4MGRA

The crystal structure of bacillus subtilis gabr, an autorepressor and plp- and gaba-dependent transcriptional activator of gabt
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
468
structure length
468
Chain Sequence
DITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHIDQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSKSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKENKRQTGRPALIIGFARLKEEDIQEGVQRLFKAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Bacillus subtilis GabR, an autorepressor and transcriptional activator of gabT.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulatory protein GabR
total genus 135
structure length 468
sequence length 468
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4mgrA01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4mgrA02
4UHOA 3JSPA 1CZCA 1WYVA 4AO9A 3LY1A 3N97A 3GX4X 3PPLA 3WTTC 3AEMA 5BOXA 3TFTA 2AY1A 4L9VA 3J80K 1TQPA 1HW5A 1ZODA 1QZYA 1AICA 1AJRA 1GVJA 1ZC9A 3F21A 4JEVA 3QU6A 4WXGA 1B9IA 3DP7A 2FA5A 1XSVA 4EJOA 1DGDA 4M2MA 3EDPA 2J5PA 1BI2A 2H09A 4G7ZF 3CO6C 3K1PA 1AY5A 3IWFA 2Y75A 3BN1A 3V8LA 3AENB 2DQLA 1VP4A 2QLRA 4HVKA 1O57A 2K86A 2DI3A 4UVBA 4FX4A 1ARIA 2QUFA 1O62A 4KYWA 3ZMUA 3WGHA 3WTVC 5G0AA 5HOOA 4E77A 4UHTA 1WKHA 2JRTA 3ACZA 1OYYA 3RQ1A 4A5NA 1U3EM 2ZSMA 3GFIA 3GJUA 4KT5C 4JEYA 1K6OA 1ASAA 4GO1A 2HORA 3FVXA 3EYYA 4I7HA 2IA1A 4XSXF 4DNCA 4LLGF 2CGPA 3ECDA 4RGUA 2HZPA 2NNYA 3COAC 3Q9VA 4U0WA 4XSZF 1QZ9A 4J8LA 2R5CA 4HF8A 4O6JA 3QPHA 4L0ZB 3GFJA 2AY9A 3PD6A 5BPDA 2R3SA 4K2MA 2FNAA 4IW7A 2BV6A 1J0RA 5AX8A 3A2BA 2P4WA 1ODDA 1CQ7A 2RKHA 3E77A 1IJIA 2XGXA 2TDXA 1GEXA 5E18F 1Y4IA 3RCHB 2KJCA 1FNNA 2DOUA 2COMA 1P92A 3BP8A 5JVTA 3CAIA 2DFIA 3B46A 4RLGA 4L0OA 3NUBA 3NNKA 4ASNA 4LGWA 4Q6RA 4HV5A 4MNUA 1J5YA 1O4SA 5E5IA 2ESHA 3T32A 1B9MA 2XRNA 1HKSA 1IN5A 3F0HA 2VC1A 5LGNA 4KDPA 4WYDA 1BKGA 4EV0A 1V2EA 2DK5A 4NHJA 3HRUA 4D0PA 4ZSWA 1GC0A 2VGWA 4AWXB 3TO6A 3DR4A 5FT4A 2DT5A 4CBRA 2YKYA 5L3BA 4P5OA 2AY2A 1GXQA 3EI9A 1U5TC 2QBYB 5F1RA 5CYVA 2LDUA 2ZO4A 3MC6C 1N8PA 4P3MA 3CO7C 4CVQA 3NTJA 4KMUX 1LKCA 5L3DA 3FQ7A 2BI9A 2OQXA 3J80Z 1ON1A 5D5VB 1AJSA 3NU7A 3GO5A 2OGEA 3F9TA 4JEZA 4I8AA 2HKXA 3GBXA 4ENMA 1FSEA 1U8RA 3A8UX 1YW9A 2UXXA 4ZYHA 1IAYA 4F5HA 4AIHA 4CHUA 2OU2A 4ADDA 1AIAA 4RIZA 4MKJA 2KJBA 3D6KA 4WYGA 3VEPA 2GMSA 2VOOA 5EQCA 2W8TA 1H9TA 2R7DA 1GBNA 4IXAA 3FHZA 4MTDA 3ATHA 1IRFA 2AEUA 1BIBA 2VMTA 3IL2A 1J32A 4GDYA 4BA4A 3TGNA 4HBLA 2M30A 2PI0A 5BPIA 1FYKA 4ZH4F 2Z9WA 1TOIA 1PMMA 3RPQA 1J2XA 3B1DA 4F4EA 3HLMA 4BQ0A 1P2FA 2DR1A 4NQWA 2PFBA 2ZP7A 4HQEA 4KMFA 1GDEA 2DPDA 3D0SA 5E3KA 4U88A 1RV3A 4LK1F 4KN7X 2HOEA 3L09A 3EUHA 2L3DA 3TFUA 4WD2A 3FDBA 1S08A 2Z5UA 4HF0A 3HOTA 2XAJA 2M87A 4ZM3A 5FB2A 4JBAA 3KCCA 3LFKA 3PA9A 2H27A 1GC2A 1ZGAA 5BQTA 1YG2A 4Y17A 3RCHA 4HX7A 1D7SA 2PLYA 3N75A 3PQJA 1HW2A 3W1HA 4ZWVA 2DU9A 1KKPA 2PEXA 2Z61A 5D4SA 4M2KA 3AEPA 1MDZA 2LKPA 3QU3A 1X0MA 2EH6A 5HDKA 3ZN0A 1S0AA 2E7WA 2BEOA 3HMUA 3ELKA 2E7XA 5D5WB 1PDNC 4XLNF 4G7OF 2R5CB 3GF2A 3TDUC 2EV6A 5C6UA 1CJ0A 2FOKA 3ISLA 2HKOA 1AOYA 5L3GA 2O3FA 1LVAA 3VB2A 4R1HA 4LLNA 3FQ8A 3F6TA 1FP1D 3VK3A 3WKRA 2E54A 3F72A 3N5MA 2W25A 2FRHA 1AMQA 1MAQA 4YIIA 1REPC 1Z6RA 4KFCA 2W85A 3CQ6A 1QO0D 5LLQA 3AEJA 4L5IA 1OR7A 3WTSC 4HDVA 1X3UA 4LNLA 5ILVA 3BWGA 2GQQA 3I0TA 1HKQA 3N0LA 1M0QA 1O69A 4XRFA 3COGA 4M2JA 3SQNA 3MAFA 1IRGA 5CJ9A 1B6AA 2RVCA 2GSAA 4XJMA 5DV5A 4H51A 4BMKA 3WCOA 2DQRA 1N31A 1LDDA 2XKOA 3Q5FA 1JF9A 3PDBB 2W84A 4ZSYA 1IF1A 4A0HA 1R58A 3DFGA 3FFRA 3FZ8A 1M4NA 2TPLA 1JG8A 2WV0A 3L7WA 3HTSB 5D5SA 4AH3A 2XIGA 3GXOA 5HLHA 4WXBA 4AOAA 4IRGA 2VMQA 2WK9A 3E5QA 2VGSA 1OHYA 4F5LA 1JS3A 1QITA 1YQAA 1TOEA 1NHAA 1WYVB 4O3MA 3FKDA 1G3YA 3KP7A 3QRFF 1ARTA 4DQ2A 1KU2A 2YPRA 1W7LA 3BB8A 2QMAA 2EA4A 3C7JA 4IHSA 5DJ1A 5K8BA 1R1VA 2H6BA 3REOA 4M74A 3WGGA 1BJWA 5M4BA 2O8XA 4HW0A 1S07A 1IXCA 2ZC0A 2E7JA 2D2WA 5F6FA 3ZRRA 3HYIA 2GMUA 2XROA 2WK8A 1Z6TA 4M6XA 4BH9A 4RITA 5DDGA 1HXDA 2IJLA 4N9HA 3FXRA 5EIGA 2CTZA 1UU0A 1YJSA 5L3FA 1DUXC 3K69A 4A6UA 3JAMK 2CANA 2PJPA 1XSXA 3EUCA 4ZDLA 4PVFA 5HVQC 2NNNA 3MQ0A 5EUNA 1XGMA 1DFOA 4YFKF 1I48A 1DGEA 3R9AA 5CVIA 3W6JB 1K79A 4M9XA 3RBLA 4P55A 1HBXG 4HQMA 1BN5A 1BC8C 4UOYA 2ZSLA 2GQNA 3RTRA 1W5TA 2BBYA 2HZTA 2HFHA 1R1TA 1C7NA 4A6TA 5ILUA 1BJAA 2YX4A 1X2AA 1AY8A 1I41A 5DCMB 2R5EA 1T3IA 3DU4A 1USTA 2KKOA 2DK8A 3LA7A 5E4ZA 1OXPA 2LF7A 2GXBA 2FNIA 1BJOA 3ECOA 3M5UA 4XEWA 4IF4A 5K5QA 4OTLA 4RS8A 3KZYA 2FNUA 3AOVA 1TOKA 4ITGA 3FWEA 5LEKA 5D95A 4AZJA 1ZAOA 2M1BA 3RBFA 2IPQX 2AY4A 3FQAA 3DXJF 2V1UA 1W7PB 4CXRA 4KIGA 2KIUA 1G3WA 1XD7A 2DLLA 2BWNA 3K0LA 3NRVA 5HHYA 3ULQB 4RJYA 1DJ9A 2HYFA 4IVNA 4KA4A 1TBXA 4WXDA 3LQQA 5FD5A 3BPXA 3QHXA 4L9JA 1SMTA 1CS1A 3ASAA 1WYUB 4LD5A 1ZYRF 2D65A 4KXKA 5LGUA 2YU3A 5JR3A 5HLIA 2X5FA 4LFUA 4HF2A 3FZ6A 2VMWA 4IRIA 2VMYA 4H0EA 1LEAA 1UKJA 4LW2A 2F5EA 1XSDA 4RGSA 4ADCA 5CVUA 1TNTA 3JWBA 2C7TA 5DUIA 2CQKA 4IYOB 2O03A 3E3VA 2BIEA 2Q7WA 4EGYA 3H3UA 1SD4A 5BJ3A 1JHHA 1CL1A 4CO8A 1LW5A 4A00A 3CJNA 1ASMA 2Z1ZA 4EB7A 2HTJA 2R2NA 3SFZA 2QM3A 4IXSA 4ESFA 2A5YB 4UNOA 3B1EA 3LA3A 5G2PA 5D8LB 1OPCA 2VMOA 4RGRA 3EIBA 2ZNZA 4BA5A 3ZP5A 3OP7A 4B8XA 4OMYA 4MQQA 3MC6A 3T8RA 1R5HA 2EGYA 2MD5A 1ZG3A 1E17A 1JE8A 2RQPA 4U2HA 1UHMA 3FSLA 2DGMA 1YTYA 2D7ZA 1MKMA 3PGYA 4G7HF 1W23A 1S6LA 2A69F 3HIFA 3KETA 5KVRA 1DP7P 1OATA 2AATA 2ELHA 1AHGA 1DJUA 2VMPA 1B59A 4YFXF 4ZWMA 2FSWA 2B0LA 3VFZA 1YFHA 1CL2A 1SZKA 1IAXA 3WY7A 3PJ0A 5DJ9A 2BGCA 1YW7A 4Q31A 2PMUA 1SAXA 2FQ3A 3GFLA 3E9KA 2ISYA 1EH6A 1AMSA 4WYAA 1P4XA 2PBIA 1FC4A 2IA2A 1J04A 4BXUA 3Q9SA 1O3SA 1LC7A 4R79A 4UV9A 1DPUA 1S06A 2GZWA 1TARA 1USSA 2DO7A 4GSAA 2QBYA 3KE3A 4N0WA 1IN4A 2BI2A 3GSBA 4LMYA 4IY7A 1AMRA 2EFWA 1TQIA 1X29A 3KKIA 1FY7A 5J8CA 4Q76A 1RUNA 3KLNA 5K5RA 1V2FA 3GEZA 2OQRA 3BWNA 1I43A 1MJBA 3FFHA 3DODA 3QPGA 2D1HA 4LB6B 3HTUA 5E1WA 5LHGA 3H3ZA 2ESNA 3OKSA 2K27A 2CSTA 3MKJA 1UCRA 2CSOA 1G4VA 2QZ8A 4JEXA 3E6GA 3AAFA 2MC3A 2BIAA 2CYYA 4HX8A 1FG7A 2VN2A 2ZJ2A 4R8HA 2Q0OA 3WU0A 1LC5A 1FBQA 3NUIA 1C0WA 3FXUA 4MQ9F 1AKBA 2ISZA 1OXOA 1T2KA 4F5JA 1ZLKA 4MEYF 2YKVA 4HX4A 4EJUA 3K9TA 2NMPA 1QQIA 2BI5A 3L00A 1M0OA 3PD6B 1B1BA 3NEUA 3VK2A 2MH2A 1T6SA 3MZYA 3GYHX 2PN6A 1STZA 5CLSA 2A61A 4E70A 3LWSA 3JSOA 3O2PE 3KEQA 3L9FA 2NS0A 2Z9OA 2W8WA 2YKUA 5EFSA 4W91A 5FFZA 2G6WA 2GAUA 3E97A 4F5MA 1SZUA 1ZG5A 3BROA 1GEYA 1CQ8A 2GB3A 2IW5A 3R6SA 1D8JA 3T0YA 3EETA 1L0OC 4BHBA 4ADBA 5TJJA 1BS0A 2JSCA 1J9IA 2VC0A 4ZYEA 2ZBKA 5AIQA 4L9TA 3GUDA 2P6TA 2V79A 3F8CA 4PFNA 1IN6A 3LQRA 3TO9A 1KL2A 3PFIA 2VMVA 3BWNC 1GC3A 4WF2A 3WGCA 3LAPA 1ZREA 4E1OA 2H94A 3ZZJA 2ETHA 3EQLF 2VGUA 1Z9CA 3W1IA 4HZFA 4A0ZA 2VODA 2W7HA 5FT6A 1SFFA 1ELUA 3SXYA 3TQXA 3JAMZ 1QGNA 3AENA 4RAYA 2BIGA 3CDHA 1OMIA 2OKKA 2ADUA 3WGBA 4UV8A 4WYCA 4A6RA 2STTA 4I09A 3F6OA 4S05A 2EWNA 5LHHA 2O0RA 2PG4A 4CICA 1AKAA 3KGXA 5CVVA 2VIAA 3B1CA 3G7QA 1W7NA 1TTYA 4U0YA 1Z7UA 3DXWA 5H20A 1W7MA 2FXAA 1KGSA 1AHYA 3K1MA 1MLYA 3HSFA 3R60A 1YIYA 4WLHA 4FHTA 3WG9A 2L4AA 4N0BA 4ATQA 1ZOBA 1TPLA 2G7HA 2EFOA 1M32A 1XDUA 2W7IA 1UU2A 1HKTA 2C81A 4Q48A 3FMRA 1YW8A 2XAHA 1C7GA 3HHGA 2DKBA 4PGHA 9AATA 2ORDA 2HYGD 5JHUA 3WZFA 1BJNA 3NYTA 2OGAA 1FZPB 1SPAA 1YLFA 2QYOA 1MGTA 1SD7A 2DTRA 1AX4A 1SZSA 1XDSA 2VGTA 4TN4A 3BJAA 2VXZA 2BHXA 2D7YA 3TKYA 4PGGA 3IRQA 1WSUA 2W7FA 4W1XA 3GWZA 2BWPA 3VODA 2YCTA 1AKCA 3WTWC 1LB2A 3LVKA 1U08A 1ZN2A 2K4BA 4A5MA 4IXZA 4EVIA 1FT9A 2JJGA 4A0GA 1FBUA 4Q75A 1JS6A 4WYEA 1LK9A 1RI7A 4PCQA 3MWMA 2HWVA 4W1WA 1MJ9A 1QISA 4XJPA 3D5LA 2QB2A 5EAVA 4U0VA 1ZHFA 1PFFA 1YIOA 2W7EA 4UUVA 2R7FA 4M71A 1FOKA 3HRTA 5F8VA 5LEJA 1H0CA 1X28A 5ICCA 3QP6A 4AIJA 5LBQA 2HOYA 2XKPA 1RVYA 1SVVA 2EFQA 3VP6A 3I5TA 3JTXA 1WKMA 4ETSA 1KQ0A 1MDMA 5BJ4A 1G3SA 1KL1A 1S29A 1SD5A 2VLHA 1D5VA 4ATPA 2EPJA 5D5UB 2BE5F 1M0PA 1IX7A 1K78A 4P96A 5A2QK 2QB3A 3ERED 3ZMDA 4K2EA 4MY5A 2RNJA 5DCFA 3B02A 1Z1DA 4YFNF 3R0AA 4U1TA 1K7AA 5E1ZB 2R0TA 2EV0A 2UWMA 1IUYA 3VOEA 1ZRFA 3E5UA 3E2YA 1P4AA 2AEVA 2VT2A 1DPRA 3N4MA 2M45A 1ASNA 4QLCU 1XMAA 2ZFWA 2IT0A 3IF2A 3KP4A 1P3WA 2XBNA 1LS3A 5EUEA 3SZTA 4ZAHA 3E2FA 2ZMEB 2K02A 4HOBA 1SFEA 4QGRA 1BI3A 5D8KB 1I29A 3KP6A 4OC9A 3I71A 3JZLA 2QENA 4EGZA 5F9SA 1BOAA 4UQVA 3LV2A 1O7FA 4M6YA 1IZ1A 1B4XA 3L44A 4MGRA 1KMJA 3P9KA 4HAMA 2Q2EA 4XBFA 2RC4A 2DGLA 3P6KA 3AEJC 4A6DA 4KIBA 2STWA 2VMSA 3U1DA 3HRMA 2XAQA 2HGCA 2AY6A 1KU9A 5FT8A 1ASDA 4WB0A 5HS9A 1ASBA 4WXFA 1Q1HA 1ASCA 1W7PD 2FQ6A 4RAZA 3O6BB 4A6EA 1YO5C 3P9CA 5IT9K 2HUIA 1RUOA 5DD8A 3FVSA 4UVAA 4EM2A 1TASA 2W24A 1IW7F 2Z67A 1ZG1A 2A6EF 5HDGA 1Y0UA 3ZMZA 1KU7A 5FO5A 5HDNA 3FD0A 1BQAA 2EA2A 4XJOA 2W8VA 1IX8A 4K2BA 5KK1A 3KEOA 1XB4A 2VMRA 2HEOA 3WE3A 1PG8A 1EG5A 4LK0F 2FN6A 5E17F 2RDPA 3BZ6A 3F23A 1T38A 1Z7DA 4ADEA 1RNLA 3ASBA 3F8NA 3JW9A 2JJFA 1D7RA 1IXSB 5L3CA 8AATA 3IC7A 2L02A 2FMLA 2PB0A 3LA2A 4M9ZA 4OIRF 4XAUA 4AVPA 3KP2A 3KP3A 4A0XA 2LSOA 4Q4ZF 1G4XA 3EI5A 4PFFA 1DKAA 2AS5F 4BHDA 1R36A 3K40A 4LNMA 1SFUA 4QWQA 4RJ0A 1IXRC 2D61A 1U5TB 1AAWA 5CVRA 3JTHA 2MH9A 5DX5A 2LF8A 3BS8A 5IT3A 5K5OA 1HSTA 1FYMA 4EJWA 1A04A 4WWCA 3P1TA 1GC4A 3R0JA 2NYXA 2HP2A 4GEBA 3A9XA 4HA8A 3I59B 4KIFA 1TOJA 3GETA 1I6XA 2WC2A 1BIAA 4KUMA 4AD9A 1U78A 4G6QA 3I59A 5DYMA 4Y13A 2IA0A 2CH2A 3T8TA 1KU3A 4P9UA 2YOBA 2OZUA 2ZJGA 2XH1A 1B5OA 4TV7A 4E3QA 5J8QA 4GCVA 3TDZC 1ASLA 4F5KA 4A12A 5HLGA 1PP7U 2A07F 4BHPA 2ZKZA 3QGUA 3PAAA 3AV7A 1U5TA 5FFXA 4MSOA 2Z99A 5G09A 1O61A 1I27A 2VBZA 1OHWA 4RM1A 1RV4A 3A9YA 1AMAA 4ZDPA 2ZNYA 1KMKA 1R1UA 2EFNA 5HS7A 4UHNA 2JPCA 2J5OA 2Y0MA 4R5ZA 5M4DA 1GCKA 4U7DA 2VT3A 2MA3A 3BCXA 4HYEA 2D63A 2HOZA 2X3LA 1F9NA 4EM1A 3IKVA 4OOIA 5LRSA 4A72A 2V1DA 1S3JA 2HTSA 1FG3A 4W1VA 3V8JA 3OOPA 1VJOA 1XGOA 2P5VA 5G4IA 1R22A 3TQNA 2F5DA 4ITXA 4WK8F 1CQ6A 3G0TA 4HDUA 3J81Z 1WYTB 4Y0DA 1C4KA 1I1GA 1H9GA 4UVCA 1H0MA 3ELPA 2F5CA 5ICGA 3T5XA 3GZCA 1AHXA 2JISA 4OINF 4IRHA 4EJVA 1XI9A 3IHUA 2V1XA 2MLGA 1XEYA 3GLXA 1W3UA 5D6FA 1HQCA 2JJHA 5EAAA 4I02A 2XV4S 1QZZA 1O3QA 3KLOA 2Z20A 1ON2A 3KP5A 2FBHA 2BI1A 4WX9A 3JTGA 1J59A 3HHHA 5FLXK 1P4WA 2QVOA 4UXNA 2E7IA 4JE5A 2FYFA 2EZ1A 1XGSA 4A2UA 4RB2C 3RUYA 2RGVA 1EH8A 3EYIA 3EI7A 5LRRA 4IXOA 2CG4A 4EMYA 3IKTA 2EK5A 1OYWA 4M73A 2D45A 1KKJA 1KQ8A 2W7GA 4WYFA 1B9NA 3CTAA 5TF5A 3BDDA 1CZEA 2CINA 2EB7A 3ISPA 1WQ2A 4CYDA 5FLXZ 4FFCA 1GD9A 2BI3A 3LAJA 4FX0A 4TMRA 2YCPA 3I4JA 3GZDA 2DW4A 4WCGA 4I0BA 4I98B 2BWOA 1CF7A 1UB9A 2L01A 3AELA 3V4GA 3PIUA 3FF5A 3F6VA 1OHVA 3DR7A 3BJOA 2W8UA 3TOAA 3RKYA 4G6DA 5DUKA 1UU1A 4AZKA 1LDJA 4A0FA 3B73A 3HOSA 3J81K 3ZRPA 2A68F 2D64A 1BJOB 3AEMC 4IHTA 2P5KA 2PMHA 4NOGA 2BYLA 1L3LA 2L4MA 3F8MA 3NU8A 1G4DA 3QBOA 3HDOA 3NDNA 5ED4A 5H6RA 3VK4A 4RB0A 4G94A 1XCVA 3LVMA 3ZN1A 1ORDA 4W8IA 2GA2A 3UWCA 4IPAA 5AONA 1AY4A 1ZRCA 3I53A 3IWZA 4CZZA 3LVLB 1IN8A 2WWYA 3LWFA 2BYJA 3G3ZA 3WTZA 3SZPA 1ULYA 4O6ZA 2EJRA 2ZXJA 2W57A 1ASFA 2HP1A 4OIOF 4W5KA 3MAUA 1R00A 3BJ6A 4M9SA 1BI1A 2VONA 3KFWX 3ABUA 2O1BA 1UFMA 4OMAA 3M8EA 3A9ZA 3DQVC 4OCAA 3NRAA 2CW0F 3HBXA 3SHFA 1CGPA 2KIFA 2FBIA 2VLFA 1IUGA 3RIRA 5EIGB 4L0YB 3DC1A 1H1CA 5G4JA 1BQDA 1B9HA 2X5DA 1ASEA 4OIPF 5H6QA 1P6RA 3GWPA 3ZZKA 4GYGA 4CXQA 3FZ7A 2V9VA 2IRFG 2XHKA 2P7CB 3EI8A 2OD5A 3CQ5A 1TW3A 2UXNA 2JG2A 1VTNC 1PP8F 2HQNA 1ARHA 4KYOA 3NQOA 1ASGA 3KGWA 5D6EA 3R61A 2YRIA 1F5TA 4G8XA 1N2TA 4OYTA 5JFRA 4DQ6A 1BC7C 3JWAA 2JTVA 2Z3YA 1GHCA 2CH1A 3AATA 3G73A 2HS5A 2PQ8A 3DPTA 3IRRA 1V72A 1KA8A 3TATA 3QPTA 1V4RA 2CWEA 1JGSA 1IBJA 2CJGA 1MLZA 3I64A 3F8FA 1QNTA 2FNPA 4N9IA 2P7VB 3QAHA 2MBFA 5E8GA 3BWOA 1Z3ZA 4WP0A 1XN7A 4M72A 4BQAA 1SMYF 1G7XA 2HQRA 5G2QA 4WBTA 4ZASA 1DTYA 5J8FA 3VAXA 5DEQA 1D8KA 3RI6A 4EFFA 4R5FA 3RPUA 1AIBA 2VE9A 1MDMB 4Y0HA 5LHIA 2FMYA 3HQTA 3K1NA 3ZQ7A 4S04A 3PDBA 1TATA 1W5SA 3E6DA 4EJTA 1BT4A 2H6CA 3H7FA 1F1ZA 3WU1B 3RKXA 4ZM4A 1MJAA 4NB5A 1GEWA 1U6GA 1D7VA 4MTEA 3RKWA 2P6SA 5IT9Z 4JQFA 3MAFB 3FX3A 1WSTA 2D1VA 2C44A 3BY6A 2A6HF 2F5FA 4KN4X 3PDXA 3E6BA 2DKJA 1E5EA 1RVUA 1LDKB 2KIMA 1QGPA 2OAZA 3QM2A 2QA3A 5A2QZ 4GE7A 1AHFA 4HV6A 1IX6A 2IVMA 2QBTA 4RKCA 4MHGA 2AXLA 1AWCA 2Y48A 5J6XA 2VOPA 1R5GA 1YS6A 2M8EA 5TRDA 4ZLVA 4J5UA 4OBVA 2FBKA 3ML6A 5D4RA 2CB1A 2VGZA 1S8NA 1WKGA 5I92A 2CFBA 4WLJA 2Z1YA 2PO3A 5D5XB 4MQVA 5JAYA 7AATA 1LJ9A 3EZSA 1QJ3A 2VI9A 2VBXA 3QOPA 4EU1A 3TOBA 5CVJA 1T39A 5E8IA 1WWXA 1DDNA 3WTXC 4FL0A 3HSRA 2GIVA 3E6MA 4JF0A 3FMSA 2CO5A 1CF7B 2VMZA 3QI6A 2C6YA 3WODF 2C0RA 5HDMA 3HUGA 2OBPA 4UHMA 4BHCA 1EJIA 1KQ9A 1BI0A 3C3WA 1MGVA 4JEWA 1LEBA 3MEXA 1WRJA 3MBBA 4MQRA 4Z2YA 2W7LA 2YHKA 2VMNA 2DBBA 1LC8A 2ZCWA 2M5WA 1E5FA 4EQQA 3OV8A 4F5FA 5HS8A 5DB5A 3WCNA 2QQAA 4Q5SF 2F2EA 1MDOA 1YJZA 4RB3C 1FP2A 1D2FA 1B4AA 4AIKA 2OKJA 3U2RA 3GZDC 3E5XA 2V0YA 1V2DA 3ZRQA 3I5UA 4ON0A 3L2CA 4XJLA 4LLLA 2PB2A 3RI4A 1QBJA 5K1YA 2NRAC 2L54A 4MKKA 2GA1A 3HRSA 1QPMA 3CUQC 1WI9A 4ZZDA 2YKXA 3RDIA 1C9CA 3HSEA 2VGVA 2YCNA 2MLKA 1R7JA 3BCBA 3II0A 4O5VA 1W4MA 3MEBA 4PIWA 2G9WA 1AAMA 4KNYA 2CFXA 1G7WA 3C1DA 4ESJA 2W8JA 3TO7A 4BAYA 4IJAA 4EB5A 5ILSA 4BNCA 1G3TA 1AJSB 2W7KA 1ONVA 3V7CA 2QLZA 4AO4A 2O61A 1MD0A 2W7JA 4BYYA 4U7BA 3J7AO 1WYTA 3JU7A 1F4KA 1YOOA 3O3KA 2OA4A 4ZYDA 5M49A 2P8TA 1YAAA 1M7YA 1OYIA 2O0YA 5FD6A 2VMXA 4B98A 1O7LA 4LW4A 3MFKA 2WTEA 3I58A 1S09A 1D3YA 1TNSA 2DGKA 3BOQA 2XAFA 4ENKA 2DPUA 2V1PA 3L8AA 3P9IA 5LHAA 1ARSA 1KYWA 3K2ZA 1ZLJA 3ZMSA 5L3EA 4ENNA 3AOWA 3FMQA 1QJ5A 4YG2F 1ZARA 3NYSA 1R23A 3K7YA 2EFPA 2VE8A 4IYOA 3HL2A 2FEZA 3EIAA 3H14A 5E20A 3GR9A 1ARGA 2XVCA 2HUFA 3ROUA 3V7RA 4B9BA 3HT4A 1FPQA 3U9GA 1V3FA 5FGMA 2JJEA 1HW1A 2ACJA 1TLHB 4L18B 4P9FA 4OIQF 3GZ5A 4YIFA 3ECHA 3TCMA 1FX7A 1ZH5A 4FT8A 3DKWA 2K4JA 2W7MA 3ELEA 1ELQA 3CLOA 2EV5A 2VBYA 5FT5A 3MCZA 2AY5A 2P5LC 2CY8A 1IN7A 2Q8KA 3MADA 2YSRA 4DGTA 3G8MA 3KZZA 1WYUA 1D7UA 2HOXA 3FCRA 4OU0A 2YR2A 2LNBA 1KYZA 2NAZA 1C7OA 2Z9XA 2GWRA 2E1CA 1HSJA 2BKWA 1Z91A 2YX7A 3ZMTA 2A3SA 3FXQA 1TW2A 3NYUA 2OATA 3WLXA 4ENJA 3K28A 2AY7A 3E6CC 3RYPA 3PQKA 4I01A 1YIZA 2JGTA 4B09A 3DPLC 1MDXA 4EMSA 3CBFA 5LGTA 4F7ZA 4CXFA 4HLYA 3FRKA 4GXOA 3M7GA 2KRFA 2QQBA 3CUOA 1Z05A 1AHEA 3P7NA 3QP5A 3R4TA 4F5IA 3M8FA 3VOMA 3NX3A 3B8XA 1YS7A 3V7SA 3USFA 4XLPF 5BMZA 4CGZA 3GVAA 1M0NA 4PZJA 5DCMA 3RYRA 2FU4A 4DBCA 3M9AA 4P7YA 3W1JA 4WXHA 1SF2A 1FC3A 4JE5D 2X0LA 3W6KB 1FLIA 3I4PA 1U2WA 3WTUC 1XCBA 1ZGJA 3DF8A 2RV8A 4JK1X 4XK1A 2D66A 3Q8NA 2JT1A 2HDCA 5HXXA 2AY8A 2UZKA 3F8BA 3FM5A 2O7CA 3LG0A 5ICEA 3FTBA 4E3RA 3FZVA 1JXSA 2Z9UA 2VI8A 1UHWA 4CDGA 4LG0A 1I1SA 4G9YA 1LQ1A 1YJYA 4CBSA 2JZYA 1I5ZA 2DAOA 2G7UA 3JW4A 4OBUA 4WB0B 3UE8A 2HUUA 3I54A 3WE2A 3F22A 3AEOA 2Z9VA 1BBYA 1S7OA 5JI6A 1XGNA 4Y0IA 4LNJA 2Z33A 3DRDA 4GRXA 1FYLA 3I16A 2JPBA 3MAJA 3BCAA 4WXCA 4MQPA 3WGIA 5LH9A 2X8UA 2XUBA 2XAGA 3UAKA 3F3XA 1OKRA 4F5GA 2WKAA 3FM3A 3S2WA 3WX9A 1B5PA 2VYCA 1G6NA 4ZDOA 3DXVA 1TQMA 4GE9A 4RAEA 4A0YA 1ZRDA 3FVUA 2BYVE 2ZMEA 1MZBA 4MEXF 1SFXA 1XMKA 2OZ6A 4OMZA 3IHJA 2X4HA 1IAWA 3BC8A 3E2ZB 4ESBA 2VIBA 5EEHA 4RB1A 1RZ4A 2D5YA 1W7PA 4L9NA 3GW2A 1VEFA 2RFVA 4R8DA 3WTYC 2V6CA 3CUQA 1ECXA 2IP2A 4JF1A 4KICA 1EQBA 5AIPA 2EO5A 3BV0A 2VBWA 4GGGA 1E2XA 4LJZF 5ERIA 4HF1A 5ICFA 2O6GE 2ZYJA 1FWZA 1O3TA 1K78B 1PUEE 4L5JA 5EEGA 1YNUA 4IX8A 2XASA 4R2NA 1LW4A 2EZ2A 4ZYGA 3DEUA 5F64A 1MAPA 2WK7A 2W7DA 3ZPLA 1J75A 4GYIA 2E7UA 1B8GA 1DJEA 4RKDA 2FF4A 2VMUA 1BM9A 3M1EA 4K2IA 2QQ9A 1BJ4A 5EUDA 1TOGA 3EZ1A 2OQGA 3HVYA 4KAMA 3RJPA 2RN7A 1QIRA 3MZHA 1J7KA 4I0AA 3V8KA 5BS6A 3DV8A 1C0NA 3ABTA 3CUQB 1EV7A 1M6SA 4HLXA 1BW0A 4A0RA 1YYVA 3CQ4A 2AY3A 3E2ZA 6PAXA 1EH7A 3BPVA 3DZZA 1PMOA 4I2OA 2E1NA 3C18A 1LNWA 2CJDA 3QN6A 4LB5A 3ZMVA 1IVRA 5M46A 1FSHA 4GE4A 2QWWA 2FM1A 4XQ2A 1JHFA 1T0FA 1GXPA 5IWQA 3T1BA 3EI6A 2CJHA 4PDKA 1S7AA 2K7LA 3LSTA 5E1XA 1FBSA 2HR3A 2ZUKA 3H92A 3LVJA 1SD6A 3DYDA 3R4KA 2F8JA 3KE2A 4RGXA 4LC3A 1RIOH 3GZ6A 2FE3A 4Q47A 4Y15A 2YRRA 4LG0B 4ZZLA 4EM0B 5DD4A 3WKSA 2GXGA 1O3RA 4OT8A 3GFMA 1T98A 4ISYA
chains in the Genus database with same CATH superfamily
4UHOA 1OCTC 3JSPA 4ITVA 1CZCA 1WYVA 4AO9A 3LY1A 1UZCA 1LE8B 3N97A 3GX4X 3PPLA 3WTTC 2WAEA 5BOXA 1PUFB 3AEMA 3TFTA 2AY1A 4L9VA 3J80K 1TQPA 3BG6A 1HW5A 1ZODA 1QZYA 1T08B 1QHHD 4XKVA 1AICA 1HDDC 1X3ZB 2QKLB 3QYFA 1AJRA 1GVJA 1MBJA 1ZC9A 3F21A 3HKZA 4LITA 3OYCA 4JEVA 3QU6A 4WXGA 1B9IA 3DP7A 3VYTB 1G2HA 2FA5A 1D0XA 1XSVA 1W0TA 4EJOA 4NQWB 1DGDA 1YE9A 4M2MA 2KFDA 3EDPA 2J5PA 1BI2A 2H09A 4G7ZF 2K9QA 3A1YA 3CO6C 3K1PA 1AY5A 3IWFA 5B66C 2Y75A 4QPQA 4CYCB 3BN1A 1WCMJ 3V8LA 5FKOA 3AENB 2DQLA 2XGEA 1VP4A 2QLRA 4HVKA 2ECCA 4PJJA 1O57A 2K86A 2BW3A 2KDZA 2DI3A 4UVBA 4FX4A 1ARIA 2QUFA 1O62A 4KYWA 3ZMUA 3WGHA 3WTVC 3OL4A 4J00A 1P7IA 5G0AA 5HOOA 4E77A 4UHTA 1QHGA 1WKHA 2JRTA 3ACZA 1OYYA 2HVQA 3RQ1A 1X19A 4A5NA 1U3EM 2A6TA 2IGOA 2AQEA 3IH2A 2ZSMA 3GFIA 3GJUA 4KT5C 1WJEA 4JEYA 1K6OA 3CJTB 1ASAA 4GO1A 2HORA 4BS9A 3B6AA 3H0DA 3FVXA 3EYYA 4C3JJ 4HNUA 4I7HA 2XDVA 3BR3A 2IA1A 2ELKA 4XSXF 4DNCA 4LLGF 3DKYA 2CGPA 3ECDA 1XS9A 2CQXA 4RGUA 5EDNA 2NNYA 2HZPA 1M1EB 3Q9VA 4U0WA 4XSZF 3COAC 4HSTA 1QZ9A 4J8LA 1V5EA 1D0ZA 3JRIA 2R5CA 4HF8A 4O6JA 3QPHA 4L0ZB 3GFJA 3HBLA 1T95A 2AY9A 3PD6A 4FTHA 5BPDA 2R3SA 2A05A 3LNQA 4K2MA 2FNAA 1WH5A 4IW7A 2BV6A 1J0RA 4BL0B 5AX8A 4RAFA 1BR1A 2V4JC 3KYDB 3QQAA 4ZTFA 2IBDA 2P4WA 4XKCA 4B3XA 1ODDA 1CQ7A 2RKHA 3A2BA 3HPGA 2V9PA 3E77A 1IJIA 3K70C 1Q1VA 3RSNA 2XGXA 3J7YJ 1JJ8C 2TDXA 1GEXA 5E18F 1Y4IA 1F36A 1VF9A 1BA5A 1NG7A 3RCHB 2KJCA 1FNNA 4XN0A 2DOUA 3A01B 2COMA 1E3HA 1P92A 3BP8A 5JVTA 1VQ7I 3CAIA 2DFIA 3B46A 4RLGA 4L0OA 3NUBA 3NNKA 4ASNA 4LGWA 4LIVA 4Q6RA 2R7TA 4HV5A 4MNUA 3CP8A 1J5YA 1O4SA 5E5IA 2ESHA 3T32A 1B9MA 2XRNA 1HKSA 1IN5A 2R4GA 4PJLA 3F0HA 2VC1A 5LGNA 4KDPA 4WYDA 1BKGA 3FXLA 4DZJA 1Y39A 4EV0A 1V2EA 2WB1A 2DK5A 4N4NB 1QA6A 3HRUA 1N75A 4D0PA 4NHJA 5TGTA 4ZSWA 5G4IA 2RAEA 1GC0A 2VGWA 1MMGA 4AWXB 3S2DJ 3TO6A 3DR4A 5FT4A 2DT5A 4CBRA 2WAFA 2YKYA 3L2RA 1I39A 5L3BA 4P5OA 2AY2A 1GXQA 2PX9A 3HC7A 3ZCOA 1VQMI 1U5TC 2XPVA 2QBYB 3EI9A 5F1RA 5CYVA 2LDUA 2ZO4A 3MC6C 1N8PA 4P3MA 3VPRA 3CO7C 4CVQA 3NTJA 4KMUX 1LKCA 2KMUA 2E1OA 4XORA 4ZC3A 5L3DA 3PNYA 3FQ7A 4UUSB 2BI9A 2OQXA 3J80Z 1ON1A 2IGNA 5D5VB 1AJSA 3NU7A 3GO5A 2KDOA 2OGEA 3F9TA 4JEZA 1NK3P 4I8AA 3K4NA 2HKXA 2TRTA 3GBXA 4ENMA 2HU9A 1FSEA 4RLQA 3G6EI 2XGCA 3JCUC 3I9V2 2M0CA 4RMNA 2EZKA 1ZR4A 4DIQA 1U8RA 1AU7A 3A8UX 1YW9A 2UXXA 4ZYHA 1IAYA 4F5HA 3A03A 4AIHA 1NTCA 5FJ8J 5GAHJ 4CHUA 1LUJB 5E3LA 2OU2A 4ADDA 1AIAA 4RIZA 4MKJA 5EZGA 1JUPA 3AG1H 2KJBA 1XX5A 3D6KA 4WYGA 3VEPA 1UELB 2GMSA 1RR7A 2VOOA 5EQCA 2W8TA 1H9TA 2R7DA 1JT0A 4M3DA 4E7HA 1CQTA 1GBNA 4IXAA 3FHZA 4MTDA 3ATHA 1IRFA 3CC4I 2AEUA 1BIBA 4AU7A 2GOXB 2VMTA 2VKDA 3IL2A 1J32A 4GDYA 4BA4A 1LKXA 3TGNA 4HBLA 2M30A 4BACA 2O5RA 3G1LA 2PI0A 5BPIA 1FYKA 1JKRC 4ZH4F 3DBLB 2Z9WA 1TOIA 1PMMA 4CYCA 3RPQA 1J2XA 3H36A 3B1DA 4F4EA 3HLMA 1MNEA 4BQ0A 1P2FA 2JA6J 2DR1A 2CJJA 4NQWA 2PFBA 2ZP7A 4HQEA 4KMFA 1GDEA 2DPDA 3D0SA 5E3KA 4U88A 1RV3A 1FJLA 4LK1F 3D5SC 3QPSA 4KN7X 3OSFA 2HPMA 2R5ZB 2HOEA 3L09A 3EUHA 2L3DA 3VYUB 5FRNA 3TFUA 4WD2A 3FDBA 1WJCA 3HUGB 3UR3C 3C2BA 2E35A 1S08A 2Z5UA 4HF0A 3HOTA 2XAJA 2M87A 2B63J 5FB2A 4ZM3A 1Z0XA 4JBAA 3KCCA 2VUMJ 1LE8A 3LFKA 1X58A 1JKPC 3PA9A 3A01A 2H27A 1GC2A 1ZGAA 5BQTA 2X6OA 1YG2A 2M0MA 4Y17A 1MMNA 3RCHA 4HX7A 1D7SA 1VQNI 2PLYA 2M8GX 3N75A 3PQJA 3TMOA 1HW2A 3W1HA 1K61A 5C3EJ 4ZWVA 3S1NJ 2DU9A 1KKPA 3ZQIA 2LREA 2PEXA 3W2VA 2Z61A 2VQHA 1IRXA 5D4SA 5B5EC 3AEPA 3G1OA 2LKPA 3QU3A 1MDZA 1X1DA 1X0MA 2EH6A 5HDKA 3ZN0A 1S0AA 4BQQA 2E7WA 2BEOA 3HMUA 3ELKA 2E7XA 3M1CA 2V26A 5D5WB 3OYDA 1PDNC 2KHMA 2KPMA 4XLNF 4G7OF 4IQ4A 2R5CB 3K4LA 3GF2A 3TDUC 2EV6A 1WZ2A 5C6UA 1X3WB 1CJ0A 4F55A 2FOKA 3ISLA 2HKOA 1AOYA 2YUSA 2O3FA 5L3GA 1LVAA 3VB2A 2R7VA 4R1HA 4A3DJ 1LFBA 2VB6A 4F91B 2NXNB 4LLNA 4D5CA 3FQ8A 2NVXJ 3F6TA 1FP1D 3VK3A 3WKRA 1ZQ3P 2E54A 3F72A 3N5MA 2W25A 3CF2A 1WVRA 2FRHA 4NC7A 1AMQA 3Q0VA 1MAQA 4YIIA 5GTHC 1REPC 4CCLA 1Z6RA 5FKLA 4KFCA 2W85A 3LSMA 3CQ6A 1PYVA 1QO0D 5LLQA 3AEJA 4L5IA 5JHFA 1OR7A 3WTSC 4HDVA 1X3UA 4LNLA 5ILVA 3BWGA 2GQQA 3I0TA 1HKQA 3N0LA 1M0QA 1IRZA 1O69A 4XRFA 3COGA 2H1LA 4M2JA 3SQNA 1VFCA 3MAFA 3HOWJ 1IRGA 2FJ1A 3HEFA 1B6AA 5CJ9A 4C3HJ 2RVCA 2GSAA 4XJMA 5DV5A 1YRNA 4H51A 2MGQA 4BMKA 4B44A 3WCOA 2DQRA 4NUBA 2VQCA 3HZJA 3PFYA 1N31A 1LDDA 2XKOA 2F6CA 3Q5FA 1JF9A 3PDBB 2W84A 4ZSYA 1IF1A 4A0HA 1R58A 4ZYAA 3DFGA 3FFRA 3FZ8A 1M4NA 2WA0A 2TPLA 2ZXWH 1YI2I 1JG8A 2WV0A 3L7WA 2LD5A 3HTSB 1ZKGA 1UAAA 2JQ7A 5D5SA 2OPTA 4KJZA 4AH3A 1TWCJ 3K2AA 3OIOA 3H35A 2XIGA 3RCOA 5EZHA 3GXOA 5HLHA 4WXBA 2LH9A 4AOAA 2L0KA 1F43A 4IRGA 2OCEA 2VMQA 2WK9A 3SDGA 2QF7A 1XG1A 2KL4A 3HOZJ 3E5QA 3OS0A 2VGSA 1TWFJ 1OHYA 3OMYA 4F5LA 3RZOJ 1JS3A 3LOCA 1QITA 1YQAA 2VKHA 1TOEA 1NHAA 1WYVB 4O3MA 1D1BA 3FKDA 1G3YA 3KP7A 3L2QA 3TEDA 3QRFF 1EF4A 4DQ2A 1ARTA 1KU2A 4S0HB 2ID6A 4L5EA 2YPRA 1W7LA 3BB8A 2QMAA 2EA4A 2BXYA 3C7JA 4IHSA 4XIDA 2MW8A 2W4SA 5DJ1A 5K8BA 3OR2C 4AYBA 1R1VA 2HDDA 2H6BA 3REOA 3SZGA 3ZGKA 1Z3XA 2LRDA 4M74A 3WGGA 2E60A 1WFXA 1BJWA 5M4BA 2DMUA 2O8XA 4HW0A 5DM7F 1S07A 3MVPA 1IXCA 2LC2A 2ZC0A 2JVHA 2E7JA 2D2WA 5F6FA 3HJEA 3O8GA 3HYIA 3ZRRA 2GMUA 2XROA 2WK8A 1Z6TA 1JUMA 1VZ0A 4M6XA 4B47A 4BH9A 4RITA 5DDGA 2BHYA 3FIWA 1HXDA 2IJLA 4A3LJ 4N9HA 3FXRA 5EIGA 5JLWA 3OL3A 2CTZA 1UU0A 1YJSA 5L3FA 3BLYA 1NH3A 1DUXC 3FHNA 3K69A 5C44J 4A6UA 5M5XJ 3JAMK 3GTPJ 2W7NA 2CANA 2PJPA 1XSXA 3EUCA 4ZDLA 4PVFA 5HVQC 2NNNA 3MQ0A 5EUNA 1XGMA 1DFOA 4YFKF 1I48A 1DGEA 3R9AA 5CVIA 3W6JB 1K79A 1OR7C 4M9XA 3RBLA 4P55A 1HBXG 2HOTA 4HQMA 1BN5A 2I8DA 2RNGA 2VPRA 1BC8C 4UOYA 2ZSLA 4BE2A 2GQNA 3RTRA 1W5TA 2DTZA 3FXKA 4FASD 4YELA 2PJRA 2BBYA 2ZC2A 4X1EA 2HZTA 2HFHA 1YJNI 1R1TA 1C7NA 4A6TA 2QEXI 3N05A 5ILUA 1BJAA 2YX4A 1X2AA 3H3VK 2F5VA 1AY8A 1LPQA 1I41A 5DCMB 2R5EA 3D1NI 1T3IA 3DU4A 1USTA 2KKOA 2DK8A 3LA7A 3LSIA 5E4ZA 1OXPA 2ZB9A 4II2A 2LF7A 2GXBA 2FNIA 1BJOA 3ECOA 3O8HA 3OIQA 3M5UA 1ENHA 4XEWA 1TWHJ 3LFUA 4IHWA 4IF4A 5K5QA 3OYAA 4OTLA 4RS8A 3KZYA 2FNUA 1B8IA 3AOVA 1TOKA 4ITGA 3FWEA 5KCMA 5LEKA 5D95A 4AZJA 1ZAOA 2M1BA 2PMZA 2IPQX 3RBFA 2AY4A 3FQAA 3DXJF 3PIOF 2V1UA 1W7PB 4CXRA 3CD6I 4KIGA 2KIUA 1G3WA 5GAEJ 1XD7A 2DLLA 4OAZA 2BWNA 3K0LA 3NRVA 5HHYA 1R9TJ 3OSGA 3ULQB 4RJYA 1DJ9A 2HYFA 4HSRA 4IVNA 4KA4A 1TBXA 3G2BA 4WXDA 3LQQA 5FD5A 4KT6A 1YX3A 5B1AH 3BPXA 1GT0C 2DOFA 3QHXA 3I4NJ 4RM2A 4CCJA 1KZHA 4L9JA 1SMTA 1CS1A 1VI0A 3ASAA 3MKZA 4LD5A 1WYUB 1ZYRF 1B72B 2D65A 4DYQA 4HRIA 1ZR2A 4DGWB 4KXKA 5LGUA 1EJ9A 2YU3A 5JR3A 5FLVA 3S17J 2KZGA 5HLIA 2JA8J 2X5FA 2KRCA 4LFUA 4BBRJ 4HF2A 3FZ6A 5DS9A 1MBHA 2PMZN 4MFDA 2VMWA 4IRIA 2VMYA 4ABZA 4H0EA 1LEAA 1UKJA 3DBRB 4LW2A 2F5EA 4YEJA 2JVGA 1XSDA 1GV2A 4LIUA 4RGSA 4BDZA 1H89C 4ADCA 5CVUA 1TNTA 3GTMJ 2ZSIB 2R7UA 2CS3A 1VQ8I 1X1BA 2DFEA 4NC8A 4AYBN 3JWBA 4D1QA 2C7TA 2R92J 5DUIA 3IV5A 1SAUA 1JKOC 2CQKA 1FIAA 4IYOB 2O03A 3E3VA 2BIEA 2VASA 2Q7WA 2TCTA 4EGYA 3H3UA 1SD4A 2G0EA 2L9RA 3S16J 5BJ3A 1JHHA 2IAIA 1CL1A 2FD5A 4CO8A 1LW5A 1SVMA 4A00A 3CJNA 1ASMA 2Z1ZA 4EB7A 2M7AA 2R5ZA 1FMWA 2HTJA 4PFOA 2R2NA 3SFZA 3BQYA 2QM3A 4IXSA 4ESFA 2A5YB 4UNOA 3B1EA 1Z77A 3LA3A 1FOXA 5G2PA 5D8LB 1OPCA 3RQ4A 3RZDJ 1IJWC 2VMOA 2VJ4A 4RGRA 1MBKA 2ZNZA 3EIBA 4BA5A 1BW6A 3ZP5A 3OP7A 4W97A 2LTPA 5J3LA 3VDXA 4B8XA 3CMMA 2K3FA 4DZPA 3FK6A 1O4XA 4D7MA 4OMYA 4MQQA 1SANA 3MC6A 1Z67A 5J4VA 2WY7Q 3FK7A 3T8RA 1R5HA 2OV7A 2MD5A 3VSLA 2EGYA 1ZG3A 1E17A 1JE8A 2RQPA 2XB0X 4U2HA 1UHMA 3IUOA 3ABLH 3FSLA 2Y30A 2DGMA 1YTYA 2LP0A 1ZTRA 3ASOH 1MKMA 2D7ZA 3PGYA 4G7HF 2L9SA 1W23A 1S6LA 2A69F 3HIFA 2RREA 3KETA 5KVRA 1DP7P 1OATA 1MSEC 2AATA 2ELHA 1AHGA 1DJUA 3DTIA 2VMPA 1B59A 4YFXF 4ZWMA 2V1NA 4XOPA 2FSWA 2B0LA 3VFZA 1YFHA 1CL2A 2K9SA 1SZKA 1D1AA 1IAXA 3WY7A 2EZIA 2K40A 3JRCA 2Z1DA 3PJ0A 5DJ9A 2BGCA 1YW7A 4Q31A 2PMUA 1SAXA 2FQ3A 3GFLA 3E9KA 2ISYA 4X6AJ 1EH6A 1AMSA 4WYAA 1P4XA 2DA5A 2PBIA 2HOAA 3JRDA 1OCCH 4II3A 1FC4A 2IA2A 1J04A 4UUSA 4BXUA 3Q9SA 1O3SA 3PSIA 1LC7A 4R79A 3UNGC 4UV9A 2ZSHB 2X48A 1DPUA 1N25A 1S06A 2GZWA 3OYEA 1TARA 1USSA 4RM3A 5GAGJ 2DO7A 4GSAA 3CCRI 2QBYA 3KE3A 4N0WA 1IN4A 4F52A 1YIJI 3GTOJ 2JA5J 4DYRA 2P81A 2BI2A 3GSBA 2O7OA 4LMYA 4IY7A 1AMRA 2K5CA 2XSJC 2IS6A 3CCVI 5F0HA 2EFWA 1TQIA 2LVSA 1X29A 3KKIA 2E34A 1FY7A 1N77A 3AG3H 5J8CA 4Q76A 1RUNA 3KLNA 2LY9A 5K5RA 1V2FA 1WHUA 3GEZA 2OQRA 4A93J 2IEKA 2BHZA 3BWNA 1AKHB 1I43A 2HVRA 4UY8I 1MJBA 3FFHA 3DODA 1ETVA 3QPGA 2H8WA 2D1HA 4LB6B 3HTUA 1R6RA 4M6VA 5JVGF 5E1WA 5FKKA 3MKLA 5LHGA 4BE1A 3H3ZA 3FDYA 2ESNA 3OKSA 2K27A 2CSTA 3MKJA 1UCRA 2CSOA 3BQZA 1G4VA 2QZ8A 4JEXA 3E6GA 3AAFA 2MC3A 2ME0A 2JUGA 2BIAA 2CYYA 2CQNA 1R71A 4HX8A 1KONA 2CV2A 1FG7A 2VN2A 2ZJ2A 4R8HA 1VQ9I 3BZCA 2KLOA 2Q0OA 3WU0A 4DOZA 3BG3A 1TC3C 3AG2H 1FBQA 1P7JA 1LC5A 1C0WA 3NUIA 3OYBA 3FXUA 4MQ9F 1AKBA 4UUTA 2ISZA 1OXOA 1T2KA 4A3IJ 1ZLKA 4F5JA 2CW7A 4FISA 4MEYF 3BR6A 2YKVA 4HX4A 4EJUA 2ME6A 3K9TA 2NMPA 1QQIA 2BI5A 3L00A 1QZEA 1M0OA 2E71A 3U21A 3PD6B 1B1BA 3NEUA 3VK2A 2LK2A 2MH2A 1T6SA 2OUMA 3MZYA 2PN6A 1STZA 3GYHX 5CLSA 1RKTA 2A61A 4E70A 3LWSA 3JSOA 3O2PE 3IAS2 3KEQA 3L9FA 2NS0A 2Z9OA 2W8WA 2YKUA 2AHQA 4PJMA 1DU0A 5EFSA 2JUCA 4W91A 3K7AJ 3HGYA 5FFZA 2VLAA 2GAUA 3E97A 4JX5A 4A3FJ 2G6WA 4F5MA 1ETKA 1SZUA 1ZG5A 3BROA 1GEYA 1CQ8A 2GB3A 2IW5A 3R6SA 1U8BA 1D8JA 3T0YA 1APLC 3EETA 1L0OC 4BHBA 4ADBA 5TJJA 2NVQJ 1BS0A 2JSCA 1R4MB 3KX2A 3ZQQA 1J9IA 3ESWB 2VC0A 4NDLA 1BL0A 4ZYEA 2R7OA 2ZBKA 5AIQA 2HPIA 4L9TA 3GUDA 4AUXA 2P6TA 2V79A 3GTLJ 1ETQA 1MBFA 3F8CA 4PFNA 1IN6A 3LQRA 2R7ZJ 3TO9A 1KL2A 4QTRA 3PFIA 2VMVA 2CRGA 2ZJQF 3BWNC 1GC3A 4WF2A 3WGCA 3LAPA 3IH3A 1ZREA 1JT6A 4E1OA 2H94A 3ZZJA 2ETHA 1I50J 3EQLF 2VGUA 1Z9CA 3PO2J 3W1IA 4HZFA 4A0ZA 2VODA 2W7HA 5FT6A 2P0WA 1ELUA 4LG3A 3SXYA 1Y1VJ 5HNFA 2BW3B 3BR0A 1SFFA 2I10A 3JAMZ 1QGNA 3TQXA 3JRAA 3AENA 4BU2A 4RAYA 2BIGA 3CDHA 1OMIA 2CUZA 5FROA 5TISC 2ADUA 2OKKA 3GTGJ 4AVZA 3WGBA 4UV8A 4WYCA 4A6RA 4C2TA 2STTA 4CSWA 4I09A 3F6OA 4S05A 1E0EA 2EWNA 5LHHA 3WHCA 1IG7A 2O0RA 2PG4A 2ECBA 4CICA 3KYCB 2LG4A 1AKAA 3KGXA 5CVVA 2VIAA 3B1CA 3G7QA 2M3AA 3OYFA 1W7NA 1QVUA 1TTYA 2QQ8A 4U0YA 3K70D 5GP9A 2GIZA 1Z7UA 3DXWA 1U9OA 5H20A 2BY2A 1W7MA 2FXAA 1KGSA 1AHYA 3K1MA 4XK4A 3HSFA 1MLYA 4JX6A 3ZQGA 3R60A 1YIYA 2DFFA 1PUFA 4WLHA 4FHTA 4M3GA 3WG9A 2L4AA 1HDPA 4N0BA 2B9SA 1AA7A 4ATQA 3K4KA 3KIOA 1ZOBA 1TPLA 2G7HA 2EFOA 5HODA 1M32A 1XDUA 2W7IA 2OJED 1JTYA 2KQRA 3TW6A 1UU2A 1HKTA 2B7EA 2C81A 4Q48A 3FMRA 2EIJH 1VQOI 1YW8A 2I5UA 2WY8Q 2XAHA 4F3QA 3HHGA 1C7GA 1QVTA 2DKBA 3M8JA 4PGHA 9AATA 2ORDA 2HYGD 3EUKL 2XPUA 5JHUA 3WZFA 1BJNA 3OYNA 4XRMA 2OGAA 1FZPB 3NYTA 1SPAA 4M3EA 1HF0A 1YLFA 3CDIA 2DA6A 2QYOA 3CF5F 5LD2C 2L7KA 1MGTA 1SD7A 2DTRA 1AX4A 1SZSA 1XDSA 2VGTA 4TN4A 3BJAA 2VXZA 2QSFX 2BHXA 2D7YA 4BY1J 4M3FA 3TKYA 4PGGA 5EG0B 3IRQA 1WSUA 2W7FA 4W1XA 3F0CA 3GWZA 3HKZN 4XKWA 2BWPA 2GOMA 3VODA 2YCTA 1AKCA 3WTWC 1LB2A 3LVKA 2VKVA 1U08A 1ZN2A 4CCOA 2K4BA 4A5MA 4IXZA 4EVIA 1RC9A 1FT9A 5KAIC 4JX4A 1VQ6I 2JJGA 5KAFC 4A0GA 1FBUA 4B48A 1POGA 4Q75A 1JS6A 4WYEA 2KIQA 1LK9A 4A3KJ 1RI7A 4PCQA 4Y52J 3MWMA 2HWVA 4W1WA 1MJ9A 1P9QC 3LL7A 3D5LA 4I99C 2V6EA 4U0VA 1QISA 2QB2A 4XJPA 1UJ8A 1ZHFA 2QKMB 5EAVA 1PFFA 4BY7J 1YIOA 2VQGA 2W7EA 4UUVA 2R7FA 4M71A 1W36C 3M3YJ 1FOKA 3IH4A 3HRTA 5F8VA 3HOXJ 5LEJA 5LFAA 1H0CA 1X28A 5E3NA 5ICCA 1FEXA 3QP6A 2HVSA 3JREA 4AIJA 1SVLA 1X2NA 5LBQA 2XKPA 1RVYA 2HOYA 3GLLA 3M4OJ 1SVVA 5FKNA 2EFQA 3VP6A 3I5TA 2F4OB 3JTXA 1WKMA 4ETSA 2ZJRF 1KQ0A 5EG0A 5E3OA 1JGGA 4U87A 4XM3A 1MDMA 5BJ4A 3OYMA 1G3SA 1KL1A 1S29A 1SD5A 1XMXA 2VLHA 1D5VA 4ATPA 2EPJA 4IOCF 5D5UB 2BE5F 1M0PA 1IX7A 4Y0HA 1LVKA 4CZCA 1K78A 4P96A 5A2QK 2QB3A 3ZMDA 3ERED 4K2EA 4MY5A 2RNJA 5DCFA 4PUSA 2X85A 4PSWA 5K7FA 3B02A 1MH4A 1Z1DA 3R0AA 4YFNF 4U1TA 1K7AA 5E1ZB 5E79C 2R0TA 1J09A 2EV0A 2UWMA 1Y56A 1IUYA 1V54H 1W36D 3J7AY 3VOEA 1ZRFA 3E5UA 3E2YA 3OYHA 1SEUA 1P4AA 2AEVA 2VT2A 1DPRA 3N4MA 2M45A 1ASNA 3LMMA 2BVMA 4QLCU 1ZGWA 3CESA 2M2EA 2DT6A 1XMAA 2ZFWA 2IT0A 3IF2A 3KP4A 1P3WA 4C9YA 5GTIC 2XBNA 1FTTA 1LS3A 3DTKA 5M3FJ 5EUEA 3SZTA 1H88C 4ZAHA 3PNVA 3E2FA 2ZMEB 2K02A 3H9GA 1SFEA 2L7ZA 4HOBA 5IY5H 2M9HA 2QSGX 4QGRA 1BI3A 2L2OA 3L2UA 5D8KB 4D5FA 1I29A 3KP6A 3H0GJ 4OC9A 3I71A 3MN2A 3SDBA 3JZLA 2VPLA 2QENA 4EGZA 5F9SA 1BOAA 1YX5A 4FCYA 4UQVA 3LV2A 1O7FA 4M6YA 3NAUA 1IZ1A 4G12A 1B4XA 3L44A 3WHBA 4MGRA 4QIWN 5EGOA 1MH3A 3P9KA 4HAMA 2Q2EA 3MMYB 4GRIA 2RC4A 4XBFA 4A3JJ 1G59A 2DGLA 3OWTA 4XR6A 1WJ5A 3P6KA 3AEJC 4A6DA 4KIBA 2STWA 2IS4A 2VMSA 3U1DA 3HRMA 3CCEI 2XAQA 2HGCA 2AY6A 4HNVA 1KU9A 5FT8A 2WAQA 2WB1N 1ASDA 2CFOA 4WB0A 5HS9A 1ASBA 4WXFA 1Q1HA 3CMEI 1ASCA 1W7PD 2FQ6A 1DQUA 4RAZA 3O6BB 4A6EA 1SC7A 1YO5C 3K4BA 3P9CA 5IT9K 1HA8A 2HUIA 2BY1A 1K83J 5DD8A 1RUOA 4MIMA 3CCYA 3FVSA 4UVAA 1NK2P 4EM2A 3BR5A 1TASA 2W24A 5GADJ 4XLAA 4XNFA 1IW7F 2X1DA 5F0FA 4D7NA 2Z67A 1ZG1A 2Y0SA 2A6EF 3E0JB 2MD0A 3BT9A 3AATA 5HDGA 4M3BA 1QPIA 1Y0UA 3ZMZA 5HNHA 1D5YA 3OOUA 2WADA 3ONQA 2VJIA 3CCQI 1KU7A 5FO5A 5HDNA 3GTKJ 4ZTJA 3FD0A 1BQAA 2EA2A 2R0QC 4GFBA 4E7KA 3OY9A 1YJWI 3SEQA 4XJOA 2W8VA 1IX8A 4BEHA 2LBFB 2VJJA 2X9DA 4K2BA 1XTAA 2V9KA 5KK1A 3KEOA 1Y6IA 1XB4A 2COBA 2HEOA 3VYSB 2VMRA 3H5RA 4RBOA 2K9MA 2W00A 2FX0A 3WE3A 2CUEA 2W48A 1PG8A 1EG5A 1FOYA 4LK0F 2FN6A 5IP9J 4JP0A 5E17F 2RDPA 3BZ6A 3F23A 1T38A 1Z7DA 4ADEA 1RNLA 2HQ5A 3DU6A 3ASBA 3F8NA 3JW9A 3OYLA 2JJFA 1D7RA 1IXSB 3L1PA 1S7EA 2DMPA 4NBQA 1BOBA 4B43A 3BG5A 3IC7A 5L3CA 3GTQJ 4MO7A 2L02A 8AATA 2FMLA 2PB0A 3LA2A 4M9ZA 4OIRF 1SFOJ 4XAUA 4AVPA 2EQRA 2EZHA 3KP2A 3KP3A 4A0XA 2LSOA 3NWTA 4Q4ZF 1G4XA 3EI5A 1GDTA 1DKAA 4PFFA 2AS5F 4BHDA 1R36A 3K40A 2X6XA 4LNMA 3OYJA 4XQFA 3BTLA 1SFUA 4QWQA 4HNTA 1EA3A 1OCZH 1OJLA 1WPKA 3C2GA 4RJ0A 1IXRC 1Y8RB 2D61A 2QGUA 2UUZA 2X1CA 2UV1A 3W2AA 1U5TB 2O8KA 1AAWA 3RKQA 5CVRA 3JTHA 1A5JA 2MH9A 5DX5A 2LF8A 4XONA 3QYEA 3BS8A 1AKHA 4ZJZA 2L7MP 5IT3A 5K5OA 4C3IJ 1HSTA 1FYMA 1QRYA 4EJWA 1A04A 4WWCA 3P1TA 1GC4A 2K3PA 2XF7A 3R0JA 3RQIA 2NYXA 2HP2A 4GEBA 3A9XA 3PL8A 4HA8A 3PSFA 1OISA 5J1UA 2XAUA 3I59B 4KIFA 1TOJA 3GETA 1I6XA 3JRFA 2ZXHA 2WC2A 1BIAA 4KUMA 4AD9A 5IP7J 5KNLA 4FE4A 5EEAA 4G6QA 4E7JA 1U78A 3HPHA 1T33A 2KP6A 3CDLA 1RKWA 2IA0A 3I59A 5DYMA 3FBIB 1KU3A 3T8TA 4BJTA 4Y13A 2CH2A 4P9UA 5B3SH 2YOBA 1DP3A 4XLCA 2OZUA 2ZJGA 3BG9A 2XH1A 1B5OA 4TV7A 4E3QA 5J8QA 4GCVA 3TDZC 3GMEA 1ASLA 4F5KA 4A12A 1MBGA 5CKTA 4IHYA 1WJAA 3AKZA 5HLGA 1PP7U 3HGGA 2A07F 4XLEA 4BHPA 1A6IA 2ZKZA 3EUAA 3QGUA 3PAAA 3AV7A 1U5TA 5FFXA 4MSOA 5M5WJ 2Z99A 4E6KG 1V5FA 1E3OC 1O61A 1I27A 2VBZA 1OHWA 5G09A 4RM1A 1RV4A 5KHDA 3A9YA 4XICA 3JRBA 1MIJA 1AMAA 4ZDPA 1OQYA 2KT0A 2EIMH 2ZNYA 1KMKA 1R1UA 2EFNA 5HS7A 4UHNA 1RRJA 2JPCA 2J5OA 2Y0MA 4R5ZA 5M4DA 3BR2A 1GCKA 4U7DA 2VT3A 4I76A 2MA3A 1UG2A 3CCMI 3A2KA 3BCXA 1UHSA 1VQLI 5IYCJ 3L2WA 4HYEA 1WGXA 2D63A 2HOZA 2X3LA 5BNGA 1F9NA 3KPHA 1SVOA 4EM1A 3IKVA 4OOIA 1GVDA 5LRSA 4A72A 2V1DA 1S3JA 2HTSA 1FG3A 3OIPA 3V8JA 3OOPA 4XKBA 1XGOA 2CQQA 2P5VA 1R22A 3TQNA 2F5DA 2LR8A 4WK8F 4ITXA 1CQ6A 3G0TA 4HDUA 3PM1A 3J81Z 1WYTB 4Y0DA 1GV5A 1ORKA 1I1GA 1H9GA 1C4KA 4UVCA 3WU2C 1H0MA 3ELPA 4N4OB 2F5CA 2DOEA 2LBFA 3DU5A 4BKXA 2KZVA 5ICGA 3T5XA 3GZCA 1AHXA 2JISA 4OINF 4IRHA 4EJVA 4GDFA 5C4XJ 1XI9A 2JA2A 2Z16A 3IHUA 2V1XA 3PUBA 2MLGA 3A0HC 1XEYA 2X6YA 2NOJB 3GLXA 1W3UA 5D6FA 4BQOA 4BDYA 1HQCA 2JJHA 1IDYA 4I02A 5EAAA 2XV4S 2Y9YA 1VQPI 4IHXA 1QZZA 1O3QA 1RR8C 3CLQA 3KLOA 2Z20A 1ON2A 3KP5A 2FBHA 2BI1A 5FKMA 4WX9A 3JTGA 4I6ZA 1J59A 3HHHA 2XF6A 5FLXK 1P4WA 3CCLI 2QVOA 4UXNA 2E7IA 4JE5A 2FYFA 2EZ1A 1XGSA 1W1WE 4A2UA 4RB2C 3RUYA 2RGVA 3H9QA 1EH8A 3EYIA 3EI7A 2DA3A 5LRRA 4IXOA 2CG4A 4EMYA 3BR1A 4XLFA 5F04A 3IKTA 1ACIA 1IGNA 1DGWY 2EK5A 1OYWA 2FQ4A 4XOTA 2Q2EB 4M73A 2D45A 1KKJA 2V7FA 1KQ8A 2W7GA 4WYFA 1B9NA 1R4NB 3CTAA 3DPUA 4CCNA 5TF5A 3BDDA 1CZEA 2CINA 2EB7A 2HQAA 3ISPA 1WQ2A 4CYDA 2H1KA 1OCPA 5FLXZ 3VWBA 4JOMA 1D0YA 1GD9A 4FFCA 2BI3A 4C2UA 3B6CA 3LAJA 4FX0A 2O9LA 4TMRA 2YCPA 3I4JA 3GZDA 2DW4A 2VIXA 2E1MC 3ABKH 4WCGA 4I0BA 2H8RA 3TW7A 3OS2A 4I98B 5CQGA 2BWOA 3PIPF 4CCMA 4V19K 1CF7A 1UB9A 2L01A 3HOYJ 3LSKA 4HG2A 2Y69H 3S1QJ 3AELA 3V4GA 3PIUA 3FF5A 3F6VA 1WI3A 2DN0A 1OHVA 4QPOA 3DR7A 3BJOA 1Z7LA 2W8UA 3TOAA 5K7ZA 3OYIA 3SJMA 3RKYA 2LY2A 4G6DA 2DJNA 5DUKA 1Y0NA 5J47A 1UU1A 1LDJA 1B8IB 4AZKA 3H9JA 2F4MB 4A0FA 1X4PA 2GLOA 3B73A 3HOSA 3J81K 3ZRPA 2A68F 2QCOA 2D64A 3A02A 1BJOB 3AEMC 4IHTA 1LFPA 2P5KA 2PMHA 4NOGA 2HNHA 3MZ8A 4UB8C 1HCRA 2BYLA 1L3LA 2L4MA 3F8MA 1WJBA 3NU8A 1G4DA 3QBOA 3LSRA 3HDOA 3NDNA 3F9KA 5ED4A 5H6RA 2DT7B 1MMSA 3VK4A 4RB0A 4G94A 1XCVA 3CMYA 3LVMA 3ZN1A 3OYGA 1ORDA 4W8IA 1I3AA 2Y31A 2R5YB 3S3MA 3ZR8X 2GA2A 5M3MJ 3UWCA 2VQLA 1T8IA 4IPAA 5AONA 4J19A 2WV1A 1AY4A 2MG4A 4IEJA 1ZRCA 2R7WA 3I53A 3I4MJ 2DODA 3PUFA 1PJRA 3IWZA 4XLHA 4CZZA 3LVLB 1IN8A 2WWYA 4EATA 3LWFA 2BYJA 3G3ZA 3WTZA 3SZPA 4DYCA 1ULYA 4O6ZA 2EJRA 4E7IA 3AG4H 3QPLA 2ZXJA 2W57A 4LOCA 1ASFA 4ANJA 4OIOF 2HP1A 4W5KA 3MAUA 4V2GA 1R00A 3BJ6A 4M9SA 1BI1A 2VONA 2LLKA 3ABUA 3KFWX 2O1BA 1JUSA 1UFMA 4OMAA 2M4KA 3M8EA 1MSFC 3A9ZA 3DQVC 1FTZA 4OCAA 3NRAA 2CW0F 5CPRB 3HBXA 3SHFA 1CGPA 2KIFA 5IPAA 2EINH 2GM4A 2FBIA 4F92B 2VLFA 3H5NA 1IUGA 3RIRA 5EIGB 4L0YB 1MNMC 3DC1A 1DGRM 2HXOA 1H1CA 1T56A 2R7XA 5G4JA 5J4YA 2CUFA 1BQDA 1B9HA 2X5DA 1ASEA 4OIPF 5H6QA 1P6RA 3GWPA 1UG0A 4XMYA 3ZZKA 4GYGA 2DDBA 3HDDA 4CXQA 3FZ7A 2V9VA 3DLAA 2IRFG 2XHKA 2P7CB 3FXOA 3EI8A 5C4JJ 2OD5A 3CQ5A 1W0UA 1TW3A 2UXNA 2JG2A 1VTNC 1UMQA 1ZELA 2IGMA 3ZQHA 3JRHA 1R49A 2VI6A 1PP8F 2HQNA 1ARHA 4KYOA 3NQOA 1ASGA 3KGWA 4BXXJ 1K4TA 3A4CA 1IO2A 3BTIA 3PNTA 5D6EA 5GPAA 3R61A 2YRIA 1F5TA 3V42A 3E7LA 4G8XA 1N2TA 2ID3A 5JFRA 4OYTA 3G1MA 3UKGA 4DQ6A 1BC7C 3JWAA 1JJ6C 4AC0A 3LSHA 1AHDP 4A3MJ 1HC8A 2JTVA 2Z3YA 4AM3A 1GHCA 1KMJA 1TT5B 2CH1A 3G73A 2HS5A 2PQ8A 2XPWA 3DPTA 3QOEA 3IRRA 1IV6A 2ICWG 1V72A 1KA8A 3TATA 3QPTA 1V4RA 2CWEA 1JGSA 5F08A 1IBJA 4YRVA 2CJGA 3S2HJ 2F48A 1ETWA 3I64A 5EYRA 4CH7A 4NNJA 1LFUP 1MLZA 3F8FA 1QNTA 2FNPA 4N9IA 5J1YA 4XRSG 2P7VB 4IX7A 3QAHA 2ZJPF 2MBFA 5E8GA 2CH0A 4MFEA 3BWOA 1Z3ZA 4WP0A 1XN7A 2CUJA 3E1SA 4M72A 4BQAA 3S15J 1SMYF 3H5AA 2M4GA 2HQRA 3W6VA 1G7XA 4WBTA 1DTYA 5J8FA 4ZASA 5G2QA 5DEQA 1D8KA 2OCCH 3DBHB 3RI6A 4EFFA 2DCEA 3K6GA 4R5FA 3RPUA 1AIBA 2VE9A 1MDMB 3ZQCA 2ZFUA 1A6QA 3HXLA 2FMYA 1ETXA 2EZLA 5LHIA 4F93B 1A35A 4BBSJ 3HQTA 1NG6A 2LMDA 3K1NA 3ZQ7A 4S04A 3OYKA 2FOWA 3PDBA 1TATA 1W5SA 3E6DA 5IOYA 4J01A 4EJTA 1BT4A 2H6CA 4PK4A 3H7FA 1F1ZA 3WU1B 3RKXA 4ZM4A 1MJAA 4NB5A 1VQ5I 3BZKA 5CQEA 1GEWA 1U6GA 4W1VA 3AL0C 1D7VA 4MTEA 3RKWA 2P6SA 5IT9Z 2JSPA 4JQFA 3P5JA 3MAFB 3FX3A 2VL8A 1WSTA 2D1VA 2C44A 3FBNB 3BY6A 2A6HF 2F5FA 4KN4X 3HOUJ 3PDXA 3E6BA 2AO9A 3L2VA 2DKJA 1E5EA 1RVUA 1LDKB 3ASNH 3K10A 2KIMA 1QGPA 2OAZA 3QM2A 2QA3A 5A2QZ 3ZXSA 4IHVA 4GE7A 1AHFA 1H8AC 4HV6A 1IX6A 2IVMA 2QBTA 4RKCA 3TP3A 4CUGA 1MW7A 1R5ID 1W5CC 5E3MA 4MHGA 3LSPA 2AXLA 2ELJA 1AWCA 2DA2A 2Y48A 3I55I 5J6XA 4PSXA 2R5YA 1PVEA 3BTJA 2VOPA 1R5GA 4A3EJ 1YS6A 2M8EA 2BXZA 5TRDA 4J5UA 4OBVA 4ZLVA 4IZZA 2DA1A 2FBKA 3IHJA 1JTXA 2XB5A 3ML6A 2JWTA 3S14J 5D4RA 1YJ9I 2CB1A 1S8NA 2BY0A 2MSYA 1WKGA 2CFBA 2VGZA 5I92A 1A31A 1YITI 4WLJA 3C2HA 2Z1YA 1A36A 2PO3A 4B3AA 5D5XB 4MQVA 4UB6C 5JAYA 7AATA 1LJ9A 3EZSA 1QJ3A 2VI9A 2VBXA 3QOPA 4EU1A 3TOBA 5CVJA 1T39A 5E8IA 3GZNB 2R7SA 1WWXA 1DDNA 3WTXC 2NS8A 2DMNA 4FL0A 3HSRA 1K6YA 3BTCA 2HOSA 2GIVA 3E6MA 5DTDA 1U0JA 5F0CA 3Q0WA 4JF0A 3FMSA 5J1RA 2CO5A 1K4SA 1CF7B 2VMZA 3QI6A 2C6YA 1FOWA 4RLFA 3RPUD 3IAM2 3WODF 2C0RA 5HDMA 3HUGA 2OBPA 4BQNA 4UHMA 3KZIC 1TT0A 4BHCA 1EJIA 1KQ9A 1BI0A 3H1CA 3C3WA 1MGVA 4JEWA 2XGDA 2CQ7A 5F27A 3MEXA 1LEBA 1WRJA 4DJAA 2IGKA 3MBBA 4Z2YA 5FLMJ 4MQRA 2R93J 2YHKA 2VMNA 2W7LA 2DBBA 1LC8A 2ZCWA 4Y7NJ 2M5WA 1E5FA 4EQQA 3OV8A 4F5FA 5HS8A 5IYDJ 5DB5A 2EPFA 1ZK8A 3LSGA 3WCNA 2QQAA 4Q5SF 2F2EA 1MDOA 1YJZA 3JR9A 2JRMA 4RB3C 1FP2A 2RQQA 1B4AA 4AIKA 1D2FA 2OKJA 3U2RA 3GZDC 3E5XA 2V0YA 1V2DA 4BGDA 3ZRQA 3K4MA 3I5UA 3PJRA 4ON0A 3L2CA 4XJLA 3MKWB 4LLLA 2PB2A 3CCUI 4HPQA 4IQJA 3RI4A 3ZRGA 1QBJA 2F4IA 1MMAA 2E36A 5K1YA 2NRAC 2HZDA 2LKXA 2L54A 4MKKA 2GA1A 3HRSA 1QPMA 3CUQC 4HEA2 2IS2A 1WI9A 4Z6YA 4ZZDA 1V5GA 2YKXA 2XF5A 3WG7H 3RDIA 1C9CA 3HSEA 2VGVA 2YCNA 2MLKA 1R7JA 3BCBA 3II0A 4O5VA 1W4MA 3MEBA 5GPCA 3EUHC 4PIWA 2G9WA 1S5LC 1X4OA 1AAMA 2OF7A 4KNYA 2CFXA 3QODA 3C1DA 4ESJA 1G7WA 2W8JA 3TO7A 3CJQB 4BAYA 4IJAA 4EB5A 5ILSA 4BNCA 1G3TA 1AJSB 2W7KA 1ONVA 4OAYA 3V7CA 2CV1A 2QLZA 3GCMA 4AO4A 2O61A 1MD0A 2W7JA 4BYYA 4U7BA 2CU7A 3J7AO 1WYTA 3JU7A 1F4KA 1YOOA 2XRLA 3O3KA 2MC4A 1VQKI 2OA4A 4ZYDA 2VJ5A 5M49A 2MFZA 3S1RJ 4W1UA 2P8TA 1YAAA 2W1OA 4B4CA 1RPWA 1Z21A 3BG7A 3ERMA 4Y33A 1OYIA 1M7YA 1S9HA 2O0YA 1I6HJ 5FD6A 3FKJA 2VMXA 3W2WA 1V55H 4FETA 4B98A 1O7LA 4LW4A 5H2FC 2L7FP 3MFKA 3KYLA 3TBIA 4FQGA 2WTEA 3I58A 1S09A 1D3YA 1TNSA 2R7RA 2DGKA 2IXSA 3BOQA 2XAFA 5EJCA 3PO3J 4XRSA 4ENKA 1OCOH 9ANTA 2DPUA 2XC7A 2V1PA 4A69C 3K4JA 2DA7A 3P9IA 3L8AA 1ARSA 3G71I 5LHAA 3J7ZI 3CZ6A 1KYWA 3K2ZA 1X1PA 1ZLJA 3ZMSA 5L3EA 4ENNA 2E2JJ 2GXAA 3AOWA 2E19A 3FMQA 1QJ5A 4YG2F 1BR2A 5IP6A 1ZARA 1X1CA 3NYSA 1R23A 3K7YA 2EFPA 2X1EA 2VE8A 4IYOA 3HL2A 1TL8A 4A3CJ 4M2KA 2FEZA 2L9NA 3EIAA 3H14A 2DYSH 2M34A 5E20A 2BOLA 3GR9A 1ARGA 2XVCA 2HUFA 3ROUA 3V7RA 4KISA 4B9BA 3HT4A 1VNDA 1FPQA 3U9GA 1V3FA 5FGMA 1X1AA 2E2HJ 4E7ZA 1HOMA 2JJEA 4E4HA 4B1RA 1HW1A 3MD2A 2ACJA 4BXFA 1TLHB 4L18B 4P9FA 2HI3A 2VXDA 3GZ5A 4OIQF 4YIFA 3OS1A 3ECHA 3TCMA 3A0BC 1FX7A 2OC6A 1ZH5A 4FT8A 3DKWA 2K4JA 2W7MA 2GBYA 3ELEA 1ELQA 3CLOA 2EV5A 2VBYA 5FT5A 1E3PA 3MCZA 2JK3A 1MMDA 4IKFA 2AY5A 2P5LC 2CY8A 1IN7A 3ZOBA 2Q8KA 3S93A 3MADA 2YSRA 4DGTA 3G8MA 3KZZA 4IO9F 3FKIJ 5IOZA 3MKYB 1WYUA 2QA4I 1D7UA 2HOXA 2CV0A 1GLNA 2NS7A 3OR1C 4OU0A 2YR2A 3FCRA 2LNBA 2K9NA 1KYZA 2NAZA 4KITB 1C7OA 2Z9XA 2EBIA 2FUG2 2R7QA 2GWRA 2K85A 1HSJA 2E1CA 4CA0A 2IS1A 4FE7A 4QSHA 2BKWA 1Z91A 2YX7A 3ABMH 3ZMTA 2A3SA 3FXQA 3JRGA 1TW2A 1YOVB 4BJ5C 1GUUA 3NYUA 2OATA 4G6TB 2NVUB 3KEYA 3WLXA 2DA4A 4ENJA 3K28A 2AY7A 3E6CC 2WBMA 3RYPA 3PQKA 4I01A 2XSDC 4D9JA 1YIZA 3HOVJ 2JGTA 3S3NA 4B09A 3DPLC 3S8PA 3K4CA 3CMAI 4EMSA 2MABA 1MDXA 3CBFA 5LGTA 3DKXA 4F7ZA 1ITYA 1Y8QB 2HYJA 4CXFA 3G4SI 3CQZJ 4HLYA 3FRKA 4GXOA 3M7GA 2DJIA 2A5WA 2KRFA 2QQBA 2CW8A 2EILH 3CUOA 2DDAA 1Z05A 4NC6A 1AHEA 3P7NA 3QP5A 3R4TA 1TZLA 4F5IA 3W3CA 3M8FA 1TP4A 2YS9A 3VOMA 3NX3A 3EPZA 4BE0A 4BJ6C 3B8XA 3AFHA 1YS7A 3V7SA 3USFA 4XLPF 3I56I 5BMZA 2LYCA 2NOGA 4CGZA 1FMVA 4IOAF 2OTLI 3GVAA 1WJFA 1M0NA 3VAXA 3QWLA 2DYRH 4PZJA 5DCMA 2EIKH 2NVTJ 4RAGA 2AXTC 3RYRA 2FU4A 4BEHB 4DBCA 3ZQFA 2VKEA 3M9AA 4P7YA 3W1JA 4WXHA 1SF2A 1FC3A 1X2MA 4JE5D 2X0LA 3TP0A 3W6KB 2MYSA 1FLIA 2N8GA 1U2WA 3I4PA 3X2QH 2HDWA 3WTUC 3FXMA 1IUFA 1XCBA 3HG9A 1ZGJA 1XC5A 4DW6A 1G8XA 1XPXA 2E1MB 3DF8A 2RV8A 4JK1X 4XK1A 1U9NA 2JJ7A 2D66A 3Q8NA 2JT1A 4RDUA 3DLLF 1OFCX 2HDCA 4A3BJ 3CCSI 4Y4RA 2AY8A 3DCFA 2UZKA 5HXXA 3F8BA 2JMWA 3FM5A 5B1BH 3SFIA 2O7CA 5ICEA 1OCRH 3LG0A 4XL9A 1ERDA 3FTBA 3SEZA 1ETOA 4A3GJ 4E3RA 1Z3YA 3FZVA 3NWSA 2DXIA 1HLVA 4PJNA 1JXSA 2Z9UA 2VI8A 1UHWA 4CDGA 3DEEA 5HLTA 1RESA 4LG0A 1I1SA 1EKEA 4IL6C 4G9YA 1LQ1A 1YJYA 4CBSA 2JZYA 1I5ZA 1TWAJ 2DAOA 2G7UA 1ETYA 3CJRB 3I3LA 3JW4A 4OBUA 4WB0B 2QSHX 2HUUA 3UE8A 3I54A 3WE2A 3F22A 3ZQLA 3AEOA 3GBGA 2Z9VA 1BBYA 1BJZA 1S7OA 5JI6A 1XGNA 3VSKA 5K7HA 4LNJA 4Y0IA 2Z33A 3S1MJ 3DRDA 4GRXA 1FYLA 5DM6F 3I16A 5EGOB 2JPBA 2D5VA 2WAQN 3MAJA 2Y9ZA 3BCAA 4WXCA 1B72A 4MQPA 3WGIA 2L9VA 2YU9J 1I3QJ 2DMQA 5LH9A 2X8UA 2XUBA 2XAGA 3UAKA 3F3XA 1OKRA 1WH7A 4F5GA 2WKAA 3FM3A 3S2WA 3WX9A 1B5PA 2VYCA 1G6NA 2E5NA 5IYBJ 4ZDOA 1TQMA 3DXVA 3VYRB 4GE9A 4A0YA 4RAEA 1ZRDA 3FVUA 2DFHA 2BYVE 2Z2SB 2W82A 2ZMEA 1MZBA 2HXIA 2KISA 4MEXF 2BY3A 1TWGJ 1SFXA 1XMKA 2OZ6A 4OMZA 4DBQA 5FRMA 2Q1ZB 2X4HA 1IAWA 1N78A 2Y0SN 3BC8A 3E2ZB 1BW5A 4ESBA 2VIBA 2M7BA 5EEHA 4RB1A 1RZ4A 2D5YA 3D5RC 1W7PA 4L9NA 3GW2A 5F1JA 1VEFA 1SFKA 4DBRA 2RFVA 4R8DA 3U1KA 3WTYC 2V6CA 3CUQA 2BVLA 1ECXA 2IP2A 4JF1A 2JN6A 4KICA 1EQBA 5AIPA 2EO5A 1S72I 3BV0A 2VBWA 4GGGA 4JYKA 1E2XA 2KRHA 3CCJI 4RA2A 4LJZF 5ERIA 5ICFA 2O6GE 4HF1A 2LOOA 2ZYJA 2LY1A 4H4KC 1FWZA 1O3TA 2X6WA 3DTEA 1K78B 1PUEE 4L5JA 4CCKA 5EEGA 1YNUA 4IX8A 2XASA 4R2NA 1LW4A 2EZ2A 4ZYGA 3DEUA 5F64A 2OTJI 2K9LA 1MAPA 2WK7A 2W7DA 3ZPLA 1YHQI 1J75A 3Q0UA 4GYIA 4C30A 1B8GA 1DJEA 2E7UA 4RKDA 3M07A 2FF4A 1DU6A 1T0FC 4V2FA 2VMUA 1BM9A 3M1EA 4X0GA 4K2IA 2QQ9A 3FXJA 2L5QA 5EF6A 1BJ4A 4E7SA 5EUDA 3CC2I 1BR4A 2E5ZA 3S32A 3DEWA 1TOGA 2PJRB 3EZ1A 1YRNB 1JI8A 2OQGA 3S3OA 3HVYA 2NVYJ 2ZMEC 4AIDA 1IV8A 4KAMA 3RJPA 2RN7A 3CC7I 1QIRA 3MZHA 1J7KA 4I0AA 1OLTA 4XN3A 2X51A 3V8KA 3DV8A 4BUPA 5BS6A 4C2MJ 1C0NA 3ABTA 3CUQB 4P1WA 1EV7A 3Q3SA 1M6SA 4HLXA 3IP4B 1BW0A 3NARA 1IC8A 3SYTA 4PFPA 5M5YJ 4A0RA 1YYVA 3CQ4A 2AY3A 1QU3A 4YIRX 6PAXA 3E2ZA 2BZTA 1WJDA 3HM5A 3QYBA 1EH7A 3BPVA 4E7LA 3DZZA 2ZXIA 1PMOA 3FISA 4I2OA 2E1NA 3AL0B 3C18A 1LNWA 5JLXA 2EH3A 2CJDA 3QN6A 1FIPA 4LB5A 2LKSA 3ZMVA 2DMTA 1IVRA 5M46A 1FSHA 4GE4A 2QWWA 3DWLE 2FM1A 4XQ2A 1MNDA 1JHFA 1T0FA 1GXPA 2AQFA 2DOAA 5IWQA 1JKQC 3T1BA 3GTJJ 3EI6A 3HB9A 2CJHA 4EEFG 3CP2A 4PDKA 5J40A 2E2IJ 1S7AA 2K7LA 1VJOA 1IDZA 2CMPA 4Y3OA 1VQ4I 2Y2ZA 3LSTA 5E1XA 4OWRB 1FBSA 2HR3A 2ZUKA 3H92A 3LVJA 1SD6A 3DYDA 3TL4X 3R4KA 2LFBA 2F8JA 3KE2A 4RGXA 1RETA 4MLOA 4PJ0C 2JA7J 4LC3A 1RIOH 3GZ6A 2FE3A 4Q47A 4Y15A 2YRRA 4LG0B 4ZZLA 1D1CA 4EM0B 5DD4A 1MBEA 3WKSA 3LSJA 2GXGA 1O3RA 4OT8A 3GFMA 1T98A 4ISYA 1Y1WJ
chains in the Genus database with same