 3E7XA 4IIUA 4CQMA 3G2HA 4KK3A 3SXUB 4LJSA 1C1XA 3H9GA 1QJ4A 2KI5A 3ZD8A 1PKXA 3VJLA 4KMOA 1XTIA 5KKAA 1AGRA 1XT6A 5IN4A 1PTJC 4DA7A 5JCZA 2BE9A 4RVCA 2JBAB 1WZ2A 3OIVA 1UXOA 3ZJ5A 5DIZA 4X8OA 1SCIA 3W8DA 1U1DA 2Y0BA 5FORA 4CV2A 3RYIB 1WW3A 4TXNA 1I2BA 1NOIA 2H9IA 2X5KO 3BK7A 2BGUA 1SXJA 5F1OA 2FV8A 5EG5A 4E4RA 3R0ZA 2W2KB 3QNUA 3FWZA 1Z68A 2N1BA 4QLBA 4B0PA 2NV0A 5CH8A 3AJDA 1R1DA 2EKZA 3MYYA 3H8SA 2W8BB 3WBBA 4BFSA 3WB9A 1J7KA 4ZI7B 2WJJA 2WYOA 1BWPA 4ZI7F 3CW9A 4E5SA 3MGCA 2H16A 5CNMA 4MS1B 1HQKA 3VZPA 1L5QA 2JGDA 3DDOA 5CFRA 4RWZA 4DZRA 2EFYA 1FLDA 2NXNA 1RYNA 2FUKA 2OQ2A 3S1LA 2BBTA 2QZ9A 1FNBA 3GFRA 2AJCA 4B3JA 4KWCA 1V8OA 1EVYA 1X7XB 2F3UA 1EX1A 2WZCA 4GVXA 5C52B 1UAAA 4BRSA 2WJWA 3OFNA 1IUNA 1OBHA 5DTMA 2FEMA 2Y4NA 4Y1EA 4B3FX 4MKFA 1QH0A 2Y0CA 3MTGA 3N05A 4PYQA 5A3RA 1ZGCA 1KOGA 4LE2A 2IHJA 1RXYA 2C42A 3I04M 1A9PA 5LMUB 4JYZA 3AFIA 5L3QB 3EA0A 3PHCA 4FMPA 2QUIA 1ESCA 4IOKA 4BJ1A 1Z7WA 3CONA 4PLCA 2R6DA 4YLGA 1S3GA 3F3YA 1NT4A 5KYUA 2M32A 3TR0A 5SYAA 2QMHA 1LDEA 3BRWD 3K09C 3OQHA 3PC4A 1KYZA 3PI6A 4J7CA 3H1AA 5DJ5A 3L8ZA 4GKAA 4TS1A 3A3NA 4BP9A 3WLRA 5JWRA 3H11B 1J2JA 3IR7A 4JT8A 5EOVA 3E8MA 4P38A 3F6YA 4Z4QA 3DHYA 5FQNA 1JHPA 4OGFA 3VU9B 1PLJA 2HLPA 4TM8A 2NPIA 3QLVA 4ZMRA 4QNRA 4C21A 4KXQA 3A9TA 1XMPA 4AUEA 4LZNA 1FU8A 1MO4A 5FI5A 5IBQA 4G07A 1P2DA 3K70D 3B78A 1VJ1A 3RS5A 1A97A 2VDOB 4JB0A 4JI6B 2QTVB 1N9GA 3IPCA 5FOQA 3UK2A 5KJ1A 1AV7A 1Z6TA 4O4JB 4YXFA 2YWDA 1N9ZA 1PG0A 1UFVA 5G1OA 2ICAA 4LWPA 4O4JF 4URWR 3FI9A 5E2AA 3F4BA 4GPZA 3B9PA 1UM8A 2IYFA 3WGZA 2I4LA 3G49A 4N7BA 1J70A 4YJGB 3STVA 5SY9A 3UMRA 4KNYA 4ZCRA 1QF7A 2FHPA 1RJEA 2VYND 4HQLA 2RSLA 4IIDA 1SURA 1YBFA 2PXAA 2WAXA 4RCZA 1XIVA 4B85A 1GNTA 5TPZD 3ZNOA 1C3OB 3KPUA 4DB4A 3LY5A 4IQ0A 1YRYE 4ARSA 4AZ0A 2B94A 3L40A 1VJDA 3GEMA 4MW2A 3RKSA 3U3JA 5CB0A 3HLKA 2EKDA 2GD2A 4MVJA 3SYRA 4IV5A 1I5EA 2MSKA 1NZDA 2YCLA 3QPAA 1Y9JA 5AUPB 1GHTA 2H11A 3GVPA 3KVYA 4FBGA 4M7OA 4CG3A 3R6LA 5AIBA 1IN1A 1MHPA 4JL5A 5A1TA 1IM2A 1IXRC 4J4BA 3RM3A 4FI3C 3PFWO 2AMJA 4R2XA 4IFTA 1OXTA 3C43A 5T4BA 3DE6X 4RX1A 3X1KA 3OETA 1WB4A 2HJRA 1V4BA 3ESCA 4KQGA 3VOBA 5AR1A 1Q95A 3DHWC 4Q9DA 4BASA 4KIGA 4A8HA 4AX8A 2ZQZA 3ZWQA 3EMBA 4G4JA 1E6UA 2C9MA 4ZANA 2NZVG 5KYYB 3SFVA 2H54A 4B3SB 5KJCA 4DQLA 2PWPA 4FYKA 3ONFA 1JPJA 3MWEA 1I14A 1Y1KE 4DYDA 4C3OB 5GVRA 1HNZB 5HF9A 1I0ZA 4TTAA 1NVFA 1CSEE