4MGRA

The crystal structure of bacillus subtilis gabr, an autorepressor and plp- and gaba-dependent transcriptional activator of gabt
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
468
structure length
468
Chain Sequence
DITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHIDQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSKSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKENKRQTGRPALIIGFARLKEEDIQEGVQRLFKAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Bacillus subtilis GabR, an autorepressor and transcriptional activator of gabT.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulatory protein GabR
total genus 135
structure length 468
sequence length 468
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4mgrA01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4mgrA02
1XGNA 2W7FA 3M8EA 2F5CA 4F5KA 4LW4A 1KQ9A 2VE9A 2V6CA 3K7YA 1R5HA 2O0RA 4AZKA 4ITGA 3QPTA 2CY8A 2QQ9A 4P96A 1ZN2A 4JE5A 3DPLC 4IVNA 4RITA 3FXQA 3F21A 3B8XA 1MGTA 4EM0B 3BC8A 1BQDA 2ZC0A 2DGMA 1S29A 4Q48A 5HS7A 3WU0A 5CVIA 3FFHA 3E6DA 3LVJA 1AY8A 4G7ZF 4PDKA 2DK8A 3WZFA 2UXNA 1XGMA 1LW5A 3W1JA 5K5RA 4LLNA 2HOXA 4ZYGA 5K5OA 4WLHA 1O69A 4F7ZA 1QJ3A 3KGXA 3G8MA 2QVOA 2CJGA 5DUKA 1IAXA 1GHCA 5FD6A 4WYDA 3PIUA 4LMYA 2VGUA 5DDGA 1L3LA 3ZN1A 3K1NA 3ZMTA 2V0YA 2L54A 1DTYA 3Q8NA 4XAUA 3NEUA 5ICFA 2HOEA 5ICEA 3QPHA 4Q47A 1IUGA 2ISZA 2ISYA 4F5IA 2VODA 1W3UA 1MDOA 6PAXA 5G09A 1U5TA 2CSOA 1R1TA 3BPXA 4LD5A 1I43A 1ZG3A 5HLGA 5CVVA 1TPLA 2VIBA 2MLKA 2VIAA 3SHFA 1I1GA 4LJZF 1AOYA 2D7ZA 4CDGA 4HX7A 2PLYA 2YRIA 1OHVA 2ZKZA 3E6BA 3U2RA 4E77A 1EH7A 2H94A 4RLGA 3LSTA 1KMJA 4RGUA 1S7AA 4BMKA 1G7WA 1N31A 3R6SA 3E2ZA 3RUYA 3FMSA 3FWEA 3GZ5A 4ZSWA 4CHUA 3RCHB 4M9SA 5K8BA 5E3KA 3MADA 2PB0A 5LRSA 2QUFA 1HQCA 1TQMA 4GRXA 3NU8A 2JJHA 2M30A 4IX8A 1UU1A 4XJMA 4EV0A 4ADBA 3TGNA 2FNAA 1UHWA 4ZWVA 2LKPA 2P5LC 1S09A 4ZYEA 3I59B 4RB3C 4GE7A 2DQLA 3JAMK 1D2FA 4M6XA 4TMRA 4KMUX 4OU0A 1FWZA 2BHXA 2IA2A 1FSEA 4A6DA 4FT8A 3RYRA 4F5FA 5ICCA 5ILVA 1REPC 5EQCA 1RV3A 2AEUA 3HT4A 2BGCA 4RJYA 2QBYA 2L3DA 2TPLA 4EJTA 3J80Z 1DPUA 2LDUA 2R5CA 2J5PA 1SFEA 3Q9VA 2QBTA 2BBYA 1WI9A 4WWCA 1RUOA 4ETSA 1JE8A 5FGMA 3WCNA 4W1WA 4F5HA 4ENMA 2V1XA 3FMRA 4LG0B 3RKWA 1SFFA 4G8XA 1QBJA 4ZH4F 3NTJA 2D45A 3IHJA 1MGVA 4N0WA 5KVRA 1ARIA 5D5UB 1QPMA 4UQVA 4WXHA 5ED4A 2V9VA 1WYUA 2DPDA 1RZ4A 2XAQA 4P7YA 2VLFA 1IVRA 3F6OA 3RI6A 1ZARA 3PD6B 2AS5F 2QB2A 1BIAA 1T6SA 2Q0OA 1K7AA 2W7GA 1UU2A 2VMUA 4Y0DA 3HLMA 1ON1A 3HSFA 3KP7A 3AENA 1GXQA 4HQMA 5EUEA 5G2QA 2A61A 4K2MA 3ECHA 2VMNA 4XBFA 5ILUA 3CUQC 3P9CA 3L8AA 3GXOA 1J04A 1DFOA 1ON2A 1GEWA 1KL2A 5H6QA 3VOMA 3FRKA 2BKWA 3IHUA 2E7WA 1SD6A 3T8TA 3HHHA 4Q31A 4H0EA 2P7VB 2QYOA 2R2NA 4RAEA 4ZYHA 1K79A 1O4SA 2FBHA 2W57A 5H6RA 5IT9K 4HVKA 2PO3A 4HOBA 1BBYA 3RYPA 3BROA 3QOPA 4KYWA 3DRDA 1USSA 1GC0A 3VODA 4U0YA 1Z05A 3COAC 4RGXA 4KICA 3V4GA 4GCVA 4HBLA 4ZZLA 2QA3A 1ARGA 5LEJA 2ETHA 3NQOA 1W7LA 1H9GA 4OINF 1B6AA 4CBRA 2FQ3A 2FBIA 3AEJC 2D7YA 2Y48A 3ABTA 1B5OA 3EUCA 1BJAA 2HDCA 2HS5A 4YFNF 4OCAA 3C1DA 1XDSA 2CJHA 3K40A 1B9HA 1Y0UA 5FB2A 1P2FA 1NHAA 2DO7A 2JISA 1WWXA 3LA7A 4QLCU 3VAXA 1TNSA 2B0LA 2DOUA 4EJUA 5EFSA 2ZP7A 1XCBA 4HF8A 2ZCWA 4L18B 2XROA 2DQRA 5HDKA 1E2XA 3DF8A 1EG5A 2ZNZA 1MDMA 3FQAA 2AXLA 2KRFA 5G4JA 1TLHB 3II0A 4EJWA 4LNMA 3GWZA 2XASA 3KP6A 3E2FA 5AONA 1YW8A 4WP0A 2K02A 5LH9A 4TV7A 4Z2YA 5M4BA 4N9IA 2CQKA 3LA2A 1VTNC 2JPCA 2E54A 1C7OA 2JZYA 2PB2A 1G4VA 4WX9A 2Z3YA 1P4WA 9AATA 1OR7A 1U78A 1SD4A 3ML6A 3H14A 2BV6A 2E1NA 2VN2A 4GSAA 1YO5C 1XMKA 2IPQX 2L4AA 3FTBA 2GIVA 2VT2A 3GLXA 3ZMVA 1C7GA 4OBVA 2CH1A 1FZPB 2XKPA 1KKPA 1PMOA 1SD5A 3KCCA 4CO8A 2OQGA 4M9ZA 3L7WA 4IY7A 1H0MA 4I02A 4S05A 1EH8A 3GJUA 2D65A 2NAZA 4WYAA 3B1CA 4L9NA 1FSHA 1ZAOA 1ASNA 5E18F 3DEUA 3FQ7A 4UV8A 1AMSA 3R60A 1IN8A 1D7UA 1S3JA 1SAXA 5G4IA 4RB1A 2KKOA 3GZCA 4UXNA 1AHYA 1I5ZA 3CQ5A 1XN7A 3TO6A 1M7YA 1XSXA 3JTGA 3GUDA 3MZYA 1Z6RA 3ZP5A 1AMQA 5LEKA 2V79A 2O3FA 3SZTA 4S04A 3ZQ7A 2D1VA 3TDUC 3WTWC 1IXCA 2KIMA 5LHIA 1HW2A 2E7XA 3FM3A 3EZ1A 2EV6A 2XKOA 3KFWX 5F9SA 2VMSA 3EI7A 5AX8A 1LS3A 3BWOA 2Z33A 2G7UA 2X8UA 3UE8A 3QBOA 3WU1B 1X28A 3PDXA 5EUDA 1TASA 1GVJA 5JHUA 1C0NA 3LQRA 4OOIA 2OZ6A 3CO7C 4K2IA 5ERIA 4WXGA 3E6MA 1UB9A 4GO1A 2ZJGA 1BJOB 1WKGA 3USFA 1FBQA 1R23A 5CVJA 3W1IA 2VBZA 2YCTA 3WTVC 5H20A 1RVYA 4ZDLA 3F8MA 4KN4X 2ZMEA 3KE2A 2QQBA 4F5JA 2YSRA 2X5FA 3PPLA 2CGPA 3MBBA 4A5MA 1KYWA 2P4WA 2ZYJA 2GMSA 4P3MA 3D5LA 2ZUKA 2Q8KA 3BS8A 2X3LA 2W7DA 1DDNA 2FU4A 2CWEA 5DD8A 1FP2A 4HF2A 1LC8A 2FMLA 3FCRA 5E17F 2V1DA 1B5PA 4YIFA 5D6EA 3ELKA 1JS6A 2GQNA 4W1XA 1ZOBA 2BI9A 2PFBA 1MLYA 1O3TA 5DCMB 1M6SA 2H6CA 4ZYDA 2Y75A 3HOSA 1LC7A 1I27A 3M1EA 4PFFA 3CQ4A 4ZDOA 2XVCA 3MFKA 5LBQA 2XAJA 5LGNA 4ZZDA 2F5FA 3JAMZ 2MD5A 3I58A 4DQ6A 2R7DA 1PUEE 5EAVA 4OBUA 2CG4A 1MJAA 2FMYA 3PJ0A 3V7RA 3D6KA 4I2OA 2E7UA 3DQVC 4NQWA 3B73A 2G9WA 4NOGA 2HEOA 3IF2A 2HYGD 2Z5UA 2AY1A 2W8TA 4OMAA 2FF4A 4MTDA 1KKJA 1R5GA 2BIEA 1O7LA 2FXAA 5L3FA 2BYLA 1EQBA 5A2QK 2M1BA 2YKVA 4I7HA 2Z9VA 2EV0A 4OTLA 1OPCA 2OAZA 2DW4A 2W7EA 1TBXA 1SFXA 5EEGA 1FC3A 3DKWA 3LV2A 4IYOB 1AKAA 3CQ6A 4JEWA 3HRSA 2V1PA 3FD0A 3FZ7A 1MKMA 4AWXB 1R58A 1ASFA 4UHMA 2K86A 4ATPA 1ZGAA 1W5TA 1O61A 4LLGF 3KP3A 4HV5A 1D8JA 2VYCA 4KYOA 1RV4A 2FRHA 5HHYA 1LKCA 1QJ5A 1KU2A 4L9JA 3ACZA 3TOAA 4HX4A 1KQ8A 3W1HA 5FFXA 2K7LA 1ZC9A 4ADDA 5BMZA 2DBBA 3B46A 4WXDA 5D5WB 1W7PD 2IW5A 4PIWA 2RNJA 1SMYF 4DNCA 1J0RA 2DFIA 3K9TA 1KA8A 2XH1A 1Z7DA 3DODA 2CJDA 4UVBA 1Z6TA 2HQRA 3AEJA 1DGEA 2JJGA 3KEOA 1Z7UA 4MEXF 2O6GE 3BY6A 2YKYA 4QWQA 4O3MA 2AY8A 4MY5A 1XEYA 2W84A 1OXOA 5K1YA 4ADCA 1JG8A 7AATA 3N75A 1X29A 3NRAA 3CJNA 3O2PE 3V7CA 3ATHA 5L3DA 3I53A 1OYWA 5EUNA 1YIOA 4ISYA 1D7SA 1J75A 1MJBA 1BJWA 5FLXZ 2HYFA 2STWA 4WYCA 2YHKA 1O3QA 2JGTA 1D8KA 2K4BA 2VI8A 2Z1ZA 4WD2A 1S07A 2ORDA 3E9KA 2Z9XA 1UFMA 2A68F 2M8EA 3ZRPA 3I54A 2Z99A 5IT3A 4OC9A 3L09A 3MAJA 3HDOA 1ZG5A 2NNNA 3ERED 3L00A 4OMYA 1BQAA 1V2EA 1OMIA 2IVMA 3B1EA 4FL0A 4IW7A 3DR7A 2ZJ2A 1J9IA 1MDXA 4KFCA 5I92A 4IHSA 5AIQA 3TKYA 5LRRA 5LHHA 3BB8A 1OATA 1W7PA 2A07F 1ECXA 3P6KA 1QO0D 4R79A 4EGYA 4HA8A 4E3QA 2C81A 3TFTA 3JWBA 5J8FA 2XIGA 2XAHA 4G9YA 5ICGA 2AY7A 3AEPA 1C0WA 1ARSA 1U2WA 4XSZF 3MQ0A 2V1UA 3WE2A 3R4KA 4CXFA 1BS0A 4B9BA 2IT0A 5HXXA 5HS9A 4AIKA 2RDPA 2EZ2A 2Z20A 4XQ2A 3I0TA 5LLQA 1FT9A 2MBFA 5DCFA 3GW2A 4LK0F 1F9NA 4UVAA 4A6UA 2F5EA 4L0OA 3G3ZA 4XLPF 5AIPA 1KGSA 1OYYA 1ELUA 2FNIA 3GZDC 3T5XA 4CZZA 3IRRA 2L01A 3RKYA 2W85A 3TO7A 5HDNA 2WTEA 2FM1A 5CJ9A 2QB3A 2R7FA 4I0AA 3QHXA 4A0RA 5HDMA 2MH9A 2GZWA 3GF2A 5FT6A 2WKAA 1T0FA 2EWNA 1TW2A 3ZMUA 3K69A 3NYUA 3HRTA 4XLNF 3WGCA 1HW1A 4EGZA 3E2ZB 1J5YA 3PQJA 5HDGA 3FZ8A 1ZG1A 3KZYA 4KIGA 4BXUA 2VOOA 3TQNA 1ASDA 3BCAA 4MQQA 4EJOA 4WXFA 5L3EA 1M4NA 5KK1A 1I6XA 5D4SA 4Q4ZF 3TATA 1FBUA 1E5FA 2J5OA 2WK9A 4GEBA 1SPAA 4ZSYA 1GD9A 2VBYA 4Q6RA 3MWMA 4OMZA 3WTTC 4XK1A 4ESJA 3OOPA 2ACJA 4GE4A 2OQRA 3H7FA 5FO5A 2YPRA 3BDDA 2E1CA 4A0ZA 3BJAA 3AEOA 5L3GA 1MAQA 1FYMA 1DP7P 1R00A 2PI0A 5F64A 5D8KB 3EDPA 4CXRA 2UWMA 4J5UA 2X4HA 5M49A 1VEFA 3P7NA 3RJPA 1LEAA 2CYYA 1BOAA 2MLGA 1YJYA 2R5CB 2XHKA 3GFIA 4LB5A 2FEZA 3ASAA 3MC6A 1R36A 4XSXF 3EETA 2OU2A 1GXPA 4Y15A 1M0QA 3LA3A 1ASBA 2O7CA 2O8XA 4HQEA 1B59A 1W7MA 4ZM4A 1RI7A 4M74A 4MQRA 2FOKA 3E5UA 2IJLA 2HQNA 2QM3A 4MGRA 4RAZA 1G4XA 3AENB 3A2BA 1YIYA 1XB4A 1X3UA 1JHFA 1S8NA 3I59A 2JJEA 4KA4A 3KGWA 3QM2A 4O6JA 4R5ZA 2JG2A 4N0BA 1Z91A 1IX7A 1E5EA 2K4JA 3JSPA 4P9FA 5D95A 2F2EA 2HR3A 2CFXA 4JBAA 1BIBA 5F8VA 1OYIA 2H27A 4BA4A 3I5UA 1U6GA 1TOIA 4EMYA 4IF4A 5E1ZB 3V8JA 2VE8A 2X0LA 2C0RA 4BQ0A 5ILSA 2HKXA 2DGLA 5LGUA 1YS7A 1CQ6A 4F5MA 4F5GA 1M0PA 3N4MA 2R5EA 4JK1X 3PQKA 4BHCA 2AEVA 1GEYA 3QPGA 3GFJA 4ZAHA 4RGSA 3AEMC 4HX8A 1IBJA 3MKJA 3DPTA 2RC4A 4GYGA 3GVAA 4E1OA 2W7HA 2IA0A 4E70A 2YRRA 2VMWA 4FHTA 4HF1A 2D66A 1AY4A 5BS6A 4RB2C 1MDZA 1XD7A 3GFMA 5LHGA 3FVXA 3QGUA 4O6ZA 1S6LA 2BWPA 2W7LA 2STTA 4BQAA 2R0TA 1LW4A 2VMVA 4AZJA 3WX9A 2EK5A 1UKJA 1MAPA 3DYDA 4KT5C 3NU7A 4U7BA 2MC3A 2ELHA 3O3KA 2CANA 2JPBA 2JT1A 1XSVA 4M2KA 3RIRA 4WYFA 4EB5A 4D0PA 1Z1DA 4HZFA 1U5TC 4LGWA 1IF1A 2PJPA 3DXVA 3FKDA 2VC0A 3ZMSA 3WE3A 1OHYA 1S08A 4G7HF 1J2XA 1M0NA 3WKSA 2D63A 3VEPA 4KN7X 1HSTA 2FQ6A 3HHGA 1FPQA 2RKHA 4ASNA 3GFLA 2OKKA 4HAMA 2Y0MA 1AWCA 4I01A 4P9UA 1B8GA 1BJNA 3AEMA 4WB0A 4DGTA 4AO9A 1X0MA 4A6RA 2L02A 1P6RA 3NDNA 1YFHA 1G7XA 2VXZA 1C9CA 1WYTB 1KYZA 3JW4A 5FFZA 5JVTA 1LC5A 1R22A 5IWQA 1ORDA 2HKOA 1YOOA 1QQIA 3WLXA 4AVPA 4Y0HA 2W8VA 5CVRA 4BHDA 5CYVA 2BIGA 1TOJA 2K27A 2P7CB 3CO6C 4QGRA 5JAYA 3FMQA 1G4DA 1O57A 4UOYA 5M4DA 5DUIA 1EJIA 4JEZA 3CDHA 3GZ6A 5LHAA 1ZYRF 2DPUA 1GCKA 4I98B 2VGSA 1AHXA 4A0FA 3FDBA 2OQXA 2W7IA 4H51A 1Y4IA 3JWAA 3MEBA 3R9AA 4HLXA 2ZNYA 4LC3A 1AX4A 2BYVE 3BJOA 2C6YA 3LVLB 1RVUA 1BKGA 2FNUA 3BOQA 1HKQA 3DZZA 1RNLA 3NNKA 1SMTA 2VMRA 4FFCA 3G0TA 3QU3A 2PN6A 1S0AA 1IX8A 4RKCA 4F5LA 1WYUB 1GC2A 3E5QA 3VK4A 1TOGA 5DD4A 3L9FA 2GB3A 4A2UA 3BCXA 3VFZA 1HSJA 3FX3A 3EI9A 3G73A 3BV0A 4KDPA 1JXSA 1W4MA 3BWNC 1AJRA 2IA1A 3KLOA 1QISA 5LGTA 2O1BA 2EO5A 2P6TA 1T38A 4I0BA 2NMPA 4LFUA 2AY9A 1P3WA 1BJOA 4Q76A 1YS6A 1R7JA 4BH9A 3HQTA 4IXSA 2HTJA 4UHNA 3NX3A 2FA5A 5BPDA 5DYMA 4JE5D 1T2KA 3QI6A 1AJSA 3AAFA 1IX6A 1JS3A 3UWCA 2YX7A 2XAGA 3JSOA 1GBNA 3E5XA 4U88A 1ZRCA 3J81Z 2GQQA 4IHTA 2EH6A 3D0SA 1ZGJA 4JF0A 4NB5A 3R4TA 4UHTA 2L4MA 3DXWA 3RCHA 3L44A 1FBSA 4MEYF 3H3ZA 2HOYA 4MTEA 1FYLA 1WSUA 3N97A 3R61A 4OIQF 1B1BA 3GSBA 1SZUA 3RQ1A 1WKHA 2W7JA 1W7PB 4OYTA 1BW0A 1DKAA 5EIGB 4A12A 1YAAA 4ATQA 1DPRA 1TQIA 2FSWA 1ULYA 2JJFA 4DBCA 3T8RA 4Y17A 3CUQB 3IC7A 2HZTA 3HYIA 1PFFA 3Q9SA 2DK5A 3BZ6A 2DAOA 3PGYA 2YKUA 2ZBKA 2VMYA 3MAUA 2C44A 5JI6A 1YJZA 4LNLA 1IAWA 3FXRA 1LB2A 3B1DA 5FLXK 1RUNA 1CZCA 3WODF 2VGZA 4W5KA 2VBXA 1B9NA 1G3WA 1CL1A 3AATA 2CB1A 2VMXA 3NYTA 3ISPA 4KIFA 4LG0A 1IN4A 3CAIA 2GWRA 1B9MA 1YW9A 1U08A 1MDMB 2MA3A 3J7AO 1DJ9A 3IWFA 2LF7A 2P6SA 3E97A 3H3UA 1XSDA 1AY5A 4ITXA 4U7DA 2OGAA 3KE3A 2F8JA 1HW5A 1Q1HA 2QLZA 4ZASA 1VP4A 5TJJA 5FT5A 1F4KA 4A6EA 1I1SA 4I09A 1FOKA 1R1UA 4EMSA 3WCOA 4GDYA 3K1PA 3BJ6A 5L3BA 4AIHA 4WLJA 4W1VA 1PG8A 4A0XA 4PGGA 2D2WA 2WV0A 4JEXA 3A9XA 3WTZA 3ULQB 4A72A 3AOVA 3ELPA 1W5SA 2BWOA 2CTZA 4R1HA 2Q2EA 1FG3A 2NNYA 3ASBA 1LJ9A 3EIAA 1LEBA 4MSOA 4L5IA 3ZN0A 2JRTA 3V8LA 1K78B 1FC4A 1QZ9A 2QLRA 1SZSA 3E6GA 2XAFA 4P55A 5DJ1A 1KU9A 2D1HA 5EEHA 3HTSB 2CH2A 3QU6A 4L5JA 3GEZA 1AMRA 3H92A 3F72A 3E6CC 1CS1A 2E7JA 3JU7A 5D8LB 1MD0A 1USTA 4MQPA 3SXYA 3RPQA 1OXPA 3Q5FA 2AY4A 4L0ZB 2YCPA 3FSLA 4HW0A 2CW0F 2VONA 3OP7A 3EI8A 3PFIA 1SZKA 1GEXA 3VK3A 4JEYA 3HSRA 4ZLVA 4AO4A 1U5TB 4BNCA 4WYGA 3W6JB 1H9TA 2QBYB 4R8DA 3IWZA 3EI6A 3DV8A 3ZZJA 3F8BA 2BIAA 2GMUA 5K5QA 1CL2A 3PD6A 1AIAA 4KNYA 4N9HA 4P5OA 4XRFA 2VI9A 4K2EA 5IT9Z 2BI2A 2YU3A 3CBFA 4TN4A 3DFGA 2EV5A 1IRGA 2H6BA 2JTVA 2W24A 2RGVA 2HGCA 3F8FA 5J6XA 3LWSA 2VGVA 1IXRC 1ZRFA 4A0GA 4WYEA 1IN5A 3HL2A 2ESHA 1UCRA 4NHJA 5J8QA 3WGBA 2DTRA 1MLZA 4GE9A 5EIGA 5TF5A 2FYFA 2CSTA 2RQPA 3T1BA 1HKSA 2FNPA 2BE5F 1ASEA 2OZUA 1K6OA 1H0CA 3W6KB 4IJAA 3QP5A 4EQQA 3PAAA 4HDUA 4U1TA 3CLOA 3V7SA 3K0LA 1B4AA 5JR3A 2HTSA 2W7KA 4ADEA 1GC4A 1PDNC 1VJOA 5BPIA 4B98A 3JTXA 3ECOA 3KP4A 2FE3A 2OGEA 1W7NA 3ZZKA 1GDEA 4IXOA 3LWFA 2UZKA 1P4AA 4MQVA 2YOBA 4JQFA 5D6FA 3TFUA 4PVFA 3HUGA 3HMUA 5DB5A 2BWNA 2UXXA 5FD5A 3ABUA 3F23A 3KKIA 1STZA 4ESBA 3JW9A 3FXUA 3REOA 4MNUA 1ARTA 3I4PA 3VK2A 4EJVA 1WKMA 4AH3A 1CJ0A 1JGSA 3P9IA 1BI1A 1X2AA 3PDBA 2KJBA 3GYHX 4CYDA 3IKVA 5A2QZ 3FM5A 1U8RA 3F6TA 3G7QA 1ASLA 2NRAC 2OKJA 1WYVA 1FLIA 2W25A 1FX7A 3RTRA 4L0YB 1YNUA 3U9GA 4CBSA 3WGHA 2Z9WA 4EM1A 3A9ZA 1G6NA 3N0LA 1LVAA 3M7GA 4CXQA 3QRFF 3JTHA 3BPVA 3TCMA 3E3VA 4JEVA 3UAKA 1CZEA 4GGGA 2PMHA 3FF5A 2X5DA 1K78A 3LVKA 3C18A 4AIJA 1P92A 4HLYA 5CVUA 2W8JA 3A9YA 2CFBA 3K28A 3F3XA 2YCNA 1BJ4A 2ZSLA 3LG0A 3J81K 3VOEA 1KL1A 4FX0A 4PFNA 1WYVB 1MJ9A 4IXZA 2CO5A 2P5KA 2KIUA 3ECDA 3NUBA 2A6EF 4GXOA 3GETA 3FQ8A 3VP6A 5E8GA 1IUYA 2EGYA 1F1ZA 3AV7A 2NS0A 1FY7A 2YX4A 3RPUA 1PMMA 5HLHA 2CINA 1H1CA 1CF7A 5DEQA 2VMTA 1ASCA 4OIOF 1YLFA 3C3WA 1AKBA 1KMKA 2HP2A 2HUFA 5E5IA 3I16A 5DCMA 1KU3A 4BA5A 4KAMA 4KUMA 5E1XA 2COMA 1LNWA 4L9TA 2ESNA 3I5TA 1V2DA 2M87A 2VBWA 2DGKA 4ON0A 1BI0A 1YTYA 3WGGA 2EA2A 1O3SA 2HZPA 1AAMA 3HRUA 1TQPA 3KEQA 3BP8A 5D4RA 3OKSA 1AKCA 1IXSB 1OHWA 3TOBA 2AATA 2W7MA 3F9TA 4KXKA 3DP7A 1TTYA 3E2YA 1CF7B 4CGZA 4XJLA 3ZMZA 2O0YA 1KQ0A 3NRVA 3LQQA 3MCZA 5BOXA 1AICA 1ZRDA 5G0AA 3KZZA 1IN7A 3WTUC 4O5VA 2DU9A 5C6UA 3TDZC 1TATA 3KP2A 4EU1A 5DJ9A 4A0HA 1N8PA 1LK9A 3V8KA 4M2MA 2RN7A 2KJCA 3F8CA 2HUIA 1V3FA 4W91A 2AY5A 1E17A 3HRMA 3M8FA 4ZM3A 3DU4A 1IAYA 2XBNA 2Z9UA 3VB2A 4OT8A 2AY3A 1O3RA 5JFRA 2W8WA 1ASMA 1PP7U 2OA4A 2EFOA 2A5YB 2AY2A 2WK8A 3PA9A 2YKXA 4K2BA 4R5FA 4ESFA 2XGXA 3B02A 1G3TA 1V4RA 4CVQA 4YG2F 2A69F 1ZREA 3ZRRA 1WYTA 5DV5A 2XRNA 2EFWA 1FP1D 2OATA 3RBFA 3FFRA 3EUHA 4M73A 1S06A 3HIFA 4EFFA 2A6HF 1IZ1A 1EH6A 1ZLJA 4IRGA 2A3SA 4M6YA 1YG2A 5F1RA 4HF0A 2VMPA 2WC2A 4RKDA 2O61A 5FT4A 4XJOA 4MQ9F 1FG7A 1O62A 4LNJA 4HDVA 4B09A 3JZLA 4ZWMA 3RI4A 4WB0B 1SVVA 1I48A 3CUOA 1DUXC 3LFKA 4R8HA 4RS8A 2HUUA 3FHZA 2D61A 4OIPF 4RM1A 2QWWA 3M9AA 3I71A 2Z61A 5E8IA 1ARHA 3GR9A 2EFPA 1KU7A 4RIZA 4AOAA 2ADUA 1T98A 2EZ1A 3ELEA 4WK8F 4Q75A 1JHHA 2ZMEB 3HTUA 1D7RA 4W8IA 4G6QA 4AD9A 4MKJA 1DJEA 4BHPA 1I29A 5L3CA 1BC7C 2H09A 3GO5A 1QNTA 3WG9A 3EYYA 3IKTA 2F5DA 3QAHA 1XCVA 1QGPA 1CQ7A 1LDKB 3WY7A 2O03A 2IP2A 3EI5A 4HYEA 3F0HA 2DLLA 2EA4A 3HSEA 4DQ2A 2GA2A 3EIBA 3F8NA 3WTSC 2FBKA 4PCQA 2QQAA 4M2JA 2JSCA 2QMAA 4RJ0A 1AIBA 1UHMA 4R2NA 4E3RA 5FT8A 4M9XA 3BCBA 3ZPLA 3WTYC 3BWNA 1HBXG 2PG4A 4LLLA 2ZSMA 3EZSA 1M32A 1YJSA 1AHGA 1BC8C 4FX4A 3HVYA 3IRQA 3PDBB 3MEXA 3RDIA 3QN6A 5BJ3A 2HP1A 2EFNA 4CICA 2BI1A 1QZYA 4UHOA 1Z3ZA 1RIOH 4BHBA 1ONVA 1P4XA 3A8UX 1PP8F 4YIIA 5D5XB 2WK7A 5BJ4A 1TOKA 3KP5A 3K2ZA 2GXGA 3N5MA 4U0WA 5HS8A 2M5WA 4G6DA 3GBXA 3P1TA 3HBXA 2GA1A 3MC6C 1AHEA 5BQTA 2EFQA 3L2CA 3IL2A 1XGOA 3T0YA 1QIRA 4IPAA 2Z9OA 1DJUA 3R0AA 2ZFWA 3RBLA 1Z9CA 1J32A 3FVUA 3ISLA 2D5YA 1TOEA 4B8XA 4KMFA 4WXBA 1LDDA 3O6BB 2LSOA 1R1VA 3F6VA 1AJSB 3TQXA 4A00A 1LDJA 1ZHFA 4EM2A 4EB7A 3NYSA 1BN5A 5M46A 1LQ1A 3EYIA 3T32A 1A04A 1D5VA 2G7HA 1QGNA 1BM9A 4WCGA 4Y0IA 4ENKA 4Y13A 1FNNA 3BWGA 3ZRQA 3GZDA 3WKRA 1ZH5A 1AAWA 2VGTA 1SFUA 1WRJA 2WWYA 4UVCA 4UUVA 3I4JA 2PEXA 4LW2A 5EAAA 2XV4S 4Q5SF 3LVMA 2VT3A 3J80K 1B4XA 2G6WA 4UNOA 4J8LA 2VMZA 1G3SA 4EVIA 4PZJA 3R0JA 2ZXJA 3BN1A 3DR4A 2C7TA 2VLHA 5DX5A 2VC1A 4RB0A 2BEOA 1ZLKA 2GSAA 1XGSA 2DR1A 1MZBA 4WBTA 8AATA 3ROUA 4UV9A 1BI2A 4YFXF 1C7NA 2VOPA 3ZMDA 4XJPA 2DI3A 3LAPA 1BT4A 1N2TA 3E77A 3FZ6A 1D7VA 2P8TA 1ZODA 3TO9A 1L0OC 1T3IA 1EV7A 3MZHA 4LK1F 1XI9A 2OD5A 2XUBA 2PBIA 5E4ZA 1D3YA 4U2HA 2E7IA 3CTAA 2TDXA 3FZVA 5D5VB 3KETA 2HFHA 2YR2A 4G7OF 4I8AA 2RV8A 2GAUA 2HOZA 1UU0A 4IXAA 1V2FA 3NUIA 3WTXC 5J8CA 2VMOA 2LF8A 3SQNA 4IYOA 1HXDA 5E1WA 3DC1A 4G94A 2BYJA 4BAYA 3COGA 2ZO4A 2FN6A 2OBPA 1FYKA 2HWVA 2EJRA 3I64A 3S2WA 3MAFA 3CUQA 2M45A 4PGHA 2GXBA 2D64A 4IRHA 3HOTA 3QP6A 1ODDA 4ENNA 2BI5A 3LY1A 4XEWA 4YFKF 2Z67A 2P5VA 3C7JA 1J7KA 1IJIA 4JF1A 5CLSA 1ELQA 4M71A 3FVSA 3GX4X 2IRFG 1V72A 4ENJA 2PQ8A 1XMAA 1YYVA 3EQLF 4RAYA 1CGPA 4M72A 5G2PA 1M0OA 1ASAA 4WF2A 1IRFA 3F22A 1OKRA 1IW7F 2NYXA 1AHFA 3P9KA 2MH2A 3WGIA 1QZZA 1J59A 2KIFA 2R3SA 1O7FA 4A0YA 4HV6A 4A5NA 2BI3A 2Q7WA 2QENA 4U0VA 2PMUA 4L9VA 5HVQC 1ASGA 2EB7A 1WQ2A 3OV8A 5F6FA 4ZDPA 2RFVA 3DXJF 2DKBA 2HORA 3RKXA 2Z1YA 2QZ8A 1WSTA 3M5UA 1XDUA 5HOOA 1HKTA 4LB6B 1B9IA 2RVCA 1U3EM 1YW7A 4MHGA 1GC3A 1IN6A 4KIBA 4OIRF 5HLIA 1S7OA 2AY6A 5D5SA 1T39A 1F5TA 4BYYA 3GWPA 1BI3A 3U1DA 1AMAA 2VGWA 1TW3A 2VMQA 4RGRA 4MKKA 3KLNA 4A6TA 3LAJA 1JF9A 5E20A 1YQAA 1TNTA 1W23A 2DT5A 1YIZA 2DKJA 1I41A 4F4EA 3SFZA 1QITA 3SZPA 2LNBA 1TARA 3AOWA 1DGDA 1SF2A 1G3YA 2W8UA 3K1MA 4GYIA 1CQ8A 2EPJA 1SD7A 3AELA 3MAFB 1C4KA 5TRDA 4IRIA 4WXCA
chains in the Genus database with same CATH superfamily
2DT7B 1G59A 1XGNA 2W7FA 3M8EA 2F5CA 3H1CA 4F5KA 4LW4A 4D1QA 1KQ9A 1FIAA 1ZELA 5B5EC 2V6CA 2VE9A 1R5HA 3HOYJ 3K7YA 3W2VA 4HEA2 2O0RA 5FLMJ 1RR7A 4CCKA 4AZKA 4ITGA 2LK2A 3QPTA 2QQ9A 4P96A 1ZN2A 2CY8A 3A03A 3DPLC 4IVNA 4RITA 3FXQA 4QPQA 3F21A 3B8XA 2JK3A 2XGEA 1MGTA 4EM0B 3BC8A 2DA3A 2VIXA 1BQDA 2ZC0A 2DGMA 1S29A 4Q48A 1OISA 1UG0A 5HS7A 5CVIA 3WU0A 1SEUA 2HVSA 1Z3XA 3FFHA 3E6DA 5JVGF 3LVJA 2CUEA 1AY8A 4A3KJ 4G7ZF 4PDKA 2HVQA 2DK8A 2TRTA 3WZFA 2UXNA 2X9DA 1XGMA 3PIPF 1LW5A 3W1JA 5K5RA 4LLNA 2HOXA 4ZYGA 2VKVA 5K5OA 4WLHA 1O69A 4F7ZA 5FRMA 1QJ3A 3KGXA 3G8MA 3S3MA 2QVOA 2CJGA 5DUKA 3MN2A 1IAXA 1GHCA 5FD6A 2CV2A 3PIUA 3K10A 3BG3A 3H5AA 4LMYA 2VGUA 3BR1A 5DDGA 1L3LA 3ZN1A 3K1NA 3ZMTA 2V0YA 2L54A 1DTYA 3JRFA 3Q8NA 3KIOA 1U9OA 4XAUA 1R49A 3NEUA 3PSFA 1ZTRA 5ICFA 2HOEA 1HDDC 5ICEA 2IGOA 2HXIA 3QPHA 4Q47A 4DBQA 1IUGA 2ISZA 4E7HA 2ISYA 1JJ6C 4F5IA 4XK4A 2VODA 3H5NA 1W3UA 1MDOA 6PAXA 1IJWC 5G09A 1U5TA 4C3HJ 2CSOA 1R1TA 3BPXA 4LD5A 1MIJA 1I43A 1ZG3A 3LSJA 1QHHD 4IEJA 2M34A 2ZXWH 2WADA 5HLGA 1FJLA 2H8WA 5CVVA 1TPLA 2VIBA 2MLKA 3ZQGA 1DGWY 2VIAA 3SHFA 2HYJA 2XAUA 1I1GA 4XLAA 4LJZF 4XN0A 1AOYA 2D7ZA 3VPRA 4CDGA 3D1NI 4HX7A 3AG1H 2PLYA 2YRIA 1OHVA 2ZKZA 3E6BA 3U2RA 4E77A 1EH7A 2H94A 1OCCH 4RLGA 1QZEA 1A6QA 3LSTA 1GV2A 3SFIA 4BY7J 1KMJA 4RGUA 1VQ8I 1S7AA 4BMKA 1X4PA 1G7WA 3ZQHA 1N31A 3R6SA 3E2ZA 2DMNA 3FMSA 3RUYA 3FWEA 3GZ5A 4ZSWA 4BJ5C 4CHUA 3RCHB 4M9SA 5GAGJ 5K8BA 2BXZA 2DODA 5E3KA 4FETA 3MADA 2PB0A 5LRSA 2KMUA 2QUFA 1HQCA 1TQMA 3G6EI 4GRXA 3CJTB 3NU8A 2HZDA 2OC6A 2JJHA 2M30A 2VI6A 4G6TB 1UU1A 4IX8A 4XJMA 4EV0A 3CJQB 4ADBA 1YX5A 3TGNA 4A3BJ 2FNAA 1UHWA 4ZWVA 2LKPA 2P5LC 1S09A 4JE5A 2ELKA 4ZYEA 3I59B 4RB3C 4AC0A 4GE7A 2DQLA 3OIQA 3JAMK 1D2FA 4CCMA 4M6XA 4TMRA 4KMUX 4OU0A 1FWZA 2A05A 2QGUA 2W1OA 2IA2A 5EZGA 2BHXA 1FSEA 4P1WA 4A6DA 1E3OC 4FT8A 4AIDA 2HI3A 3RYRA 4F5FA 2M0CA 5ICCA 5ILVA 1REPC 5EQCA 2QSGX 2H1LA 2VXDA 4M3FA 3VDXA 1RV3A 2AEUA 3HT4A 2BGCA 4RJYA 2QBYA 1LFPA 1YX3A 2CUFA 5KCMA 2L3DA 2TPLA 4EJTA 3J80Z 1DPUA 5KAFC 2LDUA 3K7AJ 2R5CA 2J5PA 1SFEA 4YIRX 3OYBA 3Q9VA 3OS1A 2BBYA 1WI9A 2LR8A 3QOEA 4WWCA 1RUOA 2H1KA 2QBTA 4ETSA 1JE8A 2EIJH 5FGMA 3WCNA 4W1WA 4F5HA 2R0QC 2Z2SB 4DJAA 4ENMA 1HLVA 3JR9A 2V1XA 3FMRA 4LG0B 3RKWA 1SFFA 4D5CA 4G8XA 1QBJA 2B7EA 4ZH4F 3NTJA 2DYSH 5IP9J 2D45A 1MGVA 3IHJA 4N0WA 5KVRA 3LSHA 5KNLA 1ARIA 2WA0A 2PMZA 2XF6A 5D5UB 5E3NA 5KAIC 1QPMA 4UQVA 4WXHA 5ED4A 2V9VA 1WYUA 1RKTA 2DPDA 3BZKA 1RZ4A 4GFBA 2XAQA 3TP0A 2PJRB 4P7YA 1OJLA 2Y9YA 2VLFA 1V5EA 1IVRA 1D1AA 3QYBA 3F6OA 2M4GA 1W0TA 5B1BH 3RI6A 2PMZN 1X1CA 1ZARA 1FTZA 2AS5F 2KLOA 1BIAA 1T6SA 2QSFX 2Q0OA 2HVRA 1K7AA 2QB2A 3S17J 2W7GA 1UU2A 2VMUA 4Y0DA 3HLMA 1ON1A 3I9V2 3HSFA 3KP7A 3O8GA 3AENA 1GXQA 4HQMA 5EUEA 5G2QA 2A61A 4K2MA 3ECHA 1MMSA 2BY3A 2VMNA 4XBFA 1TT5B 2XPWA 5ILUA 3CUQC 3P9CA 3L8AA 3GXOA 1J04A 1DFOA 1ON2A 1GEWA 2UUZA 1KL2A 4NC7A 5H6QA 2MABA 3VOMA 3FRKA 2BKWA 2XSJC 2ZSHB 3G2BA 2DT6A 2E7WA 3IHUA 1SD6A 3T8TA 3HHHA 3ZRGA 3CMAI 4Q31A 4DOZA 2EIKH 5BNGA 2P7VB 4H0EA 2QYOA 2R2NA 4RAEA 4ZYHA 1K79A 4XKVA 4NBQA 2Z16A 2FBHA 4FCYA 2W57A 5H6RA 5IT9K 1O4SA 4HVKA 4BUPA 3L2WA 2PO3A 4HOBA 4IX7A 1BBYA 3OYLA 4BQNA 1SAUA 2LD5A 1B8IA 3RYPA 3BROA 2V26A 3QOPA 3S2DJ 2DTZA 4BQOA 4KYWA 3DRDA 1USSA 1GC0A 3VODA 4U0YA 3PD6B 3SEZA 1Z05A 2CRGA 3HXLA 3M1CA 3COAC 4RGXA 3HOZJ 3DU5A 3IP4B 2DFHA 4GCVA 4KICA 3V4GA 2K9SA 4HBLA 1QVTA 2WAQN 4ZZLA 2QA3A 1ARGA 5LEJA 2ETHA 3NQOA 4MIMA 1H9GA 1W7LA 4OINF 1ETKA 1B6AA 2RQQA 4CCOA 2FQ3A 4CBRA 3DLLF 2FBIA 3AEJC 2D7YA 4PJ0C 1Y1VJ 4XORA 2Y48A 3ABTA 1B5OA 3EUCA 3LSPA 1BJAA 2X6XA 2M2EA 2HDCA 2HS5A 4YFNF 4OCAA 3C1DA 3MD2A 1XDSA 2G0EA 2CJHA 3K40A 2DOEA 2R7XA 1B9HA 4J00A 3ESWB 1Y0UA 5FB2A 1P2FA 3S2HJ 1NHAA 2DO7A 2JISA 4BJTA 1W36C 4BGDA 1T0FC 1WWXA 3LA7A 4CA0A 4QLCU 4Y7NJ 3AL0C 1XC5A 3VAXA 1GUUA 1TNSA 2B0LA 2LREA 2DOUA 2BY1A 4EJUA 5EFSA 2ZP7A 1XCBA 3PIOF 3RKQA 3JCUC 1X3WB 4HF8A 2ZCWA 3JRCA 4L18B 2XROA 1DU0A 2DQRA 5HDKA 1E2XA 3K70D 3DF8A 1EG5A 2DFEA 5FRNA 1Y1WJ 2ZNZA 5J1UA 1MDMA 3UNGC 1K61A 3DTKA 3FQAA 2AXLA 2KRFA 3RCOA 5G4JA 1TLHB 3II0A 4EJWA 4LNMA 3GWZA 2MGQA 2XASA 5EEAA 3KP6A 4A3GJ 1NG6A 3E2FA 5AONA 1YW8A 4WP0A 3NARA 1TC3C 2K02A 2D5VA 5LH9A 4TV7A 1W36D 4Z2YA 1PJRA 2K3FA 2L9NA 5F0CA 2LFBA 5M4BA 4N9IA 2CQKA 3LA2A 1VTNC 2VQLA 1ZR4A 4HG2A 2IS1A 2JPCA 3CQZJ 3GCMA 3F0CA 2E54A 3K2AA 1C7OA 2JZYA 2BVLA 4F55A 2PB2A 1G4VA 4WX9A 3PNTA 2Z3YA 1P4WA 1NG7A 2NXNB 9AATA 1OR7A 1U78A 1SD4A 3ML6A 4IKFA 4LITA 2BV6A 2E1NA 1EF4A 3H14A 2VN2A 1ACIA 4GSAA 1YO5C 2I8DA 3FIWA 3S16J 1XMKA 2IPQX 2L4AA 3FTBA 2GIVA 1TWFJ 3GTQJ 5E3OA 2VT2A 1VQ9I 3GLXA 3ZMVA 1C7GA 4OBVA 2DJNA 2CH1A 4EATA 1POGA 1FZPB 2XKPA 2JA6J 1KKPA 2BW3B 1SD5A 3KCCA 2LBFB 2IS2A 4CO8A 1PMOA 2OQGA 4M9ZA 3L7WA 1YRNB 2E2IJ 2OPTA 4IY7A 2XB0X 1H0MA 1Y39A 3I4NJ 4I02A 5EG0A 3K4BA 4S05A 1EH8A 3GJUA 2D65A 3QODA 1I50J 3NAUA 2NAZA 5M5XJ 4RLQA 5IYDJ 4WYAA 1HF0A 3B1CA 1WGXA 1WJAA 1I39A 4L9NA 2FD5A 3HPGA 1FSHA 3S3OA 1ZAOA 1ASNA 5E18F 3DEUA 3OIPA 3CF5F 2OUMA 3FQ7A 4UV8A 1AMSA 1VQMI 3NWTA 1IN8A 3R60A 4C30A 1D7UA 1S3JA 1SAXA 1WHUA 2HOTA 5G4IA 4RB1A 2KKOA 3GZCA 5J3LA 4UXNA 4YELA 2R5YB 1AHYA 1I5ZA 3CQ5A 1XN7A 3TO6A 1M7YA 2XRLA 1XSXA 3PFYA 3GUDA 3MZYA 4B3AA 1Z6RA 2YS9A 3JTGA 1ZK8A 1NK2P 4A3LJ 3FXMA 3ZP5A 3PSIA 1AMQA 3LSRA 5LEKA 5H2FC 2V79A 3TEDA 2O3FA 3HB9A 3SZTA 4A3CJ 4S04A 3ZQ7A 2D1VA 3TDUC 3WTWC 4IO9F 1IXCA 3HUGB 2X1DA 3H5RA 2KIMA 5LHIA 1HW2A 2E7XA 3FM3A 3EZ1A 2EV6A 2XKOA 3C2HA 3KFWX 5F9SA 2JRMA 2VMSA 3EI7A 5AX8A 4I76A 1LS3A 2Z33A 4ZTJA 3BWOA 2XSDC 1Z67A 4GDFA 5HODA 3QYEA 1WH5A 2G7UA 1UAAA 1IGNA 3LSMA 2X8UA 3UE8A 3QBOA 3WU1B 4BBSJ 3Q0UA 1X28A 3PDXA 2E5NA 5EUDA 3PL8A 2CV1A 2L9VA 1TASA 1GVJA 2F5VA 5JHUA 1C0NA 2BHYA 3LQRA 1IV8A 2OZ6A 4OOIA 1VF9A 3CO7C 4K2IA 5ERIA 3W3CA 3MVPA 4WXGA 4BBRJ 3E6MA 1UB9A 4GO1A 3EUHC 2XPVA 2ZJGA 4DZJA 3JRBA 2DYRH 1HCRA 1OFCX 1BJOB 1WKGA 3USFA 1FBQA 1R23A 3JRIA 5HNFA 2M0MA 2GM4A 2PJRA 5CVJA 3W1IA 3VYUB 2VBZA 3W2AA 2YCTA 3WTVC 2LVSA 2IGKA 5H20A 1RVYA 4ZDLA 3F8MA 4KN4X 3BG5A 2ZMEA 2ECCA 2QQBA 3KE2A 2R7OA 2NOGA 3GTMJ 4F5JA 2YSRA 1R4MB 2X5FA 4W97A 2CGPA 3MBBA 4A5MA 1KYWA 3PPLA 2P4WA 2ZYJA 2GMSA 4P3MA 3D5LA 2ZUKA 2Q8KA 3TMOA 4E7JA 3CDLA 3BS8A 3U1KA 1T56A 5HNHA 2W7DA 2X3LA 4F92B 2V9KA 1DDNA 1SC7A 3TW6A 2FU4A 2CWEA 5DD8A 1FP2A 1SFOJ 4HF2A 1LC8A 2FMLA 2GOXB 2VB6A 3FCRA 5E17F 2V1DA 1B5PA 2R5YA 4YIFA 5D6EA 3ELKA 2EZLA 4M3DA 1YJNI 2B63J 3DBHB 1JS6A 2GQNA 4W1XA 1ZOBA 2BHZA 2F4IA 1WJDA 4Y4RA 2BI9A 3PNVA 2PFBA 3KPHA 1MLYA 1O3TA 1MBJA 5DCMB 1VQPI 1M6SA 1VQNI 2H6CA 2DMTA 2Y75A 4ZYDA 3HOSA 1RC9A 3ZOBA 1LC7A 1I27A 3M1EA 3ZQFA 3CQ4A 4ZDOA 4PFFA 2L7MP 2XVCA 5LBQA 2XAJA 3MFKA 5LGNA 5GAEJ 2FX0A 1JGGA 3VYRB 4ZZDA 2F5FA 1LKXA 3JAMZ 3IAS2 2E71A 2MD5A 3FXOA 5FLVA 3I58A 4DQ6A 2R7DA 1PUEE 5EAVA 4OBUA 2CG4A 3EUAA 3VSLA 1MJAA 2JJ7A 1V55H 1WJBA 2VJ5A 3KZIC 1LPQA 2FMYA 2R7RA 3PJ0A 1WCMJ 3V7RA 3D6KA 4I6ZA 4I2OA 2XB5A 2E7UA 3DQVC 4NQWA 3B73A 2G9WA 1MBKA 3DTEA 3PM1A 2L0KA 4ZJZA 4NOGA 2KP6A 2HEOA 3IF2A 2HYGD 3MZ8A 2Z5UA 2AY1A 2W8TA 4OMAA 2FF4A 3P5JA 4MTDA 4CCLA 1KKJA 1R5GA 2BIEA 1O7LA 1ENHA 2FXAA 5L3FA 2BYLA 1EQBA 5A2QK 1WJ5A 2M1BA 4RA2A 1TL8A 2K85A 2YKVA 4I7HA 2Z9VA 3BR6A 2EV0A 4OTLA 1OPCA 1V5FA 2OAZA 4FISA 2DW4A 1RESA 2W7EA 1TBXA 1SFXA 5EEGA 2DN0A 1FC3A 1TWAJ 3DKWA 5M5WJ 3LV2A 4IYOB 3LSIA 3OL3A 1AKAA 3CQ6A 4JEWA 3HRSA 2V1PA 3FD0A 3FZ7A 1MKMA 4AWXB 3GTKJ 2Y2ZA 1R58A 1ASFA 4UHMA 2K86A 3FKIJ 1SFKA 4QSHA 4ATPA 1ZGAA 1W5TA 4XICA 1O61A 4LLGF 3KP3A 4HV5A 1D8JA 2VYCA 3M4OJ 5EG0B 3GTOJ 4ABZA 4KYOA 1RV4A 2FRHA 2LG4A 1TWGJ 5HHYA 1LKCA 1ORKA 1KU2A 1QJ5A 3ASOH 4WYDA 4XRSA 4II3A 4L9JA 3ACZA 3TOAA 2XGCA 5F04A 4HX4A 1KQ8A 1RETA 3W1HA 3D5RC 5FFXA 2K7LA 1ZC9A 4ADDA 5BMZA 2DBBA 3B46A 2MD0A 2N8GA 4WXDA 5D5WB 4LIUA 1W7PD 2IW5A 3HOWJ 4PIWA 2VKHA 2RNJA 2WB1A 2M7BA 4DNCA 1J0RA 2DFIA 3K9TA 1KA8A 5J40A 1Z7DA 2XH1A 3DODA 2CJDA 4UVBA 2CQ7A 1Z6TA 2HQRA 1TWHJ 3BTCA 1DGEA 3AEJA 2JJGA 1A31A 3FK7A 4IHVA 3KEOA 1Z7UA 4MEXF 1OCRH 3BY6A 3TW7A 2O6GE 2YKYA 4QWQA 4O3MA 2AY8A 1ETYA 2R7TA 3SDGA 1Z7LA 1JJ8C 4MY5A 1XEYA 5EYRA 2W84A 1GT0C 1OXOA 3L1PA 4AVZA 3KEYA 4BDYA 5K1YA 4ADCA 1JG8A 7AATA 3N75A 1X29A 3NRAA 3CJNA 3O2PE 3V7CA 3ATHA 2CU7A 5L3DA 1YOVB 3I53A 1OYWA 2IS6A 1YIOA 1H88C 3S14J 4ISYA 1D7SA 5EUNA 1J75A 1MJBA 1BJWA 5FLXZ 2HYFA 2STWA 4WYCA 2YHKA 2BVMA 3I56I 1O3QA 2JGTA 1D8KA 1BOBA 2KRHA 2K4BA 2VI8A 2Z1ZA 1QRYA 1S07A 4WD2A 2ORDA 5CPRB 4B1RA 2HOSA 1YRNA 3E9KA 2Z9XA 1UFMA 2A68F 2M8EA 3ZRPA 2OCEA 3I54A 2R7VA 5LFAA 3LFUA 1FIPA 2Z99A 5IT3A 4OC9A 2DA2A 1YJ9I 3L09A 4D7MA 3K4NA 3MAJA 3HDOA 1ZG5A 1A6IA 2NNNA 1UG2A 3L00A 3ERED 4OMYA 4UB8C 1BQAA 1V2EA 1OMIA 2IVMA 3B1EA 4FL0A 4IW7A 3DR7A 2ZJ2A 1J9IA 1MDXA 4KFCA 5I92A 4IHSA 5AIQA 3H35A 5LRRA 3TKYA 5LHHA 3BB8A 2E60A 1OATA 1W7PA 2A07F 1ECXA 3P6KA 1QO0D 4R79A 4EGYA 4HA8A 4E3QA 2C81A 4IZZA 2DDBA 3TFTA 5FKMA 3JWBA 5J8FA 2XIGA 4M3GA 2XAHA 4G9YA 5ICGA 2AY7A 3AEPA 2BY0A 1C0WA 3QYFA 1ARSA 1U2WA 1PUFA 4XSZF 3OYJA 3MQ0A 2V1UA 2EILH 4PUSA 3WE2A 3R4KA 4CXFA 1BS0A 4B9BA 4Y3OA 2Z1DA 2IT0A 5HS9A 4JYKA 3GTGJ 5HXXA 2VQGA 4AIKA 2RDPA 2EZ2A 2Z20A 4XQ2A 3I0TA 1MMNA 5LLQA 1FT9A 1Z77A 2MBFA 1WVRA 1D1BA 4XLFA 5DCFA 4G12A 2ZJRF 3GW2A 2IEKA 3AG4H 3DLAA 4LK0F 1F9NA 4XKWA 4UVAA 4A6UA 2F5EA 4L0OA 3HGYA 3OYFA 3G3ZA 4XLPF 1TZLA 1KGSA 2X85A 1OYYA 5AIPA 4HNVA 3CCUI 1ELUA 2FNIA 1WH7A 3T5XA 4CZZA 4BE1A 3IRRA 3GZDC 2L01A 2LY2A 3RKYA 2W85A 3TO7A 5HDNA 1VQ5I 2WTEA 2HOAA 4B48A 5CJ9A 1PUFB 2R7FA 4I0AA 5IP6A 2FM1A 2QB3A 3QHXA 4A3MJ 4XL9A 1VI0A 4A0RA 5HDMA 4W1UA 2MH9A 1U9NA 2GZWA 3CCYA 2ZC2A 3GF2A 4IOCF 1T0FA 1O4XA 2WKAA 2EWNA 5FT6A 1TW2A 1N75A 3ZMUA 5F0HA 3K69A 3NYUA 2COBA 3HRTA 4XLNF 3WGCA 2K40A 1HW1A 4EGZA 3E2ZB 1J5YA 3PQJA 4CUGA 5HDGA 3FZ8A 1ZG1A 3KZYA 1FOWA 1WJCA 3BCAA 4KIGA 4BXUA 3TQNA 2VOOA 1ASDA 4MQQA 4EJOA 4WXFA 5L3EA 1QHGA 1EA3A 1M4NA 1X19A 5KK1A 1I6XA 2W82A 5D4SA 4Q4ZF 3TATA 1FBUA 4NNJA 4B3XA 2J5OA 1HA8A 3MMYB 1OQYA 1E5FA 1ETXA 2WK9A 4GEBA 4NUBA 1SPAA 2Y0SN 4ZSYA 3PUBA 1GD9A 2VBYA 4Q6RA 1RRJA 3MWMA 1QA6A 4OMZA 3WTTC 2K9QA 4ESJA 4XK1A 3OOPA 2ACJA 4GE4A 2OQRA 4RBOA 3H7FA 2QF7A 1X1AA 2K9MA 2YPRA 5FO5A 4ZTFA 3BDDA 2E1CA 4A0ZA 3BJAA 3AEOA 5L3GA 1MAQA 4JOMA 1FYMA 1DP7P 1R00A 2PI0A 5F64A 5D8KB 3EDPA 3HC7A 4CXRA 1HDPA 2UWMA 1MH3A 4J5UA 2X4HA 3H3VK 3J7YJ 2QQ8A 5M49A 1K4TA 1SVLA 2Q1ZB 1MNMC 1VEFA 3P7NA 3RJPA 1LEAA 4Y52J 3BR2A 2CYYA 1BOAA 4XKBA 3DBRB 4XQFA 2MLGA 1YJYA 5J47A 2R5CB 2XHKA 3GFIA 4LB5A 1MH4A 2DMQA 2ELJA 2FEZA 3OSGA 2AQFA 1R36A 2MFZA 3ASAA 3MC6A 4XSXF 3EETA 2OU2A 1GXPA 4Y15A 2P81A 1M0QA 1N77A 2Y31A 3LA3A 3OS2A 1ASBA 2O8XA 2O7CA 3S1NJ 4HQEA 1B59A 1W7MA 1BW6A 4ZM4A 1RI7A 4M74A 4MQRA 2FOKA 3E5UA 2DDAA 2IJLA 2HQNA 2QM3A 4MGRA 4RAZA 1G4XA 3AENB 3A2BA 1YIYA 1ETQA 1XB4A 2VL8A 1X3UA 5IPAA 4MFDA 1JHFA 1S8NA 1YIJI 3I59A 2JJEA 4KA4A 3KGWA 1JUPA 3QM2A 4O6JA 4N4NB 4R5ZA 2JG2A 4N0BA 1Z91A 1IX7A 3W6VA 1UZCA 2K4JA 1R4NB 2WV1A 3JSPA 1E5EA 4P9FA 5D95A 2F2EA 2HR3A 4BEHB 2CFXA 2L5QA 4JBAA 4HPQA 1BIBA 1BL0A 2QEXI 3OWTA 5F8VA 3CP8A 1OYIA 3F9KA 2XGDA 1BR1A 5J4VA 2O8KA 1JKOC 2RAEA 2H27A 3FISA 4BA4A 3I5UA 1U6GA 1TOIA 4EMYA 2VQHA 4IF4A 5E1ZB 3V8JA 2VE8A 2W48A 2X0LA 2C0RA 4BQ0A 5ILSA 3N05A 2HKXA 4UUSA 2KT0A 3CCSI 5LGUA 1JKQC 2DGLA 1YS7A 1CQ6A 4F5MA 3OL4A 3UR3C 4F5GA 2IXSA 2DFFA 1M0PA 3N4MA 2R5EA 4JK1X 3PQKA 4BHCA 2LKXA 2AEVA 1GEYA 5EZHA 3GFJA 3JRGA 3QPGA 4RGSA 4ZAHA 3AEMC 2EBIA 4HX8A 4CSWA 1IBJA 3MKJA 3B6CA 2RC4A 3DPTA 4GYGA 3GVAA 3ZQLA 2R92J 4E1OA 5F27A 4YEJA 2IA0A 2M8GX 4Z6YA 3GBGA 2W7HA 3JRDA 4E70A 3RZDJ 2YRRA 2VMWA 1AA7A 4FHTA 4HF1A 2D66A 1AY4A 5BS6A 4RB2C 3G4SI 1X2NA 1MDZA 3HOUJ 1XD7A 1S72I 4RM3A 3GFMA 1Y0NA 5DM6F 5LD2C 5LHGA 3J7AY 3FVXA 3QGUA 4UUSB 2OF7A 1S6LA 4O6ZA 3IH3A 2BWPA 2W7LA 1JI8A 2STTA 3DCFA 4BQAA 4A3DJ 2R0TA 1LW4A 2VMVA 4AZJA 2IGNA 3WX9A 2EK5A 1IUFA 1UKJA 2EQRA 4PFPA 1MAPA 3DYDA 3GLLA 1LUJB 4KT5C 4PSWA 3KYCB 4U7BA 3NU7A 2MC3A 2ELHA 3O3KA 2QA4I 4DW6A 3ZQQA 3ERMA 2CANA 2JPBA 1ZR2A 4A3JJ 3EUKL 2JT1A 1XSVA 4M2KA 4F3QA 3RIRA 4WYFA 4EB5A 4D0PA 1Z1DA 4HZFA 1IRXA 1U5TC 4LGWA 1IF1A 2PJPA 1IDZA 3DXVA 4NQWB 4CZCA 3RQ4A 3FKDA 2QKMB 2VC0A 3ZMSA 3WE3A 1OHYA 2E1MB 1S08A 4G7HF 1J2XA 1M0NA 3WKSA 2D63A 3VEPA 4KN7X 1HSTA 2FQ6A 3HHGA 1FPQA 3CDIA 2RKHA 5E3LA 5C3EJ 4ASNA 3GFLA 4E4HA 3G71I 3WHBA 4HAMA 2Y0MA 1AWCA 4I01A 4P9UA 1B8GA 1BJNA 3AEMA 4WB0A 4DGTA 4AO9A 1X0MA 3VYSB 4A6RA 2L02A 1P6RA 3NDNA 1YFHA 3DWLE 1G7XA 2VXZA 1JUSA 2ZFUA 2XF7A 4DGWB 1KYZA 1LFUP 1C9CA 1WYTB 3JW4A 3BZCA 5FFZA 2LBFA 5JVTA 1LC5A 2VASA 1R22A 1JT6A 4KISA 2CQNA 5IWQA 1ORDA 5C44J 2HKOA 1YOOA 3FK6A 1QQIA 3WLXA 4AVPA 4Y0HA 2W8VA 5CVRA 4BHDA 3OYEA 4QIWN 5CYVA 1XPXA 2BIGA 3OR1C 3FHNA 4XMYA 1UHSA 4PK4A 4HSRA 1TOJA 2K27A 2P7CB 1QU3A 4BE2A 3CO6C 2V6EA 2JA8J 4QGRA 3BG6A 1VQKI 5JAYA 5IOZA 4XRSG 3FMQA 1O57A 1G4DA 4UOYA 5M4DA 5DUIA 1EJIA 3ONQA 4JEZA 3CDHA 3GZ6A 4XM3A 5LHAA 1ZYRF 2DPUA 1GCKA 4I98B 4Y33A 2VGSA 1AHXA 4A0FA 3FDBA 2O7OA 4D7NA 2OQXA 2W7IA 4H51A 2WB1N 1Y4IA 3JWAA 1LFBA 3MEBA 3R9AA 4HLXA 2ZNYA 1UELB 2ME6A 4PJNA 1R9TJ 4LC3A 1AX4A 2BYVE 4NC8A 3VSKA 4CYCA 3BJOA 2OTJI 2C6YA 3HKZA 4DYCA 3LVLB 1VZ0A 2DOFA 1RVUA 1BKGA 2FNUA 3BOQA 4BQQA 1T33A 1HKQA 1MBFA 5GP9A 1RNLA 3DZZA 3NNKA 1I3QJ 2X1CA 3Q0WA 1SMTA 2ZMEC 2VMRA 4FFCA 3G0TA 3QU3A 2DXIA 4ITVA 2OCCH 2PN6A 1S0AA 1IX8A 4RKCA 4F5LA 5K7FA 2NVQJ 1GC2A 1WYUB 2V1NA 3E5QA 3DKYA 1X3ZB 3VK4A 1TOGA 2CW7A 5DD4A 4X6AJ 3L9FA 3H36A 3AG2H 2GB3A 3L2UA 4A2UA 3BCXA 5JLXA 3VFZA 1HSJA 3FX3A 3EI9A 5EF6A 5TGTA 3G73A 3BV0A 2R7QA 4KDPA 1OR7C 1JXSA 1W4MA 3BWNC 1AJRA 2IA1A 3KLOA 1ETVA 3HM5A 1QISA 5LGTA 2O1BA 3SYTA 2EO5A 4FE7A 2P6TA 1T38A 1XMXA 4I0BA 3SZGA 2NMPA 4LFUA 2LC2A 2AY9A 1P3WA 1BJOA 4Q76A 1YS6A 4CYCB 1R7JA 4BH9A 3HQTA 4IXSA 2HTJA 4UHNA 3NX3A 2OTLI 2FA5A 4V2FA 5BPDA 3LNQA 5DYMA 2I10A 4JE5D 1T2KA 3QI6A 5FJ8J 1AJSA 2K9LA 4UUTA 3AAFA 1IX6A 1JS3A 4E7LA 3UWCA 1SVMA 2YX7A 1MNEA 3I55I 2YUSA 2EH3A 2XAGA 3S1MJ 2WBMA 1BW5A 3JSOA 1GBNA 3E5XA 2EIMH 2HPIA 4U88A 4RM2A 1ZRCA 3J81Z 2GQQA 2JN6A 2JUCA 2R5ZB 3DKXA 4MO7A 3S1QJ 4IHTA 2EH6A 2VQCA 3D0SA 4IQ4A 4KJZA 1ZGJA 1MW7A 4JF0A 4NB5A 2VJJA 4XR6A 3R4TA 3BTLA 4UHTA 2L4MA 3DXWA 3RCHA 3L44A 1FBSA 4MEYF 3H3ZA 2HOYA 4MTEA 4AU7A 5J1YA 1FYLA 1TT0A 1WSUA 3N97A 3R61A 4OIQF 1B1BA 2OJED 3GSBA 2ECBA 1SZUA 3RQ1A 3S93A 1WKHA 2W7JA 1W7PB 3PO2J 2NVUB 3WG7H 2BY2A 2KDOA 3ABKH 5M3FJ 4OYTA 1B72A 1BW0A 1DKAA 5EIGB 4A12A 1YAAA 4ATQA 1DPRA 1TQIA 2FSWA 1ULYA 2JJFA 4DBCA 3T8RA 1NK3P 3A0HC 3CUQB 3IC7A 4Y17A 2HZTA 3HYIA 1PFFA 3Q9SA 2I5UA 2DK5A 2JVGA 2MYSA 3BZ6A 1BR2A 2DAOA 3DU6A 4C2MJ 4DBRA 3PGYA 2YKUA 1VNDA 2ZBKA 1IRZA 2ZJPF 2VMYA 2E1MC 3MAUA 2C44A 5JI6A 1YJZA 4LNLA 2AQEA 1IAWA 4AUXA 1AKHB 3FXRA 1LB2A 4DZPA 3B1DA 5FLXK 3WHCA 3ZGKA 1RUNA 1CZCA 3WODF 2O5RA 2VGZA 4W5KA 2VBXA 3BQZA 1B9NA 1OCZH 4M3EA 1G3WA 1W1WE 2ZB9A 1CL1A 3AATA 2CB1A 2VMXA 3NYTA 3ISPA 4KIFA 4LG0A 1IN4A 3CAIA 1XTAA 2GWRA 1B9MA 1QPIA 1GLNA 1YW9A 1U08A 1MDMB 4YRVA 2VJ4A 2MA3A 2R7WA 3OYCA 3CCLI 3IV5A 2HNHA 3J7AO 4JX4A 4IQJA 1DJ9A 4BJ6C 2YOBA 3IWFA 2IAIA 1Y8RB 2LF7A 2P6SA 1I3AA 3E97A 3H3UA 1XSDA 1AY5A 4ITXA 4U7DA 2OGAA 2EPFA 3KE3A 2F8JA 1HW5A 1Q1HA 2QLZA 4ZASA 5J4YA 1VP4A 5TJJA 5FT5A 3OIOA 1F4KA 4A6EA 2JSPA 1I1SA 4I09A 1BR4A 1FOKA 1R1UA 4EMSA 1TWCJ 4LOCA 1S5LC 3WCOA 4GDYA 3K1PA 3BJ6A 5L3BA 4AIHA 3PUFA 2R7ZJ 4WLJA 4W1VA 1PG8A 1JKRC 4A0XA 2R93J 4PGGA 9ANTA 2D2WA 2WV0A 3CCQI 4JEXA 3A9XA 3WTZA 3ULQB 4A72A 3AOVA 3ELPA 1W5SA 2BWOA 2CTZA 4R1HA 2Q2EA 4UY8I 1FG3A 4C3IJ 2NNYA 3ASBA 1LJ9A 3EIAA 1QVUA 2XF5A 1LEBA 4MSOA 3FXLA 4M6VA 3FXJA 3CMMA 4L5IA 3ZN0A 1WJFA 2JRTA 3V8LA 5EGOA 1K78B 4M3BA 1X1PA 1FC4A 3GTJJ 1QZ9A 2QLRA 2HXOA 1SZSA 3E6GA 2XAFA 4P55A 5DJ1A 4CCNA 1KU9A 4J01A 1Z21A 2D1HA 2GIZA 5EEHA 3HTSB 1HOMA 1D0YA 2CH2A 3QU6A 4L5JA 4IHYA 3GEZA 2LP0A 1AMRA 5B3SH 2JA5J 1FEXA 3H92A 3CCRI 3F72A 3E6CC 1CS1A 2E7JA 1P9QC 3JU7A 4C3JJ 5D8LB 1MD0A 3V42A 1USTA 5E79C 3SXYA 4MQPA 3BR3A 4RAFA 3RPQA 3GMEA 2VPRA 1OXPA 1N25A 3A4CA 2X6WA 3Q3SA 3Q5FA 2AY4A 4L0ZB 2YCPA 3FSLA 4HW0A 2CW0F 1WZ2A 4PSXA 2VONA 5GTIC 2Y9ZA 3A0BC 3ZQIA 3EI8A 3OP7A 3L2QA 1A35A 2XDVA 3PFIA 1SZKA 1GEXA 3VK3A 4JEYA 2WAEA 4B43A 3HSRA 4ZLVA 3H9JA 4AO4A 1U5TB 2LYCA 4BNCA 3W2WA 4WYGA 3W6JB 5GPAA 1H9TA 1SANA 2QBYB 1P7JA 4R8DA 1H8AC 4BXXJ 3IWZA 3EI6A 1IDYA 3DV8A 4A69C 3ZZJA 3F8BA 2WY8Q 3TBIA 2BIAA 2GMUA 5K5QA 1CL2A 3S1RJ 3PD6A 1AIAA 3H0GJ 4KNYA 4N9HA 4P5OA 1V54H 2CQQA 4HNTA 4XRFA 2VI9A 4K2EA 1IG7A 5IT9Z 2BI2A 2YU3A 3CBFA 3DTIA 4AYBN 4TN4A 3DFGA 2EV5A 4BE0A 2DA5A 4XRMA 5JHFA 2H6BA 2JTVA 1IRGA 2W24A 2RGVA 2HGCA 2LTPA 3F8FA 2KHMA 5J6XA 3LWSA 5FROA 3ZQCA 1IXRC 2VGVA 1RPWA 2VKEA 1ZRFA 2BW3A 1DU6A 4A0GA 4WYEA 1IN5A 4AYBA 3HL2A 2ESHA 1UCRA 4NHJA 5J8QA 3WGBA 2DTRA 3OY9A 1MLZA 1DQUA 4GE9A 4FQGA 5EIGA 5TF5A 5B66C 2FYFA 2CSTA 3ABMH 2RQPA 1X4OA 3T1BA 1HKSA 2FNPA 2BE5F 3AKZA 1ASEA 2OZUA 1LE8B 1K6OA 5GPCA 1H0CA 2DOAA 4IJAA 3W6KB 3QP5A 4B44A 4EQQA 3PAAA 4HDUA 4U1TA 3CLOA 2E5ZA 2ICWG 3K0LA 3V7SA 4FE4A 2KL4A 2ID6A 1B4AA 5JR3A 2HTSA 2W7KA 4ADEA 1GC4A 1R6RA 1PDNC 3IUOA 2F6CA 5BPIA 1VJOA 4B98A 2XC7A 3JTXA 3ECOA 2VPLA 3KP4A 2FE3A 5CQGA 2OGEA 1W7NA 2HQ5A 3ZZKA 3OSFA 2LY1A 1GDTA 3HOVJ 1GDEA 1Y8QB 2CMPA 4BU2A 1FMVA 4IXOA 3MKLA 1W5CC 3LWFA 2IGMA 2UZKA 1D0XA 1P4AA 4MQVA 1P7IA 3A1YA 3K4MA 4JQFA 5D6FA 2DA6A 2WAQA 2KDZA 3TFUA 1MMDA 4PVFA 1XS9A 2MG4A 3HUGA 3HMUA 3CESA 5DB5A 2BWNA 5EDNA 2UXXA 5FD5A 3ABUA 3F23A 3LOCA 3GZNB 3KKIA 2W7NA 1STZA 4JX5A 4ESBA 3OS0A 2CQXA 4XOPA 1APLC 1PVEA 3AG3H 4UB6C 3JW9A 2QCOA 3FXUA 2HDDA 3REOA 1V5GA 4MNUA 1OCPA 2NOJB 3HGGA 1ARTA 3I4PA 3VK2A 4EJVA 2KPMA 4DYQA 1VQ6I 1WKMA 2V9PA 4AH3A 4A93J 1CJ0A 5M3MJ 1JGSA 3CLQA 5F08A 3P9IA 1BI1A 3D5SC 1YITI 1X2AA 3HZJA 3PDBA 2KJBA 3GYHX 3X2QH 4CYDA 3OYKA 3IKVA 5A2QZ 2QSHX 1PYVA 2O9LA 3FM5A 3QWLA 1U8RA 3F6TA 3G7QA 1ASLA 2NRAC 2OKJA 1K4SA 1FTTA 1WYVA 4HNUA 4IL6C 1FLIA 2W25A 1FX7A 3RTRA 4L0YB 1YNUA 3U9GA 1YE9A 3WGHA 4CBSA 2Z9WA 4EM1A 3A9ZA 2DA1A 1G6NA 4HRIA 3HEFA 2ZXHA 3N0LA 1LVAA 3M7GA 3OYGA 4CXQA 1DGRM 3QRFF 3JTHA 3BPVA 3TCMA 3E3VA 4JEVA 3UAKA 2FOWA 1CZEA 2M7AA 4GGGA 2PMHA 1EJ9A 4XONA 3FF5A 1BA5A 1E3PA 2X5DA 1K78A 3LVKA 3C18A 2VKDA 2P0WA 1P92A 4HLYA 4AIJA 4NC6A 5CVUA 4C9YA 3L2RA 2W8JA 3A9YA 2CFBA 2Q2EB 1T8IA 3K28A 3F3XA 2YCNA 1BJ4A 2ZSLA 3LG0A 3J81K 4LG3A 3VOEA 4BS9A 1VQOI 1KL1A 3G1OA 4FX0A 1IC8A 4PFNA 1WYVB 1MJ9A 4IXZA 2CO5A 2P5KA 4AM3A 2KIUA 3K4LA 2L7FP 3ECDA 3NUBA 2A6EF 4GXOA 3GETA 3FQ8A 3VP6A 5E8GA 1IUYA 2EGYA 1F1ZA 3KX2A 3AV7A 2X6OA 3QPSA 1F43A 3CP2A 2CH0A 2NS0A 1FY7A 3LL7A 2YX4A 1H89C 3RPUA 4XLHA 3PO3J 1PMMA 5HLHA 2CINA 1H1CA 1CF7A 1UJ8A 2ID3A 5DEQA 2VMTA 2K3PA 2CFOA 4XIDA 2M9HA 1ASCA 4OIOF 1YLFA 1M1EB 3C3WA 5C4JJ 3OYMA 2GXAA 1TP4A 1AKBA 1KMKA 2QKLB 5IYBJ 4B47A 4X1EA 2HP2A 5B1AH 2HUFA 5E5IA 1D0ZA 3BT9A 1WJEA 3I16A 5DCMA 1KU3A 4BA5A 4IOAF 4KAMA 4KUMA 5E1XA 2COMA 1Y56A 1LNWA 4L9TA 2ESNA 4A3FJ 3I5TA 1V2DA 4E7IA 2M87A 2EZHA 2VBWA 2DGKA 3U21A 1C4KA 5K7HA 3LSGA 4ON0A 1BI0A 3DEWA 1YTYA 3WGGA 2EA2A 1O3SA 2HZPA 1AAMA 3HRUA 1TQPA 4XOTA 3BP8A 2FUG2 3KEQA 5D4RA 3OKSA 1AKCA 1IXSB 3NWSA 1OHWA 3TOBA 4RAGA 2AATA 2W7MA 3F9TA 4KXKA 3DP7A 1TTYA 3E2YA 4E7ZA 1CF7B 4CGZA 2CUZA 4XJLA 3ZMZA 4IHXA 2O0YA 4XLEA 1KQ0A 3NRVA 1VQ4I 3BG9A 3LQQA 3MCZA 5FKOA 5BOXA 1AICA 1ZRDA 5G0AA 2NS8A 3KZZA 3AL0B 3G1MA 1IN7A 4DIQA 3L2VA 3WTUC 1JUMA 4O5VA 2DU9A 5C6UA 1WFXA 2KQRA 3TDZC 3TP3A 5HLTA 2GBYA 2VUMJ 3HBLA 1TATA 3KP2A 5IYCJ 5DJ9A 4A0HA 4EU1A 3ZCOA 1LK9A 1N8PA 2CS3A 3V8KA 4F93B 4M2MA 2RN7A 2KJCA 4MFEA 3F8CA 3K70C 4BDZA 3RPUD 2LRDA 3CC4I 1W0UA 3BLYA 2HUIA 1V3FA 2NVTJ 4W91A 2AY5A 3I4MJ 1E17A 3HRMA 3M8FA 3WU2C 1OCOH 3O8HA 4ZM3A 3G1LA 1OCTC 1ETWA 1RKWA 1IAYA 3DU4A 2XBNA 2Z9UA 3VB2A 3J7ZI 3OR2C 2AY3A 3CZ6A 1O3RA 1D5YA 2MW8A 5JFRA 4OT8A 1CQTA 2W8WA 1ASMA 5CQEA 1PP7U 2OA4A 2EINH 2LOOA 3FKJA 1G8XA 1MBEA 2LH9A 2E35A 2EFOA 3QPLA 2A5YB 2AY2A 2WK8A 3PA9A 2YKXA 4K2BA 4R5FA 4ESFA 5IY5H 1YI2I 4IHWA 1X1BA 2XGXA 3CD6I 3B02A 1MBHA 1G3TA 3S3NA 1V4RA 4CVQA 3DEEA 4YG2F 2A69F 2DJIA 1ZREA 4F91B 3ZRRA 1WYTA 3CCEI 5DV5A 4PFOA 2XRNA 1FOXA 2AHQA 2AXTC 3IAM2 1IV6A 2KRCA 2EFWA 2MC4A 2M3AA 2ZXIA 4D9JA 2JA2A 3BG7A 1ZGWA 1FP1D 2OATA 3RBFA 1KZHA 3FFRA 3EUHA 5DM7F 4U87A 1S7EA 4M73A 1S06A 3HIFA 4EFFA 2F4MB 2A6HF 1IZ1A 1T08B 1EH6A 2RNGA 1ZLJA 4IRGA 2UV1A 2A3SA 4M6YA 1YG2A 5F1RA 4HF0A 3MKYB 2WC2A 2VMPA 4RKDA 2O61A 2R7SA 3K4CA 1SVOA 5EJCA 5FT4A 4XJOA 3E1SA 1GVDA 3EPZA 4MQ9F 5C4XJ 1FG7A 1O62A 4LNJA 4HDVA 4B09A 4A3EJ 2HQAA 3JZLA 4ZWMA 3CCVI 3RI4A 1SVVA 4WB0B 3A01A 3FDYA 4PJJA 3CUOA 1I48A 1DUXC 2V7FA 3LFKA 4R8HA 4JX6A 4RS8A 4NDLA 2HUUA 3FHZA 2D61A 4OIPF 2K5CA 2QWWA 3M9AA 4RM1A 3I71A 3S32A 2F4OB 2Z61A 3E0JB 5E8IA 1KONA 1ARHA 1FOYA 3GR9A 2EFPA 1KU7A 4RIZA 4AOAA 2ADUA 1T98A 2E19A 4V2GA 2EZ1A 3ELEA 3GTLJ 4WK8F 4Q75A 1JHHA 2ZMEB 5CKTA 1A5JA 3HTUA 4HSTA 4DYRA 2JA7J 4C2UA 1D7RA 1I6HJ 2E2HJ 4XLCA 4W8IA 4G6QA 4AD9A 3CMYA 2K9NA 4MKJA 1DJEA 4BHPA 2L7KA 1I29A 5L3CA 2KZGA 1BC7C 2CV0A 2HDWA 1HC8A 2H09A 2W00A 5IOYA 3GO5A 1QNTA 2YU9J 5K7ZA 5GTHC 2E2JJ 3WG9A 3MKWB 3EYYA 2Y0SA 4E7SA 3DBLB 3CCMI 3IKTA 3FBNB 2F5DA 3QAHA 1XCVA 1E3HA 1F36A 1QGPA 3A2KA 4KT6A 4ZC3A 2JWTA 1CQ7A 1R5ID 2R4GA 1LDKB 2LLKA 4OAZA 5DS9A 1AU7A 3WY7A 2O03A 2IP2A 4QTRA 3EI5A 5E3MA 3JREA 2MSYA 4HYEA 1MBGA 3F0HA 2DLLA 2EA4A 1XG1A 2F48A 2TCTA 3KYDB 3HSEA 4DQ2A 1JT0A 2GA2A 3EIBA 3F8NA 1Y6IA 3WTSC 3B6AA 2HPMA 2CUJA 1YHQI 3K6GA 2FBKA 4PCQA 2QQAA 4OWRB 4M2JA 2JSCA 2QMAA 4RJ0A 1AIBA 1AKHA 1UHMA 4R2NA 4E3RA 2OV7A 5FT8A 4M9XA 3BCBA 3ZPLA 3WTYC 3BWNA 1HBXG 2PG4A 2E36A 4LLLA 2V4JC 2ZSMA 3EZSA 4A3IJ 1M32A 1YJSA 1AHGA 1VQ7I 1BC8C 4FX4A 3HVYA 3IRQA 3PDBB 3MEXA 3RDIA 3QN6A 5BJ3A 2HP1A 2EFNA 4CICA 2BI1A 1QZYA 4UHOA 1Z3ZA 2IS4A 1RIOH 2EZIA 4H4KC 4BHBA 2NVYJ 1ONVA 1P4XA 1LVKA 1EKEA 3S15J 2A6TA 3A8UX 1JTXA 1PP8F 4YIIA 5D5XB 2WK7A 5BJ4A 3CF2A 1UMQA 2DA7A 1TOKA 3H9QA 2HU9A 3KP5A 2VJIA 3HJEA 3GTPJ 3K2ZA 1NH3A 3OOUA 2GXGA 3N5MA 2WY7Q 2AO9A 4I99C 4U0WA 2M5WA 5GAHJ 5HS8A 2M4KA 3ZXSA 4G6DA 4D5FA 3GBXA 2Y69H 3P1TA 4XKCA 3HBXA 2GA1A 2DMPA 3MC6C 1GV5A 2R5ZA 2KIQA 1AHEA 5BQTA 2EFQA 2JVHA 3BQYA 3L2CA 3SJMA 3IL2A 2JUGA 1U8BA 1XGOA 3T0YA 4BY1J 1QIRA 2XPUA 2DCEA 2PX9A 3OYNA 4IPAA 2Y30A 1X1DA 1X58A 3M07A 2EZKA 3R0AA 2Z9OA 2ZFWA 1DJUA 1S9HA 2L9RA 3RBLA 4BL0B 1Z9CA 1J32A 3FVUA 3ISLA 2D5YA 1TOEA 4B8XA 1NTCA 4BKXA 3KYLA 3CCJI 4KMFA 4WXBA 1LDDA 5TISC 3O6BB 2LSOA 5F1JA 1R1VA 3F6VA 1AJSB 2L2OA 3TL4X 3TQXA 1LE8A 2OKKA 4A00A 1LDJA 1ZHFA 4EM2A 4EB7A 5FKKA 3NYSA 1BN5A 1A36A 5M46A 3H9GA 2FQ4A 1LQ1A 3EYIA 3T32A 1A04A 3HG9A 1D5VA 2G7HA 2KZVA 2GLOA 2BXYA 1QGNA 1BM9A 4WCGA 4LIVA 4Y0IA 4ENKA 1ZQ3P 2FJ1A 1FNNA 2BZTA 3BWGA 4Y13A 3ZRQA 3GZDA 3OYHA 1RR8C 3WKRA 1ZH5A 3ABLH 3E7LA 3M8JA 1AAWA 2VGTA 1K83J 1SFUA 5IP7J 1WRJA 2WWYA 5F0FA 4UVCA 4UUVA 3I4JA 1ETOA 2PEXA 3IH2A 4LW2A 5EAAA 2XV4S 3HPHA 4Q5SF 2A5WA 2VT3A 3J80K 3LVMA 2X6YA 3OYAA 4KITB 3CJRB 1B4XA 4RMNA 2G6WA 4UNOA 4J8LA 4S0HB 4J19A 2VMZA 1G3SA 2KFDA 3OMYA 4EVIA 4PZJA 2R7UA 2BOLA 3R0JA 4PJMA 3A01B 2ZXJA 3BN1A 3DR4A 3RSNA 2C7TA 2VLHA 5DX5A 2VC1A 4RB0A 2BEOA 3FXKA 4XNFA 1ZLKA 2GSAA 1XGSA 4BACA 2DR1A 1MZBA 4WBTA 4QPOA 8AATA 3ROUA 3M3YJ 4UV9A 3CC7I 1BI2A 1Z3YA 4YFXF 2VOPA 1C7NA 3ZMDA 4XJPA 4OAYA 2DI3A 3LAPA 1BT4A 3VWBA 1N2TA 3E77A 3FZ6A 5JLWA 1D7VA 2P8TA 1ZODA 1BJZA 1MMGA 3TO9A 3RZOJ 1L0OC 1T3IA 1EV7A 3MZHA 4LK1F 1XI9A 2OD5A 4BXFA 1X2MA 2XUBA 2PBIA 4EEFG 5E4ZA 1D3YA 4U2HA 2E7IA 3CTAA 2TDXA 3BR0A 2WAFA 1Z0XA 3FZVA 5D5VB 3KETA 1MSEC 2HFHA 1U0JA 2LKSA 3S8PA 2YR2A 4G7OF 1IO2A 4N4OB 4I8AA 2RV8A 5J1RA 2GAUA 1Q1VA 2HOZA 1UU0A 3OYIA 2ME0A 2DMUA 3JRHA 4ZYAA 3BTJA 4IXAA 1V2FA 3NUIA 3WTXC 3I3LA 5M5YJ 2X1EA 4RLFA 5J8CA 1OLTA 1ERDA 2VMOA 4L5EA 5EGOB 1MNDA 2LF8A 2LMDA 3SQNA 2H8RA 4PJLA 5FKLA 3PJRA 1HXDA 5E1WA 4IYOA 3DC1A 3LSKA 4E7KA 4G94A 2BYJA 4BAYA 3OYDA 3COGA 3A02A 2ZO4A 1WPKA 2OBPA 1FYKA 2HWVA 2VLAA 1E0EA 2FN6A 1T95A 2EJRA 3I64A 3S2WA 3MAFA 3CUQA 2M45A 4PGHA 2GXBA 5KHDA 2D64A 3IH4A 4IRHA 3HOTA 2JMWA 3Q0VA 4FASD 3QP6A 2X48A 1ODDA 4ENNA 3DPUA 2BI5A 3QQAA 3HKZN 3LY1A 4ANJA 4XEWA 3CMEI 3UKGA 4YFKF 2Z67A 2P5VA 3C7JA 1N78A 4II2A 4B4CA 1J7KA 1IJIA 2CJJA 5CLSA 4JF1A 1G2HA 3MKZA 4M71A 1ELQA 3FVSA 3GX4X 1DP3A 2IRFG 2KISA 1V72A 3HOXJ 4ENJA 1MMAA 2PQ8A 1JKPC 1XMAA 3ASNH 1YYVA 2NS7A 3EQLF 3SDBA 4RAYA 1FMWA 1ITYA 5GADJ 4CH7A 1CGPA 4MLOA 4M72A 4E6KG 5G2PA 3C2GA 3SEQA 1ASAA 1M0OA 1K6YA 1IRFA 1OKRA 1IW7F 2NYXA 4WF2A 3F22A 1AHFA 3P9KA 2MH2A 1XX5A 3WGIA 1AHDP 1QZZA 1J59A 2KIFA 2R3SA 1O7FA 4V19K 4A0YA 1J09A 4HV6A 4A5NA 2JQ7A 2BI3A 1YJWI 2Q7WA 2QENA 1JTYA 4U0VA 2DA4A 2PMUA 1MSFC 4L9VA 5HVQC 2LY9A 1WQ2A 2EB7A 3OV8A 5F6FA 1ASGA 3FBIB 4ZDPA 2RFVA 3C2BA 3DXJF 3H0DA 3RKXA 1VFCA 2DKBA 3CC2I 2QZ8A 2W4SA 1WSTA 2HORA 2Z1YA 3M5UA 1XDUA 5HOOA 1HKTA 4LB6B 3LMMA 1R71A 1B8IB 2RVCA 1B9IA 1U3EM 1YW7A 2RREA 4MHGA 1GC3A 2GOMA 2ZSIB 1IN6A 5DTDA 4C2TA 4KIBA 5FKNA 1D1CA 4OIRF 3RQIA 5HLIA 2CW8A 1S7OA 2AY6A 4GRIA 5D5SA 3JRAA 3K4KA 4X0GA 4BYYA 1T39A 1F5TA 1BI3A 3GWPA 2L9SA 4JP0A 3U1DA 3K4JA 1AMAA 2E34A 1TW3A 3HDDA 4RGRA 2VGWA 2VMQA 2ZJQF 4MKKA 3KLNA 4A6TA 3LAJA 1JF9A 4RDUA 5E20A 2NVXJ 1YQAA 1TNTA 2X51A 1W23A 2DT5A 1YIZA 2DKJA 1I41A 4F4EA 3SFZA 1QITA 3SZPA 2LNBA 1TARA 4FTHA 1DGDA 3AOWA 2E1OA 1B72B 1SF2A 1G3YA 2L7ZA 4F52A 3AFHA 3ZR8X 4BEHA 2W8UA 1WI3A 2IBDA 5TRDA 3K1MA 4GYIA 2B9SA 3BTIA 1VQLI 4CCJA 1CQ8A 1SD7A 4XN3A 2EPJA 3VYTB 3AELA 3BR5A 3MAFB 3PNYA 1ZKGA 1SMYF 4IRIA 4WXCA
chains in the Genus database with same