4MGQA

Pbxyn10c cbm apo
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
159
structure length
159
Chain Sequence
QVAYLNSLITDPNATKHVLYIHMGEPKTNNWDRELYVNPTTELQSGKTYTLKLRVKTSAACDVTVWPQGDATQYWPTPSFKSTTEWTTVAQAFEAKSALKQLRFELGTLGGDIWMDDVQLLDPDGNNLIANGTFEENADGWTKPSWHEYEIKTVADPDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Xylan utilization in human gut commensal bacteria is orchestrated by unique modular organization of polysaccharide-degrading enzymes.
pubmed doi rcsb
source organism Prevotella bryantii
molecule tags Hydrolase
molecule keywords Glycosyl hydrolase family 10
total genus 30
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2013-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4mgqA01
2VCBA 1JU4A 1UXXX 3ACHA 2HLEA 3LEKA 3OGSA 3NNGA 4CU6A 4XURA 2QQJA 4XUTA 3ACGA 2W94A 1SHWB 5DQ0A 2C26A 3WNMA 3HNMA 4E8CA 3NJXA 2J1SA 3ZM8A 1GOGA 1IQDC 3OEAA 2WBKA 1BHGA 4MGQA 3VD5A 5JXJA 4KMQA 1O8PA 3NRUA 1XNTA 3T2QA 2RVAA 4OZOA 3ETPA 1JZ7A 1UY3A 5B4XA 1SDDB 3WEZA 1NAEA 4OMCA 2B4KA 3BGAA 3W5NA 2J1UA 2Y8KA 1JHJA 1W99A 2WYSA 2LW8A 2XOMA 1H6XA 5IFPA 5JR2A 2J7MA 1UY2A 3C8XA 3PUHA 3K4DA 1J83A 3K46A 4M4PA 3WQBA 2EIDA 3UNPA 2DDUA 2VMFA 1JYWA 5LA1A 2QQMA 3CKHA 3HEIA 1W8NA 3ABZA 4DEVA 2Y6JA 3I2GA 1R64A 3C7EA 3DYMA 3GM8A 4CUCA 2E33A 3IDAA 3UETA 5IYYA 2DCKA 5IHRA 4CUAA 1PMHX 1XC6A 1MPXA 2WDBA 3VD9A 1JZ4A 5JXIA 3T2OA 5EJZB 3A22A 3DECA 4XUNA 3FHQA 5I0DA 2EIBA 3IAPA 4QX0A 3VD4A 1OF4A 2W3JA 4TTGA 3MO4A 1JYVA 3CDZB 3HNYM 4JX0A 1UYXA 3C7OA 2W1UA 1UYYA 2VM9A 1RYYA 2E31A 2VZQA 4GWIA 4QX2A 4MO3M 4XUQA 4DXTA 2JD9A 3A7QA 4QB6A 3VDAA 4JKMA 3CIHA 2JDAA 2VZPA 3I3DA 3WNNA 3HJRA 4UAPA 1DP0A 1JZ6A 2VZOA 2WZEA 4D0QA 4JKLA 2ZEXA 3CZJA 2J1TA 5DN2A 4BJ0A 2EICA 2C4XA 1GOHA 1JYXA 2RJ2A 5JXHA 3IIIA 4OMDA 3WF1A 4CU9A 3HNBM 2B9VA 2WQ8A 3D3AA 2YC4A 4QDSA 2WN2A 2DCJA 2YFZA 2W1WA 2WAAA 2VMEA 4QDRA 1DYOA 2BBAA 4E8DA 3K75B 3T0AA 3P6BA 4RN5A 3OB8A 1NUKA 4W50A 3T2PA 1K45A 2XQXA 1WKYA 3ECQA 1XPWA 1UWWA 2LS6A 2VCCA 4A45A 2BZDA 3THCA 1PX4A 4MADA 1OT5A 4XVHA 4L0PA 1H6YA 4AG4A 3WNKA 5LCWL 1GQPA 2ID4A 3EYPA 2QQNA 2J22A 1I5PA 3ACIA 4QPWA 4CUBA 5C71A 4KWUA 3LPGA 3FN9A 4A6OA 4D8MA 1CZTA 1GMMA 3OGVA 1UX7A 5FUIA 4JHZA 2WO3A 3VDBA 1UXZA 2WZ8A 3CZUA 3OEBA 3AC0A 2J1RA 3T08A 5G04L 1W8OA 2WO2A 4PT6A 3I97A 1DLCA 1NKGA 1UZ0A 4ZZ8A 1J84A 3T0DA 2Y6HA 1CZVA 2W5FA 2VO5A 3T0BA 4RYDA 1JZ2A 1SG3A 4ARXA 2QQIA 3HN3A 1W9SA 2X09A 1P8JA 2QQLA 5DMYA 4LPLA 5HXMA 1OH4A 2W47A 2Y6GA 2XONA 5A1AA 4Z2AA 1F4HA 3FHAA 3LQCA 4LQRA 2V4VA 2VMDA 4PF1A 5EJ1B 2J1VA 5IFTA 4BK4A 4P08A 2E32A 3SEEA 5LA0A 3A21A 4BK5A 4GZ9A 1W0NA 3K4ZA 3LE0A 2HYXA 2ORXA 3GXUA 1KEXA 2E26A 3C7HA 2W91A 3GDBA 4BDVB 5JMOA 3E1F1 2BGPA 3WF3A 1EUTA 3UESA 1F4AA 4QB2A 4ET7A 3DYOA 1JZ5A 4OUEA 4A4AA 3NJVA 5J1XA 3IB3A 1GU3A 5DPNA 4OYUA 1NX9A 2ZXQA 1JZ3A 3CQOA 5CZKA 3SKJE 2V5DA 2J1AA 1K12A 3K4AA 4CVUA 5G05L 1GOFA 2BGOA 2V72A 1O8SA 2VJXA 4XZUG 1JZ8A 2VZSA 2WO1A 1EUUA 2VZ3A 3MUZ1 1ULPA 4M4RA 4IUGA 4W8JA 2KD7A 2RV9A 5LA2A 4DXSA 1W9TA 4PQQA 3ACFA 5JXGA 3I2HA 2YFUA 3P1IA 4AAXA 2QBXA 2VZTA 4YPJA 3I2JA 1UY4A 4JKKA 1JI6A 2JE8A 1OF3A 3U37A 1L7QA 3LEGA 1K42A 4MOAA 1O59A 2XHNA 2C9KA 2VR4A 2ZEWA 3I3BA 3VDCA 2ORZA 3OGRA 2WABA 3PUIA 2L9LA 4P00B 3HOBA 4P5YA 3VD7A 2Y64A 1US3A 1ULOA 1D7PM 2VOTA 3THDA 3VD3A 3F2ZA 5HPOA 4KI5M 4UOJA 1US2A 2Y6LA 3BN6A 1PX3A 3LEIA 4DUWA 2CDPA 3SEPA 4ARYA 5JUVA 2W1SA 3C7FA 3I3EA 3DYPA 4QB1A 3I2KA 3C7GA 1HN1A 1TG7A 2YG0A 2JKXA 4ZXEA 2QQOA 2VZVA 2VZ1A 4LHSA 2YB7A 1UY0A 4DUVA 5F7UA 1WCQA 2Y6KA 2VMCA 2ZEZA 1UMHA 4CU8A 2W95A 2WN3A 4W4ZA 4GWJA 1UY1A 1W9WA 5IJRA 4A42A 1K3IA 4MGSA 2WAOA 4CU7A 3IAQA 4DXRA 1UYZA 4TXWA 2VC9A 1GNYA 3WNOA 3FL7A 4QX3A 4A44A 3EB7A 3MUY1 4ZY9A 3W5MA 2W92A 2R7EB 2VL4A 3WF0A 3MV11 1XNAA 4A41A 2VZUA 2W9XA 3OBAA 5C7GA 1YQ2A 3CMGA 1GUIA 2X10A 4LKSA 3HPNA 4P02B 2X05A 3K77A 4XUOA 1LNSA 4BXSV 2W87A 2OKXA 1CX1A 3T09A 1JYNA 3OG2A 2VCAA 1UMIA 1JU3A 3LPFA 1PMJX 3WNLA 5EIYB 1CZSA 3NQHA 4ZZ5A 2PQSA 1L7RA 4A3ZA 4QDQA 1OD3A 4QX1A 3I2FA 3MBWA 1TVGA 3A23A 4QAWA 3WNPA 3WSOA 2QQKA 2W46A 3I2IA 2J1EA 2W1QA 2VQUA 2YC2A 5C70A 3WF2A 2CDOA 1KGYA 2VTFA 3J7HA 2VZRA 1CIYA 2WUHA 5CYYA 3JXSA 2BERA 4XUPA 4DUXA 3SKVA 2ZEYA 4DEQA 3MV01 3WF4A 5B4NA 1T2XA 2VQTA 4FI9A 2Z4FA 4UI9L 4HG6B 2EIEA 3GGLA
chains in the Genus database with same CATH superfamily
3NVCA 2JG9A 2VULA 3AP4A 2JX9A 2VCBA 3ILFA 3ZSKA 5JZGC 2BP6A 1UXXX 2B7YA 1JYCA 5GLZA 5FYHA 1XE0A 3ZKYA 5A7SA 4CEWA 1O4YA 2QQJA 2HEYF 2WT0A 4QMAA 4URTA 4XFHA 5J96B 4XUTA 1H2MA 4G3YC 4HMZA 2R0HA 4UBHA 5BNNC 5D8AC 5SV8A 2E9QA 5DQ0A 3M70A 1D0HA 1J1LA 4OHVA 3B00A 3OBZA 4XIKA 4LK7A 4E8CA 3VBSC 3NJXA 5ERLA 4Q4V2 2WKKA 1Z7S2 1IQDC 2BU9A 3FFQA 3OF1A 1FPN2 2WBKA 3AYCA 3QOPA 1MACA 3WG2A 4PJYA 1XRUA 2D6KA 3VBSB 1HXS2 1UY3A 4ORFA 4Q8KA 1R1ZA 2VNOA 2VU9A 3NAPC 3O1VA 5CFCC 1T6GC 1W3XA 1W8TA 1IKPA 3N9NA 4Y5Z0 4NMIA 5GLUA 2JIGA 3BGAA 3H1WA 5D8AB 3I59A 4HKLA 3UGHA 1U5YA 4X8NA 2UWCA 4XDQA 1W99A 4BMBA 5FZ3A 3MYXA 4COVA 1HDKA 2YYOA 5DUVA 4GJZA 4CCDA 4HL0A 5IFPA 2W68A 4MX3A 2HKXA 5IVVA 2UU8A 3O0XA 2BBVA 1UY2A 4D69A 4CTEA 4M4PA 1DIWA 4Z2WA 3KHCA 1C3HA 5A6XA 2VGDA 4YZ5A 1HB1A 4CDQA 3ALQA 3B94A 3FLTA 5LA1A 2GP3A 1DZQA 4QM8A 3PURA 2GDFA 4FOVA 1NA1B 4HT1T 4IV1A 4LLFA 4Y22A 2D7FA 1W8NA 3G7DA 4P14A 5CKQA 2IVIB 3LD8A 4JZRA 3TNQA 4SLIA 4DEVA 3KQRA 2ZX0A 1ZBA2 3I2GA 3O1MA 3B5LB 3LKJA 4GMP1 2E33A 5IYYA 5IHRA 4NHLA 3POBA 2R041 4OULA 5KBFA 2SLIA 1XC6A 2ZX1A 2NMNA 4NO4A 3JB4C 1WCUA 3IZOA 1S0GA 4YFWA 1AR62 1IPSA 2H0VA 4J6GA 1PNFA 4GAZA 4WVMB 1X9PA 1Q56A 3KZ4C 3RJRA 2A6YA 4M0NA 3E5QA 4Q0UA 4QPIC 3A22A 5C6CA 5K0UC 3DECA 4XUNA 5FY7A 4COYA 4KU8A 3IWZA 1BVVA 4QX0A 4LORA 1YIPA 4NVPA 3UYJA 5APAA 3MO4A 2XVKA 1NCRB 1UZZA 3MZHA 4LLOA 3E6BA 2HWB1 3HNYM 4JX0A 5ANQA 2AREA 1NG0A 4RGKA 3RDIA 4AVCA 1UYYA 5E16A 1RYYA 1TMF2 2RS51 4AHZA 1NZIA 5FJKA 2JD9A 5FZIA 1H8TA 4JKMA 3CIHA 1BMV2 1R092 1VAKA 4IE4A 1ENXA 1EPZA 2GSYA 5C9AC 1BVP1 1UOGA 3HJRA 4K21A 1JZ6A 5LBBA 2EXHA 4I3PA 1REFA 4LO7A 1DG6A 1YO8A 4XFIA 2HWC1 4WVWA 1G7YA 5D21A 5BXXA 4QPGA 1DHKB 4AQ2A 3RZLA 4EYUA 4FPFA 1E5SA 2ZEXA 2IXHA 4A6SA 3CZJA 2JB8A 3KVBA 4BJ0A 4ZXKA 2C4XA 3D5OA 5I0RA 2GN7A 4E9KA 1ZZ7A 4CDXC 2FDJA 4Y1XA 4B3NA 3VBOC 2HWD1 1CPNA 1A3KA 1XNDA 5JXHA 2ZJCA 2WNUC 4XJ9A 2WWSA 5T52A 1AX1A 1QIQA 1XE7A 1OH3A 1YUDA 2B9VA 2OVUA 2R042 3BALA 4PF5A 1W05A 4JAAA 2Q8CA 1BEV2 4C0BA 5LZ6A 2YC4A 4XAEA 1G86A 4XW3A 4RR3C 2VOVA 2W1WA 2C9AA 1V6MA 5I8YA 4IE7A 2AENA 1QJX2 1DYOA 1QY4A 1S0DA 2BBAA 4B4PA 1W8ZA 2XHKA 1OD5A 4QQPA 3HQXA 4HVRA 4IEOA 3VKMA 3ZMOA 4XBNA 1O3QA 2WZR1 1KITA 1ULDA 1A8DA 5GLVA 1JHNA 1PK6B 2I74A 3I8TA 4TWTA 1KDKA 1MS0A 2X53S 1NUKA 1V6JA 1YNAA 4LBQB 3LOBA 2P6CA 5SV5A 1BEV1 1PMIA 2O0OA 2WSUA 2RR12 2XQXA 3N7MA 1WKYA 2CAVA 4LA2A 4QHBA 5FLJA 4AEJA 5L7OC 1QWRA 2K9ZA 4XE9A 4Y1YA 4ES9A 1N3PA 2JE7A 1HRI2 3TEWA 4A45A 2GNTA 3THCA 5J37A 3PL0A 1YWKA 2BFUL 1MZ5A 4MADA 1OT5A 5FAXA 1WMXA 4NWVA 3SLIA 2RMU3 5FZFA 1H6YA 4JGZC 3WG4A 3IDCB 3W5NA 2KM2A 1GQPA 1KDMA 3GBWA 5BUVA 2QQNA 2RHPA 1I5PA 2D6PA 3O0VA 1PVC3 4HK8A 3LPGA 3IT8A 4YNIA 3KV4A 4D8MA 1CZTA 3OGVA 3R0RA 4B8EA 3FLPA 4OVEA 4JTNA 2Q8OA 3GZTB 1CAWA 1ZBE2 2ZGLA 3KT4A 2WO3A 3MW3A 1UXZA 3WD5A 3DN7A 2WZ8A 4NAMA 1RHI3 1ODMA 2ZGKA 2RS52 4RQPC 1AYN1 2IC1A 3NV1A 3AYAA 1CX4A 2WFF3 1UU4A 3RJ2X 4XJ8A 2RG4A 1S0JA 2XBO1 1W8OA 2GMEA 4PT6A 3I97A 3QD6A 1HQLA 1NZCA 3B9IA 5GZDA 1XU2A 3AMPA 1UZ0A 3POIA 1J84A 4RHV2 4R4XA 3ZYJB 3VKOA 3WDVA 1CZVA 1UAIA 5BNOC 3N9OA 4Q5OA 3D0SA 4AQSA 4H2AA 2PQQA 1XBFA 3N7LA 4RYDA 5DUXA 1AR71 2E7TA 5F9TA 5LA9A 1UYPA 1AL0G 2RDRA 3AL5A 3PLQA 3UV9A 1WLWA 1RUH3 4LBLA 1LTEA 3VHOA 4L9BA 2X09A 3VBSA 4UW6A 1C28A 3WQ1A 2NYYA 5HXMA 1OH4A 4AI0A 1JOBA 1QJX1 1LECA 2AH2A 1W2UA 3PUAA 1GP4A 5M0TA 5K0UA 3HBKA 1RUC3 4AHYA 1ACCA 4LBNA 2ILMA 2EF6A 1RUG2 1VBD2 2R16A 5FZMA 2A6XA 4LQRA 1DZRA 1H30A 2GN3A 1G6NA 1PGW1 1WCDJ 3OUJA 3X29B 4ZU5A 1WW4A 3C3VA 4OI2A 4BK5A 1YCIA 3ZN5A 1R081 2CWSA 1VBC3 1HB2A 2YPDA 4PIXA 4Y4RA 3LE0A 1G9FA 4NIIA 4OI4A 1IS3A 4WM8B 3GXUA 2QE3A 1KEXA 3CO2A 1CAXA 4Y1VA 3USUB 1AR93 1JN2P 1WLDA 2HWC2 4DY3A 5A3TA 2D3SA 3BOWA 4JDMA 5JMOA 1V6LA 1MR5A 3WF3A 4BIOA 1EUTA 4H3WA 1QOTA 5FIXA 1XNKA 4XABA 3K51A 1JZ5A 1OOPA 4YGCA 5J1XA 3H50A 5FTTC 1GP6A 1OMIA 4O9GA 5LBEA 5CZKA 5LRRA 5FK7A 1K12A 3CBNA 5EJ3A 3ZXGA 1KRIA 4I02A 5G05L 2G9ZA 4E2QA 1FXZA 3T2TA 1CN1A 2WWUA 4AI8A 2DU1A 2XH6A 3U14A 1RUC2 3ZFGB 3RZMA 3C2UA 4QKFA 3S6PA 3WY6A 4FTBA 1F2NA 4WM8A 1XE8A 4DY5A 1FMD2 3OCPA 4HPKB 5E89A 1JYTA 2FDGA 4AOCA 2WNUB 5BPXA 1CVNA 1GR3A 4M4RA 4I01A 4LHLA 4QPGB 4W8JA 3CJIB 1UN1A 2JDPA 3KQ4B 1X33A 1W0PA 2EIGA 2KD7A 3RG0A 1UPIA 1W04A 2RV9A 4OHXA 5ABJC 3BTXA 3V0AA 4PQQA 3DKWA 5JXGA 4WM7B 3LB9A 5A33B 2YFUA 1H1MA 1SPPB 3JD73 1UU6A 3A0NA 2QBXA 4JGYA 4YPJA 5K0UB 1JI6A 1RUE2 2JE8A 3FJSA 3K3OA 3AL6A 1LB2A 2O14A 5FMOL 1Y9GA 5AC92 3N3HA 3AKQA 2VVDA 4MZUA 3RI8A 2XDVA 2P4EA 1L7LA 1VBE3 5GM0A 3VBRC 3VKNA 3JB8A 4UBGA 5HV4A 3WP3A 4AGVA 3JBG2 1NCRA 4FOYA 4Q0VA 4XYXA 1MS5A 3I3BA 4E4SA 5J7MA 5CKMA 1ND3A 4QQ2A 2ORZA 4CCJA 1KS5A 3GF6A 1LOFC 3M3EA 1SCSA 3SH3A 1FMD3 3MHZA 1M06G 1D4M2 3WDWA 2W2IA 4YW3A 2UYBA 4A7YA 4R9CA 4FOWA 2GU9A 3ZXJA 1ZZ8A 4UT5A 2CDPA 4IERA 1U0AA 3SEPA 1GP5A 1Y9QA 3BI3A 4BQ1A 4CEWC 3WX5A 3KS7A 2OA2A 4P9JA 4QT6A 2LROA 1BLZA 2DVGA 2BWCA 1S2EA 2HWE1 4OZXA 5FYTA 5T5OA 2JKXA 4TN7A 3G6JB 1MQTB 2HEWF 4CEYB 2VZ1A 4CXWA 1M4WA 2BDRA 2IXIA 2PHUA 5IK8A 1R083 1WD4A 4YLZA 3DKQA 2VMCA 1NXMA 1COV2 2BEOA 2BJSA 2IXKA 1RUF2 2CYFA 4D6RA 1V0AA 3AP6A 2XL7A 4W4ZA 4CCEA 1RVF2 1W9WA 4A42A 4ZU7A 2PAMA 3CNAA 2D3PA 1W28A 4DXRA 3V64A 1KS4A 1WCKA 5KXBA 4M0HA 3U75A 4Z1VA 5A3MA 1QJY2 1KFXL 1VB2A 4AK3A 3FL7A 4XDPA 1YEWA 4FPOB 3EB7A 1RUH1 3ES1A 4ZY9A 4BQWA 2RJLA 2W92A 4N53A 4N53C 2OUJA 4XJWA 3WF0A 1RINA 2XUEA 4XZPA 4C0HA 4FTSA 4JQTA 4QPYA 4OQ9A 3Q8CA 1XNAA 1PM4A 1WD3A 1EV12 2ZMNA 2VVFA 3UKVA 4HKOA 1G9AA 4XOGA 5TSWA 1RUG1 1TME3 3WUDA 2ADEA 4H55A 4TLGA 3BIWE 5C5TA 2VBDA 2X10A 2OT7A 2ZGOA 4P9IA 2XXZA 1AYN3 3NJYA 3H0OA 1LNSA 5HCAA 2Y6FA 1X9TA 5T5JA 1SLTA 2XJVA 1AR81 1S55A 2ZTNA 3FWEA 5FYUA 3WP6A 1ZM1A 3OG2A 5I8SA 4DS0A 1JYNA 4GXLA 4HKWA 5IVBA 1N3QA 2CV6A 3HMYA 3HWJA 2BNOA 5EWSA 4AE2A 4I30A 4Y20A 3MF6A 3AP5A 2DCYA 2OX0A 3VBUA 2PHLA 1NT0A 2PQSA 5ACA1 1E5IA 2XR4A 4PDWA 2YUEA 2WS93 3GHMA 4FQZA 5FYMA 3VHRA 3E6DA 4IL7A 3JU9A 4I0AA 1Q3EA 1TVGA 4QAWA 2VUCA 2ZMLA 5EYXA 4EN8B 3BPSA 4XFFA 2G9GA 5L36A 1QJY3 4GMP0 2GC0A 4IV1C 4QQHA 3RZKA 1CR7A 4XF4A 4Q4V3 2JJ6A 5HCBA 4Q29A 1ULEA 2ZHLA 3N7KA 1DQ5A 2YC2A 3WF2A 2CDOA 4MGYE 4RHV1 2JDYA 3FZ3A 3GJAA 3KV9A 1D4VB 4GB31 3VBHC 1WW6A 1CIYA 2WUHA 5CYYA 2IZWA 2QQVA 4XUPA 2RDNA 4UFKA 2JDNA 2CGNA 3AMHA 1QJX3 4BWOA 5I91A 1PO21 5B4NA 4M3CE 4XFBA 1NCQA 4PDWB 2Z4FA 4AEMA 1I5ZA 1VBB2 4U36A 3ZR5A 3GGLA 2WZR3 3B9CA 3KM5A 3QH6A 5DZFA 1D2QA 1CGPA 1JU4A 3S30A 4AYUA 4WZCA 3ACHA 2HLEA 1ZZ9A 4JRLA 4UW5A 5LY2A 4IV3A 1A34A 2BUKA 3NNGA 1KFUL 4LXLA 4XURA 3ZSLA 4R4ZA 1SFPA 3HQRA 4CDUA 5FZAA 4X6QB 4QWNA 2B46X 2ZGTA 2XBO3 1W9YA 3ZXEA 4DINB 1DGLA 1SHWB 2F6BA 2XKPA 5FO7B 1HV1A 4K3UA 1SBDA 3FFZA 1B35B 2BW8A 4HETA 4Q0PA 1XXNA 4CDWA 1OPMA 3ZM8A 3NKGA 1GOGA 4G9SB 3KT1A 4W6WA 4QQLA 2XWBB 3WNXA 4COZA 4N43C 1PVC2 4R9DA 3VD5A 4ATEA 4Q4X2 1O8PA 3SITA 1IOAA 3T2QA 4OZOA 1HKDA 2GC3A 2WINB 2ZZQA 2A5ZA 1SDDB 2OPWA 5FXVA 5HXVA 5B4XA 2FDHA 4EZ4A 2YGLA 2WFF1 5FLIA 1VBA2 4CE8A 1H1AA 2PHFA 5LY1A 1X36A 2J1UA 2FMYA 4IEUA 2ZX4A 5FZOB 4LKFA 3GZAA 4FXGB 5KXDA 1JHJA 3PU8A 5FYIA 3U10A 4XILA 1AZDA 1H2NA 2PXJA 2UURA 3OD0A 1RMU2 4YM1A 2XOMA 3M2MA 4KGGA 5IWFA 4TSVA 1VRH2 5A80A 2I45A 4LMFA 1ZRDA 1FATA 5LRSA 2WT2A 2I2SA 1FV3A 2VMIA 3VZKA 2O8OA 4EQVA 2CAUA 2XUMA 1FI2A 1BQPA 3Q9OA 2PTMA 2P3KA 2XBO2 2G1MA 3NAPB 2VMFA 3P5BA 1ZNPA 1V9U1 3O1PA 3POEA 4Q2FA 1F5FA 4QX5A 1VRBA 5D1IA 4NROA 4NHYA 3ZXAC 4Y22B 1ZBE1 4AHWA 4DRRA 2Q1FA 2RE9A 1S4CA 3ZFFC 5I0SA 2FZ2A 1UD1A 2R49A 1R64A 3C7EA 4CUCA 4DIQA 4MLOA 3M3OA 3UETA 3VL8A 3IM0A 4GMP3 1ZRRA 1YJLA 1FAYA 3ZSMA 4P5HA 4CUAA 4FPEA 1PMHX 2FDFA 3VD9A 1J3QA 1JZ4A 1YI7A 5CFDC 3O14A 5A3PA 4B29A 4FPJA 4V1PA 5FKBA 1LU1A 1DGRA 1F9KA 3FHQA 2VOWA 2G9FA 2YMZA 2A1XA 1PGSA 2W3JA 4LO8A 3RRDA 1JUIA 1VRH3 4TTGA 2HWC3 3WUCA 1STMA 4BZ4A 4QPIB 3CDZB 1BCXA 4Y33A 3ZYGA 2ADDA 1UYXA 4YARA 2B45X 5FOJB 1Q8SA 4HK9A 2AZ5A 1QMJA 4HSJA 2VZQA 3OD4A 5L9RA 4MO3M 4XUQA 3ZPOA 3LDKA 2JDZA 1XNCA 1IPJA 2UY9A 4R8HA 4D7YA 3D4KA 5LK7B 1KJRA 4X6RB 1QH7A 3V0AB 3I3DA 2Q8EA 2WFF2 2ZABA 3WNNA 1UO9A 4LIVA 4Q0QA 4UAPA 1DP0A 1OFNA 2JWPA 2VZOA 2RR13 4D0QA 4BOWA 4GWNA 2R6QA 2DBIA 2HYKA 1AL22 1CAVA 3LCPA 1NQJA 2EICA 3OJBA 1WMEA 4XDOA 1C1LA 1RL3A 3ZFGA 1JYXA 2ZHNA 1GKBA 2RJ2A 4TYSA 4E4HA 1W8WA 1S0CA 4Q4Y1 4JRAA 5FY9A 5KR7A 3IIIA 4NWWA 2A3YA 1HLCA 2HWB3 5FOBB 3HNBM 4FT8A 2BNMA 3D3AA 1DBNA 1FNYA 1XYNA 4A7KA 1MS1A 4QDSA 4B4QA 5FPUA 2XQRA 1I3HA 3IMMA 1HXS1 1NY71 2WN2A 3HQUA 2DCJA 4GB33 4PLOA 1VBD3 2AEYA 1IS6A 2VMEA 2WAAA 4WV8A 2IWGB 5GALA 4WZFA 5C5UA 2AR6A 3ZO0B 3POSA 3VZLA 5CFCB 4Q1RA 4Q4V1 4P9LA 1TE1B 3JBG3 1WLTA 5JZGB 3K75B 5F3CA 3T0AA 1W6MB 4HLTA 3I4IA 4PLMA 2VW2A 3LDRA 3N7JA 5EPAA 5IK5A 2BPA2 3KHBA 2VW0A 3POWA 5JCTA 4K1YA 2RM21 3ECQA 4YFZA 2R073 2OPKA 1RUF1 1XPWA 1HQWA 1RUD1 2OW4A 2YU1A 5EP9A 1UWWA 2XLGA 1LOGA 2LS6A 3MFCA 1APNA 2HWF2 4GA9A 5CU1A 5FPXA 4NRMA 2JXAA 4EN0A 4B7EA 1H9WA 1EY2A 5FWJA 1PO11 4CPBD 2VNRA 3WDXA 3MIHA 2WNVA 1W6QB 5CADA 2JDKA 3WNKA 4J1XA 1W6MA 5FYYA 1PIV1 3FC0A 2OYZA 3KT7A 4MGIE 1SLBA 1JOJA 2YU2A 3IPVB 1HRV2 4CUBA 4KWUA 1KXGA 1DLLA 2TNFA 1RUG3 1J3PA 1TME1 2A3XA 2OQ7A 3DL3A 3LWCA 3TEZA 1GMMA 1QQP1 1ZBA1 3RQ0A 5CG9A 4KBBA 4OUMA 4NIGA 1VP6A 1VLNA 1LR5A 4P9YA 3ILRA 1PZ7A 4K8FA 1AJOA 2P2KA 5EYYA 1S0FA 3OEBA 1MEC3 2RS33 4QKDA 4YGEA 2ZACA 1S1AA 3B01A 1AYM1 1F35A 4DO0A 4ASMB 4AI3A 2NZ9A 3OBTA 1AVBA 1W03A 4CYDA 5FXZA 1DLCA 1ND2B 2YC0A 2XLAA 4LEJA 1NKGA 4R52A 3ORJA 5LATA 3VDDA 4AGGA 4CDUC 4ZZ8A 2E7AA 4JGYB 2R072 5FP4A 1ZA7A 5FY0A 5FREA 1ZRIA 3T0BA 4BYYA 3ZSJA 2QKDA 1OLQA 1ZA4A 1RC6A 3VHPA 5FUPA 1N1VA 1VB4A 3HN3A 4KL1A 3K48A 3N9PA 4AXOA 4ARXA 1JYIA 5FYSA 4ZKTB 3CJIA 1OUXA 2DTYA 3MPBA 2VQAA 5IAVA 4AHXA 5DMYA 1RUE1 2XPJA 4Q4W3 3LA2A 1PO23 3M3CA 2VTXA 2W47A 1WGPA 2Y6GA 3VBFB 4WM7C 2VUJA 3WT3A 1EAH3 2B42B 3B7MA 1RTVA 1UOJA 3OSDA 4K7JA 5ABJB 1HXS3 4Z2AA 5DUUA 5LBFA 2YBPA 3KCXA 2V4VA 5IFTA 2CTVA 1SLCA 2J1VA 4D94A 1I6XA 4CP9A 5BNOB 2E32A 3SEEA 5LA0A 4X8PA 4LIUA 5J36A 2ZX2A 4GZ9A 1W0NA 2LALA 2XL9A 3VUOA 3K4ZA 4P9XA 2IUWA 3RZGA 2ERFA 1ULCA 4Y3OA 4XCAA 3P3PA 5F6KA 1HB4A 5I0TA 1WMFA 4AFCA 4YW5A 5A3NA 2Y26A 4AFDA 2WQZC 4IEPA 3BPZA 4XTMA 3AP7A 2VNVA 4Z07A 4XFGA 2WO7A 4IE5A 1T6BX 3TRSB 5KC6A 1HRV1 2Y33A 3ACLA 3BOPA 1F4AA 3N35A 3PVNA 4HN0A 4QB2A 4OUEA 4NJ4A 4O9EA 5AC93 4NHKA 4A4AA 4O65A 1MEC1 3I7DA 2HBUA 2UWBA 3T3YA 2ZA9A 1NX9A 2VE1A 5FPVA 1JZ3A 1YFYA 2FCUA 5EQUA 4JV4A 2WT1A 2ZKLA 2X5IC 1OC1A 3J7MA 4AW7A 2ZX3A 3LFIA 4CVUA 1Z7S3 4A3XA 3U4SA 3AJYA 2ZGNA 1OVSA 5IK4A 1XB9A 2PAEA 2VJXA 2RM22 1QF3A 4E4ZA 5IVFA 2VZSA 2XWJB 1RITA 3H42B 4UFHA 4N43A 1EUUA 1NLSA 2H6CA 1ULPA 3PMSA 4FFGA 4CDWB 2ES3A 5BNPC 2WNEA 4MYEA 2FCTA 1PO13 3RI9A 3LDBA 3ZSEA 1VE0A 3ZX7A 5KC5A 4CCNA 3RNSA 1OOPC 3WW1A 1HB3A 1W6OA 4DXSA 4XCBA 1NE6A 5F6LB 1VBD1 1RUD3 4IGOA 4M3CA 5T5PA 3THTA 4FPGA 3ZXKA 5A6ZA 1O6UA 3VBRB 2A6ZA 4FAGA 5FJHA 2WYFA 3SCGA 4ES8A 4BU2A 4GH4B 2O1QA 4XIOA 1SCRA 1PIV2 1RUI3 3GZEA 4Q4Y3 1L7QA 2LUWA 5C8CC 2WWJA 5F37A 3KWVA 2WNVC 5FZHA 3RWNA 1O59A 5DUWA 2XHNA 4MHUA 5CG8A 2C9KA 3AXEA 2QVSB 4RQPA 4JCKA 1GZWA 3V65A 3TN91 3MLLA 3PVBB 3VDCA 2ZHMA 4LO4B 2HWF1 4LBQA 3OGRA 1K5MA 1B35C 1JXNA 2WABA 5I93A 3N4MA 3HBZA 1Y7BA 4N53B 1QQP2 1WMDA 3CEWA 4P00B 5FY1A 2FQPA 3FBYA 2ET7A 3UL2A 2Y64A 5LBCA 4FFIA 1C5HA 1F15A 5FLHA 3WV6A 4YG0A 1NYWA 3THDA 1IZ3A 4LA3A 4Q1PA 3F2ZA 5A33A 2WQ4A 3ZDSA 5HBAA 1E57A 4KI5M 5GZGA 2A70A 1US2A 4QXKA 3T4VA 3BN6A 1PX3A 4DUWA 4IV3C 5FFOC 4ARYA 1O3TA 1DQ0A 1EV13 1QNWA 3I3EA 1CAUB 1BBT3 1FOD1 4QB1A 3I2KA 3ZFFA 4L2NA 5FPBA 1LOAA 3PIJA 5GZCA 4OI1A 1HN1A 1LULA 1XQNA 2YG0A 4UW3A 2K46A 1LODA 4Q4Y2 1QHDA 3VDDB 1UIJA 2YB7A 3ZDVA 1VBE1 1UY0A 3IDEA 4Y26A 4DUVA 1VBB3 2YBKA 4I3GA 4XPVA 4GKYA 4UW4A 5K7PA 4XJUA 1EP0A 4R9BA 2QCSB 1LOCA 3I3QA 4HVQA 3TEXA 2ZGPA 1DYPA 1UY1A 4AVBA 3LIGA 2WS92 2ARXA 4RR3A 4YVWA 1K3IA 1N3OA 4CU7A 3FBMA 4AGRA 2YY1A 4HVOA 3VGIA 3WDYA 2JEMA 4M3CF 1UU5A 1LGBA 5I0UA 3TB0A 1GNYA 4AI1A 2TBVA 2RDQA 4QX3A 4XC9A 4C1XA 4YW4A 2Q4SA 1V9U2 1CPMA 1OLME 3WLUA 3W5MA 4MG2A 4OCTA 2R7EB 2VL4A 3AFGA 1AR73 2RJKA 3R4SA 4LJHA 1POV0 1HRI1 5FZCA 4CEYA 4CEYC 4E4DX 4A2UA 3KGLA 4LKDA 2HBTA 5JI7A 1LEMA 4S2DA 3J8F2 3WCRA 1LOEA 2W9XA 2ZS6B 4LUKA 1W6OB 4J1WA 4CRQA 5C7GA 1DZTA 3VZMA 5DABA 1GUIA 1JH5A 5DAXA 4LKSA 4QHOA 4B1LA 1NA1A 3I3MA 3ZIWA 2K2SA 3K77A 4XUOA 4K1ZA 2WZR2 4FO9A 4B4RA 2W87A 1RHI1 4BXSV 1DFQA 1O4ZA 4RFT0 3S7IA 1OQEA 4F83A 4KGQA 2ZZJA 1ODNA 3W20A 1DQ6A 3WNLA 5C9AB 1CZSA 5EIYB 4JDOA 3V0BA 5F32A 3HN1A 1L7RA 2WS91 1LOFA 3EXUA 4OUSA 1OD3A 1BYHA 1DCSA 1PVC1 2ZCWA 4YW1A 1GWKA 2VOXA 3I2FA 1OSGA 3MBWA 2VUDA 1ULFA 1WW5A 3A23A 3JCIA 4UFLA 4CSWA 1BJQA 4NPLA 3PHMA 1UKRA 3WSOA 3A4UA 1O4TA 1IQAA 3I59B 1TMF1 2DFCA 5IVYA 4WVMA 5CEHA 5K8SA 2MEV2 2VQUA 5FZ0A 1OA2A 1JTZX 3DF0A 4YW2A 5FZBA 3W9AA 1NOVA 4NHMA 1S0IA 3J7HA 4QXHA 5FXWA 2WNOA 1O91A 2R062 5IW0A 2BERA 3NV4A 4DNYA 4IEQA 4GD4A 3LFMA 5K4LA 1AJKA 4IEZA 1CIWA 1ASJ2 3Q8FA 3PVOA 1GSLA 4N9HA 3UGGA 2PFWA 3S5AA 4HG6B 3AZZA 4GIQA 1W6PA 3BTAA 1RHI2 4AEDB 3FE5A 1SMVA 4RSUA 5IAXA 5D2AA 1C8M2 1OA4A 2WNUA 3WP4A 2P17A 3MW4A 2CU5A 3OGSA 4LKEA 5FYZA 4CDQB 4S2GA 2RDSA 4WM8C 4CCMA 3MIGA 4MSVA 1VAVA 5CB7A 1NXD1 3ST7A 3LA7A 3Q8BA 3I2OA 3KF5A 3ACGA 3NSTA 4XQ4A 2W94A 4MXWB 2EAAA 3SC7X 3LOIA 5C4WB 2BFUS 2QNKA 5JPNB 2C26A 3RMXA 1TMF3 1WZXA 3WNMA 1FV2A 2HWD3 2VH9A 3ZYPA 1YFUA 2B8MA 4CCOA 4YSFA 4EWEA 4NPRA 3B3QE 3I54A 4QGNA 2EXJA 2ZOEB 3KCCA 3OEAA 1G8WA 2CGOA 4LOTA 1BHGA 4MGQA 1H8TC 5T54A 3VZJA 5A70A 5ANNA 2SBAA 3POYA 1BBT1 5L9BA 1UOBA 1Q8QA 1JZ7A 3O1SA 4BISA 4KQ7A 2P3YA 1IPKA 2PELA 4OMCA 3WEZA 4FQ4A 2NP0A 2B4KA 1LHOA 4OLLA 5FMOS 5LK5A 3S5QA 2BVBA 1R091 5BNQA 2Y8KA 3R05A 4XFCA 2FMDA 3VKLA 3ZR6A 2Z5WA 5F5CA 5LASA 3ZYBA 1LEDA 2JICA 3AXDA 5GJ6A 1E5HA 4UF0A 4Z82A 2WYSA 3IMNA 1RUOA 1H6XA 3ATGA 1QNYA 1IS5A 1AXKA 3GCWA 3VN4A 2HWB2 2J7MA 3UJOA 1Q8PA 4GH4A 3AP9A 3K4DA 1J83A 1FPN1 2XJTA 4GH4C 3U1XA 2JIJA 1XJAA 1LCLA 1PZ8A 4BQ4A 2EIDA 1VMHA 3UNPA 1AR83 3D82A 3RWKX 4CA9A 1JYWA 1SLAA 1RUH2 2C5DA 2V73A 3FX3A 4L99A 5A3WA 3MLJA 5KXCA 3O5SA 4XF0A 3HEIA 3CU7A 2D93A 4U2AA 4QX8A 2QFEA 5FPAA 5JOYA 3MLKA 1LRHA 2ZAHA 3AYDA 2YBSA 2D3RA 2HEVF 3KVAA 5LEKA 3ABZA 4BQXA 2Y6JA 4XFAA 3FHIB 5BNPB 1VIWB 3N9QA 1QGLA 1QJFA 3O7OA 3TWIA 3ZFEC 5FO8B 1OLRA 2DCKA 4BH9A 2B5HA 2XVLA 5L19A 4I2OA 2GNMA 4CDQC 2P37A 2WDBA 1Z7S1 3DXTA 2ZKNA 4I09A 3EO6A 4BHPA 3BTZA 1GANA 4S2FA 1U5ZA 2GC1A 4QPIA 4BPZA 4SBVA 1H4GA 5BYNA 1B09A 4K9SA 2DBNA 4NRQA 5I0DA 2EIBA 4Y4YA 3IAPA 1O5LA 4DOUA 1OF4A 4QGLA 4QX7A 3NV2A 5DG1A 4OHWA 1JYVA 4NPMA 1X8EA 1WUVA 4O7XA 2CWMA 3URFA 3C7OA 1PZ9A 3KCYA 2H0BA 2EVXA 2IXLA 2UY8A 4PI2A 4QX2A 4LT5A 1UL9A 4DXTA 3J4UH 2W08A 1RUJ1 3VBRA 4IETA 4Y24A 3VDAA 4QU2A 4OHYA 4QHZA 1COV3 2JDAA 2RS53 4QXBA 1QOOA 4BM8A 2VZPA 1XU1A 5HI0A 4WM7A 1H9PA 1MVQA 1ST8A 4Q27A 2RS12 4F8AA 3QLQA 3AFKA 3BVCA 5T55A 3KV6A 2BGCA 1AHSA 3I2DA 1S2BA 3OY8A 4JKLA 5A7NA 2HWF3 4AI9A 4FCAA 5IVJA 5DN2A 2J1TA 1PGL1 1CONA 1HV0A 1SFYA 4AI2A 2VXJA 2GP5A 2VECA 1CD3G 4MUVA 1GOHA 1LGNA 4XBLA 1N1TA 3PUSA 3AZYA 4CP1A 1RUI1 4XJZA 3TYJA 3DEMA 1NLRA 3WF1A 4NAOA 4CU9A 2VMHA 3J9SA 1IG0A 4L8QA 4E2GA 1TME2 1YC61 5AFBA 3H8RA 2AYHA 3PJYA 1G9CA 4COWA 1EAH1 5FPLA 1ND2A 3TN93 2BTVC 1N1YA 2P34A 3LSEA 4AVSA 4E8DA 4GULA 2WA3A 3ASIA 2GH8A 1QOSA 5FZ4A 3U07A 4AVVA 4EN7B 5KHHA 2LTNA 3OYWA 4YVSC 4ZU4A 4RN5A 1LESA 3OB8A 5A3UA 4HFSA 1SLIA 4KBZA 4OI0A 1UMZA 2A75A 1SDWA 1C8NA 3OUHA 1URXA 2YXSA 1QQP3 4UXAA 1AR92 4IDZA 5IUQA 4YM3A 4WBBA 1RVF3 2ARAA 1OHFA 3IKWA 4RGAA 2GAUA 1H4HA 2V09A 2LM3A 2VCCA 4OHZA 2NM1A 4HSLA 1D4M3 1V6NA 4IEVA 3IPVA 4FVVA 1PX4A 4FPHA 3ZYIB 2P1BA 5ISLA 1XYPA 2JE9A 1H8TB 1LU2A 3OOXA 3WVJA 4F3JA 4L0PA 2VNGA 4AG4A 5LCWL 4UYBA 5AC91 5A6YA 4L92A 3MICA 1PK6C 1GFF2 1ZZBA 2ID4A 3NJZA 3KLSA 3EYPA 2NMOA 5FMDA 4B7KA 3ACIA 5T50A 1UX6A 2PLV3 2R071 3MI8A 4A6OA 4AZZA 3HIFA 2RM23 3NMBA 3ROUA 3ZN6B 5BY5A 4I0WB 3OTFA 2DVDA 4JDNA 4YRDA 3A0KA 5FUIA 4JHZA 3O1TA 4GKXA 3E6CC 3EMRA 1S0BA 3CZUA 1ND2C 4ATFA 4BQ2A 3NNMA 5FZKA 1R082 1R093 2Z42A 2EXIA 3JBG1 4UFJA 5EV7A 4ZHNA 3UGFA 3PUQA 4KWJA 1L3JA 4HONA 4AL9A 4NUBA 3T08A 1UZVA 4KNCA 1OQ1A 2ETEA 2WO2A 1YFXA 1I9RA 3WCSA 3R4DB 1AR91 1ENRA 1OKQA 2GNBA 1W2NA 3UKNA 3AMNA 1MZ6A 4CDXA 2VO5A 1GICA 4MGKE 2QZ3A 2VTXJ 5FBJA 1C8M1 3EHKA 4DMIA 4Y5SA 4C90A 2VY0A 4IQPA 5DZGA 2QQIA 4I0BA 3HT1A 3ZN6A 1QH6A 1SZBA 1PHMA 1W9SA 3VZOA 3ZOIA 1P8JA 2D5FA 4ZS3A 5FCCA 4LPLA 1YQ5A 1QJU3 4C1WA 3ZIXA 2OZJA 4KWKA 5C3RA 4HXCA 2XONA 4CDUB 4Q0SA 1W6QA 2BYVE 2Q5TA 2DVAA 5E1RA 1CAVB 2PLV2 3J8F3 1E5RA 2FDIA 5IT6A 4DZGA 5CBLA 2VMDA 5EJ1B 4PF1A 4P08A 1AYM3 3AYEA 4N90A 4ONUA 4QKBA 1XOYA 4YM0A 1WBLA 4JGZA 4EV0A 1AYN2 5F3IA 3PIGA 5CA6A 2E7QA 2BNNA 5FO9B 2JDUA 3ZFGC 1R1A3 2MHFA 2R30A 3HD8B 2AUYA 3LF7A 1ZVFA 1YIFA 3LGRA 2ORXA 2AGSA 1PGW2 5CIRA 1UOFA 4C8DA 2E26A 2ZPXA 5JWPA 5JZGA 4O61A 2Q1ZB 2DYCA 3LAGA 4IE6A 2XVGA 4BDVB 4NRPA 4ZPIA 2R0FA 4ZS2A 4AEDA 3E1F1 1BBT2 2YDEA 1O7FA 3MF9A 3HVDA 3L2YA 5KHJA 1IHMA 1TEIA 4ET7A 3RZHA 4IEWA 3MIEA 3MPPG 2DTWA 3H8UA 1H1IA 5FY5A 4QPGC 1ND3B 3RZJA 4HANA 3IB3A 4DFSA 2RMU1 1GU3A 5DPNA 4AEKA 4OYUA 4V2VA 2ZXQA 3CQOA 4FPLA 3SKJE 3IDBB 1N47A 2V5DA 3OPZA 5F5IA 1DQ4A 4KH9A 2WC2A 1XSQA 2XJPA 3K4AA 4N7IA 2VG9A 1NY72 1KD7A 1ZBA3 1AF9A 4XBQA 1Y43B 2XMLA 1GOFA 5BNOA 1RUF3 2BGOA 5EHDA 2PHWA 4Y20B 3WW2A 1JZ8A 1BZWA 2Y0OA 2KA3A 3POFA 4CEWB 2VZ3A 4XQDA 1QXRA 3TOJA 1LHVA 4E2SA 1WW7A 1LGCA 4META 3ZFFB 4IUGA 2QZ2A 2DFBA 2EXKA 1RXFA 5CNAA 2W39A 3AMMA 2NPIA 3DUIA 5LA2A 3PNAA 1W90A 1W9TA 5B2GB 1RUNA 3U78A 3V0BB 3ACFA 1AR72 4EROA 2X8KA 1WA6X 2R043 1BEV3 1MVEA 2WLQA 1OBNA 2C6SA 4AAXA 2VZTA 3VBHA 5LW9A 4QM9A 3RPQA 3SCHA 1FNZA 1WBFA 5H9RA 3ZXFA 1HJGA 4G4FA 2QQWA 1F8VA 3AX4A 1OF3A 3LEGA 1POQA 4FFFA 1OLMA 2YGMA 4NN0A 5CFCA 1W8HA 1TQ5A 1BKZA 1CAXB 3T1MA 1ASJ1 1IKQA 4RS5A 3PMEA 2P3IA 3H1MA 2VBBA 3KMHA 5FP7A 3H8OA 3QH7A 2WL1A 1W2OA 4LUMA 4EJRA 5JOWA 4RQPB 2GH2A 4Q4X3 2FZ1A 3AVRA 5FBZA 3ZKUA 3LSDA 2L9LA 2RR11 1YHFA 1DYKA 1GBGA 4P5YA 5DDJ2 4R9AA 5FZDA 1G9BA 3VD7A 3GZUC 3VZNA 1VMJA 5JSRA 3VV1A 2ENRA 4MV2A 5LEJA 1W8FA 3NNFA 3ZYHA 2GMPA 5JVVA 1XYOA 5J98B 4AQTA 2VUAA 1BMV1 1VBC2 3UJQA 1D7PM 2E6VA 1AR63 1OI6A 2VOTA 3RS6A 3VD3A 5HPOA 2BVVA 1SPPA 5DAWA 4YW7A 1ND3C 2JG9B 2VCMA 3LZZA 4JGZB 5JSPA 4EWAA 1YXWA 4A7ZA 1Y4WA 4FPKA 4D6SA 2PYTA 1N1SA 2BOIA 3D8CA 3C7GA 3J8F1 4IV1B 5JI9A 4FTEA 4BXFA 1GWLA 3FMGA 3Q8EA 4D6QA 1GWMA 1UCXA 4ZXEA 2QQOA 2VZVA 1ASJ3 1D2SA 2HJIA 1YRZA 3ENRA 1X7NA 3DPRB 5A7OA 1DQ1A 2A71A 3AZXA 5JOXA 1WCQA 2Y6KA 2ZEZA 1I1EA 1UMHA 2FBEA 1H2LA 1C8M3 2Z79A 4UF0B 5LB6A 3MW2A 2D40A 1OFSA 4ASKA 1A78A 3DPRC 3PTYA 1VRH1 3N9MA 4K20A 4LBKA 3RYRA 4MHRA 4MGSA 1BK1A 5BNNA 3H7JA 2VC9A 1IGOA 1GZCA 2RMU2 3CF6E 1UZWA 4A44A 2HWD2 3RMYA 3D6EA 4FSJA 5JR7B 4BB3A 2X5IA 1BXHA 3UT0A 1DDLA 1VPHA 4H14A 2VMGA 1A8MA 4FP2A 5DDJ1 2R061 2VZUA 3ZVXA 1CAUA 2QJVA 4YZ1A 5ACA3 4H7LA 1ZBE3 3CMGA 5C3SA 1CJDA 1Q43A 3KV5A 1VBA3 1ZZCA 3ZXLA 2ZGRA 4P02B 2X05A 2IVJA 3NNLA 4NIDA 3P3NA 4QQOA 1KJLA 3BYWA 3T09A 1CX1A 4LNVA 3U4XA 2VCAA 4HBNA 1PK6A 1JU3A 3LPFA 1Q8VA 1PMJX 4YGBA 1RMU3 3VHNA 3TEYA 1JUHA 5L9VA 1AXZA 4ZZ5A 2ZMKA 4QGMA 1V6IA 3OGJA 2YHJA 3E97A 2OQ6A 1RVF1 4LK6A 4PDWC 4AF9A 5CAZA 1PM7A 3WR0A 3IBMA 1AL23 4QX1A 2PHRA 4JVAA 3VKFC 1OA3A 1TNFA 3VBOB 1HRI3 3DXUA 3ON7A 4COUA 1UKGA 3PU3A 4CDXB 4URAA 2QQKA 2W46A 2JKBA 4D3WA 2UYAA 2A3WA 4UFMA 4CZSA 3BODA 4FP3A 1RXGA 5FP9A 2VVEA 2HWE2 1VR3A 1YYNA 2C24A 2BWAA 4YZ3A 3CLPA 1GQGA 1KGYA 2XJSA 2OS2A 3RYPA 2VTFA 5FYCA 4AFBA 3BIEA 2VZRA 3USUA 4Y1ZA 3PVEA 4CXXA 2FDKA 4CPBA 1HW5A 4XF3A 2WZPP 2ZEYA 4LTAA 5ACA2 3TN92 5AVAA 3WF4A 1T2XA 2XJRA 4M3CB 3SQOA 3QACA 3M3QA 4LHKA 1JMUB 2ZAAA 4YVSB 2EIEA 4M00A 2QDNA 4BLJA 4FAHA 2JD4A 4CCLA 3QCWA 4MXVA 1UNBA 3LEKA 3NAPA 4TZDA 3DCQA 4CU6A 2D97A 5CKNA 1FT9A 1MS9A 2YPJA 4IV3B 4LULA 4QD2A 5FZ7A 2K0GA 1YQ8A 1QJU1 1EV11 1ALYA 1RUE3 1YI9A 3H7YA 3HR9A 4ASLA 1AR82 5JAXA 1DF0A 5FP3A 1OVPA 1S2KA 1VBE2 2PAKA 2CY6A 1F5JA 2QUOA 3AMQA 3HNMA 3H3UA 5FQ0A 3Q8AA 2J1SA 4YG6A 5FWEA 5CFDA 2D6LX 1V6OA 4TLFA 1LJ7A 1UW8A 1C1FA 2HWE3 3RFRA 5JXJA 4KMQA 1QXJA 1EAH2 5C3PA 2PLV1 1XNTA 3NRUA 2RVAA 4XACA 3ETPA 3T30A 4CCCA 5JOZA 1J1TA 3QBQA 1NAEA 1MS8A 1LKNA 2EAKA 1GLHA 4XXPA 3ETQA 4YWAA 1OQDA 1J3RA 2ZBJA 5A3OA 5A32B 1FX5A 2WR9A 3WG1A 4ZONA 4E27A 5JDBA 1COV1 2BV4A 1QJY1 5GZEA 4EN9B 1MEC2 3VBOA 5FQ0B 2I07B 1NCQC 1W2TA 3WINE 4Y5TA 3K3NA 3N36A 2DVBA 4PIZA 5FYVA 3U0ZA 2VAUA 2ATFA 2LW8A 1JOPA 2Q1MA 3J7NA 4AVAA 1W6NA 2ZGQA 4YZ2A 2Y60A 3KGZA 4QKNA 5JR2A 1TZOA 1WCSA 2CNAA 3DPRA 4Q8LA 3C8XA 3PUHA 4FOQA 3K46A 2YZ4A 4XMIA 5F5AA 1PIV3 1RUI2 1HN0A 2VQ0A 5F2WA 4N43B 3WQBA 2Y38A 4FFHA 1SLLA 2ZGUA 2DDUA 1W0OA 4AEDC 3AKSA 5BNPA 4PBOA 2QQMA 3OY8B 3KSCA 3WW3A 3CKHA 2MPFA 4LHNA 2ET1A 4Q4W2 1QJU2 1V00A 3VDDC 3VBUB 3GALA 3ZYRA 3AKRA 2A6WA 1ENQA 3M1HA 4ISRA 4L11A 5FPZA 4PHZA 1YLLA 4XQWA 5EZWA 2P5BA 2NN8A 3DYMA 2RS11 3GM8A 4RL7A 1QJZA 3IDAA 4PI0A 3R6SA 3SNMA 2X5IB 2CHHA 3T1LA 1MPXA 1YFWA 1LHWA 4YM2A 2IFRA 1AXYA 5JXIA 5KHGA 3RYKA 1RUJ2 3D0JA 1PNGA 1SACA 3T2OA 5IVCA 1J59A 5EJZB 4P9GA 3S57A 2Z69A 5BNNB 4QXCA 1ENSA 1Z78A 2A73B 1POV1 3VD4A 1K5MC 3OUIA 3AZWA 5AFEA 2OUHA 4EN6B 1V6KA 3KD4A 1HJFA 4AVTA 4EZHA 1S0EA 1HRV3 4INDA 4PIYA 2Z2SB 2XGXA 3GBGA 1ONAA 2WIIB 3NV3A 2IXCA 5A6QA 3WHUA 2W1UA 3DV8A 1YQ6A 1ZX5A 2VM9A 4GALA 2E31A 4RD7A 3PDQA 5JIAA 4BQYA 4GWIA 4XETA 3IN9A 2DCTA 5IVEA 2QDRA 2A7AA 3A7QA 4QB6A 4KG8A 5FMCA 4Y1UA 3AVSA 2WNVB 3BU0A 4YW6A 1MS4A 5FZ1A 2JG8C 3WW4A 1SBFA 3WQ0A 1YJKA 5FYBA 3O1UA 3H1YA 1X50A 2UWAA 2WZEA 4MXWA 4OFGA 4XJAA 2GZWA 3VBFC 3AKPA 3HT2A 3ZN4A 2XLFA 3FUOA 5GKAC 5KXEA 1RUC1 2C0ZA 4DPNA 1MQTA 2JECA 1KQRA 3E5XA 5FK8A 3M4FA 2IFWA 2WJSA 5EXOA 1RUJ3 1PO12 3M8LA 3USSA 4BMEA 4K40A 1O5UA 1DQ2A 1C57A 2E63A 4FXKB 1FMD1 3L2HA 4JTOA 5IATA 1FYUA 3NKTA 4OMDA 5C8WA 4S2HA 3PJQA 3B02A 4FPYA 1H2KA 2CL2A 1HQNA 2WQ8A 5HV0A 2NLRA 3ELNA 1YQCA 2EA7A 3JD71 2JG8B 4PCRA 2C1FA 1Q8OA 4LO6B 4BIFA 2YFZA 2ZGSA 4D7TA 1MQTC 4QDRA 4K8RB 3JUUA 3ZMNA 2F4PA 2V4AA 3EBRA 4NHXA 2RS31 4HN1A 2FHRA 3P6BA 5FZGA 2DUOA 1U12A 4PBPA 5CFDB 5F3GA 4XEZA 4W50A 3T2PA 4CP2A 1K45A 1MZEA 1W2AX 2JG8A 1CAWB 2R32A 3SH4A 3WP5A 1AL21 4IEXA 3ES4A 3SCFA 5DZEA 1OKOA 3ZPYA 3ILNA 5A7WB 3AM2A 3J26N 3UK9A 1OUSA 2O8QA 2BZDA 3BU7A 1RMU1 4Q26A 5C4WA 1RJ8A 5C4WC 4W6XA 4CP9B 1WWYA 3IIAA 4NOTA 4LO5B 3WDUA 1SFNA 4XVHA 2YROA 5DG2A 2DV9A 1UF2C 1V70A 3FUQA 2D6OX 2MEV3 3AK0A 2G4IA 1VBA1 4PQ9A 5BV6A 5JLVA 2J22A 1FPN3 4QPWA 2XJQA 5C71A 5A3LA 3VBUC 1W3VA 4YVSA 1J58A 2E51A 3FN9A 5T5LA 3J7LA 5F8PA 2VXRA 4EE2A 2A6VA 4P9WA 1UX7A 5FKCA 2DWRA 5C33A 2D5HA 3VDBA 2MEV1 2GALA 5FY8A 5I8TA 1VBC1 5HCHA 3W59A 4RS5C 3AC0A 2R1BA 2CGPA 2Q8DA 5FR3A 2J1RA 5G04L 1REEA 2DF7A 1DU3D 4YGDA 5GLTA 1QDCA 1WA4A 3T4HB 1RUD2 2PMWB 3O0WA 5FUNA 2DU0A 2QTWB 2OIIA 1RGSA 1VALA 1VJ2A 1K5MB 1ULGA 2Y6HA 3T0DA 4RR3B 2W5FA 4V2WA 5FZOA 3WDTA 3AKTA 3CJXA 1OOPB 3AB0A 3GHNA 1JZ2A 3GJBA 4UFIA 1HIXA 1SG3A 1LOBA 1W06A 1GNZA 1DGRN 1VBB1 4IW3A 3RZZA 4CDWC 3BCWA 2QQLA 5T3NA 3S7EA 4W6YA 2JDHA 4JC1A 4NE9A 4N7UA 4NR1A 5L73A 4NIAA 4BE3A 5C9AA 3LIHA 1RB8G 2MNGA 1ZREA 5F39A 4AAPA 4NIHA 5HCFA 5A1AA 1F4HA 3FHAA 5H9SA 3JQWA 3LQCA 5CISA 5E88A 3WHTA 5FV3A 4W65A 2B39A 3H8XA 1H0BA 3GNEA 4BK4A 2F4LA 2XKOA 5J09A 3A21A 3SMHA 2F17A 4Z8BA 5A7WA 1WLCA 4MH0E 4XHXA 4MVTA 1ZRCA 2P6HA 4LBQD 3OBRA 3WQ7A 5FMBA 5F3EA 1GZ9A 2FCVA 1AR61 1JBCA 1EYBA 1UIKA 2HYXA 3JQXA 3OGGA 3SH5A 3O1RA 1GZWB 2PHXA 1O3SA 1MS3A 3JZVA 4RFRB 2X29A 3C7HA 4LE4A 4KWLA 1BK0A 3K2OA 2W91A 3GDBA 3POJA 4HZFA 2G19A 5FZ8A 3RSJA 4RHV3 3SHRA 5JMCA 1AX2A 1NA1C 1W6NB 1ZYBA 2BGPA 2HH9A 3GYDA 5E6HA 3CHXA 2W52A 4Q4X1 1CQ9A 3UESA 4CP0A 5FDBA 2ARBA 3DYOA 4M01A 5CVRA 2BQPA 2AC1A 4XTPA 3INAA 3WOGA 3NJVA 2PN5A 1XSRA 4YVWB 1B35A 2J1AA 2WLPA 4CUGA 2QQPA 4BQ3A 1LENA 3EJKA 2DUQA 5L7OB 2FD8A 4LR4A 2V72A 3BUCA 1AUYA 1O8SA 2H6BA 4IEYA 4XZUG 5E8AA 4IGPA 2R063 1X82A 4BQ5A 3BKZA 5DDJ3 2WO1A 2PHTA 3R4UA 3H9AA 2BOJA 3VB9A 4Z92B 1NQDA 2CSGA 3MUZ1 5FZEA 1X8MA 1CJPA 1QXPA 1REDA 4YVWC 5EFUA 4DQAA 4UWDA 1W9FA 1IS4A 3SISA 1RIRA 1JS9A 4CXYA 4MGZE 4IE0A 1V9U3 1NCQB 2DUPA 3HAGA 4DB5A 3I2HA 1D0GA 1FOD2 3P1IA 1VMFA 3NL1A 5FZLA 4AFAA 3ITQA 5A1LA 2LRPA 3OPTA 3W58A 5A32A 1JODA 5FP8A 3I2JA 2TUNA 3OYWB 1UY4A 4GB32 3LA3A 4H7MA 1U5XA 4JKKA 3NO8A 4LOSA 2WFPA 4EWDA 3U37A 2JENA 1CWPA 5KWRA 3DGTA 3N9LA 5DXDA 4AQ6A 4YYOA 1K42A 3MIBA 3BTYA 3NW4A 4MOAA 4LBMA 3S0MA 3CL1A 2VR4A 2ZEWA 1GNHA 1Z0HA 3BB6A 5H9PA 5IK7A 1GYKA 1OURA 1C5IA 3B93A 2J42A 2WSVA 4RS5B 1NLQA 3I49A 4JHTA 1W39A 3PUIA 4AFMA 4CCKA 2ARCA 5FY4A 2VD7A 3AJZA 4MGTA 3HOBA 3TAYA 3ZLIA 2OZ6A 5F5QA 5FRAA 3H3LA 3PTRB 3E5UA 3F95A 1US3A 4FBFA 1MZFA 4JGYC 5JPMB 2DURA 1ZZ6A 1ULOA 1G9DA 3FLRA 5FXXA 4WVZA 1GZTA 3O1OA 3THPA 2TEPA 5C3OA 4UOJA 2WRAA 1QJEA 2Y6LA 4WVVA 3LEIA 1UQXA 5H9QA 4XMAA 2EALA 5AVPA 1Y3TA 3NWKA 1NCRC 1FOD3 4XF1A 5JUVA 2BRTA 3OPWA 2W1SA 2ZGMA 3C7FA 4K6BA 2AEZA 3JD72 4IESA 3RVHA 3DYPA 3O12A 1A6CA 3V56A 3MEPA 4HPKA 5GZFA 1TG7A 1POV3 1PVXA 1W8UA 2NQYA 3RGBA 1U5IA 4KG0A 4LHSA 1XNBA 2XB6C 2AACA 2OXBA 3WG3A 4IXLA 1QKQA 2RS32 3ME2A 5J48A 5F7UA 5J3UA 2VOKA 3UKTA 3M7AA 4BLIA 4CU8A 1UPSA 4ITCA 1K5JA 5L7OA 2W95A 4OQ8A 3MIFA 3MDPA 2WN3A 3CJIC 4GWJA 3MIDA 1F31A 2IXJA 2KR2A 2E53A 2QQUA 2RS13 3KF3A 4DXZA 5IJRA 4GQ7A 1LAJA 2WAOA 3ZXDA 3IAQA 1Y9MA 2R1DA 3KB5A 2ZHKA 4GJYA 5FZ6A 1SEFA 4RGGA 1UYZA 3U11A 1OPOA 3MGUA 4Q4W1 4TXWA 5GLWA 4DRVA 1SQ4A 1Q5OA 5JSOA 3WNOA 5F1RA 4JQRA 1ZRFA 3MFAA 3MUY1 2XJUA 3TNPB 2VW1A 4LE3A 2P3JA 4XHBA 1QEXA 1AX0A 1PO22 1UZYA 3MV11 1IG3A 2YV8A 1C4RA 4LITA 5DAPA 4A41A 5C3QA 3GBFA 1CESA 5C8CA 4HOOA 3OBAA 3M3IA 4AR2A 1YQ2A 2PA7A 2W0XA 2JB4A 1NE4A 1JW6A 5DAQA 1OXCA 2GNDA 2B9UA 3HPNA 4LBOA 2Y34A 1QDOA 2GC2A 2OKXA 1SBEA 2VPVA 3VBHB 2PHDA 5ABJA 5FZ9A 4RA0A 5KHIA 1UMIA 2GMMA 5A1FA 3VBFA 1LHUA 1D4M1 2D6MA 3VL9A 3WZ1A 3NQHA 1W6PB 1EPWA 4KU7A 4D7SA 2Y0IA 4GWMA 4L97A 3W21A 4A3ZA 4ISQA 4QDQA 4B1MA 4QU1A 5DAVA 3TBDA 4LBJA 1HX6A 5C8CB 4FPCA 3ZFEB 2D44A 3AZVA 3WNPA 4BA6A 2KXLA 1R1A1 2XG3A 2DCZA 3GCXA 4AWDA 2D43A 2D6NA 3I2IA 3ZYFA 4XAAA 2J1EA 3H3ZA 3POGA 4YG3A 1H8VA 2Q0AA 1QU0A 4YZ4A 3WXPA 4XXAA 3L9JT 5JIUA 1PGL2 2WA4A 2W1QA 5KHKA 2D98A 5A7QA 5C70A 3SXWA 1O3RA 4F7ZA 5K9YA 1VAMA 2N7GA 2V5YA 3EQEA 4C91A 4XF9A 1GV9A 3JXSA 3NNJA 3LEMA 4J25A 4N9IA 3APBA 1AYM2 3SKVA 4DUXA 4DEQA 3ZFEA 2Q30A 3MV01 4BCUA 3B69A 1TNRA 5D8AA 1LHNA 4IGQA 1DGWA 2VBPA 2VQTA 1GQHA 2JDMA 4FI9A 3VLBB 4UI9L 1DGWX 1R1A2 4N8MA 4PLNA 2DVFA 1RJ7A 5LWBA 5A7PA 5F2SA 2JG9C
chains in the Genus database with same CATH topology
2VCBA 1JU4A 1UXXX 3ACHA 2HLEA 3LEKA 3OGSA 3NNGA 4CU6A 4XURA 2QQJA 4XUTA 3ACGA 2W94A 1SHWB 5DQ0A 2C26A 3WNMA 3HNMA 4E8CA 3NJXA 2J1SA 3ZM8A 1GOGA 1IQDC 3OEAA 2WBKA 1BHGA 4MGQA 3VD5A 5JXJA 4KMQA 1O8PA 3NRUA 1XNTA 3T2QA 2RVAA 4OZOA 3ETPA 1JZ7A 1UY3A 5B4XA 1SDDB 3WEZA 1NAEA 4OMCA 2B4KA 3BGAA 3W5NA 2J1UA 2Y8KA 1JHJA 1W99A 2WYSA 2LW8A 2XOMA 1H6XA 5IFPA 5JR2A 2J7MA 1UY2A 3C8XA 3PUHA 3K4DA 1J83A 3K46A 4M4PA 3WQBA 2EIDA 3UNPA 2DDUA 2VMFA 1JYWA 5LA1A 2QQMA 3CKHA 3HEIA 1W8NA 3ABZA 4DEVA 2Y6JA 3I2GA 1R64A 3C7EA 3DYMA 3GM8A 4CUCA 2E33A 3IDAA 3UETA 5IYYA 2DCKA 5IHRA 4CUAA 1PMHX 1XC6A 1MPXA 2WDBA 3VD9A 1JZ4A 5JXIA 3T2OA 5EJZB 3A22A 3DECA 4XUNA 3FHQA 5I0DA 2EIBA 3IAPA 4QX0A 3VD4A 1OF4A 2W3JA 4TTGA 3MO4A 1JYVA 3CDZB 3HNYM 4JX0A 1UYXA 3C7OA 2W1UA 1UYYA 2VM9A 1RYYA 2E31A 2VZQA 4GWIA 4QX2A 4MO3M 4XUQA 4DXTA 2JD9A 3A7QA 4QB6A 3VDAA 4JKMA 3CIHA 2JDAA 2VZPA 3I3DA 3WNNA 3HJRA 4UAPA 1DP0A 1JZ6A 2VZOA 2WZEA 4D0QA 4JKLA 2ZEXA 3CZJA 2J1TA 5DN2A 4BJ0A 2EICA 2C4XA 1GOHA 1JYXA 2RJ2A 5JXHA 3IIIA 4OMDA 3WF1A 4CU9A 3HNBM 2B9VA 2WQ8A 3D3AA 2YC4A 4QDSA 2WN2A 2DCJA 2YFZA 2W1WA 2WAAA 2VMEA 4QDRA 1DYOA 2BBAA 4E8DA 3K75B 3T0AA 3P6BA 4RN5A 3OB8A 1NUKA 4W50A 3T2PA 1K45A 2XQXA 1WKYA 3ECQA 1XPWA 1UWWA 2LS6A 2VCCA 4A45A 2BZDA 3THCA 1PX4A 4MADA 1OT5A 4XVHA 4L0PA 1H6YA 4AG4A 3WNKA 5LCWL 1GQPA 2ID4A 3EYPA 2QQNA 2J22A 1I5PA 3ACIA 4QPWA 4CUBA 5C71A 4KWUA 3LPGA 3FN9A 4A6OA 4D8MA 1CZTA 1GMMA 3OGVA 1UX7A 5FUIA 4JHZA 2WO3A 3VDBA 1UXZA 2WZ8A 3CZUA 3OEBA 3AC0A 2J1RA 3T08A 5G04L 1W8OA 2WO2A 4PT6A 3I97A 1DLCA 1NKGA 1UZ0A 4ZZ8A 1J84A 3T0DA 2Y6HA 1CZVA 2W5FA 2VO5A 3T0BA 4RYDA 1JZ2A 1SG3A 4ARXA 2QQIA 3HN3A 1W9SA 2X09A 1P8JA 2QQLA 5DMYA 4LPLA 5HXMA 1OH4A 2W47A 2Y6GA 2XONA 5A1AA 4Z2AA 1F4HA 3FHAA 3LQCA 4LQRA 2V4VA 2VMDA 4PF1A 5EJ1B 2J1VA 5IFTA 4BK4A 4P08A 2E32A 3SEEA 5LA0A 3A21A 4BK5A 4GZ9A 1W0NA 3K4ZA 3LE0A 2HYXA 2ORXA 3GXUA 1KEXA 2E26A 3C7HA 2W91A 3GDBA 4BDVB 5JMOA 3E1F1 2BGPA 3WF3A 1EUTA 3UESA 1F4AA 4QB2A 4ET7A 3DYOA 1JZ5A 4OUEA 4A4AA 3NJVA 5J1XA 3IB3A 1GU3A 5DPNA 4OYUA 1NX9A 2ZXQA 1JZ3A 3CQOA 5CZKA 3SKJE 2V5DA 2J1AA 1K12A 3K4AA 4CVUA 5G05L 1GOFA 2BGOA 2V72A 1O8SA 2VJXA 4XZUG 1JZ8A 2VZSA 2WO1A 1EUUA 2VZ3A 3MUZ1 1ULPA 4M4RA 4IUGA 4W8JA 2KD7A 2RV9A 5LA2A 4DXSA 1W9TA 4PQQA 3ACFA 5JXGA 3I2HA 2YFUA 3P1IA 4AAXA 2QBXA 2VZTA 4YPJA 3I2JA 1UY4A 4JKKA 1JI6A 2JE8A 1OF3A 3U37A 1L7QA 3LEGA 1K42A 4MOAA 1O59A 2XHNA 2C9KA 2VR4A 2ZEWA 3I3BA 3VDCA 2ORZA 3OGRA 2WABA 3PUIA 2L9LA 4P00B 3HOBA 4P5YA 3VD7A 2Y64A 1US3A 1ULOA 1D7PM 2VOTA 3THDA 3VD3A 3F2ZA 5HPOA 4KI5M 4UOJA 1US2A 2Y6LA 3BN6A 1PX3A 3LEIA 4DUWA 2CDPA 3SEPA 4ARYA 5JUVA 2W1SA 3C7FA 3I3EA 3DYPA 4QB1A 3I2KA 3C7GA 1HN1A 1TG7A 2YG0A 2JKXA 4ZXEA 2QQOA 2VZVA 2VZ1A 4LHSA 2YB7A 1UY0A 4DUVA 5F7UA 1WCQA 2Y6KA 2VMCA 2ZEZA 1UMHA 4CU8A 2W95A 2WN3A 4W4ZA 4GWJA 1UY1A 1W9WA 5IJRA 4A42A 1K3IA 4MGSA 2WAOA 4CU7A 3IAQA 4DXRA 1UYZA 4TXWA 2VC9A 1GNYA 3WNOA 3FL7A 4QX3A 4A44A 3EB7A 3MUY1 4ZY9A 3W5MA 2W92A 2R7EB 2VL4A 3WF0A 3MV11 1XNAA 4A41A 2VZUA 2W9XA 3OBAA 5C7GA 1YQ2A 3CMGA 1GUIA 2X10A 4LKSA 3HPNA 4P02B 2X05A 3K77A 4XUOA 1LNSA 4BXSV 2W87A 2OKXA 1CX1A 3T09A 1JYNA 3OG2A 2VCAA 1UMIA 1JU3A 3LPFA 1PMJX 3WNLA 5EIYB 1CZSA 3NQHA 4ZZ5A 2PQSA 1L7RA 4A3ZA 4QDQA 1OD3A 4QX1A 3I2FA 3MBWA 1TVGA 3A23A 4QAWA 3WNPA 3WSOA 2QQKA 2W46A 3I2IA 2J1EA 2W1QA 2VQUA 2YC2A 5C70A 3WF2A 2CDOA 1KGYA 2VTFA 3J7HA 2VZRA 1CIYA 2WUHA 5CYYA 3JXSA 2BERA 4XUPA 4DUXA 3SKVA 2ZEYA 4DEQA 3MV01 3WF4A 5B4NA 1T2XA 2VQTA 4FI9A 2Z4FA 4UI9L 4HG6B 2EIEA 3GGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VCB A;  1JU4 A;  1UXX X;  3ACH A;  2HLE A;  3LEK A;  3OGS A;  3NNG A;  4CU6 A;  4XUR A;  2QQJ A;  4XUT A;  3ACG A;  2W94 A;  1SHW B;  5DQ0 A;  2C26 A;  3WNM A;  3HNM A;  4E8C A;  3NJX A;  2J1S A;  3ZM8 A;  1GOG A;  1IQD C;  3OEA A;  2WBK A;  1BHG A;  4MGQ A;  3VD5 A;  5JXJ A;  4KMQ A;  1O8P A;  3NRU A;  1XNT A;  3T2Q A;  2RVA A;  4OZO A;  3ETP A;  1JZ7 A;  1UY3 A;  5B4X A;  1SDD B;  3WEZ A;  1NAE A;  4OMC A;  2B4K A;  3BGA A;  3W5N A;  2J1U A;  2Y8K A;  1JHJ A;  1W99 A;  2WYS A;  2LW8 A;  2XOM A;  1H6X A;  5IFP A;  5JR2 A;  2J7M A;  1UY2 A;  3C8X A;  3PUH A;  3K4D A;  1J83 A;  3K46 A;  4M4P A;  3WQB A;  2EID A;  3UNP A;  2DDU A;  2VMF A;  1JYW A;  5LA1 A;  2QQM A;  3CKH A;  3HEI A;  1W8N A;  3ABZ A;  4DEV A;  2Y6J A;  3I2G A;  1R64 A;  3C7E A;  3DYM A;  3GM8 A;  4CUC A;  2E33 A;  3IDA A;  3UET A;  5IYY A;  2DCK A;  5IHR A;  4CUA A;  1PMH X;  1XC6 A;  1MPX A;  2WDB A;  3VD9 A;  1JZ4 A;  5JXI A;  3T2O A;  5EJZ B;  3A22 A;  3DEC A;  4XUN A;  3FHQ A;  5I0D A;  2EIB A;  3IAP A;  4QX0 A;  3VD4 A;  1OF4 A;  2W3J A;  4TTG A;  3MO4 A;  1JYV A;  3CDZ B;  3HNY M;  4JX0 A;  1UYX A;  3C7O A;  2W1U A;  1UYY A;  2VM9 A;  1RYY A;  2E31 A;  2VZQ A;  4GWI A;  4QX2 A;  4MO3 M;  4XUQ A;  4DXT A;  2JD9 A;  3A7Q A;  4QB6 A;  3VDA A;  4JKM A;  3CIH A;  2JDA A;  2VZP A;  3I3D A;  3WNN A;  3HJR A;  4UAP A;  1DP0 A;  1JZ6 A;  2VZO A;  2WZE A;  4D0Q A;  4JKL A;  2ZEX A;  3CZJ A;  2J1T A;  5DN2 A;  4BJ0 A;  2EIC A;  2C4X A;  1GOH A;  1JYX A;  2RJ2 A;  5JXH A;  3III A;  4OMD A;  3WF1 A;  4CU9 A;  3HNB M;  2B9V A;  2WQ8 A;  3D3A A;  2YC4 A;  4QDS A;  2WN2 A;  2DCJ A;  2YFZ A;  2W1W A;  2WAA A;  2VME A;  4QDR A;  1DYO A;  2BBA A;  4E8D A;  3K75 B;  3T0A A;  3P6B A;  4RN5 A;  3OB8 A;  1NUK A;  4W50 A;  3T2P A;  1K45 A;  2XQX A;  1WKY A;  3ECQ A;  1XPW A;  1UWW A;  2LS6 A;  2VCC A;  4A45 A;  2BZD A;  3THC A;  1PX4 A;  4MAD A;  1OT5 A;  4XVH A;  4L0P A;  1H6Y A;  4AG4 A;  3WNK A;  5LCW L;  1GQP A;  2ID4 A;  3EYP A;  2QQN A;  2J22 A;  1I5P A;  3ACI A;  4QPW A;  4CUB A;  5C71 A;  4KWU A;  3LPG A;  3FN9 A;  4A6O A;  4D8M A;  1CZT A;  1GMM A;  3OGV A;  1UX7 A;  5FUI A;  4JHZ A;  2WO3 A;  3VDB A;  1UXZ A;  2WZ8 A;  3CZU A;  3OEB A;  3AC0 A;  2J1R A;  3T08 A;  5G04 L;  1W8O A;  2WO2 A;  4PT6 A;  3I97 A;  1DLC A;  1NKG A;  1UZ0 A;  4ZZ8 A;  1J84 A;  3T0D A;  2Y6H A;  1CZV A;  2W5F A;  2VO5 A;  3T0B A;  4RYD A;  1JZ2 A;  1SG3 A;  4ARX A;  2QQI A;  3HN3 A;  1W9S A;  2X09 A;  1P8J A;  2QQL A;  5DMY A;  4LPL A;  5HXM A;  1OH4 A;  2W47 A;  2Y6G A;  2XON A;  5A1A A;  4Z2A A;  1F4H A;  3FHA A;  3LQC A;  4LQR A;  2V4V A;  2VMD A;  4PF1 A;  5EJ1 B;  2J1V A;  5IFT A;  4BK4 A;  4P08 A;  2E32 A;  3SEE A;  5LA0 A;  3A21 A;  4BK5 A;  4GZ9 A;  1W0N A;  3K4Z A;  3LE0 A;  2HYX A;  2ORX A;  3GXU A;  1KEX A;  2E26 A;  3C7H A;  2W91 A;  3GDB A;  4BDV B;  5JMO A;  3E1F 1;  2BGP A;  3WF3 A;  1EUT A;  3UES A;  1F4A A;  4QB2 A;  4ET7 A;  3DYO A;  1JZ5 A;  4OUE A;  4A4A A;  3NJV A;  5J1X A;  3IB3 A;  1GU3 A;  5DPN A;  4OYU A;  1NX9 A;  2ZXQ A;  1JZ3 A;  3CQO A;  5CZK A;  3SKJ E;  2V5D A;  2J1A A;  1K12 A;  3K4A A;  4CVU A;  5G05 L;  1GOF A;  2BGO A;  2V72 A;  1O8S A;  2VJX A;  4XZU G;  1JZ8 A;  2VZS A;  2WO1 A;  1EUU A;  2VZ3 A;  3MUZ 1;  1ULP A;  4M4R A;  4IUG A;  4W8J A;  2KD7 A;  2RV9 A;  5LA2 A;  4DXS A;  1W9T A;  4PQQ A;  3ACF A;  5JXG A;  3I2H A;  2YFU A;  3P1I A;  4AAX A;  2QBX A;  2VZT A;  4YPJ A;  3I2J A;  1UY4 A;  4JKK A;  1JI6 A;  2JE8 A;  1OF3 A;  3U37 A;  1L7Q A;  3LEG A;  1K42 A;  4MOA A;  1O59 A;  2XHN A;  2C9K A;  2VR4 A;  2ZEW A;  3I3B A;  3VDC A;  2ORZ A;  3OGR A;  2WAB A;  3PUI A;  2L9L A;  4P00 B;  3HOB A;  4P5Y A;  3VD7 A;  2Y64 A;  1US3 A;  1ULO A;  1D7P M;  2VOT A;  3THD A;  3VD3 A;  3F2Z A;  5HPO A;  4KI5 M;  4UOJ A;  1US2 A;  2Y6L A;  3BN6 A;  1PX3 A;  3LEI A;  4DUW A;  2CDP A;  3SEP A;  4ARY A;  5JUV A;  2W1S A;  3C7F A;  3I3E A;  3DYP A;  4QB1 A;  3I2K A;  3C7G A;  1HN1 A;  1TG7 A;  2YG0 A;  2JKX A;  4ZXE A;  2QQO A;  2VZV A;  2VZ1 A;  4LHS A;  2YB7 A;  1UY0 A;  4DUV A;  5F7U A;  1WCQ A;  2Y6K A;  2VMC A;  2ZEZ A;  1UMH A;  4CU8 A;  2W95 A;  2WN3 A;  4W4Z A;  4GWJ A;  1UY1 A;  1W9W A;  5IJR A;  4A42 A;  1K3I A;  4MGS A;  2WAO A;  4CU7 A;  3IAQ A;  4DXR A;  1UYZ A;  4TXW A;  2VC9 A;  1GNY A;  3WNO A;  3FL7 A;  4QX3 A;  4A44 A;  3EB7 A;  3MUY 1;  4ZY9 A;  3W5M A;  2W92 A;  2R7E B;  2VL4 A;  3WF0 A;  3MV1 1;  1XNA A;  4A41 A;  2VZU A;  2W9X A;  3OBA A;  5C7G A;  1YQ2 A;  3CMG A;  1GUI A;  2X10 A;  4LKS A;  3HPN A;  4P02 B;  2X05 A;  3K77 A;  4XUO A;  1LNS A;  4BXS V;  2W87 A;  2OKX A;  1CX1 A;  3T09 A;  1JYN A;  3OG2 A;  2VCA A;  1UMI A;  1JU3 A;  3LPF A;  1PMJ X;  3WNL A;  5EIY B;  1CZS A;  3NQH A;  4ZZ5 A;  2PQS A;  1L7R A;  4A3Z A;  4QDQ A;  1OD3 A;  4QX1 A;  3I2F A;  3MBW A;  1TVG A;  3A23 A;  4QAW A;  3WNP A;  3WSO A;  2QQK A;  2W46 A;  3I2I A;  2J1E A;  2W1Q A;  2VQU A;  2YC2 A;  5C70 A;  3WF2 A;  2CDO A;  1KGY A;  2VTF A;  3J7H A;  2VZR A;  1CIY A;  2WUH A;  5CYY A;  3JXS A;  2BER A;  4XUP A;  4DUX A;  3SKV A;  2ZEY A;  4DEQ A;  3MV0 1;  3WF4 A;  5B4N A;  1T2X A;  2VQT A;  4FI9 A;  2Z4F A;  4UI9 L;  4HG6 B;  2EIE A;  3GGL A; 
#chains in the Genus database with same CATH topology
 3NVC A;  2JG9 A;  2VUL A;  3AP4 A;  2JX9 A;  2VCB A;  3ILF A;  3ZSK A;  5JZG C;  2BP6 A;  1UXX X;  2B7Y A;  1JYC A;  5GLZ A;  5FYH A;  1XE0 A;  3ZKY A;  5A7S A;  4CEW A;  1O4Y A;  2QQJ A;  2HEY F;  2WT0 A;  4QMA A;  4URT A;  4XFH A;  5J96 B;  4XUT A;  1H2M A;  4G3Y C;  4HMZ A;  2R0H A;  4UBH A;  5BNN C;  5D8A C;  5SV8 A;  2E9Q A;  5DQ0 A;  3M70 A;  1D0H A;  1J1L A;  4OHV A;  3B00 A;  3OBZ A;  4XIK A;  4LK7 A;  4E8C A;  3VBS C;  3NJX A;  5ERL A;  4Q4V 2;  2WKK A;  1Z7S 2;  1IQD C;  2BU9 A;  3FFQ A;  3OF1 A;  1FPN 2;  2WBK A;  3AYC A;  3QOP A;  1MAC A;  3WG2 A;  4PJY A;  1XRU A;  2D6K A;  3VBS B;  1HXS 2;  1UY3 A;  4ORF A;  4Q8K A;  1R1Z A;  2VNO A;  2VU9 A;  3NAP C;  3O1V A;  5CFC C;  1T6G C;  1W3X A;  1W8T A;  1IKP A;  3N9N A;  4Y5Z 0;  4NMI A;  5GLU A;  2JIG A;  3BGA A;  3H1W A;  5D8A B;  3I59 A;  4HKL A;  3UGH A;  1U5Y A;  4X8N A;  2UWC A;  4XDQ A;  1W99 A;  4BMB A;  5FZ3 A;  3MYX A;  4COV A;  1HDK A;  2YYO A;  5DUV A;  4GJZ A;  4CCD A;  4HL0 A;  5IFP A;  2W68 A;  4MX3 A;  2HKX A;  5IVV A;  2UU8 A;  3O0X A;  2BBV A;  1UY2 A;  4D69 A;  4CTE A;  4M4P A;  1DIW A;  4Z2W A;  3KHC A;  1C3H A;  5A6X A;  2VGD A;  4YZ5 A;  1HB1 A;  4CDQ A;  3ALQ A;  3B94 A;  3FLT A;  5LA1 A;  2GP3 A;  1DZQ A;  4QM8 A;  3PUR A;  2GDF A;  4FOV A;  1NA1 B;  4HT1 T;  4IV1 A;  4LLF A;  4Y22 A;  2D7F A;  1W8N A;  3G7D A;  4P14 A;  5CKQ A;  2IVI B;  3LD8 A;  4JZR A;  3TNQ A;  4SLI A;  4DEV A;  3KQR A;  2ZX0 A;  1ZBA 2;  3I2G A;  3O1M A;  3B5L B;  3LKJ A;  4GMP 1;  2E33 A;  5IYY A;  5IHR A;  4NHL A;  3POB A;  2R04 1;  4OUL A;  5KBF A;  2SLI A;  1XC6 A;  2ZX1 A;  2NMN A;  4NO4 A;  3JB4 C;  1WCU A;  3IZO A;  1S0G A;  4YFW A;  1AR6 2;  1IPS A;  2H0V A;  4J6G A;  1PNF A;  4GAZ A;  4WVM B;  1X9P A;  1Q56 A;  3KZ4 C;  3RJR A;  2A6Y A;  4M0N A;  3E5Q A;  4Q0U A;  4QPI C;  3A22 A;  5C6C A;  5K0U C;  3DEC A;  4XUN A;  5FY7 A;  4COY A;  4KU8 A;  3IWZ A;  1BVV A;  4QX0 A;  4LOR A;  1YIP A;  4NVP A;  3UYJ A;  5APA A;  3MO4 A;  2XVK A;  1NCR B;  1UZZ A;  3MZH A;  4LLO A;  3E6B A;  2HWB 1;  3HNY M;  4JX0 A;  5ANQ A;  2ARE A;  1NG0 A;  4RGK A;  3RDI A;  4AVC A;  1UYY A;  5E16 A;  1RYY A;  1TMF 2;  2RS5 1;  4AHZ A;  1NZI A;  5FJK A;  2JD9 A;  5FZI A;  1H8T A;  4JKM A;  3CIH A;  1BMV 2;  1R09 2;  1VAK A;  4IE4 A;  1ENX A;  1EPZ A;  2GSY A;  5C9A C;  1BVP 1;  1UOG A;  3HJR A;  4K21 A;  1JZ6 A;  5LBB A;  2EXH A;  4I3P A;  1REF A;  4LO7 A;  1DG6 A;  1YO8 A;  4XFI A;  2HWC 1;  4WVW A;  1G7Y A;  5D21 A;  5BXX A;  4QPG A;  1DHK B;  4AQ2 A;  3RZL A;  4EYU A;  4FPF A;  1E5S A;  2ZEX A;  2IXH A;  4A6S A;  3CZJ A;  2JB8 A;  3KVB A;  4BJ0 A;  4ZXK A;  2C4X A;  3D5O A;  5I0R A;  2GN7 A;  4E9K A;  1ZZ7 A;  4CDX C;  2FDJ A;  4Y1X A;  4B3N A;  3VBO C;  2HWD 1;  1CPN A;  1A3K A;  1XND A;  5JXH A;  2ZJC A;  2WNU C;  4XJ9 A;  2WWS A;  5T52 A;  1AX1 A;  1QIQ A;  1XE7 A;  1OH3 A;  1YUD A;  2B9V A;  2OVU A;  2R04 2;  3BAL A;  4PF5 A;  1W05 A;  4JAA A;  2Q8C A;  1BEV 2;  4C0B A;  5LZ6 A;  2YC4 A;  4XAE A;  1G86 A;  4XW3 A;  4RR3 C;  2VOV A;  2W1W A;  2C9A A;  1V6M A;  5I8Y A;  4IE7 A;  2AEN A;  1QJX 2;  1DYO A;  1QY4 A;  1S0D A;  2BBA A;  4B4P A;  1W8Z A;  2XHK A;  1OD5 A;  4QQP A;  3HQX A;  4HVR A;  4IEO A;  3VKM A;  3ZMO A;  4XBN A;  1O3Q A;  2WZR 1;  1KIT A;  1ULD A;  1A8D A;  5GLV A;  1JHN A;  1PK6 B;  2I74 A;  3I8T A;  4TWT A;  1KDK A;  1MS0 A;  2X53 S;  1NUK A;  1V6J A;  1YNA A;  4LBQ B;  3LOB A;  2P6C A;  5SV5 A;  1BEV 1;  1PMI A;  2O0O A;  2WSU A;  2RR1 2;  2XQX A;  3N7M A;  1WKY A;  2CAV A;  4LA2 A;  4QHB A;  5FLJ A;  4AEJ A;  5L7O C;  1QWR A;  2K9Z A;  4XE9 A;  4Y1Y A;  4ES9 A;  1N3P A;  2JE7 A;  1HRI 2;  3TEW A;  4A45 A;  2GNT A;  3THC A;  5J37 A;  3PL0 A;  1YWK A;  2BFU L;  1MZ5 A;  4MAD A;  1OT5 A;  5FAX A;  1WMX A;  4NWV A;  3SLI A;  2RMU 3;  5FZF A;  1H6Y A;  4JGZ C;  3WG4 A;  3IDC B;  3W5N A;  2KM2 A;  1GQP A;  1KDM A;  3GBW A;  5BUV A;  2QQN A;  2RHP A;  1I5P A;  2D6P A;  3O0V A;  1PVC 3;  4HK8 A;  3LPG A;  3IT8 A;  4YNI A;  3KV4 A;  4D8M A;  1CZT A;  3OGV A;  3R0R A;  4B8E A;  3FLP A;  4OVE A;  4JTN A;  2Q8O A;  3GZT B;  1CAW A;  1ZBE 2;  2ZGL A;  3KT4 A;  2WO3 A;  3MW3 A;  1UXZ A;  3WD5 A;  3DN7 A;  2WZ8 A;  4NAM A;  1RHI 3;  1ODM A;  2ZGK A;  2RS5 2;  4RQP C;  1AYN 1;  2IC1 A;  3NV1 A;  3AYA A;  1CX4 A;  2WFF 3;  1UU4 A;  3RJ2 X;  4XJ8 A;  2RG4 A;  1S0J A;  2XBO 1;  1W8O A;  2GME A;  4PT6 A;  3I97 A;  3QD6 A;  1HQL A;  1NZC A;  3B9I A;  5GZD A;  1XU2 A;  3AMP A;  1UZ0 A;  3POI A;  1J84 A;  4RHV 2;  4R4X A;  3ZYJ B;  3VKO A;  3WDV A;  1CZV A;  1UAI A;  5BNO C;  3N9O A;  4Q5O A;  3D0S A;  4AQS A;  4H2A A;  2PQQ A;  1XBF A;  3N7L A;  4RYD A;  5DUX A;  1AR7 1;  2E7T A;  5F9T A;  5LA9 A;  1UYP A;  1AL0 G;  2RDR A;  3AL5 A;  3PLQ A;  3UV9 A;  1WLW A;  1RUH 3;  4LBL A;  1LTE A;  3VHO A;  4L9B A;  2X09 A;  3VBS A;  4UW6 A;  1C28 A;  3WQ1 A;  2NYY A;  5HXM A;  1OH4 A;  4AI0 A;  1JOB A;  1QJX 1;  1LEC A;  2AH2 A;  1W2U A;  3PUA A;  1GP4 A;  5M0T A;  5K0U A;  3HBK A;  1RUC 3;  4AHY A;  1ACC A;  4LBN A;  2ILM A;  2EF6 A;  1RUG 2;  1VBD 2;  2R16 A;  5FZM A;  2A6X A;  4LQR A;  1DZR A;  1H30 A;  2GN3 A;  1G6N A;  1PGW 1;  1WCD J;  3OUJ A;  3X29 B;  4ZU5 A;  1WW4 A;  3C3V A;  4OI2 A;  4BK5 A;  1YCI A;  3ZN5 A;  1R08 1;  2CWS A;  1VBC 3;  1HB2 A;  2YPD A;  4PIX A;  4Y4R A;  3LE0 A;  1G9F A;  4NII A;  4OI4 A;  1IS3 A;  4WM8 B;  3GXU A;  2QE3 A;  1KEX A;  3CO2 A;  1CAX A;  4Y1V A;  3USU B;  1AR9 3;  1JN2 P;  1WLD A;  2HWC 2;  4DY3 A;  5A3T A;  2D3S A;  3BOW A;  4JDM A;  5JMO A;  1V6L A;  1MR5 A;  3WF3 A;  4BIO A;  1EUT A;  4H3W A;  1QOT A;  5FIX A;  1XNK A;  4XAB A;  3K51 A;  1JZ5 A;  1OOP A;  4YGC A;  5J1X A;  3H50 A;  5FTT C;  1GP6 A;  1OMI A;  4O9G A;  5LBE A;  5CZK A;  5LRR A;  5FK7 A;  1K12 A;  3CBN A;  5EJ3 A;  3ZXG A;  1KRI A;  4I02 A;  5G05 L;  2G9Z A;  4E2Q A;  1FXZ A;  3T2T A;  1CN1 A;  2WWU A;  4AI8 A;  2DU1 A;  2XH6 A;  3U14 A;  1RUC 2;  3ZFG B;  3RZM A;  3C2U A;  4QKF A;  3S6P A;  3WY6 A;  4FTB A;  1F2N A;  4WM8 A;  1XE8 A;  4DY5 A;  1FMD 2;  3OCP A;  4HPK B;  5E89 A;  1JYT A;  2FDG A;  4AOC A;  2WNU B;  5BPX A;  1CVN A;  1GR3 A;  4M4R A;  4I01 A;  4LHL A;  4QPG B;  4W8J A;  3CJI B;  1UN1 A;  2JDP A;  3KQ4 B;  1X33 A;  1W0P A;  2EIG A;  2KD7 A;  3RG0 A;  1UPI A;  1W04 A;  2RV9 A;  4OHX A;  5ABJ C;  3BTX A;  3V0A A;  4PQQ A;  3DKW A;  5JXG A;  4WM7 B;  3LB9 A;  5A33 B;  2YFU A;  1H1M A;  1SPP B;  3JD7 3;  1UU6 A;  3A0N A;  2QBX A;  4JGY A;  4YPJ A;  5K0U B;  1JI6 A;  1RUE 2;  2JE8 A;  3FJS A;  3K3O A;  3AL6 A;  1LB2 A;  2O14 A;  5FMO L;  1Y9G A;  5AC9 2;  3N3H A;  3AKQ A;  2VVD A;  4MZU A;  3RI8 A;  2XDV A;  2P4E A;  1L7L A;  1VBE 3;  5GM0 A;  3VBR C;  3VKN A;  3JB8 A;  4UBG A;  5HV4 A;  3WP3 A;  4AGV A;  3JBG 2;  1NCR A;  4FOY A;  4Q0V A;  4XYX A;  1MS5 A;  3I3B A;  4E4S A;  5J7M A;  5CKM A;  1ND3 A;  4QQ2 A;  2ORZ A;  4CCJ A;  1KS5 A;  3GF6 A;  1LOF C;  3M3E A;  1SCS A;  3SH3 A;  1FMD 3;  3MHZ A;  1M06 G;  1D4M 2;  3WDW A;  2W2I A;  4YW3 A;  2UYB A;  4A7Y A;  4R9C A;  4FOW A;  2GU9 A;  3ZXJ A;  1ZZ8 A;  4UT5 A;  2CDP A;  4IER A;  1U0A A;  3SEP A;  1GP5 A;  1Y9Q A;  3BI3 A;  4BQ1 A;  4CEW C;  3WX5 A;  3KS7 A;  2OA2 A;  4P9J A;  4QT6 A;  2LRO A;  1BLZ A;  2DVG A;  2BWC A;  1S2E A;  2HWE 1;  4OZX A;  5FYT A;  5T5O A;  2JKX A;  4TN7 A;  3G6J B;  1MQT B;  2HEW F;  4CEY B;  2VZ1 A;  4CXW A;  1M4W A;  2BDR A;  2IXI A;  2PHU A;  5IK8 A;  1R08 3;  1WD4 A;  4YLZ A;  3DKQ A;  2VMC A;  1NXM A;  1COV 2;  2BEO A;  2BJS A;  2IXK A;  1RUF 2;  2CYF A;  4D6R A;  1V0A A;  3AP6 A;  2XL7 A;  4W4Z A;  4CCE A;  1RVF 2;  1W9W A;  4A42 A;  4ZU7 A;  2PAM A;  3CNA A;  2D3P A;  1W28 A;  4DXR A;  3V64 A;  1KS4 A;  1WCK A;  5KXB A;  4M0H A;  3U75 A;  4Z1V A;  5A3M A;  1QJY 2;  1KFX L;  1VB2 A;  4AK3 A;  3FL7 A;  4XDP A;  1YEW A;  4FPO B;  3EB7 A;  1RUH 1;  3ES1 A;  4ZY9 A;  4BQW A;  2RJL A;  2W92 A;  4N53 A;  4N53 C;  2OUJ A;  4XJW A;  3WF0 A;  1RIN A;  2XUE A;  4XZP A;  4C0H A;  4FTS A;  4JQT A;  4QPY A;  4OQ9 A;  3Q8C A;  1XNA A;  1PM4 A;  1WD3 A;  1EV1 2;  2ZMN A;  2VVF A;  3UKV A;  4HKO A;  1G9A A;  4XOG A;  5TSW A;  1RUG 1;  1TME 3;  3WUD A;  2ADE A;  4H55 A;  4TLG A;  3BIW E;  5C5T A;  2VBD A;  2X10 A;  2OT7 A;  2ZGO A;  4P9I A;  2XXZ A;  1AYN 3;  3NJY A;  3H0O A;  1LNS A;  5HCA A;  2Y6F A;  1X9T A;  5T5J A;  1SLT A;  2XJV A;  1AR8 1;  1S55 A;  2ZTN A;  3FWE A;  5FYU A;  3WP6 A;  1ZM1 A;  3OG2 A;  5I8S A;  4DS0 A;  1JYN A;  4GXL A;  4HKW A;  5IVB A;  1N3Q A;  2CV6 A;  3HMY A;  3HWJ A;  2BNO A;  5EWS A;  4AE2 A;  4I30 A;  4Y20 A;  3MF6 A;  3AP5 A;  2DCY A;  2OX0 A;  3VBU A;  2PHL A;  1NT0 A;  2PQS A;  5ACA 1;  1E5I A;  2XR4 A;  4PDW A;  2YUE A;  2WS9 3;  3GHM A;  4FQZ A;  5FYM A;  3VHR A;  3E6D A;  4IL7 A;  3JU9 A;  4I0A A;  1Q3E A;  1TVG A;  4QAW A;  2VUC A;  2ZML A;  5EYX A;  4EN8 B;  3BPS A;  4XFF A;  2G9G A;  5L36 A;  1QJY 3;  4GMP 0;  2GC0 A;  4IV1 C;  4QQH A;  3RZK A;  1CR7 A;  4XF4 A;  4Q4V 3;  2JJ6 A;  5HCB A;  4Q29 A;  1ULE A;  2ZHL A;  3N7K A;  1DQ5 A;  2YC2 A;  3WF2 A;  2CDO A;  4MGY E;  4RHV 1;  2JDY A;  3FZ3 A;  3GJA A;  3KV9 A;  1D4V B;  4GB3 1;  3VBH C;  1WW6 A;  1CIY A;  2WUH A;  5CYY A;  2IZW A;  2QQV A;  4XUP A;  2RDN A;  4UFK A;  2JDN A;  2CGN A;  3AMH A;  1QJX 3;  4BWO A;  5I91 A;  1PO2 1;  5B4N A;  4M3C E;  4XFB A;  1NCQ A;  4PDW B;  2Z4F A;  4AEM A;  1I5Z A;  1VBB 2;  4U36 A;  3ZR5 A;  3GGL A;  2WZR 3;  3B9C A;  3KM5 A;  3QH6 A;  5DZF A;  1D2Q A;  1CGP A;  1JU4 A;  3S30 A;  4AYU A;  4WZC A;  3ACH A;  2HLE A;  1ZZ9 A;  4JRL A;  4UW5 A;  5LY2 A;  4IV3 A;  1A34 A;  2BUK A;  3NNG A;  1KFU L;  4LXL A;  4XUR A;  3ZSL A;  4R4Z A;  1SFP A;  3HQR A;  4CDU A;  5FZA A;  4X6Q B;  4QWN A;  2B46 X;  2ZGT A;  2XBO 3;  1W9Y A;  3ZXE A;  4DIN B;  1DGL A;  1SHW B;  2F6B A;  2XKP A;  5FO7 B;  1HV1 A;  4K3U A;  1SBD A;  3FFZ A;  1B35 B;  2BW8 A;  4HET A;  4Q0P A;  1XXN A;  4CDW A;  1OPM A;  3ZM8 A;  3NKG A;  1GOG A;  4G9S B;  3KT1 A;  4W6W A;  4QQL A;  2XWB B;  3WNX A;  4COZ A;  4N43 C;  1PVC 2;  4R9D A;  3VD5 A;  4ATE A;  4Q4X 2;  1O8P A;  3SIT A;  1IOA A;  3T2Q A;  4OZO A;  1HKD A;  2GC3 A;  2WIN B;  2ZZQ A;  2A5Z A;  1SDD B;  2OPW A;  5FXV A;  5HXV A;  5B4X A;  2FDH A;  4EZ4 A;  2YGL A;  2WFF 1;  5FLI A;  1VBA 2;  4CE8 A;  1H1A A;  2PHF A;  5LY1 A;  1X36 A;  2J1U A;  2FMY A;  4IEU A;  2ZX4 A;  5FZO B;  4LKF A;  3GZA A;  4FXG B;  5KXD A;  1JHJ A;  3PU8 A;  5FYI A;  3U10 A;  4XIL A;  1AZD A;  1H2N A;  2PXJ A;  2UUR A;  3OD0 A;  1RMU 2;  4YM1 A;  2XOM A;  3M2M A;  4KGG A;  5IWF A;  4TSV A;  1VRH 2;  5A80 A;  2I45 A;  4LMF A;  1ZRD A;  1FAT A;  5LRS A;  2WT2 A;  2I2S A;  1FV3 A;  2VMI A;  3VZK A;  2O8O A;  4EQV A;  2CAU A;  2XUM A;  1FI2 A;  1BQP A;  3Q9O A;  2PTM A;  2P3K A;  2XBO 2;  2G1M A;  3NAP B;  2VMF A;  3P5B A;  1ZNP A;  1V9U 1;  3O1P A;  3POE A;  4Q2F A;  1F5F A;  4QX5 A;  1VRB A;  5D1I A;  4NRO A;  4NHY A;  3ZXA C;  4Y22 B;  1ZBE 1;  4AHW A;  4DRR A;  2Q1F A;  2RE9 A;  1S4C A;  3ZFF C;  5I0S A;  2FZ2 A;  1UD1 A;  2R49 A;  1R64 A;  3C7E A;  4CUC A;  4DIQ A;  4MLO A;  3M3O A;  3UET A;  3VL8 A;  3IM0 A;  4GMP 3;  1ZRR A;  1YJL A;  1FAY A;  3ZSM A;  4P5H A;  4CUA A;  4FPE A;  1PMH X;  2FDF A;  3VD9 A;  1J3Q A;  1JZ4 A;  1YI7 A;  5CFD C;  3O14 A;  5A3P A;  4B29 A;  4FPJ A;  4V1P A;  5FKB A;  1LU1 A;  1DGR A;  1F9K A;  3FHQ A;  2VOW A;  2G9F A;  2YMZ A;  2A1X A;  1PGS A;  2W3J A;  4LO8 A;  3RRD A;  1JUI A;  1VRH 3;  4TTG A;  2HWC 3;  3WUC A;  1STM A;  4BZ4 A;  4QPI B;  3CDZ B;  1BCX A;  4Y33 A;  3ZYG A;  2ADD A;  1UYX A;  4YAR A;  2B45 X;  5FOJ B;  1Q8S A;  4HK9 A;  2AZ5 A;  1QMJ A;  4HSJ A;  2VZQ A;  3OD4 A;  5L9R A;  4MO3 M;  4XUQ A;  3ZPO A;  3LDK A;  2JDZ A;  1XNC A;  1IPJ A;  2UY9 A;  4R8H A;  4D7Y A;  3D4K A;  5LK7 B;  1KJR A;  4X6R B;  1QH7 A;  3V0A B;  3I3D A;  2Q8E A;  2WFF 2;  2ZAB A;  3WNN A;  1UO9 A;  4LIV A;  4Q0Q A;  4UAP A;  1DP0 A;  1OFN A;  2JWP A;  2VZO A;  2RR1 3;  4D0Q A;  4BOW A;  4GWN A;  2R6Q A;  2DBI A;  2HYK A;  1AL2 2;  1CAV A;  3LCP A;  1NQJ A;  2EIC A;  3OJB A;  1WME A;  4XDO A;  1C1L A;  1RL3 A;  3ZFG A;  1JYX A;  2ZHN A;  1GKB A;  2RJ2 A;  4TYS A;  4E4H A;  1W8W A;  1S0C A;  4Q4Y 1;  4JRA A;  5FY9 A;  5KR7 A;  3III A;  4NWW A;  2A3Y A;  1HLC A;  2HWB 3;  5FOB B;  3HNB M;  4FT8 A;  2BNM A;  3D3A A;  1DBN A;  1FNY A;  1XYN A;  4A7K A;  1MS1 A;  4QDS A;  4B4Q A;  5FPU A;  2XQR A;  1I3H A;  3IMM A;  1HXS 1;  1NY7 1;  2WN2 A;  3HQU A;  2DCJ A;  4GB3 3;  4PLO A;  1VBD 3;  2AEY A;  1IS6 A;  2VME A;  2WAA A;  4WV8 A;  2IWG B;  5GAL A;  4WZF A;  5C5U A;  2AR6 A;  3ZO0 B;  3POS A;  3VZL A;  5CFC B;  4Q1R A;  4Q4V 1;  4P9L A;  1TE1 B;  3JBG 3;  1WLT A;  5JZG B;  3K75 B;  5F3C A;  3T0A A;  1W6M B;  4HLT A;  3I4I A;  4PLM A;  2VW2 A;  3LDR A;  3N7J A;  5EPA A;  5IK5 A;  2BPA 2;  3KHB A;  2VW0 A;  3POW A;  5JCT A;  4K1Y A;  2RM2 1;  3ECQ A;  4YFZ A;  2R07 3;  2OPK A;  1RUF 1;  1XPW A;  1HQW A;  1RUD 1;  2OW4 A;  2YU1 A;  5EP9 A;  1UWW A;  2XLG A;  1LOG A;  2LS6 A;  3MFC A;  1APN A;  2HWF 2;  4GA9 A;  5CU1 A;  5FPX A;  4NRM A;  2JXA A;  4EN0 A;  4B7E A;  1H9W A;  1EY2 A;  5FWJ A;  1PO1 1;  4CPB D;  2VNR A;  3WDX A;  3MIH A;  2WNV A;  1W6Q B;  5CAD A;  2JDK A;  3WNK A;  4J1X A;  1W6M A;  5FYY A;  1PIV 1;  3FC0 A;  2OYZ A;  3KT7 A;  4MGI E;  1SLB A;  1JOJ A;  2YU2 A;  3IPV B;  1HRV 2;  4CUB A;  4KWU A;  1KXG A;  1DLL A;  2TNF A;  1RUG 3;  1J3P A;  1TME 1;  2A3X A;  2OQ7 A;  3DL3 A;  3LWC A;  3TEZ A;  1GMM A;  1QQP 1;  1ZBA 1;  3RQ0 A;  5CG9 A;  4KBB A;  4OUM A;  4NIG A;  1VP6 A;  1VLN A;  1LR5 A;  4P9Y A;  3ILR A;  1PZ7 A;  4K8F A;  1AJO A;  2P2K A;  5EYY A;  1S0F A;  3OEB A;  1MEC 3;  2RS3 3;  4QKD A;  4YGE A;  2ZAC A;  1S1A A;  3B01 A;  1AYM 1;  1F35 A;  4DO0 A;  4ASM B;  4AI3 A;  2NZ9 A;  3OBT A;  1AVB A;  1W03 A;  4CYD A;  5FXZ A;  1DLC A;  1ND2 B;  2YC0 A;  2XLA A;  4LEJ A;  1NKG A;  4R52 A;  3ORJ A;  5LAT A;  3VDD A;  4AGG A;  4CDU C;  4ZZ8 A;  2E7A A;  4JGY B;  2R07 2;  5FP4 A;  1ZA7 A;  5FY0 A;  5FRE A;  1ZRI A;  3T0B A;  4BYY A;  3ZSJ A;  2QKD A;  1OLQ A;  1ZA4 A;  1RC6 A;  3VHP A;  5FUP A;  1N1V A;  1VB4 A;  3HN3 A;  4KL1 A;  3K48 A;  3N9P A;  4AXO A;  4ARX A;  1JYI A;  5FYS A;  4ZKT B;  3CJI A;  1OUX A;  2DTY A;  3MPB A;  2VQA A;  5IAV A;  4AHX A;  5DMY A;  1RUE 1;  2XPJ A;  4Q4W 3;  3LA2 A;  1PO2 3;  3M3C A;  2VTX A;  2W47 A;  1WGP A;  2Y6G A;  3VBF B;  4WM7 C;  2VUJ A;  3WT3 A;  1EAH 3;  2B42 B;  3B7M A;  1RTV A;  1UOJ A;  3OSD A;  4K7J A;  5ABJ B;  1HXS 3;  4Z2A A;  5DUU A;  5LBF A;  2YBP A;  3KCX A;  2V4V A;  5IFT A;  2CTV A;  1SLC A;  2J1V A;  4D94 A;  1I6X A;  4CP9 A;  5BNO B;  2E32 A;  3SEE A;  5LA0 A;  4X8P A;  4LIU A;  5J36 A;  2ZX2 A;  4GZ9 A;  1W0N A;  2LAL A;  2XL9 A;  3VUO A;  3K4Z A;  4P9X A;  2IUW A;  3RZG A;  2ERF A;  1ULC A;  4Y3O A;  4XCA A;  3P3P A;  5F6K A;  1HB4 A;  5I0T A;  1WMF A;  4AFC A;  4YW5 A;  5A3N A;  2Y26 A;  4AFD A;  2WQZ C;  4IEP A;  3BPZ A;  4XTM A;  3AP7 A;  2VNV A;  4Z07 A;  4XFG A;  2WO7 A;  4IE5 A;  1T6B X;  3TRS B;  5KC6 A;  1HRV 1;  2Y33 A;  3ACL A;  3BOP A;  1F4A A;  3N35 A;  3PVN A;  4HN0 A;  4QB2 A;  4OUE A;  4NJ4 A;  4O9E A;  5AC9 3;  4NHK A;  4A4A A;  4O65 A;  1MEC 1;  3I7D A;  2HBU A;  2UWB A;  3T3Y A;  2ZA9 A;  1NX9 A;  2VE1 A;  5FPV A;  1JZ3 A;  1YFY A;  2FCU A;  5EQU A;  4JV4 A;  2WT1 A;  2ZKL A;  2X5I C;  1OC1 A;  3J7M A;  4AW7 A;  2ZX3 A;  3LFI A;  4CVU A;  1Z7S 3;  4A3X A;  3U4S A;  3AJY A;  2ZGN A;  1OVS A;  5IK4 A;  1XB9 A;  2PAE A;  2VJX A;  2RM2 2;  1QF3 A;  4E4Z A;  5IVF A;  2VZS A;  2XWJ B;  1RIT A;  3H42 B;  4UFH A;  4N43 A;  1EUU A;  1NLS A;  2H6C A;  1ULP A;  3PMS A;  4FFG A;  4CDW B;  2ES3 A;  5BNP C;  2WNE A;  4MYE A;  2FCT A;  1PO1 3;  3RI9 A;  3LDB A;  3ZSE A;  1VE0 A;  3ZX7 A;  5KC5 A;  4CCN A;  3RNS A;  1OOP C;  3WW1 A;  1HB3 A;  1W6O A;  4DXS A;  4XCB A;  1NE6 A;  5F6L B;  1VBD 1;  1RUD 3;  4IGO A;  4M3C A;  5T5P A;  3THT A;  4FPG A;  3ZXK A;  5A6Z A;  1O6U A;  3VBR B;  2A6Z A;  4FAG A;  5FJH A;  2WYF A;  3SCG A;  4ES8 A;  4BU2 A;  4GH4 B;  2O1Q A;  4XIO A;  1SCR A;  1PIV 2;  1RUI 3;  3GZE A;  4Q4Y 3;  1L7Q A;  2LUW A;  5C8C C;  2WWJ A;  5F37 A;  3KWV A;  2WNV C;  5FZH A;  3RWN A;  1O59 A;  5DUW A;  2XHN A;  4MHU A;  5CG8 A;  2C9K A;  3AXE A;  2QVS B;  4RQP A;  4JCK A;  1GZW A;  3V65 A;  3TN9 1;  3MLL A;  3PVB B;  3VDC A;  2ZHM A;  4LO4 B;  2HWF 1;  4LBQ A;  3OGR A;  1K5M A;  1B35 C;  1JXN A;  2WAB A;  5I93 A;  3N4M A;  3HBZ A;  1Y7B A;  4N53 B;  1QQP 2;  1WMD A;  3CEW A;  4P00 B;  5FY1 A;  2FQP A;  3FBY A;  2ET7 A;  3UL2 A;  2Y64 A;  5LBC A;  4FFI A;  1C5H A;  1F15 A;  5FLH A;  3WV6 A;  4YG0 A;  1NYW A;  3THD A;  1IZ3 A;  4LA3 A;  4Q1P A;  3F2Z A;  5A33 A;  2WQ4 A;  3ZDS A;  5HBA A;  1E57 A;  4KI5 M;  5GZG A;  2A70 A;  1US2 A;  4QXK A;  3T4V A;  3BN6 A;  1PX3 A;  4DUW A;  4IV3 C;  5FFO C;  4ARY A;  1O3T A;  1DQ0 A;  1EV1 3;  1QNW A;  3I3E A;  1CAU B;  1BBT 3;  1FOD 1;  4QB1 A;  3I2K A;  3ZFF A;  4L2N A;  5FPB A;  1LOA A;  3PIJ A;  5GZC A;  4OI1 A;  1HN1 A;  1LUL A;  1XQN A;  2YG0 A;  4UW3 A;  2K46 A;  1LOD A;  4Q4Y 2;  1QHD A;  3VDD B;  1UIJ A;  2YB7 A;  3ZDV A;  1VBE 1;  1UY0 A;  3IDE A;  4Y26 A;  4DUV A;  1VBB 3;  2YBK A;  4I3G A;  4XPV A;  4GKY A;  4UW4 A;  5K7P A;  4XJU A;  1EP0 A;  4R9B A;  2QCS B;  1LOC A;  3I3Q A;  4HVQ A;  3TEX A;  2ZGP A;  1DYP A;  1UY1 A;  4AVB A;  3LIG A;  2WS9 2;  2ARX A;  4RR3 A;  4YVW A;  1K3I A;  1N3O A;  4CU7 A;  3FBM A;  4AGR A;  2YY1 A;  4HVO A;  3VGI A;  3WDY A;  2JEM A;  4M3C F;  1UU5 A;  1LGB A;  5I0U A;  3TB0 A;  1GNY A;  4AI1 A;  2TBV A;  2RDQ A;  4QX3 A;  4XC9 A;  4C1X A;  4YW4 A;  2Q4S A;  1V9U 2;  1CPM A;  1OLM E;  3WLU A;  3W5M A;  4MG2 A;  4OCT A;  2R7E B;  2VL4 A;  3AFG A;  1AR7 3;  2RJK A;  3R4S A;  4LJH A;  1POV 0;  1HRI 1;  5FZC A;  4CEY A;  4CEY C;  4E4D X;  4A2U A;  3KGL A;  4LKD A;  2HBT A;  5JI7 A;  1LEM A;  4S2D A;  3J8F 2;  3WCR A;  1LOE A;  2W9X A;  2ZS6 B;  4LUK A;  1W6O B;  4J1W A;  4CRQ A;  5C7G A;  1DZT A;  3VZM A;  5DAB A;  1GUI A;  1JH5 A;  5DAX A;  4LKS A;  4QHO A;  4B1L A;  1NA1 A;  3I3M A;  3ZIW A;  2K2S A;  3K77 A;  4XUO A;  4K1Z A;  2WZR 2;  4FO9 A;  4B4R A;  2W87 A;  1RHI 1;  4BXS V;  1DFQ A;  1O4Z A;  4RFT 0;  3S7I A;  1OQE A;  4F83 A;  4KGQ A;  2ZZJ A;  1ODN A;  3W20 A;  1DQ6 A;  3WNL A;  5C9A B;  1CZS A;  5EIY B;  4JDO A;  3V0B A;  5F32 A;  3HN1 A;  1L7R A;  2WS9 1;  1LOF A;  3EXU A;  4OUS A;  1OD3 A;  1BYH A;  1DCS A;  1PVC 1;  2ZCW A;  4YW1 A;  1GWK A;  2VOX A;  3I2F A;  1OSG A;  3MBW A;  2VUD A;  1ULF A;  1WW5 A;  3A23 A;  3JCI A;  4UFL A;  4CSW A;  1BJQ A;  4NPL A;  3PHM A;  1UKR A;  3WSO A;  3A4U A;  1O4T A;  1IQA A;  3I59 B;  1TMF 1;  2DFC A;  5IVY A;  4WVM A;  5CEH A;  5K8S A;  2MEV 2;  2VQU A;  5FZ0 A;  1OA2 A;  1JTZ X;  3DF0 A;  4YW2 A;  5FZB A;  3W9A A;  1NOV A;  4NHM A;  1S0I A;  3J7H A;  4QXH A;  5FXW A;  2WNO A;  1O91 A;  2R06 2;  5IW0 A;  2BER A;  3NV4 A;  4DNY A;  4IEQ A;  4GD4 A;  3LFM A;  5K4L A;  1AJK A;  4IEZ A;  1CIW A;  1ASJ 2;  3Q8F A;  3PVO A;  1GSL A;  4N9H A;  3UGG A;  2PFW A;  3S5A A;  4HG6 B;  3AZZ A;  4GIQ A;  1W6P A;  3BTA A;  1RHI 2;  4AED B;  3FE5 A;  1SMV A;  4RSU A;  5IAX A;  5D2A A;  1C8M 2;  1OA4 A;  2WNU A;  3WP4 A;  2P17 A;  3MW4 A;  2CU5 A;  3OGS A;  4LKE A;  5FYZ A;  4CDQ B;  4S2G A;  2RDS A;  4WM8 C;  4CCM A;  3MIG A;  4MSV A;  1VAV A;  5CB7 A;  1NXD 1;  3ST7 A;  3LA7 A;  3Q8B A;  3I2O A;  3KF5 A;  3ACG A;  3NST A;  4XQ4 A;  2W94 A;  4MXW B;  2EAA A;  3SC7 X;  3LOI A;  5C4W B;  2BFU S;  2QNK A;  5JPN B;  2C26 A;  3RMX A;  1TMF 3;  1WZX A;  3WNM A;  1FV2 A;  2HWD 3;  2VH9 A;  3ZYP A;  1YFU A;  2B8M A;  4CCO A;  4YSF A;  4EWE A;  4NPR A;  3B3Q E;  3I54 A;  4QGN A;  2EXJ A;  2ZOE B;  3KCC A;  3OEA A;  1G8W A;  2CGO A;  4LOT A;  1BHG A;  4MGQ A;  1H8T C;  5T54 A;  3VZJ A;  5A70 A;  5ANN A;  2SBA A;  3POY A;  1BBT 1;  5L9B A;  1UOB A;  1Q8Q A;  1JZ7 A;  3O1S A;  4BIS A;  4KQ7 A;  2P3Y A;  1IPK A;  2PEL A;  4OMC A;  3WEZ A;  4FQ4 A;  2NP0 A;  2B4K A;  1LHO A;  4OLL A;  5FMO S;  5LK5 A;  3S5Q A;  2BVB A;  1R09 1;  5BNQ A;  2Y8K A;  3R05 A;  4XFC A;  2FMD A;  3VKL A;  3ZR6 A;  2Z5W A;  5F5C A;  5LAS A;  3ZYB A;  1LED A;  2JIC A;  3AXD A;  5GJ6 A;  1E5H A;  4UF0 A;  4Z82 A;  2WYS A;  3IMN A;  1RUO A;  1H6X A;  3ATG A;  1QNY A;  1IS5 A;  1AXK A;  3GCW A;  3VN4 A;  2HWB 2;  2J7M A;  3UJO A;  1Q8P A;  4GH4 A;  3AP9 A;  3K4D A;  1J83 A;  1FPN 1;  2XJT A;  4GH4 C;  3U1X A;  2JIJ A;  1XJA A;  1LCL A;  1PZ8 A;  4BQ4 A;  2EID A;  1VMH A;  3UNP A;  1AR8 3;  3D82 A;  3RWK X;  4CA9 A;  1JYW A;  1SLA A;  1RUH 2;  2C5D A;  2V73 A;  3FX3 A;  4L99 A;  5A3W A;  3MLJ A;  5KXC A;  3O5S A;  4XF0 A;  3HEI A;  3CU7 A;  2D93 A;  4U2A A;  4QX8 A;  2QFE A;  5FPA A;  5JOY A;  3MLK A;  1LRH A;  2ZAH A;  3AYD A;  2YBS A;  2D3R A;  2HEV F;  3KVA A;  5LEK A;  3ABZ A;  4BQX A;  2Y6J A;  4XFA A;  3FHI B;  5BNP B;  1VIW B;  3N9Q A;  1QGL A;  1QJF A;  3O7O A;  3TWI A;  3ZFE C;  5FO8 B;  1OLR A;  2DCK A;  4BH9 A;  2B5H A;  2XVL A;  5L19 A;  4I2O A;  2GNM A;  4CDQ C;  2P37 A;  2WDB A;  1Z7S 1;  3DXT A;  2ZKN A;  4I09 A;  3EO6 A;  4BHP A;  3BTZ A;  1GAN A;  4S2F A;  1U5Z A;  2GC1 A;  4QPI A;  4BPZ A;  4SBV A;  1H4G A;  5BYN A;  1B09 A;  4K9S A;  2DBN A;  4NRQ A;  5I0D A;  2EIB A;  4Y4Y A;  3IAP A;  1O5L A;  4DOU A;  1OF4 A;  4QGL A;  4QX7 A;  3NV2 A;  5DG1 A;  4OHW A;  1JYV A;  4NPM A;  1X8E A;  1WUV A;  4O7X A;  2CWM A;  3URF A;  3C7O A;  1PZ9 A;  3KCY A;  2H0B A;  2EVX A;  2IXL A;  2UY8 A;  4PI2 A;  4QX2 A;  4LT5 A;  1UL9 A;  4DXT A;  3J4U H;  2W08 A;  1RUJ 1;  3VBR A;  4IET A;  4Y24 A;  3VDA A;  4QU2 A;  4OHY A;  4QHZ A;  1COV 3;  2JDA A;  2RS5 3;  4QXB A;  1QOO A;  4BM8 A;  2VZP A;  1XU1 A;  5HI0 A;  4WM7 A;  1H9P A;  1MVQ A;  1ST8 A;  4Q27 A;  2RS1 2;  4F8A A;  3QLQ A;  3AFK A;  3BVC A;  5T55 A;  3KV6 A;  2BGC A;  1AHS A;  3I2D A;  1S2B A;  3OY8 A;  4JKL A;  5A7N A;  2HWF 3;  4AI9 A;  4FCA A;  5IVJ A;  5DN2 A;  2J1T A;  1PGL 1;  1CON A;  1HV0 A;  1SFY A;  4AI2 A;  2VXJ A;  2GP5 A;  2VEC A;  1CD3 G;  4MUV A;  1GOH A;  1LGN A;  4XBL A;  1N1T A;  3PUS A;  3AZY A;  4CP1 A;  1RUI 1;  4XJZ A;  3TYJ A;  3DEM A;  1NLR A;  3WF1 A;  4NAO A;  4CU9 A;  2VMH A;  3J9S A;  1IG0 A;  4L8Q A;  4E2G A;  1TME 2;  1YC6 1;  5AFB A;  3H8R A;  2AYH A;  3PJY A;  1G9C A;  4COW A;  1EAH 1;  5FPL A;  1ND2 A;  3TN9 3;  2BTV C;  1N1Y A;  2P34 A;  3LSE A;  4AVS A;  4E8D A;  4GUL A;  2WA3 A;  3ASI A;  2GH8 A;  1QOS A;  5FZ4 A;  3U07 A;  4AVV A;  4EN7 B;  5KHH A;  2LTN A;  3OYW A;  4YVS C;  4ZU4 A;  4RN5 A;  1LES A;  3OB8 A;  5A3U A;  4HFS A;  1SLI A;  4KBZ A;  4OI0 A;  1UMZ A;  2A75 A;  1SDW A;  1C8N A;  3OUH A;  1URX A;  2YXS A;  1QQP 3;  4UXA A;  1AR9 2;  4IDZ A;  5IUQ A;  4YM3 A;  4WBB A;  1RVF 3;  2ARA A;  1OHF A;  3IKW A;  4RGA A;  2GAU A;  1H4H A;  2V09 A;  2LM3 A;  2VCC A;  4OHZ A;  2NM1 A;  4HSL A;  1D4M 3;  1V6N A;  4IEV A;  3IPV A;  4FVV A;  1PX4 A;  4FPH A;  3ZYI B;  2P1B A;  5ISL A;  1XYP A;  2JE9 A;  1H8T B;  1LU2 A;  3OOX A;  3WVJ A;  4F3J A;  4L0P A;  2VNG A;  4AG4 A;  5LCW L;  4UYB A;  5AC9 1;  5A6Y A;  4L92 A;  3MIC A;  1PK6 C;  1GFF 2;  1ZZB A;  2ID4 A;  3NJZ A;  3KLS A;  3EYP A;  2NMO A;  5FMD A;  4B7K A;  3ACI A;  5T50 A;  1UX6 A;  2PLV 3;  2R07 1;  3MI8 A;  4A6O A;  4AZZ A;  3HIF A;  2RM2 3;  3NMB A;  3ROU A;  3ZN6 B;  5BY5 A;  4I0W B;  3OTF A;  2DVD A;  4JDN A;  4YRD A;  3A0K A;  5FUI A;  4JHZ A;  3O1T A;  4GKX A;  3E6C C;  3EMR A;  1S0B A;  3CZU A;  1ND2 C;  4ATF A;  4BQ2 A;  3NNM A;  5FZK A;  1R08 2;  1R09 3;  2Z42 A;  2EXI A;  3JBG 1;  4UFJ A;  5EV7 A;  4ZHN A;  3UGF A;  3PUQ A;  4KWJ A;  1L3J A;  4HON A;  4AL9 A;  4NUB A;  3T08 A;  1UZV A;  4KNC A;  1OQ1 A;  2ETE A;  2WO2 A;  1YFX A;  1I9R A;  3WCS A;  3R4D B;  1AR9 1;  1ENR A;  1OKQ A;  2GNB A;  1W2N A;  3UKN A;  3AMN A;  1MZ6 A;  4CDX A;  2VO5 A;  1GIC A;  4MGK E;  2QZ3 A;  2VTX J;  5FBJ A;  1C8M 1;  3EHK A;  4DMI A;  4Y5S A;  4C90 A;  2VY0 A;  4IQP A;  5DZG A;  2QQI A;  4I0B A;  3HT1 A;  3ZN6 A;  1QH6 A;  1SZB A;  1PHM A;  1W9S A;  3VZO A;  3ZOI A;  1P8J A;  2D5F A;  4ZS3 A;  5FCC A;  4LPL A;  1YQ5 A;  1QJU 3;  4C1W A;  3ZIX A;  2OZJ A;  4KWK A;  5C3R A;  4HXC A;  2XON A;  4CDU B;  4Q0S A;  1W6Q A;  2BYV E;  2Q5T A;  2DVA A;  5E1R A;  1CAV B;  2PLV 2;  3J8F 3;  1E5R A;  2FDI A;  5IT6 A;  4DZG A;  5CBL A;  2VMD A;  5EJ1 B;  4PF1 A;  4P08 A;  1AYM 3;  3AYE A;  4N90 A;  4ONU A;  4QKB A;  1XOY A;  4YM0 A;  1WBL A;  4JGZ A;  4EV0 A;  1AYN 2;  5F3I A;  3PIG A;  5CA6 A;  2E7Q A;  2BNN A;  5FO9 B;  2JDU A;  3ZFG C;  1R1A 3;  2MHF A;  2R30 A;  3HD8 B;  2AUY A;  3LF7 A;  1ZVF A;  1YIF A;  3LGR A;  2ORX A;  2AGS A;  1PGW 2;  5CIR A;  1UOF A;  4C8D A;  2E26 A;  2ZPX A;  5JWP A;  5JZG A;  4O61 A;  2Q1Z B;  2DYC A;  3LAG A;  4IE6 A;  2XVG A;  4BDV B;  4NRP A;  4ZPI A;  2R0F A;  4ZS2 A;  4AED A;  3E1F 1;  1BBT 2;  2YDE A;  1O7F A;  3MF9 A;  3HVD A;  3L2Y A;  5KHJ A;  1IHM A;  1TEI A;  4ET7 A;  3RZH A;  4IEW A;  3MIE A;  3MPP G;  2DTW A;  3H8U A;  1H1I A;  5FY5 A;  4QPG C;  1ND3 B;  3RZJ A;  4HAN A;  3IB3 A;  4DFS A;  2RMU 1;  1GU3 A;  5DPN A;  4AEK A;  4OYU A;  4V2V A;  2ZXQ A;  3CQO A;  4FPL A;  3SKJ E;  3IDB B;  1N47 A;  2V5D A;  3OPZ A;  5F5I A;  1DQ4 A;  4KH9 A;  2WC2 A;  1XSQ A;  2XJP A;  3K4A A;  4N7I A;  2VG9 A;  1NY7 2;  1KD7 A;  1ZBA 3;  1AF9 A;  4XBQ A;  1Y43 B;  2XML A;  1GOF A;  5BNO A;  1RUF 3;  2BGO A;  5EHD A;  2PHW A;  4Y20 B;  3WW2 A;  1JZ8 A;  1BZW A;  2Y0O A;  2KA3 A;  3POF A;  4CEW B;  2VZ3 A;  4XQD A;  1QXR A;  3TOJ A;  1LHV A;  4E2S A;  1WW7 A;  1LGC A;  4MET A;  3ZFF B;  4IUG A;  2QZ2 A;  2DFB A;  2EXK A;  1RXF A;  5CNA A;  2W39 A;  3AMM A;  2NPI A;  3DUI A;  5LA2 A;  3PNA A;  1W90 A;  1W9T A;  5B2G B;  1RUN A;  3U78 A;  3V0B B;  3ACF A;  1AR7 2;  4ERO A;  2X8K A;  1WA6 X;  2R04 3;  1BEV 3;  1MVE A;  2WLQ A;  1OBN A;  2C6S A;  4AAX A;  2VZT A;  3VBH A;  5LW9 A;  4QM9 A;  3RPQ A;  3SCH A;  1FNZ A;  1WBF A;  5H9R A;  3ZXF A;  1HJG A;  4G4F A;  2QQW A;  1F8V A;  3AX4 A;  1OF3 A;  3LEG A;  1POQ A;  4FFF A;  1OLM A;  2YGM A;  4NN0 A;  5CFC A;  1W8H A;  1TQ5 A;  1BKZ A;  1CAX B;  3T1M A;  1ASJ 1;  1IKQ A;  4RS5 A;  3PME A;  2P3I A;  3H1M A;  2VBB A;  3KMH A;  5FP7 A;  3H8O A;  3QH7 A;  2WL1 A;  1W2O A;  4LUM A;  4EJR A;  5JOW A;  4RQP B;  2GH2 A;  4Q4X 3;  2FZ1 A;  3AVR A;  5FBZ A;  3ZKU A;  3LSD A;  2L9L A;  2RR1 1;  1YHF A;  1DYK A;  1GBG A;  4P5Y A;  5DDJ 2;  4R9A A;  5FZD A;  1G9B A;  3VD7 A;  3GZU C;  3VZN A;  1VMJ A;  5JSR A;  3VV1 A;  2ENR A;  4MV2 A;  5LEJ A;  1W8F A;  3NNF A;  3ZYH A;  2GMP A;  5JVV A;  1XYO A;  5J98 B;  4AQT A;  2VUA A;  1BMV 1;  1VBC 2;  3UJQ A;  1D7P M;  2E6V A;  1AR6 3;  1OI6 A;  2VOT A;  3RS6 A;  3VD3 A;  5HPO A;  2BVV A;  1SPP A;  5DAW A;  4YW7 A;  1ND3 C;  2JG9 B;  2VCM A;  3LZZ A;  4JGZ B;  5JSP A;  4EWA A;  1YXW A;  4A7Z A;  1Y4W A;  4FPK A;  4D6S A;  2PYT A;  1N1S A;  2BOI A;  3D8C A;  3C7G A;  3J8F 1;  4IV1 B;  5JI9 A;  4FTE A;  4BXF A;  1GWL A;  3FMG A;  3Q8E A;  4D6Q A;  1GWM A;  1UCX A;  4ZXE A;  2QQO A;  2VZV A;  1ASJ 3;  1D2S A;  2HJI A;  1YRZ A;  3ENR A;  1X7N A;  3DPR B;  5A7O A;  1DQ1 A;  2A71 A;  3AZX A;  5JOX A;  1WCQ A;  2Y6K A;  2ZEZ A;  1I1E A;  1UMH A;  2FBE A;  1H2L A;  1C8M 3;  2Z79 A;  4UF0 B;  5LB6 A;  3MW2 A;  2D40 A;  1OFS A;  4ASK A;  1A78 A;  3DPR C;  3PTY A;  1VRH 1;  3N9M A;  4K20 A;  4LBK A;  3RYR A;  4MHR A;  4MGS A;  1BK1 A;  5BNN A;  3H7J A;  2VC9 A;  1IGO A;  1GZC A;  2RMU 2;  3CF6 E;  1UZW A;  4A44 A;  2HWD 2;  3RMY A;  3D6E A;  4FSJ A;  5JR7 B;  4BB3 A;  2X5I A;  1BXH A;  3UT0 A;  1DDL A;  1VPH A;  4H14 A;  2VMG A;  1A8M A;  4FP2 A;  5DDJ 1;  2R06 1;  2VZU A;  3ZVX A;  1CAU A;  2QJV A;  4YZ1 A;  5ACA 3;  4H7L A;  1ZBE 3;  3CMG A;  5C3S A;  1CJD A;  1Q43 A;  3KV5 A;  1VBA 3;  1ZZC A;  3ZXL A;  2ZGR A;  4P02 B;  2X05 A;  2IVJ A;  3NNL A;  4NID A;  3P3N A;  4QQO A;  1KJL A;  3BYW A;  3T09 A;  1CX1 A;  4LNV A;  3U4X A;  2VCA A;  4HBN A;  1PK6 A;  1JU3 A;  3LPF A;  1Q8V A;  1PMJ X;  4YGB A;  1RMU 3;  3VHN A;  3TEY A;  1JUH A;  5L9V A;  1AXZ A;  4ZZ5 A;  2ZMK A;  4QGM A;  1V6I A;  3OGJ A;  2YHJ A;  3E97 A;  2OQ6 A;  1RVF 1;  4LK6 A;  4PDW C;  4AF9 A;  5CAZ A;  1PM7 A;  3WR0 A;  3IBM A;  1AL2 3;  4QX1 A;  2PHR A;  4JVA A;  3VKF C;  1OA3 A;  1TNF A;  3VBO B;  1HRI 3;  3DXU A;  3ON7 A;  4COU A;  1UKG A;  3PU3 A;  4CDX B;  4URA A;  2QQK A;  2W46 A;  2JKB A;  4D3W A;  2UYA A;  2A3W A;  4UFM A;  4CZS A;  3BOD A;  4FP3 A;  1RXG A;  5FP9 A;  2VVE A;  2HWE 2;  1VR3 A;  1YYN A;  2C24 A;  2BWA A;  4YZ3 A;  3CLP A;  1GQG A;  1KGY A;  2XJS A;  2OS2 A;  3RYP A;  2VTF A;  5FYC A;  4AFB A;  3BIE A;  2VZR A;  3USU A;  4Y1Z A;  3PVE A;  4CXX A;  2FDK A;  4CPB A;  1HW5 A;  4XF3 A;  2WZP P;  2ZEY A;  4LTA A;  5ACA 2;  3TN9 2;  5AVA A;  3WF4 A;  1T2X A;  2XJR A;  4M3C B;  3SQO A;  3QAC A;  3M3Q A;  4LHK A;  1JMU B;  2ZAA A;  4YVS B;  2EIE A;  4M00 A;  2QDN A;  4BLJ A;  4FAH A;  2JD4 A;  4CCL A;  3QCW A;  4MXV A;  1UNB A;  3LEK A;  3NAP A;  4TZD A;  3DCQ A;  4CU6 A;  2D97 A;  5CKN A;  1FT9 A;  1MS9 A;  2YPJ A;  4IV3 B;  4LUL A;  4QD2 A;  5FZ7 A;  2K0G A;  1YQ8 A;  1QJU 1;  1EV1 1;  1ALY A;  1RUE 3;  1YI9 A;  3H7Y A;  3HR9 A;  4ASL A;  1AR8 2;  5JAX A;  1DF0 A;  5FP3 A;  1OVP A;  1S2K A;  1VBE 2;  2PAK A;  2CY6 A;  1F5J A;  2QUO A;  3AMQ A;  3HNM A;  3H3U A;  5FQ0 A;  3Q8A A;  2J1S A;  4YG6 A;  5FWE A;  5CFD A;  2D6L X;  1V6O A;  4TLF A;  1LJ7 A;  1UW8 A;  1C1F A;  2HWE 3;  3RFR A;  5JXJ A;  4KMQ A;  1QXJ A;  1EAH 2;  5C3P A;  2PLV 1;  1XNT A;  3NRU A;  2RVA A;  4XAC A;  3ETP A;  3T30 A;  4CCC A;  5JOZ A;  1J1T A;  3QBQ A;  1NAE A;  1MS8 A;  1LKN A;  2EAK A;  1GLH A;  4XXP A;  3ETQ A;  4YWA A;  1OQD A;  1J3R A;  2ZBJ A;  5A3O A;  5A32 B;  1FX5 A;  2WR9 A;  3WG1 A;  4ZON A;  4E27 A;  5JDB A;  1COV 1;  2BV4 A;  1QJY 1;  5GZE A;  4EN9 B;  1MEC 2;  3VBO A;  5FQ0 B;  2I07 B;  1NCQ C;  1W2T A;  3WIN E;  4Y5T A;  3K3N A;  3N36 A;  2DVB A;  4PIZ A;  5FYV A;  3U0Z A;  2VAU A;  2ATF A;  2LW8 A;  1JOP A;  2Q1M A;  3J7N A;  4AVA A;  1W6N A;  2ZGQ A;  4YZ2 A;  2Y60 A;  3KGZ A;  4QKN A;  5JR2 A;  1TZO A;  1WCS A;  2CNA A;  3DPR A;  4Q8L A;  3C8X A;  3PUH A;  4FOQ A;  3K46 A;  2YZ4 A;  4XMI A;  5F5A A;  1PIV 3;  1RUI 2;  1HN0 A;  2VQ0 A;  5F2W A;  4N43 B;  3WQB A;  2Y38 A;  4FFH A;  1SLL A;  2ZGU A;  2DDU A;  1W0O A;  4AED C;  3AKS A;  5BNP A;  4PBO A;  2QQM A;  3OY8 B;  3KSC A;  3WW3 A;  3CKH A;  2MPF A;  4LHN A;  2ET1 A;  4Q4W 2;  1QJU 2;  1V00 A;  3VDD C;  3VBU B;  3GAL A;  3ZYR A;  3AKR A;  2A6W A;  1ENQ A;  3M1H A;  4ISR A;  4L11 A;  5FPZ A;  4PHZ A;  1YLL A;  4XQW A;  5EZW A;  2P5B A;  2NN8 A;  3DYM A;  2RS1 1;  3GM8 A;  4RL7 A;  1QJZ A;  3IDA A;  4PI0 A;  3R6S A;  3SNM A;  2X5I B;  2CHH A;  3T1L A;  1MPX A;  1YFW A;  1LHW A;  4YM2 A;  2IFR A;  1AXY A;  5JXI A;  5KHG A;  3RYK A;  1RUJ 2;  3D0J A;  1PNG A;  1SAC A;  3T2O A;  5IVC A;  1J59 A;  5EJZ B;  4P9G A;  3S57 A;  2Z69 A;  5BNN B;  4QXC A;  1ENS A;  1Z78 A;  2A73 B;  1POV 1;  3VD4 A;  1K5M C;  3OUI A;  3AZW A;  5AFE A;  2OUH A;  4EN6 B;  1V6K A;  3KD4 A;  1HJF A;  4AVT A;  4EZH A;  1S0E A;  1HRV 3;  4IND A;  4PIY A;  2Z2S B;  2XGX A;  3GBG A;  1ONA A;  2WII B;  3NV3 A;  2IXC A;  5A6Q A;  3WHU A;  2W1U A;  3DV8 A;  1YQ6 A;  1ZX5 A;  2VM9 A;  4GAL A;  2E31 A;  4RD7 A;  3PDQ A;  5JIA A;  4BQY A;  4GWI A;  4XET A;  3IN9 A;  2DCT A;  5IVE A;  2QDR A;  2A7A A;  3A7Q A;  4QB6 A;  4KG8 A;  5FMC A;  4Y1U A;  3AVS A;  2WNV B;  3BU0 A;  4YW6 A;  1MS4 A;  5FZ1 A;  2JG8 C;  3WW4 A;  1SBF A;  3WQ0 A;  1YJK A;  5FYB A;  3O1U A;  3H1Y A;  1X50 A;  2UWA A;  2WZE A;  4MXW A;  4OFG A;  4XJA A;  2GZW A;  3VBF C;  3AKP A;  3HT2 A;  3ZN4 A;  2XLF A;  3FUO A;  5GKA C;  5KXE A;  1RUC 1;  2C0Z A;  4DPN A;  1MQT A;  2JEC A;  1KQR A;  3E5X A;  5FK8 A;  3M4F A;  2IFW A;  2WJS A;  5EXO A;  1RUJ 3;  1PO1 2;  3M8L A;  3USS A;  4BME A;  4K40 A;  1O5U A;  1DQ2 A;  1C57 A;  2E63 A;  4FXK B;  1FMD 1;  3L2H A;  4JTO A;  5IAT A;  1FYU A;  3NKT A;  4OMD A;  5C8W A;  4S2H A;  3PJQ A;  3B02 A;  4FPY A;  1H2K A;  2CL2 A;  1HQN A;  2WQ8 A;  5HV0 A;  2NLR A;  3ELN A;  1YQC A;  2EA7 A;  3JD7 1;  2JG8 B;  4PCR A;  2C1F A;  1Q8O A;  4LO6 B;  4BIF A;  2YFZ A;  2ZGS A;  4D7T A;  1MQT C;  4QDR A;  4K8R B;  3JUU A;  3ZMN A;  2F4P A;  2V4A A;  3EBR A;  4NHX A;  2RS3 1;  4HN1 A;  2FHR A;  3P6B A;  5FZG A;  2DUO A;  1U12 A;  4PBP A;  5CFD B;  5F3G A;  4XEZ A;  4W50 A;  3T2P A;  4CP2 A;  1K45 A;  1MZE A;  1W2A X;  2JG8 A;  1CAW B;  2R32 A;  3SH4 A;  3WP5 A;  1AL2 1;  4IEX A;  3ES4 A;  3SCF A;  5DZE A;  1OKO A;  3ZPY A;  3ILN A;  5A7W B;  3AM2 A;  3J26 N;  3UK9 A;  1OUS A;  2O8Q A;  2BZD A;  3BU7 A;  1RMU 1;  4Q26 A;  5C4W A;  1RJ8 A;  5C4W C;  4W6X A;  4CP9 B;  1WWY A;  3IIA A;  4NOT A;  4LO5 B;  3WDU A;  1SFN A;  4XVH A;  2YRO A;  5DG2 A;  2DV9 A;  1UF2 C;  1V70 A;  3FUQ A;  2D6O X;  2MEV 3;  3AK0 A;  2G4I A;  1VBA 1;  4PQ9 A;  5BV6 A;  5JLV A;  2J22 A;  1FPN 3;  4QPW A;  2XJQ A;  5C71 A;  5A3L A;  3VBU C;  1W3V A;  4YVS A;  1J58 A;  2E51 A;  3FN9 A;  5T5L A;  3J7L A;  5F8P A;  2VXR A;  4EE2 A;  2A6V A;  4P9W A;  1UX7 A;  5FKC A;  2DWR A;  5C33 A;  2D5H A;  3VDB A;  2MEV 1;  2GAL A;  5FY8 A;  5I8T A;  1VBC 1;  5HCH A;  3W59 A;  4RS5 C;  3AC0 A;  2R1B A;  2CGP A;  2Q8D A;  5FR3 A;  2J1R A;  5G04 L;  1REE A;  2DF7 A;  1DU3 D;  4YGD A;  5GLT A;  1QDC A;  1WA4 A;  3T4H B;  1RUD 2;  2PMW B;  3O0W A;  5FUN A;  2DU0 A;  2QTW B;  2OII A;  1RGS A;  1VAL A;  1VJ2 A;  1K5M B;  1ULG A;  2Y6H A;  3T0D A;  4RR3 B;  2W5F A;  4V2W A;  5FZO A;  3WDT A;  3AKT A;  3CJX A;  1OOP B;  3AB0 A;  3GHN A;  1JZ2 A;  3GJB A;  4UFI A;  1HIX A;  1SG3 A;  1LOB A;  1W06 A;  1GNZ A;  1DGR N;  1VBB 1;  4IW3 A;  3RZZ A;  4CDW C;  3BCW A;  2QQL A;  5T3N A;  3S7E A;  4W6Y A;  2JDH A;  4JC1 A;  4NE9 A;  4N7U A;  4NR1 A;  5L73 A;  4NIA A;  4BE3 A;  5C9A A;  3LIH A;  1RB8 G;  2MNG A;  1ZRE A;  5F39 A;  4AAP A;  4NIH A;  5HCF A;  5A1A A;  1F4H A;  3FHA A;  5H9S A;  3JQW A;  3LQC A;  5CIS A;  5E88 A;  3WHT A;  5FV3 A;  4W65 A;  2B39 A;  3H8X A;  1H0B A;  3GNE A;  4BK4 A;  2F4L A;  2XKO A;  5J09 A;  3A21 A;  3SMH A;  2F17 A;  4Z8B A;  5A7W A;  1WLC A;  4MH0 E;  4XHX A;  4MVT A;  1ZRC A;  2P6H A;  4LBQ D;  3OBR A;  3WQ7 A;  5FMB A;  5F3E A;  1GZ9 A;  2FCV A;  1AR6 1;  1JBC A;  1EYB A;  1UIK A;  2HYX A;  3JQX A;  3OGG A;  3SH5 A;  3O1R A;  1GZW B;  2PHX A;  1O3S A;  1MS3 A;  3JZV A;  4RFR B;  2X29 A;  3C7H A;  4LE4 A;  4KWL A;  1BK0 A;  3K2O A;  2W91 A;  3GDB A;  3POJ A;  4HZF A;  2G19 A;  5FZ8 A;  3RSJ A;  4RHV 3;  3SHR A;  5JMC A;  1AX2 A;  1NA1 C;  1W6N B;  1ZYB A;  2BGP A;  2HH9 A;  3GYD A;  5E6H A;  3CHX A;  2W52 A;  4Q4X 1;  1CQ9 A;  3UES A;  4CP0 A;  5FDB A;  2ARB A;  3DYO A;  4M01 A;  5CVR A;  2BQP A;  2AC1 A;  4XTP A;  3INA A;  3WOG A;  3NJV A;  2PN5 A;  1XSR A;  4YVW B;  1B35 A;  2J1A A;  2WLP A;  4CUG A;  2QQP A;  4BQ3 A;  1LEN A;  3EJK A;  2DUQ A;  5L7O B;  2FD8 A;  4LR4 A;  2V72 A;  3BUC A;  1AUY A;  1O8S A;  2H6B A;  4IEY A;  4XZU G;  5E8A A;  4IGP A;  2R06 3;  1X82 A;  4BQ5 A;  3BKZ A;  5DDJ 3;  2WO1 A;  2PHT A;  3R4U A;  3H9A A;  2BOJ A;  3VB9 A;  4Z92 B;  1NQD A;  2CSG A;  3MUZ 1;  5FZE A;  1X8M A;  1CJP A;  1QXP A;  1RED A;  4YVW C;  5EFU A;  4DQA A;  4UWD A;  1W9F A;  1IS4 A;  3SIS A;  1RIR A;  1JS9 A;  4CXY A;  4MGZ E;  4IE0 A;  1V9U 3;  1NCQ B;  2DUP A;  3HAG A;  4DB5 A;  3I2H A;  1D0G A;  1FOD 2;  3P1I A;  1VMF A;  3NL1 A;  5FZL A;  4AFA A;  3ITQ A;  5A1L A;  2LRP A;  3OPT A;  3W58 A;  5A32 A;  1JOD A;  5FP8 A;  3I2J A;  2TUN A;  3OYW B;  1UY4 A;  4GB3 2;  3LA3 A;  4H7M A;  1U5X A;  4JKK A;  3NO8 A;  4LOS A;  2WFP A;  4EWD A;  3U37 A;  2JEN A;  1CWP A;  5KWR A;  3DGT A;  3N9L A;  5DXD A;  4AQ6 A;  4YYO A;  1K42 A;  3MIB A;  3BTY A;  3NW4 A;  4MOA A;  4LBM A;  3S0M A;  3CL1 A;  2VR4 A;  2ZEW A;  1GNH A;  1Z0H A;  3BB6 A;  5H9P A;  5IK7 A;  1GYK A;  1OUR A;  1C5I A;  3B93 A;  2J42 A;  2WSV A;  4RS5 B;  1NLQ A;  3I49 A;  4JHT A;  1W39 A;  3PUI A;  4AFM A;  4CCK A;  2ARC A;  5FY4 A;  2VD7 A;  3AJZ A;  4MGT A;  3HOB A;  3TAY A;  3ZLI A;  2OZ6 A;  5F5Q A;  5FRA A;  3H3L A;  3PTR B;  3E5U A;  3F95 A;  1US3 A;  4FBF A;  1MZF A;  4JGY C;  5JPM B;  2DUR A;  1ZZ6 A;  1ULO A;  1G9D A;  3FLR A;  5FXX A;  4WVZ A;  1GZT A;  3O1O A;  3THP A;  2TEP A;  5C3O A;  4UOJ A;  2WRA A;  1QJE A;  2Y6L A;  4WVV A;  3LEI A;  1UQX A;  5H9Q A;  4XMA A;  2EAL A;  5AVP A;  1Y3T A;  3NWK A;  1NCR C;  1FOD 3;  4XF1 A;  5JUV A;  2BRT A;  3OPW A;  2W1S A;  2ZGM A;  3C7F A;  4K6B A;  2AEZ A;  3JD7 2;  4IES A;  3RVH A;  3DYP A;  3O12 A;  1A6C A;  3V56 A;  3MEP A;  4HPK A;  5GZF A;  1TG7 A;  1POV 3;  1PVX A;  1W8U A;  2NQY A;  3RGB A;  1U5I A;  4KG0 A;  4LHS A;  1XNB A;  2XB6 C;  2AAC A;  2OXB A;  3WG3 A;  4IXL A;  1QKQ A;  2RS3 2;  3ME2 A;  5J48 A;  5F7U A;  5J3U A;  2VOK A;  3UKT A;  3M7A A;  4BLI A;  4CU8 A;  1UPS A;  4ITC A;  1K5J A;  5L7O A;  2W95 A;  4OQ8 A;  3MIF A;  3MDP A;  2WN3 A;  3CJI C;  4GWJ A;  3MID A;  1F31 A;  2IXJ A;  2KR2 A;  2E53 A;  2QQU A;  2RS1 3;  3KF3 A;  4DXZ A;  5IJR A;  4GQ7 A;  1LAJ A;  2WAO A;  3ZXD A;  3IAQ A;  1Y9M A;  2R1D A;  3KB5 A;  2ZHK A;  4GJY A;  5FZ6 A;  1SEF A;  4RGG A;  1UYZ A;  3U11 A;  1OPO A;  3MGU A;  4Q4W 1;  4TXW A;  5GLW A;  4DRV A;  1SQ4 A;  1Q5O A;  5JSO A;  3WNO A;  5F1R A;  4JQR A;  1ZRF A;  3MFA A;  3MUY 1;  2XJU A;  3TNP B;  2VW1 A;  4LE3 A;  2P3J A;  4XHB A;  1QEX A;  1AX0 A;  1PO2 2;  1UZY A;  3MV1 1;  1IG3 A;  2YV8 A;  1C4R A;  4LIT A;  5DAP A;  4A41 A;  5C3Q A;  3GBF A;  1CES A;  5C8C A;  4HOO A;  3OBA A;  3M3I A;  4AR2 A;  1YQ2 A;  2PA7 A;  2W0X A;  2JB4 A;  1NE4 A;  1JW6 A;  5DAQ A;  1OXC A;  2GND A;  2B9U A;  3HPN A;  4LBO A;  2Y34 A;  1QDO A;  2GC2 A;  2OKX A;  1SBE A;  2VPV A;  3VBH B;  2PHD A;  5ABJ A;  5FZ9 A;  4RA0 A;  5KHI A;  1UMI A;  2GMM A;  5A1F A;  3VBF A;  1LHU A;  1D4M 1;  2D6M A;  3VL9 A;  3WZ1 A;  3NQH A;  1W6P B;  1EPW A;  4KU7 A;  4D7S A;  2Y0I A;  4GWM A;  4L97 A;  3W21 A;  4A3Z A;  4ISQ A;  4QDQ A;  4B1M A;  4QU1 A;  5DAV A;  3TBD A;  4LBJ A;  1HX6 A;  5C8C B;  4FPC A;  3ZFE B;  2D44 A;  3AZV A;  3WNP A;  4BA6 A;  2KXL A;  1R1A 1;  2XG3 A;  2DCZ A;  3GCX A;  4AWD A;  2D43 A;  2D6N A;  3I2I A;  3ZYF A;  4XAA A;  2J1E A;  3H3Z A;  3POG A;  4YG3 A;  1H8V A;  2Q0A A;  1QU0 A;  4YZ4 A;  3WXP A;  4XXA A;  3L9J T;  5JIU A;  1PGL 2;  2WA4 A;  2W1Q A;  5KHK A;  2D98 A;  5A7Q A;  5C70 A;  3SXW A;  1O3R A;  4F7Z A;  5K9Y A;  1VAM A;  2N7G A;  2V5Y A;  3EQE A;  4C91 A;  4XF9 A;  1GV9 A;  3JXS A;  3NNJ A;  3LEM A;  4J25 A;  4N9I A;  3APB A;  1AYM 2;  3SKV A;  4DUX A;  4DEQ A;  3ZFE A;  2Q30 A;  3MV0 1;  4BCU A;  3B69 A;  1TNR A;  5D8A A;  1LHN A;  4IGQ A;  1DGW A;  2VBP A;  2VQT A;  1GQH A;  2JDM A;  4FI9 A;  3VLB B;  4UI9 L;  1DGW X;  1R1A 2;  4N8M A;  4PLN A;  2DVF A;  1RJ7 A;  5LWB A;  5A7P A;  5F2S A;  2JG9 C; 
#chains in the Genus database with same CATH homology
 2VCB A;  1JU4 A;  1UXX X;  3ACH A;  2HLE A;  3LEK A;  3OGS A;  3NNG A;  4CU6 A;  4XUR A;  2QQJ A;  4XUT A;  3ACG A;  2W94 A;  1SHW B;  5DQ0 A;  2C26 A;  3WNM A;  3HNM A;  4E8C A;  3NJX A;  2J1S A;  3ZM8 A;  1GOG A;  1IQD C;  3OEA A;  2WBK A;  1BHG A;  4MGQ A;  3VD5 A;  5JXJ A;  4KMQ A;  1O8P A;  3NRU A;  1XNT A;  3T2Q A;  2RVA A;  4OZO A;  3ETP A;  1JZ7 A;  1UY3 A;  5B4X A;  1SDD B;  3WEZ A;  1NAE A;  4OMC A;  2B4K A;  3BGA A;  3W5N A;  2J1U A;  2Y8K A;  1JHJ A;  1W99 A;  2WYS A;  2LW8 A;  2XOM A;  1H6X A;  5IFP A;  5JR2 A;  2J7M A;  1UY2 A;  3C8X A;  3PUH A;  3K4D A;  1J83 A;  3K46 A;  4M4P A;  3WQB A;  2EID A;  3UNP A;  2DDU A;  2VMF A;  1JYW A;  5LA1 A;  2QQM A;  3CKH A;  3HEI A;  1W8N A;  3ABZ A;  4DEV A;  2Y6J A;  3I2G A;  1R64 A;  3C7E A;  3DYM A;  3GM8 A;  4CUC A;  2E33 A;  3IDA A;  3UET A;  5IYY A;  2DCK A;  5IHR A;  4CUA A;  1PMH X;  1XC6 A;  1MPX A;  2WDB A;  3VD9 A;  1JZ4 A;  5JXI A;  3T2O A;  5EJZ B;  3A22 A;  3DEC A;  4XUN A;  3FHQ A;  5I0D A;  2EIB A;  3IAP A;  4QX0 A;  3VD4 A;  1OF4 A;  2W3J A;  4TTG A;  3MO4 A;  1JYV A;  3CDZ B;  3HNY M;  4JX0 A;  1UYX A;  3C7O A;  2W1U A;  1UYY A;  2VM9 A;  1RYY A;  2E31 A;  2VZQ A;  4GWI A;  4QX2 A;  4MO3 M;  4XUQ A;  4DXT A;  2JD9 A;  3A7Q A;  4QB6 A;  3VDA A;  4JKM A;  3CIH A;  2JDA A;  2VZP A;  3I3D A;  3WNN A;  3HJR A;  4UAP A;  1DP0 A;  1JZ6 A;  2VZO A;  2WZE A;  4D0Q A;  4JKL A;  2ZEX A;  3CZJ A;  2J1T A;  5DN2 A;  4BJ0 A;  2EIC A;  2C4X A;  1GOH A;  1JYX A;  2RJ2 A;  5JXH A;  3III A;  4OMD A;  3WF1 A;  4CU9 A;  3HNB M;  2B9V A;  2WQ8 A;  3D3A A;  2YC4 A;  4QDS A;  2WN2 A;  2DCJ A;  2YFZ A;  2W1W A;  2WAA A;  2VME A;  4QDR A;  1DYO A;  2BBA A;  4E8D A;  3K75 B;  3T0A A;  3P6B A;  4RN5 A;  3OB8 A;  1NUK A;  4W50 A;  3T2P A;  1K45 A;  2XQX A;  1WKY A;  3ECQ A;  1XPW A;  1UWW A;  2LS6 A;  2VCC A;  4A45 A;  2BZD A;  3THC A;  1PX4 A;  4MAD A;  1OT5 A;  4XVH A;  4L0P A;  1H6Y A;  4AG4 A;  3WNK A;  5LCW L;  1GQP A;  2ID4 A;  3EYP A;  2QQN A;  2J22 A;  1I5P A;  3ACI A;  4QPW A;  4CUB A;  5C71 A;  4KWU A;  3LPG A;  3FN9 A;  4A6O A;  4D8M A;  1CZT A;  1GMM A;  3OGV A;  1UX7 A;  5FUI A;  4JHZ A;  2WO3 A;  3VDB A;  1UXZ A;  2WZ8 A;  3CZU A;  3OEB A;  3AC0 A;  2J1R A;  3T08 A;  5G04 L;  1W8O A;  2WO2 A;  4PT6 A;  3I97 A;  1DLC A;  1NKG A;  1UZ0 A;  4ZZ8 A;  1J84 A;  3T0D A;  2Y6H A;  1CZV A;  2W5F A;  2VO5 A;  3T0B A;  4RYD A;  1JZ2 A;  1SG3 A;  4ARX A;  2QQI A;  3HN3 A;  1W9S A;  2X09 A;  1P8J A;  2QQL A;  5DMY A;  4LPL A;  5HXM A;  1OH4 A;  2W47 A;  2Y6G A;  2XON A;  5A1A A;  4Z2A A;  1F4H A;  3FHA A;  3LQC A;  4LQR A;  2V4V A;  2VMD A;  4PF1 A;  5EJ1 B;  2J1V A;  5IFT A;  4BK4 A;  4P08 A;  2E32 A;  3SEE A;  5LA0 A;  3A21 A;  4BK5 A;  4GZ9 A;  1W0N A;  3K4Z A;  3LE0 A;  2HYX A;  2ORX A;  3GXU A;  1KEX A;  2E26 A;  3C7H A;  2W91 A;  3GDB A;  4BDV B;  5JMO A;  3E1F 1;  2BGP A;  3WF3 A;  1EUT A;  3UES A;  1F4A A;  4QB2 A;  4ET7 A;  3DYO A;  1JZ5 A;  4OUE A;  4A4A A;  3NJV A;  5J1X A;  3IB3 A;  1GU3 A;  5DPN A;  4OYU A;  1NX9 A;  2ZXQ A;  1JZ3 A;  3CQO A;  5CZK A;  3SKJ E;  2V5D A;  2J1A A;  1K12 A;  3K4A A;  4CVU A;  5G05 L;  1GOF A;  2BGO A;  2V72 A;  1O8S A;  2VJX A;  4XZU G;  1JZ8 A;  2VZS A;  2WO1 A;  1EUU A;  2VZ3 A;  3MUZ 1;  1ULP A;  4M4R A;  4IUG A;  4W8J A;  2KD7 A;  2RV9 A;  5LA2 A;  4DXS A;  1W9T A;  4PQQ A;  3ACF A;  5JXG A;  3I2H A;  2YFU A;  3P1I A;  4AAX A;  2QBX A;  2VZT A;  4YPJ A;  3I2J A;  1UY4 A;  4JKK A;  1JI6 A;  2JE8 A;  1OF3 A;  3U37 A;  1L7Q A;  3LEG A;  1K42 A;  4MOA A;  1O59 A;  2XHN A;  2C9K A;  2VR4 A;  2ZEW A;  3I3B A;  3VDC A;  2ORZ A;  3OGR A;  2WAB A;  3PUI A;  2L9L A;  4P00 B;  3HOB A;  4P5Y A;  3VD7 A;  2Y64 A;  1US3 A;  1ULO A;  1D7P M;  2VOT A;  3THD A;  3VD3 A;  3F2Z A;  5HPO A;  4KI5 M;  4UOJ A;  1US2 A;  2Y6L A;  3BN6 A;  1PX3 A;  3LEI A;  4DUW A;  2CDP A;  3SEP A;  4ARY A;  5JUV A;  2W1S A;  3C7F A;  3I3E A;  3DYP A;  4QB1 A;  3I2K A;  3C7G A;  1HN1 A;  1TG7 A;  2YG0 A;  2JKX A;  4ZXE A;  2QQO A;  2VZV A;  2VZ1 A;  4LHS A;  2YB7 A;  1UY0 A;  4DUV A;  5F7U A;  1WCQ A;  2Y6K A;  2VMC A;  2ZEZ A;  1UMH A;  4CU8 A;  2W95 A;  2WN3 A;  4W4Z A;  4GWJ A;  1UY1 A;  1W9W A;  5IJR A;  4A42 A;  1K3I A;  4MGS A;  2WAO A;  4CU7 A;  3IAQ A;  4DXR A;  1UYZ A;  4TXW A;  2VC9 A;  1GNY A;  3WNO A;  3FL7 A;  4QX3 A;  4A44 A;  3EB7 A;  3MUY 1;  4ZY9 A;  3W5M A;  2W92 A;  2R7E B;  2VL4 A;  3WF0 A;  3MV1 1;  1XNA A;  4A41 A;  2VZU A;  2W9X A;  3OBA A;  5C7G A;  1YQ2 A;  3CMG A;  1GUI A;  2X10 A;  4LKS A;  3HPN A;  4P02 B;  2X05 A;  3K77 A;  4XUO A;  1LNS A;  4BXS V;  2W87 A;  2OKX A;  1CX1 A;  3T09 A;  1JYN A;  3OG2 A;  2VCA A;  1UMI A;  1JU3 A;  3LPF A;  1PMJ X;  3WNL A;  5EIY B;  1CZS A;  3NQH A;  4ZZ5 A;  2PQS A;  1L7R A;  4A3Z A;  4QDQ A;  1OD3 A;  4QX1 A;  3I2F A;  3MBW A;  1TVG A;  3A23 A;  4QAW A;  3WNP A;  3WSO A;  2QQK A;  2W46 A;  3I2I A;  2J1E A;  2W1Q A;  2VQU A;  2YC2 A;  5C70 A;  3WF2 A;  2CDO A;  1KGY A;  2VTF A;  3J7H A;  2VZR A;  1CIY A;  2WUH A;  5CYY A;  3JXS A;  2BER A;  4XUP A;  4DUX A;  3SKV A;  2ZEY A;  4DEQ A;  3MV0 1;  3WF4 A;  5B4N A;  1T2X A;  2VQT A;  4FI9 A;  2Z4F A;  4UI9 L;  4HG6 B;  2EIE A;  3GGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...