4MGRA

The crystal structure of bacillus subtilis gabr, an autorepressor and plp- and gaba-dependent transcriptional activator of gabt
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
468
structure length
468
Chain Sequence
DITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHIDQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSKSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKENKRQTGRPALIIGFARLKEEDIQEGVQRLFKAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Bacillus subtilis GabR, an autorepressor and transcriptional activator of gabT.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulatory protein GabR
total genus 135
structure length 468
sequence length 468
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4mgrA01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4mgrA02
2GQNA 4F5IA 1O4SA 3DFGA 1O3SA 1QPMA 3LQRA 3H3UA 3F6TA 2HQRA 3AELA 1ON2A 2GQQA 2CO5A 2Y0MA 3TOAA 1OATA 2BBYA 2LDUA 3F8BA 4IVNA 1RNLA 3DU4A 2FQ3A 3AEJC 1FYLA 1FT9A 1R1TA 1DP7P 1AKAA 2CFBA 2DR1A 4OYTA 5EAAA 3WODF 1B1BA 3ERED 2FEZA 3GFLA 2AEVA 3Q9VA 1BQAA 2RV8A 4HF2A 1OHVA 4RGSA 3ATHA 5G4JA 2HUIA 3QP6A 3WTTC 1WYVB 3RI4A 2DW4A 1GEWA 4PVFA 2MH9A 4MHGA 1MDMB 2VMYA 2ZJGA 1IXCA 3KETA 4HDVA 2VONA 3BCAA 3CQ5A 4JF1A 1GD9A 1ARSA 4L9JA 4ZYDA 4EJUA 3LG0A 1ASCA 3PD6B 1IN7A 3IL2A 2C0RA 3RQ1A 5BOXA 1B59A 2ZUKA 1LDDA 3AENB 3TO6A 1GC2A 2QBYB 4GE7A 3V8LA 4TMRA 4A6DA 3FVUA 2HUUA 5AIPA 4R5ZA 3NTJA 5F64A 2HR3A 3L2CA 4ETSA 2JPCA 4XQ2A 3L00A 1ASMA 3I59A 1BC7C 1P4WA 1LVAA 4S04A 3K1NA 3KZZA 4L9TA 5M49A 5IWQA 1UHMA 1QZ9A 2YCPA 5D6EA 3IWZA 1HKQA 2OA4A 1BJ4A 5DUKA 5KK1A 4XJPA 2R7FA 3GSBA 1MDMA 4HX8A 1EQBA 1FC4A 4CBRA 1CL1A 2PBIA 3ISLA 4MEYF 2YKVA 3J80K 4G7ZF 1LEBA 3FRKA 1SF2A 1C7NA 5LHHA 2G9WA 3ZMTA 1GDEA 1B9NA 2DT5A 2R5CA 4BHPA 2QYOA 3QHXA 3E2FA 4UVAA 2JT1A 2Z3YA 3JAMK 1J5YA 4LLGF 1WSTA 4QWQA 4ASNA 4A6TA 1KQ0A 5H6QA 2OAZA 5CVJA 2VMRA 4EJVA 5CYVA 5AX8A 2DAOA 3CUQA 1BOAA 4EU1A 2OZUA 3K1PA 4ZYHA 3KFWX 1RVUA 5LGNA 2QWWA 2Z67A 3LVLB 2R3SA 3LWFA 2AEUA 4B09A 4WB0B 3LQQA 1IW7F 4I7HA 3MBBA 3RI6A 2C7TA 3LAJA 2H6CA 1OXOA 1QIRA 1KU2A 4UNOA 5IT9Z 3MC6C 5IT3A 1FBUA 2HGCA 4EGZA 3RPUA 2VBYA 1KYZA 3F8NA 2M45A 4HOBA 4U0YA 1ZGJA 4EFFA 1ORDA 4GCVA 5HVQC 1REPC 4YFNF 2Z61A 4GYIA 4F5MA 2X3LA 2UXNA 1JGSA 2EFPA 2EV0A 4OIPF 1S7OA 2FNAA 4WYCA 4HLYA 1FC3A 2VMXA 1CZCA 1MGTA 2FNUA 3VOEA 1IN5A 2VXZA 4MEXF 1ASGA 4MKKA 4EJOA 2ZJ2A 3F72A 3RUYA 2Z9OA 3DPTA 1ASAA 3ZMVA 4F5GA 3BB8A 4MKJA 4BQ0A 4P7YA 2ZP7A 3UAKA 1TOKA 3FXRA 4D0PA 2FF4A 2E7JA 4LNLA 4HZFA 3GETA 2DBBA 3WTXC 3RKWA 4LC3A 1YJSA 4NOGA 5E20A 4HYEA 4M6XA 2M30A 1MJBA 2Q8KA 4RKCA 5FT5A 1T38A 3MADA 1EH6A 3C18A 3R4KA 1UKJA 3OKSA 1ARHA 2O6GE 2FU4A 3BCXA 3BPVA 4OTLA 1HKTA 1YO5C 3W1HA 3PDBA 4OIOF 4CDGA 1OYWA 4LNMA 1IXSB 1R36A 2YCTA 3AEPA 3B46A 4WP0A 4HF8A 3ACZA 3HRUA 1PP8F 1T0FA 2OATA 3GBXA 2A68F 1R22A 1YOOA 5FT4A 2ZMEB 3S2WA 2F5DA 2ESNA 2VOPA 5E5IA 2Z20A 3BWGA 3DP7A 2OQRA 4A5MA 5HXXA 5E1WA 5DD8A 1P4AA 3E6GA 1WWXA 1G6NA 3H14A 3WKRA 1BBYA 3RKYA 4I8AA 2JJFA 4UV9A 2CSTA 2ZBKA 4MSOA 3GVAA 5G09A 1W7MA 2E7UA 3MAUA 1M6SA 1XCVA 2J5OA 2A6EF 2V1PA 1D7VA 2YHKA 1B5OA 5CLSA 1TQPA 1GHCA 3JW9A 2EZ2A 2YCNA 1QQIA 1MLYA 1XB4A 3JTHA 2D64A 4JEYA 3WGBA 1R1UA 3DPLC 5E18F 3RKXA 5ICFA 4ZDPA 5M4DA 2P8TA 3W1IA 1ZH5A 2W8VA 4N0WA 4W1VA 4ZLVA 1WKGA 3E9KA 2AS5F 1OYYA 4LMYA 4P55A 1ZLKA 4O3MA 1AMQA 1TW3A 1SFFA 1D8KA 1MKMA 1B5PA 1CS1A 1I29A 3LWSA 2Y48A 2C6YA 5EQCA 5HLHA 1E5EA 3EI8A 3BN1A 1YIOA 3QM2A 2GIVA 4RM1A 1P4XA 3VK2A 3QAHA 4L0ZB 4HF1A 1F9NA 1KQ8A 3GXOA 2VOOA 3BROA 4P9UA 2XASA 1S8NA 2W8WA 4WYGA 3D6KA 1U08A 3FHZA 2EA2A 2IA1A 1JE8A 2OGAA 4JEZA 1AAMA 1V72A 2LKPA 2VIBA 1U2WA 2GSAA 3JU7A 5L3DA 2YRRA 1X2AA 2CH2A 1TARA 3IKTA 1OXPA 3AATA 1JHFA 1G7XA 1TBXA 1TQMA 5LLQA 1P3WA 1AHEA 3EIAA 4U7DA 3GF2A 5ICEA 3MZHA 1YJZA 1VTNC 2DQRA 5BPDA 3DRDA 2ZNYA 2BWNA 4KNYA 1T39A 3IF2A 1B9HA 4OIQF 4HX7A 3ECHA 1FP2A 4MTEA 2R5CB 2X8UA 3FSLA 3VOMA 1S3JA 2W57A 1H9TA 1BJOA 3SQNA 2C81A 1DJ9A 1E17A 2YKUA 5DCMB 4M9ZA 3QPGA 1KU3A 1ZYRF 2XKOA 2OKJA 4RB1A 5EEGA 5BQTA 4IYOA 2FRHA 2UXXA 2BI5A 4ATPA 2RQPA 2ZSLA 3WU1B 4YFKF 3QN6A 1KYWA 4AVPA 1XI9A 1LW5A 1Z7UA 4KMUX 4LGWA 4RKDA 4G94A 5L3GA 1ZODA 3D5LA 2L02A 5E17F 2EPJA 1G7WA 2A69F 2GXBA 2JJEA 2VMSA 1WQ2A 2ZXJA 1B8GA 1ODDA 3FDBA 5G2PA 2JISA 4H51A 2CY8A 2HOXA 4WXBA 1FSHA 2GZWA 1KMJA 4GSAA 3V8KA 3K0LA 1DDNA 3W6JB 3M9AA 4JEWA 2YRIA 2ETHA 2P6SA 4WBTA 2W7LA 2MD5A 2BHXA 5K8BA 2STTA 1BJWA 4UHTA 3LVJA 2CG4A 3F8MA 1FYMA 2PFBA 1W4MA 2HZTA 4E70A 5G0AA 1BT4A 4A5NA 3GZCA 1X29A 1YQAA 4ENJA 3HQTA 4K2MA 1TASA 3GW2A 3M5UA 2NYXA 5HLIA 2RFVA 4M74A 4BMKA 5LGTA 4LK1F 3VK4A 2XAGA 4N9HA 4O6JA 1LK9A 3E97A 5LRSA 3G7QA 1HW1A 3KP7A 3BCBA 2XVCA 5DDGA 1IZ1A 3FVXA 4ADDA 1AMAA 4EB7A 1MAPA 4IPAA 2O7CA 4DGTA 2DPDA 2DQLA 1MZBA 1ULYA 3FF5A 5EUEA 1XCBA 2A61A 3EI6A 3FZ7A 1SZKA 2F8JA 2AY4A 3QBOA 4RAZA 3AOVA 3RDIA 3EYIA 5AONA 3PDXA 1SAXA 3P1TA 2K4BA 3UE8A 4XK1A 3BY6A 2DI3A 1AMSA 1FYKA 3AEMA 2W24A 1S6LA 3NQOA 1YW9A 3REOA 4ZAHA 2FN6A 1P2FA 2HKXA 2BIAA 4N9IA 4LLLA 1Z3ZA 1X3UA 1B9IA 4J5UA 5AIQA 4UOYA 4ATQA 2ISYA 3EIBA 2FOKA 3FD0A 3I58A 2V1UA 3ZRRA 4HF0A 4RITA 1FG7A 1ZN2A 3BS8A 2HEOA 1D8JA 1CGPA 4XLPF 4BA4A 4NB5A 1GBNA 1YG2A 2KRFA 2NAZA 2Z33A 5LRRA 1LW4A 4PZJA 4S05A 4WD2A 2JZYA 2EH6A 3F0HA 1QZYA 1JXSA 2E7XA 3EI5A 2PG4A 1D7SA 1ZGAA 3COAC 4XRFA 3ABUA 1EH7A 4GXOA 5EEHA 4KN4X 3ZQ7A 2QM3A 5JFRA 2WC2A 1RZ4A 3Q9SA 3SZTA 2QLZA 5F6FA 1FX7A 2YR2A 2ZSMA 3O6BB 4ESBA 2EJRA 4LG0A 3KLNA 2O1BA 3DQVC 3K1MA 3I59B 1DJUA 3HMUA 2UZKA 4M9SA 4RLGA 3ZP5A 2K27A 3F8CA 1ARTA 2G6WA 1WI9A 2WKAA 2VC0A 4ITXA 2AY9A 2OGEA 3KE2A 1W7LA 1TNTA 5D8KB 3BJAA 2W7MA 1SD7A 3IRQA 3F23A 3G0TA 1BI2A 1K78B 3BOQA 1FP1D 1H0CA 3GUDA 2GB3A 4Q31A 4A0XA 3PQJA 1R00A 2LNBA 3JWBA 2WK9A 3E6DA 2ADUA 5CVUA 4L0YB 2CTZA 2DKBA 3SXYA 2QQAA 2CWEA 1BC8C 2YOBA 4HQMA 4WXHA 1IAYA 1IN4A 4W5KA 3WKSA 2V1XA 1QJ3A 5LEKA 3T32A 1HW5A 2Y75A 1U5TC 3WTSC 4GYGA 2QBTA 3J81K 1KKPA 3TFUA 1M7YA 4ADBA 1OYIA 4YIFA 1KL2A 2VIAA 3P9CA 1GC3A 4M2KA 3KP4A 3WZFA 2HYFA 4KDPA 5FT6A 3J80Z 5DCMA 2C44A 1C4KA 4ZASA 2BV6A 4OMYA 4ZSWA 2BIEA 3N75A 3RYRA 5C6UA 1SPAA 4HBLA 1AX4A 4E3QA 3KKIA 2JGTA 4A12A 3HSRA 3T5XA 2VT3A 3NUIA 3MAJA 5HLGA 1M0QA 4AIKA 1MDZA 2XROA 1XN7A 5K5RA 2PB0A 1TOJA 3ZZJA 3DEUA 2GXGA 5ILVA 4K2EA 3GZ6A 2QQ9A 3E3VA 3JAMZ 2FBIA 2KIUA 2FMYA 3BWNA 1GEYA 1I27A 3F6OA 3BP8A 3RYPA 3R60A 2AY8A 1BJAA 1USTA 3HTUA 3NUBA 3W1JA 1AMRA 2X4HA 3VODA 1V2EA 3WLXA 1B4AA 3J7AO 3CUQC 3AOWA 5D6FA 4U88A 4MGRA 1AHXA 2BYLA 2DGMA 2W7JA 1Z6TA 4EM1A 2DTRA 1Y0UA 1N8PA 4RGUA 1ASNA 4LW2A 4I98B 2YKYA 2HTSA 2HTJA 2EK5A 4AO9A 2H6BA 2MLKA 3F3XA 3CUQB 4U7BA 2AY7A 2VI8A 1OHWA 3QOPA 4RJ0A 1CF7B 2Z1ZA 4RB2C 3FMQA 1Z7DA 3PFIA 1IJIA 3GZDC 2NNNA 3DC1A 4HQEA 5LHGA 3P9KA 1B6AA 1IRFA 1G4XA 2DFIA 2QB3A 3RIRA 1CQ6A 3QP5A 1AJSA 4EM0B 2X0LA 1QO0D 2VGUA 3AEJA 4PGGA 3EZ1A 1J2XA 4L5JA 4CBSA 4ESFA 2RC4A 2Q7WA 3VP6A 4KA4A 5LH9A 1IRGA 2QENA 1GEXA 1TNSA 2VYCA 4ISYA 2FSWA 4B98A 1YW8A 5FFXA 2VBXA 4AWXB 2QMAA 4NQWA 3AEMC 3HSFA 5K1YA 2E7IA 4JEXA 3EI7A 4A0HA 2ZYJA 1JF9A 1MJAA 3R6SA 3U2RA 4Q6RA 2IP2A 3M1EA 2XAQA 2P5KA 2LF7A 3FCRA 1BI3A 2IJLA 1IX7A 2V1DA 1CQ7A 1RVYA 2FA5A 3L8AA 4BNCA 2Z5UA 5D5WB 4UXNA 2K7LA 2L4AA 1PDNC 4Q75A 1C7GA 4Y15A 3BV0A 4F5LA 4GE4A 2VMUA 2O03A 2A5YB 3QPTA 3N4MA 3WGHA 1DUXC 3TDZC 5DJ1A 1IUYA 1IBJA 4HVKA 3LFKA 1CL2A 5HS8A 2CSOA 1WYTB 1WYUB 4JK1X 1ZG5A 3H3ZA 3LA2A 1BI0A 5FD5A 3TKYA 5F8VA 3J81Z 4YFXF 2L4MA 4OMZA 1J75A 2VLFA 3OV8A 4A0FA 1TOIA 3FQAA 3GFIA 2HORA 2BI1A 1D7RA 1N2TA 2VMTA 2STWA 1FBQA 2W7IA 2DK5A 2CINA 3ZN1A 3L09A 4WK8F 4L9VA 3B73A 2HP2A 1KGSA 1XDUA 2GWRA 4L5IA 2E54A 1AKBA 4F5HA 1ZRFA 4U0WA 5DEQA 3VK3A 2QBYA 3A9YA 3K7YA 3PQKA 2FXAA 1L3LA 2HYGD 3DYDA 2VODA 3EYYA 1O69A 2Q2EA 2WV0A 2QB2A 2VT2A 5JI6A 3MFKA 7AATA 2HKOA 5CVRA 2NMPA 5TRDA 1D2FA 4KMFA 2DKJA 3QGUA 4CXRA 1W5TA 3QPHA 3CTAA 4ZM4A 1F5TA 3ML6A 4LLNA 4M9XA 3WE3A 4YG2F 1WKHA 2RGVA 1MDOA 3ELPA 1KU9A 1ON1A 4Y13A 3GWPA 5FGMA 2X5DA 4R8HA 3QU6A 3II0A 2XGXA 1AICA 2YPRA 4L9NA 4W1WA 2QQBA 3QI6A 2OQXA 2EV6A 1BQDA 1MD0A 3NRAA 3HHHA 3E5XA 4M6YA 2HZPA 1F1ZA 3WCNA 4A0RA 2PLYA 1I1GA 1T3IA 2DO7A 1BN5A 3QRFF 2ZC0A 3KP3A 4ZM3A 2W7KA 2VC1A 2PMHA 3ABTA 4A2UA 4LJZF 4XLNF 2R5EA 1FLIA 1TOEA 3KE3A 4ON0A 3K2ZA 4UHMA 2K4JA 1YTYA 5D5XB 4M71A 2D2WA 2HDCA 3SHFA 4B9BA 3LSTA 3CLOA 3ISPA 3DODA 3BZ6A 5A2QK 4DBCA 2XHKA 8AATA 5CVVA 1UCRA 2TPLA 1PP7U 1PUEE 2O61A 4JE5A 4MQPA 1O7FA 1TOGA 1AIAA 4KUMA 3WGGA 1ELUA 4A6RA 4AIJA 5F9SA 4RB0A 5H6RA 4KYOA 4BXUA 4GRXA 5EIGA 4A00A 3PIUA 1IAWA 3K28A 1YLFA 3USFA 4KIGA 4UUVA 3GLXA 3E2ZA 3GX4X 2P5VA 2XKPA 1U5TA 1XSDA 4UHOA 5EUNA 1TTYA 4ENMA 2IVMA 1ZRDA 3HVYA 3LVMA 3MWMA 2EFOA 4WF2A 2FNIA 2M87A 2DOUA 4F7ZA 3GZDA 3NRVA 5K5QA 1BJNA 1GXPA 1Z6RA 1ASLA 4JEVA 2VE8A 4EVIA 3KP6A 4HW0A 3E6MA 3R0JA 1CQ8A 1AAWA 3EZSA 1KA8A 1QNTA 2MH2A 2BIGA 1E5FA 1D5VA 3MEBA 4OCAA 3TFTA 2P7VB 2CQKA 3DR4A 2ZCWA 2O0YA 2WWYA 3AEOA 3HT4A 1JS3A 3ECOA 4BHBA 4ZYEA 1MGVA 4N0BA 3F22A 3RCHA 3ZRPA 3R0AA 1GC4A 1J0RA 4OU0A 4R2NA 5ICCA 3MEXA 4JQFA 1VEFA 3E5QA 1ZG1A 1AY4A 4I2OA 3L9FA 5BJ3A 2VN2A 1V4RA 2YU3A 1AOYA 4UQVA 1LKCA 5FLXZ 1ARIA 2RN7A 3TGNA 3BC8A 2WK7A 1BW0A 1I41A 2JJHA 2RVCA 2ZKZA 1TLHB 4IXSA 3JZLA 3WU0A 3N97A 2HOEA 4RAYA 4WXCA 2F5CA 1AJSB 1I48A 3FVSA 3CAIA 5A2QZ 1WYVA 5DCFA 3ZMUA 3E2YA 1SVVA 4A0GA 1ONVA 2AXLA 2PEXA 1ASFA 1KL1A 4OT8A 4EGYA 2ZFWA 3T1BA 9AATA 4LB6B 4WYDA 1R58A 4EQQA 4IHSA 3WGIA 4AIHA 1M4NA 2YKXA 1R5GA 2D5YA 1J32A 1X0MA 3WX9A 2XIGA 3HL2A 4FFCA 1IN8A 3C3WA 2W7GA 3NYSA 3FX3A 5M46A 1I1SA 1FPQA 1S29A 4OOIA 1YJYA 3NDNA 3TATA 1MDXA 2R2NA 2VGZA 2OU2A 5E8GA 5L3BA 4ZWMA 3IRRA 1B9MA 4HA8A 4KICA 1HKSA 3DXVA 1XSXA 1BM9A 5HS9A 3SZPA 4Q47A 1C9CA 1H9GA 1S07A 1RI7A 1R5HA 5HDGA 4G7HF 1WYTA 2BE5F 4LFUA 1OHYA 1AKCA 4IF4A 4OINF 4A72A 3WE2A 5DJ9A 2FBHA 1DTYA 4Q76A 4A0YA 1F4KA 3R61A 5EAVA 3IC7A 1W7PD 5D4SA 2PN6A 2OKKA 3ZMZA 1HSJA 4BA5A 2E1CA 4MQVA 4KIFA 1ZHFA 5DB5A 3UWCA 2E1NA 3B1DA 2GA2A 4HV6A 1N31A 1G3YA 3G3ZA 3E6CC 3EUCA 1XMAA 1KQ9A 1W7PB 1V2FA 3PDBB 1E2XA 1U3EM 4GGGA 1J04A 2COMA 1ZOBA 3RPQA 3DKWA 1SZUA 4IXOA 1FG3A 4PCQA 4NHJA 4XEWA 2EO5A 5ILUA 5ICGA 2W84A 2W85A 3N5MA 4KAMA 5L3CA 3EQLF 3LA7A 1AJRA 3P9IA 1YFHA 1G4VA 5ERIA 2EFQA 2CJDA 2CYYA 4W8IA 4HV5A 5J8FA 1LQ1A 2BYVE 1MAQA 2JSCA 5HHYA 2W25A 3ZN0A 3DXWA 1LDJA 2VMWA 2FE3A 2V6CA 4JBAA 3F6VA 3GYHX 4IJAA 4IX8A 1UU1A 2HWVA 2X5FA 3ECDA 2IA0A 2JJGA 3DF8A 1O62A 2H09A 3JTGA 3AAFA 2D1VA 1ZAOA 4WYAA 1Q1HA 4ZH4F 3MAFB 3PGYA 2D1HA 3I71A 5LGUA 1DGEA 5CVIA 2L54A 2VGVA 4HAMA 3JSOA 5FT8A 3O3KA 1YW7A 3G73A 3HOTA 1AHGA 3CBFA 2W7HA 2WTEA 4WLHA 3ZRQA 5HDMA 3V7RA 2BI2A 3FZ8A 2MC3A 4ADCA 4IRGA 2OD5A 4WB0A 1OPCA 4RGRA 3B02A 4DQ2A 2DGKA 5HOOA 4O6ZA 1FNNA 1ZARA 2PO3A 3JSPA 2VGWA 3TQNA 2AY6A 1NHAA 1IXRC 1LDKB 4Z2YA 5LBQA 2D65A 2ZNZA 3V4GA 3M8EA 3FXUA 2TDXA 4CYDA 1FZPB 4KN7X 4KFCA 3HLMA 1DPRA 1ASBA 1O61A 4RS8A 4WXGA 3CJNA 3TCMA 3NU7A 2CFXA 5D4RA 3HTSB 1P92A 4KYWA 4I09A 2UWMA 4IHTA 2PB2A 3OP7A 1B4XA 4AH3A 1IAXA 2IW5A 1WYUA 2P7CB 4Y0DA 5FO5A 1GCKA 4XJOA 3HRSA 5DUIA 4JE5D 3FMSA 4EV0A 3HUGA 4BYYA 5DYMA 2BGCA 1O57A 3HYIA 5TJJA 1M0NA 3F9TA 2V9VA 2QVOA 2ESHA 5G4IA 1T6SA 2VBZA 2KIMA 2XRNA 2LF8A 2H94A 3COGA 2NRAC 5G2QA 3MAFA 3L7WA 4LB5A 1C0WA 3WTYC 2XBNA 4FX4A 1SFUA 4B8XA 4FX0A 1A04A 1QJ5A 3K40A 3RJPA 2D66A 4MQQA 2W8TA 2DLLA 1DKAA 3WCOA 1HQCA 1ZG3A 1D7UA 1VP4A 4ADEA 2YSRA 2XAHA 2CB1A 5J6XA 2JRTA 3IKVA 5ILSA 1S06A 1ZREA 2QLRA 3GZ5A 3NEUA 1W3UA 3KEOA 2VGSA 3WG9A 3NNKA 2PJPA 1M0PA 4HLXA 2LSOA 5LHAA 1SFXA 2H27A 3F21A 1R7JA 2VLHA 4J8LA 4Q48A 1WSUA 1UU2A 4BAYA 5DX5A 1DFOA 2BI3A 2XV4S 3MZYA 3BJOA 4CICA 2F5EA 3GFMA 2MA3A 3CQ4A 3FQ7A 1I5ZA 2K86A 4A0ZA 1JHHA 2KJBA 2MLGA 2OZ6A 3ASBA 4M72A 3GWZA 4PFNA 1ASDA 4FHTA 4KT5C 1JS6A 4R5FA 2VMVA 4EMYA 2NNYA 1AY8A 3HHGA 1W5SA 3GFJA 4ZWVA 1H0MA 2QZ8A 1FWZA 4UHNA 1TQIA 2M8EA 3E6BA 5EFSA 1V2DA 2BWPA 2CJGA 4JF0A 4IY7A 5LHIA 3OOPA 5E1ZB 2CW0F 2VI9A 4AZKA 1HXDA 2HUFA 1K78A 4R1HA 4ENKA 3K69A 3DZZA 4P96A 1H1CA 4WLJA 3KZYA 2JTVA 5L3EA 2JG2A 2GA1A 2CH1A 3JWAA 1G4DA 1UB9A 1ZRCA 3TDUC 2AY5A 5E3KA 3HIFA 2P4WA 1U5TB 4BQAA 4MNUA 3DXJF 1UFMA 1DJEA 3TO7A 3ASAA 1O3TA 3B1CA 4MQRA 1XSVA 3I4JA 2GAUA 3EDPA 5FFZA 3DV8A 3HRTA 5JR3A 1ZLJA 3QU3A 4OBVA 3KCCA 4WXFA 2HS5A 4L18B 4UVCA 2IPQX 3KGXA 4E3RA 1BKGA 1EV7A 1W7PA 4EMSA 1UU0A 1W23A 2DU9A 4AZJA 2M5WA 3IHUA 5HS7A 4M2JA 2EWNA 4CXQA 5J8CA 2EFNA 3MQ0A 1CF7A 1DGDA 3I4PA 3VB2A 4MQ9F 3RCHB 4XAUA 4HX4A 3LV2A 2VMNA 3AENA 1OMIA 3GEZA 3FQ8A 2A3SA 3IHJA 1U8RA 3JTXA 3CQ6A 5I92A 4IXAA 4I01A 1ZC9A 3MC6A 3TQXA 2YX7A 4U0VA 1TATA 3VAXA 3I64A 1M0OA 1WKMA 2FMLA 4GEBA 3ZMSA 5DD4A 3CO7C 2VGTA 3FZVA 3GJUA 3LVKA 1STZA 2A6HF 2RDPA 2Z9WA 1LC5A 3G8MA 1OR7A 4P3MA 1U6GA 2ZO4A 1KKJA 1XD7A 4G6QA 2Z9VA 5L3FA 2HQNA 2D45A 2P5LC 4ZZLA 1T2KA 4IYOB 1Z9CA 1V3FA 2EZ1A 4RB3C 1G3WA 3Q8NA 5D5UB 3NX3A 4OC9A 2XUBA 1UHWA 3C1DA 3ELKA 2EGYA 3FXQA 4EJWA 1MJ9A 3I5TA 4A6EA 2VMZA 5BJ4A 1S7AA 1RIOH 4GO1A 3WTVC 4CGZA 1YS6A 5BMZA 1O7LA 5FB2A 4LG0B 2ACJA 3I0TA 4Y17A 4WCGA 1S08A 1AHFA 4BHDA 3HBXA 1HBXG 1KMKA 4F4EA 1YAAA 2FNPA 4P5OA 1BIBA 2IA2A 2W7DA 2XH1A 3EI9A 6PAXA 2O8XA 2L01A 3GR9A 4IRIA 1I6XA 2FBKA 4Y0IA 1SFEA 2GMSA 2F2EA 3AV7A 2L3DA 4PIWA 2Z9UA 5EIGB 2DK8A 3Q5FA 1GC0A 5D95A 5FD6A 3E77A 4CHUA 3V7SA 4ITGA 5H20A 1SD4A 2HOYA 3NYUA 1BI1A 2DPUA 1EJIA 5E4ZA 2D7YA 2BYJA 1IVRA 3F8FA 3PAAA 1YS7A 3R4TA 1EG5A 2VMPA 1KU7A 4UVBA 4ZSYA 2HFHA 1LEAA 1AWCA 3ELEA 3CO6C 3LA3A 4WX9A 3RBFA 3A2BA 3V8JA 4EM2A 3T0YA 4OMAA 5IT9K 2B0LA 4L0OA 2VBWA 1WRJA 1R1VA 2D7ZA 3FFRA 1T98A 2D61A 4I0AA 2HP1A 4RAEA 4AD9A 5CJ9A 2CJHA 4LNJA 2QUFA 4RIZA 2G7UA 1QBJA 3CUOA 4O5VA 1QITA 5K5OA 3V7CA 1G3TA 2Q0OA 4G6DA 2OBPA 1XEYA 4Q5SF 2HOZA 5BPIA 4XJLA 5EUDA 3U9GA 3I54A 1QGPA 4MTDA 4M73A 3KGWA 4ZYGA 1BS0A 4YIIA 1C7OA 2DGLA 2EB7A 5DV5A 2AY2A 1AIBA 1SZSA 5D5VB 4G9YA 1LB2A 4K2IA 4A6UA 3T8TA 2R7DA 3E2ZB 4ENNA 1RV4A 2AY1A 5JAYA 3T8RA 3LAPA 1LJ9A 1I43A 2J5PA 4BH9A 1BJOB 2ZMEA 3KP2A 3HRMA 4E77A 1RUNA 2RKHA 3BWNC 2AATA 2F5FA 4W91A 4WYFA 2V79A 3L44A 4AO4A 2Z99A 2XAJA 4KIBA 4LD5A 1XGNA 2ELHA 1IUGA 4LK0F 2O3FA 1Y4IA 2ISZA 2P6TA 4OBUA 2K02A 3H7FA 2KKOA 4ZDLA 3WGCA 3M7GA 3EUHA 3M8FA 4FL0A 1XGSA 1ASEA 4G8XA 2EV5A 4DQ6A 4OIRF 1YIYA 4HDUA 3VEPA 4PFFA 1MLZA 2E7WA 1IX8A 3O2PE 2V0YA 1OKRA 1QZZA 1RV3A 3B8XA 4CVQA 3IWFA 2CGPA 1PMOA 1RUOA 1J7KA 5KVRA 4ESJA 3FMRA 3FFHA 4XSXF 3KP5A 3PA9A 2FM1A 3P6KA 3NYTA 3BPXA 1M32A 3LY1A 4WYEA 3FKDA 2EFWA 4GE9A 1GXQA 5HDKA 5ED4A 2IRFG 1VJOA 3P7NA 4DNCA 2MBFA 1ELQA 1D3YA 1Z91A 1DPUA 4R79A 1G3SA 4QLCU 3FZ6A 1ARGA 3TOBA 4I02A 3ULQB 1K7AA 1X28A 4CO8A 1LC7A 3KEQA 4PGHA 3CDHA 3GO5A 4XBFA 3WTUC 3R9AA 2W7FA 1USSA 2A07F 3WTZA 5HDNA 1K6OA 2WK8A 3I16A 2Z9XA 2O0RA 1XMKA 2R0TA 4IXZA 1SMYF 1FY7A 3HSEA 4ZDOA 1ECXA 3JW4A 3TO9A 4FT8A 3DR7A 2EA4A 3KLOA 3RTRA 3WY7A 3SFZA 3H92A 1U78A 3HOSA 3C7JA 4XJMA 2RNJA 3BWOA 1L0OC 3ZZKA 2QA3A 4UV8A 1FBSA 4IRHA 4U2HA 2CANA 3NU8A 3ZPLA 1PMMA 5JHUA 1O3QA 5JVTA 4M2MA 1P6RA 2IT0A 3D0SA 4PDKA 2VE9A 1BIAA 1TW2A 4Q4ZF 2BWOA 3FM3A 3FWEA 5LEJA 4LW4A 1Z1DA 5D5SA 2PMUA 4RGXA 1Z05A 4BHCA 2AY3A 4E1OA 4EB5A 4RJYA 3BDDA 5E1XA 1LC8A 2PI0A 2FYFA 1IN6A 1J59A 2NS0A 3I5UA 3EETA 2JPBA 2YX4A 1W7NA 4F5JA 4MY5A 3HDOA 1HW2A 4GDYA 3K9TA 4IW7A 2XAFA 1AY5A 3PPLA 4XSZF 2OQGA 3W6KB 4Y0HA 2FQ6A 1HSTA 4F5FA 2KJCA 4CZZA 4CXFA 1SD5A 4I0BA 1CJ0A 3RBLA 3A8UX 1PFFA 5J8QA 1S09A 2PQ8A 5E8IA 2VMQA 1IX6A 1R23A 3B1EA 2BI9A 4AOAA 3N0LA 5TF5A 1FSEA 1XGMA 4P9FA 1LNWA 5FLXK 1QISA 4WWCA 2BEOA 3FM5A 1J9IA 4QGRA 1CZEA 1QGNA 4R8DA 3U1DA 1XDSA 1C0NA 2ORDA 2W8UA 1EH8A 1JG8A 3E5UA 2Z1YA 1PG8A 3PJ0A 1SMTA 5D8LB 4H0EA 4W1XA 5M4BA 4EJTA 4U1TA 2KIFA 5BS6A 2GMUA 1SD6A 3FTBA 1S0AA 3A9XA 4TV7A 3PD6A 1GVJA 1LS3A 1YIZA 2VMOA 2M1BA 1YYVA 1XGOA 1AHYA 1YNUA 3MCZA 4K2BA 2W7EA 4ZZDA 3VFZA 1O3RA 1FOKA 3MKJA 3I53A 2BKWA 4TN4A 3ZMDA 1IF1A 4WXDA 3ROUA 3BJ6A 4G7OF 4KXKA 2W8JA 1K79A 1TPLA 2D63A 3WTWC 4F5KA 5F1RA 3A9ZA 2G7HA
chains in the Genus database with same CATH superfamily
1VNDA 2GQNA 1VZ0A 4F5IA 3UNGC 1PJRA 3L2QA 1O4SA 3DFGA 1O3SA 1QPMA 3LQRA 3H3UA 3CJTB 3F6TA 2E36A 2HQRA 3RCOA 5FKOA 3AELA 1ON2A 2GQQA 2WAQA 3RZDJ 2XSJC 2CO5A 2Y0MA 3TOAA 1OATA 2BBYA 2LDUA 1GVDA 3F8BA 4IVNA 1RNLA 3DU4A 4XK4A 2FQ3A 3AEJC 1FYLA 3C2BA 4KISA 1FT9A 1R1TA 1DP7P 5FLVA 1AKAA 2CFBA 2DR1A 2L7MP 4OYTA 5EAAA 1IRZA 3WODF 1B1BA 3AG3H 3ERED 2FEZA 3GFLA 2AEVA 3Q9VA 1MNDA 1BQAA 3ZQLA 2OUMA 2RV8A 4HF2A 1OHVA 4RGSA 3ATHA 5G4JA 2HUIA 3QP6A 3OL4A 3HM5A 4C2UA 3WTTC 1WYVB 3RI4A 5FRMA 2DW4A 1GEWA 4PVFA 2MH9A 4MHGA 1MDMB 3BCAA 4LITA 1IXCA 4PSXA 3KETA 4HDVA 2VONA 2VMYA 2ZJGA 3CQ5A 1GD9A 3PO3J 3PO2J 4CH7A 4F91B 1ARSA 4DBQA 4L9JA 4ZYDA 4QSHA 4DZPA 4EJUA 3LG0A 2ICWG 1ASCA 3PD6B 1IN7A 3IL2A 1I6HJ 5CQGA 2C0RA 3RQ1A 5BOXA 2WAFA 3FHNA 1B59A 1AKHA 3RQIA 1WJ5A 2KDOA 1LDDA 2ZUKA 3AENB 3TO6A 1OR7C 3BTIA 1GC2A 1OLTA 1BL0A 2CW8A 2QBYB 3FXOA 4GE7A 3V8LA 4TMRA 1X58A 4A6DA 3FVUA 2HUUA 5AIPA 4R5ZA 4MO7A 3JRCA 3NTJA 5F64A 2HR3A 3L2CA 4ETSA 2JPCA 4XQ2A 2VJIA 2WB1A 3L00A 3W3CA 2DA3A 4JOMA 2A6TA 1ASMA 3I59A 3H35A 1S72I 1BC7C 2OJED 1P4WA 3GLLA 5GAEJ 1JUSA 1LVAA 4S04A 3K1NA 4XN0A 3KZZA 1POGA 4L9TA 5M49A 5IWQA 1UHMA 3ZQCA 5GADJ 1QZ9A 2YCPA 5D6EA 4JX5A 3IWZA 1HKQA 2OA4A 2EILH 1T56A 1BJ4A 5DUKA 5KK1A 4CCJA 4F52A 3S1MJ 4XJPA 2R7FA 1FOWA 4BQQA 3GSBA 2KISA 1YX3A 1MDMA 4HX8A 1EQBA 4IOAF 1FC4A 1CL1A 4CBRA 1LKXA 2L7ZA 4IQJA 2PBIA 3ISLA 4MEYF 2YKVA 3J80K 4G7ZF 4BEHB 1LEBA 3K10A 4FCYA 3FRKA 1SF2A 3OS1A 1C7NA 5LHHA 2G9WA 4Y4RA 3ZMTA 1GDEA 1B9NA 2DT5A 2R5CA 4BHPA 2QYOA 4D5FA 1OCTC 3QHXA 2LH9A 3E2FA 4UVAA 2JT1A 2Z3YA 3JAMK 5F08A 3RZOJ 1J5YA 1Y1VJ 4LLGF 1WSTA 4QWQA 4ASNA 4A6TA 1KQ0A 3KYLA 2DA2A 2OAZA 2XF6A 5CVJA 5H6QA 4EJVA 5EF6A 5CYVA 2R7XA 2VMRA 1G59A 3H0GJ 5AX8A 2DAOA 3CUQA 3OYJA 1BOAA 4EU1A 2OZUA 3FDYA 3PSIA 2M9HA 3K1PA 4ZYHA 3KFWX 1MMGA 4YRVA 1RVUA 5LGNA 2QWWA 2Z67A 5DM6F 2R3SA 2Y31A 3LWFA 2AEUA 2HXIA 1OCOH 4B09A 4DJAA 4WB0B 4LG3A 2V1NA 3LQQA 1IW7F 3DPUA 4AU7A 2ZSIB 1SFKA 4I7HA 1IV6A 3MBBA 1IRXA 3RI6A 3BG7A 2C7TA 3LAJA 2H6CA 1OXOA 5HLTA 1WJEA 1QIRA 4C3IJ 1KU2A 4UNOA 3IP4B 2JVHA 2DMQA 3JCUC 3QOEA 5IT9Z 5EG0A 3HB9A 3BQYA 3BG6A 1T8IA 3MC6C 5IT3A 1FBUA 2HGCA 3CDLA 4EGZA 1D1CA 3RPUA 2VBYA 1KYZA 3F8NA 4MIMA 4NC6A 2M45A 4HOBA 4U0YA 1ZGJA 4EFFA 1ORDA 1Z3XA 4GCVA 5HVQC 5C4JJ 4YFNF 3HEFA 1JKPC 1REPC 4GYIA 2Z61A 2A05A 3DTKA 4F5MA 2X3LA 4BGDA 4XRSG 3PIPF 2UXNA 1JGSA 2EFPA 4Y3OA 2EV0A 4OIPF 1S7OA 2FNAA 4WYCA 4HLYA 1FC3A 2OCEA 5J1UA 2VMXA 1R49A 1CZCA 1TT5B 1M1EB 2FX0A 1MGTA 2FNUA 3VOEA 2R7SA 2PMZA 1N75A 3LNQA 1IN5A 2VXZA 4A3IJ 1TWGJ 1ETYA 1ZKGA 4MEXF 2KQRA 4XOPA 1ASGA 4MKKA 1X1DA 3K4BA 2BY3A 3TL4X 3IAS2 4EJOA 3PJRA 2ZJ2A 1N78A 3F72A 1RR7A 3RUYA 3L2VA 2Z9OA 3S1NJ 3DPTA 1ASAA 2AXTC 2V4JC 2W82A 3ZMVA 3BB8A 4F5GA 2LVSA 2LR8A 4MKJA 4BQ0A 4P7YA 2JA2A 1JT0A 2E5ZA 3B6AA 2ZP7A 3A03A 2VJ4A 3UAKA 5EG0B 1TOKA 4BQNA 1AU7A 3FXRA 4D0PA 2FF4A 2E7JA 4LNLA 4HZFA 3GETA 2DBBA 3WTXC 1QZEA 3RKWA 5K7ZA 2R7TA 4LC3A 2F4IA 1YJSA 3PNTA 5IOZA 3O8GA 4NOGA 2NOJB 2K9NA 3H36A 5E20A 4HYEA 2Y9YA 2MC4A 2JQ7A 4M6XA 2M30A 1MJBA 2Q8KA 4RKCA 2HOTA 5FT5A 1MMSA 1T38A 4BL0B 2V6EA 3MADA 5J47A 1EH6A 4MLOA 3C18A 1A5JA 4BUPA 3R4KA 3H0DA 3CCEI 4W97A 1UKJA 3OKSA 3BG3A 1LFBA 1ARHA 4XKWA 2O6GE 2FU4A 2ZXWH 3BCXA 3J7YJ 3CQZJ 3BPVA 4OTLA 1HKTA 1YO5C 3W1HA 3SDBA 4OIOF 4CDGA 3PDBA 1OYWA 4LNMA 1IXSB 1R36A 2YCTA 2R7UA 3VYSB 2CQ7A 3AEPA 3B46A 4WP0A 4HF8A 2OF7A 2R7QA 1UELB 3HRUA 3ACZA 5J1YA 1PP8F 1MBEA 1T0FA 2OATA 3GBXA 2A68F 5IYCJ 1R22A 2WAQN 3I4NJ 2JSPA 1MH3A 3DLAA 2M4GA 1B72A 1YOOA 5FT4A 1FTTA 2ZMEB 3S2WA 2F5DA 3PL8A 2ESNA 2VOPA 1A31A 5E5IA 2Z20A 3BWGA 1MBHA 2OQRA 3DP7A 4A5MA 2VPLA 5HXXA 5E1WA 5J4VA 5DD8A 1P4AA 3E6GA 1WWXA 1G6NA 3H14A 3WKRA 1BBYA 2QKLB 3RKYA 4I8AA 2VQGA 3D1NI 2JJFA 1ENHA 4UV9A 2CSTA 2F4OB 2Y2ZA 2ZBKA 3GVAA 3TW6A 4MSOA 2YUSA 1BA5A 1W7MA 1M6SA 2E7UA 2R93J 3MAUA 1XCVA 2J5OA 2L7KA 2A6EF 2V1PA 2LOOA 1D7VA 2YHKA 1B5OA 5CLSA 1TQPA 1GHCA 3JW9A 2EZ2A 2VIXA 3MKYB 2YCNA 2DCEA 3OIOA 1QQIA 1MLYA 1XB4A 2XPVA 3JTHA 2D64A 4JEYA 3WGBA 3G2BA 4BQOA 4IHWA 2B63J 1R1UA 3DPLC 1X2MA 4ZDPA 3RKXA 5ICFA 5E18F 5M4DA 4DIQA 1EKEA 1A35A 2P8TA 3W1IA 1ZH5A 2W8VA 4N0WA 4W1VA 4ZLVA 1WKGA 3E9KA 2IBDA 2AS5F 1OYYA 4LMYA 4P55A 3OSFA 1ZLKA 1W5CC 4O3MA 1AMQA 3PUFA 2N8GA 1TW3A 3LSHA 1D8KA 1MKMA 2PJRA 1B5PA 1CS1A 1SFFA 1I29A 3LWSA 2E35A 3L2RA 1UZCA 2Y48A 4HG2A 2C6YA 5EQCA 3DBRB 2ID3A 5HLHA 1DP3A 1E5EA 3EI8A 2NVTJ 3BN1A 1YIOA 3QM2A 2XPWA 2GIVA 5M3MJ 2O8KA 4RM1A 2PJRB 1P4XA 3VYRB 3QAHA 3VK2A 1WI3A 4HF1A 4L0ZB 1F9NA 3EPZA 4FASD 1KQ8A 3GXOA 2VOOA 3BROA 2X51A 2XASA 3FBIB 4P9UA 4ZWMA 4LOCA 2XGEA 1SFOJ 2VQLA 1S8NA 2W8WA 4WYGA 1F43A 3D6KA 1JJ6C 4ABZA 1U08A 3QWLA 3M07A 2EA2A 2IA1A 3S8PA 3FHZA 1JE8A 2KZGA 2IS1A 2ID6A 2OGAA 4JEZA 1AAMA 1V72A 2K85A 2L9NA 2LKPA 3CCQI 2VIBA 1U2WA 2JJ7A 2GSAA 5L3DA 3JU7A 3H9GA 1TWHJ 2YRRA 1X2AA 2CH2A 1TARA 3IKTA 1OXPA 3AATA 1JKOC 1JHFA 3CCLI 1V5FA 1G7XA 1TBXA 3HPHA 3H3VK 1P7JA 2XB5A 1TQMA 5LLQA 1O4XA 1P3WA 1AHEA 2IS6A 3EIAA 4U7DA 5KCMA 1MNEA 3BZCA 2R92J 3GF2A 5ICEA 2LY9A 3MZHA 3ABKH 1VTNC 2DQRA 1YJZA 5BPDA 3DRDA 2ZNYA 3KYDB 1SANA 2BWNA 4KNYA 2WY7Q 5KNLA 1ACIA 1T39A 3IF2A 4II2A 4XKBA 3OYLA 1B9HA 4XLAA 4HX7A 4OIQF 4X1EA 3ECHA 1FP2A 4MTEA 2R5CB 3SJMA 2X8UA 5M3FJ 3FSLA 3VOMA 4RAFA 2DOAA 2LK2A 1S3JA 4CCOA 5EJCA 3C2GA 2W57A 1H9TA 2ZB9A 1BJOA 3SQNA 2C81A 3M4OJ 1DJ9A 1E17A 1LFPA 2YKUA 4BBRJ 3V42A 5DCMB 4M9ZA 3QPGA 1KU3A 1ZYRF 2XKOA 4A3CJ 3CCSI 2OKJA 4RB1A 5EEGA 5BQTA 3SYTA 3I4MJ 3K4KA 4IYOA 3OYBA 2FRHA 2UXXA 2BI5A 4ATPA 2RQPA 2ZSLA 1XG1A 1PYVA 1H89C 3BR3A 3S2DJ 2OC6A 3RPUD 3BR6A 3WU1B 3QQAA 4YFKF 3QN6A 3DTEA 1KYWA 4AVPA 2DT6A 1XI9A 1LW5A 1Z7UA 4KMUX 4LGWA 4RKDA 3CESA 4G94A 2NOGA 5L3GA 1ZODA 4E7JA 2MG4A 3D5LA 2L02A 5E17F 2EPJA 4AC0A 5GTHC 1G7WA 5IYBJ 2A69F 3QPLA 2EIKH 1RETA 2GXBA 2JJEA 2VMSA 4OWRB 1WQ2A 2ZXJA 1B8GA 1ODDA 3FDBA 5G2PA 1NK3P 2JISA 2B7EA 4H51A 4CUGA 2CY8A 1I3QJ 2HOXA 4WXBA 2E34A 2GZWA 1FSHA 3AL0C 3V8KA 1KMJA 3CCYA 3K0LA 1DDNA 3W6JB 4GSAA 2EZHA 3GTJJ 1EJ9A 1D0YA 3M9AA 4JEWA 2YRIA 4J00A 3QODA 2ETHA 1IV8A 2NS8A 2P6SA 4WBTA 2W7LA 2MD5A 3ZQGA 2BHXA 5K8BA 2ECCA 2WBMA 2WY8Q 2Y9ZA 2STTA 4UHTA 1BJWA 4N4OB 3LVJA 2CG4A 3F8MA 1FYMA 2PFBA 1W4MA 2HZTA 4E70A 5G0AA 2M7BA 1BT4A 3E7LA 4A5NA 3GZCA 1X29A 2VKDA 1YQAA 5IOYA 4ENJA 2GM4A 3HQTA 2CUEA 3E1SA 4K2MA 2H8RA 3OYGA 4M3EA 1TASA 3GW2A 3M5UA 1OFCX 2R7OA 2NYXA 5HLIA 2RFVA 4M74A 3H5NA 3EUHC 5LGTA 3A01A 2VQCA 4LK1F 4BMKA 4B1RA 4IHXA 3VK4A 2XAGA 4N9HA 1XS9A 2ZXIA 2XGCA 4O6JA 2HNHA 1LK9A 3E97A 5LRSA 3G7QA 1HW1A 3JREA 3KP7A 3BCBA 3BR0A 2CUFA 2I10A 4IHYA 2XVCA 5DDGA 1IZ1A 3FVXA 4ADDA 2HQAA 1AMAA 2DMTA 4EB7A 1MAPA 4UUSA 1Y8RB 4IPAA 2O7CA 4DGTA 2DPDA 2NVQJ 2DQLA 1MZBA 1ULYA 3FF5A 1GUUA 5EUEA 1XCBA 2A61A 3EI6A 4RA2A 1SZKA 2F8JA 2AY4A 1Y6IA 3FZ7A 1SC7A 3QBOA 4RAZA 3AOVA 3LFUA 3RDIA 4DW6A 3EYIA 4PJNA 5AONA 3PDXA 1SAXA 3P1TA 2K4BA 3UE8A 5GPCA 4XK1A 3BY6A 1MIJA 3BQZA 3K7AJ 4PFPA 2DI3A 1AMSA 1FYKA 3AEMA 2W24A 2ZSHB 1S6LA 3NWSA 3NQOA 2K3PA 1YW9A 3REOA 1BR4A 5HNFA 4BE2A 4ZAHA 2MABA 2R7RA 2FN6A 2K9LA 1P2FA 2HKXA 3F0CA 2BIAA 2ZC2A 4N9IA 4LLLA 1Z3ZA 4BY7J 1X3UA 3CCVI 1B9IA 4J5UA 1BJZA 4ZC3A 5AIQA 2JA6J 4UOYA 4ATQA 2ISYA 2HOSA 3EIBA 2JWTA 2FOKA 1VQPI 3FD0A 3I58A 2V1UA 3ZRRA 4HF0A 4RITA 1FG7A 2UV1A 1ZN2A 1ZR2A 1DGWY 3BS8A 4KITB 2HEOA 2XAUA 2V9PA 2G0EA 1D8JA 1CGPA 4XLPF 2XF7A 1K4SA 3OL3A 4BA4A 1Z21A 4NB5A 4PSWA 1GBNA 1RESA 1YG2A 2KRFA 2NAZA 2Z33A 4J19A 5LRRA 4C3HJ 2CH0A 5F0HA 4PZJA 4S05A 1LW4A 4WD2A 2JZYA 2EH6A 3GCMA 3F0HA 1QZYA 1JXSA 2K40A 2X6WA 2E7XA 4A93J 3EI5A 2PG4A 1D7SA 1ZGAA 2X6OA 5J40A 5KAFC 3GTKJ 2KT0A 3COAC 4XRFA 1VF9A 3ABUA 1EH7A 3OMYA 4GXOA 4KN4X 5EEHA 3ZQ7A 1PUFA 2QM3A 5JFRA 1SVLA 2WC2A 5CQEA 1GDTA 4JF1A 5DM7F 1RZ4A 2DA7A 3Q9SA 3SZTA 2QLZA 3DKXA 3W2AA 5F6FA 2HU9A 1FX7A 2YR2A 2ZSMA 3O6BB 4ESBA 2EJRA 3CCUI 4LG0A 3KLNA 3Q0WA 3JRGA 4YIRX 2O1BA 1WH5A 3DQVC 3K1MA 3I59B 4W1UA 1DJUA 1FTZA 3HMUA 2UZKA 4M9SA 4RLGA 3ZP5A 1MW7A 1WJBA 2K27A 3F8CA 3MN2A 1ARTA 2G6WA 2KPMA 1NG6A 1WI9A 2L5QA 2WKAA 4E7KA 2VC0A 4ITXA 2AY9A 3ZGKA 2OGEA 2RAEA 3KE2A 1W7LA 4B3AA 1TNTA 5D8KB 3BJAA 3S17J 2W7MA 1SD7A 3IRQA 3F23A 3G0TA 1BI2A 1K78B 3BOQA 1FP1D 1H0CA 3GUDA 2GB3A 4Q31A 1ZTRA 2E19A 1X4PA 3PQJA 1R00A 2LNBA 4A0XA 2BHYA 3I55I 3GTQJ 2WK9A 3JWBA 3E6DA 3H5AA 2ADUA 5CVUA 4L0YB 2CTZA 2DKBA 3SXYA 2QQAA 3DU6A 2CWEA 1APLC 3X2QH 1BC8C 2E5NA 2YOBA 4HQMA 4WXHA 1IAYA 1IN4A 3LSKA 4W5KA 3WKSA 2V1XA 1QJ3A 2OCCH 2VLAA 5LEKA 3T32A 1HW5A 2Y75A 1U5TC 3WTSC 1HCRA 5IP9J 1SVOA 1R6RA 4GYGA 2QBTA 3J81K 1KKPA 3TFUA 1M7YA 4ADBA 4UB8C 1OYIA 2OTJI 2CQQA 4YIFA 2Y0SA 4HNUA 1KL2A 2VIAA 3VWBA 3P9CA 1GC3A 4M2KA 3KP4A 4Z6YA 3WZFA 2FUG2 2HYFA 3W6VA 2DOEA 4KDPA 2JK3A 5FT6A 3J80Z 1B8IB 3IH2A 5DCMA 2C44A 3NARA 1YITI 1HF0A 3K4CA 1C4KA 4ZASA 3ASNH 1Y8QB 2BV6A 4OMYA 4ZSWA 5EEAA 1X2NA 1Q1VA 2BIEA 1X3ZB 3DBHB 3N75A 3RYRA 2VQHA 2MD0A 1JTYA 4QIWN 5C6UA 1SPAA 1N77A 4HBLA 1AX4A 4E3QA 3KKIA 1U9OA 2JGTA 4A12A 3HSRA 2F6CA 3T5XA 2VT3A 3NUIA 3MAJA 4PJJA 4RDUA 5HLGA 4A3KJ 1M0QA 4AIKA 1MDZA 2XROA 1XN7A 1R4MB 5K5RA 2PB0A 2EBIA 1TOJA 3ZZJA 3VDXA 3DEUA 3JRAA 1P9QC 2GXGA 5ILVA 4K2EA 3GZ6A 2QQ9A 2VL8A 2X1DA 3E3VA 3JAMZ 2FBIA 2NVXJ 2KIUA 1LVKA 2FMYA 1WJDA 2OTLI 1GEYA 3BWNA 1I27A 1JT6A 2XRLA 2HQ5A 3BP8A 3F6OA 3RYPA 3OYNA 3R60A 2AY8A 4BJ6C 4RBOA 4ZYAA 4M6VA 1BJAA 1USTA 2ELJA 3HTUA 2HYJA 3NUBA 3W1JA 2BY1A 1AMRA 4PJMA 2X4HA 3VODA 1V2EA 3OYCA 3WLXA 3CMYA 4EATA 3HJEA 1B4AA 3J7AO 2LY2A 3CUQC 1LFUP 2VKVA 3AOWA 5D6FA 4U88A 4MGRA 1AHXA 2BYLA 2DGMA 2W7JA 1Z6TA 3FISA 4B3XA 4EM1A 2DTRA 1Y0UA 1VFCA 1N8PA 4RGUA 2W00A 3GBGA 4PJLA 2DA6A 1ASNA 3MVPA 3BG5A 1U8BA 4LW2A 4CCNA 1FIPA 1IDYA 4I98B 1IO2A 2HTSA 2LBFB 2YKYA 2CS3A 2EK5A 2HTJA 1HA8A 4AO9A 1LE8B 2H6BA 2MLKA 3F3XA 3CUQB 5JHFA 4U7BA 3MD2A 1B8IA 2AY7A 4CSWA 2VI8A 4XLCA 1OHWA 3QOPA 4B43A 4RJ0A 1CF7B 2Z1ZA 4RB2C 3S1RJ 1VQ6I 1QVUA 3FMQA 3S2HJ 1Z7DA 3MKZA 1I3AA 3PFIA 4UUSB 1HC8A 3KYCB 1IJIA 2NNNA 3DC1A 3IH3A 3GZDC 4HQEA 2L0KA 5LHGA 4XL9A 3BTJA 3P9KA 2MGQA 1B6AA 1IRFA 2DA4A 1FJLA 1IGNA 3BR5A 4DGWB 1G4XA 2DFIA 4RAGA 2QB3A 3RIRA 1CQ6A 3QP5A 1AJSA 2OV7A 4EM0B 5B3SH 2P0WA 2X0LA 3CJRB 1QO0D 2VGUA 4CCKA 2BIGA 3AEJA 2E1OA 4PGGA 1BOBA 3EZ1A 1J2XA 4L5JA 4IX7A 3AL0B 4ESFA 4CBSA 2RC4A 2Z2SB 2WADA 4BDZA 1Y1WJ 1VQ5I 2Q7WA 2O5RA 4B47A 3KZIC 2LD5A 4KA4A 3VP6A 5LH9A 1IRGA 2QENA 1GEXA 1TNSA 2VYCA 4ISYA 2FSWA 3K4JA 4B98A 1YW8A 5FFXA 2VBXA 4AWXB 2QMAA 4NQWA 3AEMC 3HSFA 5K1YA 2E7IA 4JEXA 2CUJA 3HOWJ 3EI7A 5GTIC 2XDVA 4A0HA 2ZYJA 3CCMI 2W48A 2K3FA 1JF9A 1MJAA 3R6SA 3U2RA 4Q6RA 2IP2A 1XC5A 1Y56A 3CZ6A 3M1EA 3JRDA 2XAQA 3ONQA 2Q1ZB 2P5KA 2LF7A 4XONA 2BVMA 4DYRA 4H4KC 3FCRA 1BI3A 2IJLA 1IX7A 2V1DA 1AHDP 1FEXA 3UR3C 1CQ7A 1RVYA 2FA5A 3A02A 4BNCA 3L8AA 2K9SA 1QRYA 3FIWA 4D7MA 2XC7A 2Z5UA 5D5WB 4UXNA 2K7LA 4ANJA 3KIOA 2L4AA 4XNFA 4G6TB 1PDNC 4ZTFA 4Q75A 4J01A 2HZDA 1G2HA 1C7GA 3O8HA 4FETA 4Y15A 3BV0A 4F5LA 4GE4A 2DA5A 2Y69H 2VMUA 2LP0A 2O03A 2A5YB 2Z16A 3CDIA 1BR1A 3LMMA 2QSFX 3QPTA 1T95A 2VXDA 3SEQA 3WGHA 2QQ8A 3N4MA 1DUXC 3TDZC 3JR9A 5M5XJ 5DJ1A 1IUYA 1IBJA 4HVKA 3LFKA 3J7AY 1CL2A 4FQGA 3FKIJ 3DLLF 5HS8A 2CSOA 4PK4A 1OQYA 1WYTB 1WYUB 4JK1X 1ZG5A 3H3ZA 3LA2A 1BI0A 5FD5A 3TKYA 2R0QC 1TT0A 2ZJRF 3J81Z 1J09A 4YFXF 2R5YA 4E7HA 5F8VA 2O7OA 2R7WA 2L4MA 4OMZA 4V2FA 1J75A 3OV8A 2VLFA 4A0FA 1A6QA 2IAIA 1TOIA 3FQAA 2LRDA 2BZTA 2IEKA 3A4CA 3GFIA 2HORA 2WA0A 2KHMA 2BI1A 3BZKA 1D7RA 3K70D 1N2TA 2BOLA 2VMTA 1S5LC 3NWTA 2KP6A 2JA5J 5FKNA 4BKXA 1FBQA 1WPKA 2V7FA 2STWA 2M34A 1MMNA 3AFHA 2W7IA 2DK5A 3OR1C 2CINA 3ZN1A 5C44J 3L09A 2VUMJ 1UG0A 4L9VA 4WK8F 1W0UA 3SZGA 3VSLA 4CXRA 3B73A 2LLKA 2HP2A 1KGSA 4BEHA 4G12A 4NC8A 1XDUA 2GWRA 4L5IA 2E54A 3HOVJ 4DBRA 1AKBA 4F5HA 4FE4A 1ZRFA 4U0WA 5B1AH 2QGUA 2QSHX 1NTCA 5DEQA 3VK3A 2QBYA 3A9YA 2RQQA 2QCOA 3PQKA 3K7YA 2FXAA 4BDYA 1L3LA 2HYGD 3DYDA 2E2IJ 2VODA 1V5GA 3EYYA 4IOCF 1O69A 2Q2EA 2WV0A 2QB2A 2VT2A 5JI6A 3MFKA 4HPQA 7AATA 2HKOA 5CVRA 2NMPA 5TRDA 2IGKA 4NUBA 5JLXA 1D2FA 4KMFA 2DKJA 4KJZA 1Z77A 3QGUA 1W5TA 2DTZA 3QPHA 3CTAA 1VQLI 4ZM4A 2M0CA 1F5TA 3ML6A 4LLNA 4IEJA 4QTRA 1AA7A 2XF5A 4N4NB 1E3PA 3Q0UA 4M9XA 3WE3A 4YG2F 2HOAA 2RGVA 1SAUA 1JI8A 4B48A 1KU9A 1ON1A 4Y13A 1T33A 1MDOA 2W4SA 3ELPA 3GWPA 2X48A 3G1MA 1OCRH 5FGMA 2X5DA 4DYQA 4R8HA 3WU2C 3QU6A 2B9SA 2EZIA 3LL7A 2JUCA 2KDZA 3CC7I 2XGXA 4AYBN 3II0A 1AICA 4AM3A 3BT9A 2YPRA 4L9NA 4W1WA 2QQBA 3QI6A 2OQXA 2EV6A 1BQDA 1MD0A 3NRAA 3B6CA 3HHHA 1YOVB 3OYDA 2GOMA 3E5XA 4M6YA 2ME6A 1YJ9I 5DTDA 2HZPA 1Y39A 1F1ZA 3WCNA 4A0RA 2PLYA 2IGNA 1I1GA 1T3IA 2DO7A 1BN5A 3QRFF 1YJNI 1Z3YA 2TCTA 3OR2C 2ZC0A 2E1MC 3KP3A 4ZM3A 2W7KA 1WJFA 2VC1A 2PMHA 4RM2A 3ABTA 4A2UA 4LJZF 2XGDA 4XLNF 2R5EA 1FLIA 4XM3A 3S93A 1TOEA 1F36A 3KE3A 3PNYA 4ON0A 3K2ZA 4UHMA 2K4JA 1YTYA 5D5XB 1BW6A 4M71A 2D2WA 2L2OA 2HDCA 3SHFA 4B9BA 3LSTA 2DT7B 3A0HC 2E1MB 3CLOA 5M5WJ 3ISPA 3DODA 3BZ6A 5A2QK 4DBCA 2XHKA 3D5SC 8AATA 3PSFA 5CVVA 1UCRA 2RNGA 1XPXA 3RKQA 3PM1A 2DJIA 2TPLA 1PP7U 1PUEE 2O61A 4JE5A 4MQPA 1NH3A 1O7FA 1TOGA 2FOWA 1AIAA 2MSYA 1RPWA 4KUMA 3ZQIA 3WGGA 1ELUA 4A6RA 4AIJA 5F9SA 4RB0A 5H6RA 4KYOA 4OMAA 4BXUA 3GZNB 3OSGA 3HKZA 4GRXA 5EIGA 2DYSH 3PIUA 3SEZA 1IAWA 4A00A 2CV2A 3K28A 1YLFA 5IP7J 3USFA 4UB6C 4KIGA 4E7SA 4UUVA 1VQ9I 1JKRC 1V55H 4FTHA 1NG7A 3GLXA 3E2ZA 3GX4X 2P5VA 2XKPA 1U5TA 3RQ4A 3W2VA 1XSDA 4UHOA 5EUNA 3BR2A 1TTYA 2DDBA 4RM3A 1MSFC 4ENMA 2H1KA 3DKYA 2IVMA 2VJJA 3OS2A 3S3NA 2EZKA 3MWMA 1ZRDA 3HVYA 3LVMA 2EFOA 4WF2A 3S3OA 1ETVA 2M87A 2DOUA 4F7ZA 2FNIA 3NRVA 3GZDA 5K5QA 1BJNA 1GXPA 3ABMH 1Z6RA 1YIJI 1ASLA 4JEVA 2VE8A 4EVIA 4JX6A 1V5EA 3KP6A 3HBLA 4HW0A 3HUGB 3E6MA 1ETXA 3M8JA 3R0JA 3CP8A 5IYDJ 1AAWA 1CQ8A 3EZSA 5TISC 1KA8A 3ZRGA 1QNTA 2MH2A 5E3OA 3A2KA 2KIQA 1E5FA 3LSGA 3K2AA 1JGGA 1D5VA 1JUMA 3MEBA 4OCAA 2MYSA 1X1BA 2P7VB 3TFTA 2CQKA 3DR4A 2ZCWA 5K7FA 3MKWB 2O0YA 2WWYA 3AEOA 3HT4A 2MW8A 1JS3A 4BY1J 3ECOA 4BHBA 4ZYEA 1TWCJ 1MGVA 4Y7NJ 4N0BA 3F22A 3RCHA 4PFOA 3ZRPA 3R0AA 1GC4A 1J0RA 4OU0A 4R2NA 5ICCA 3MEXA 4JQFA 1VEFA 3E5QA 1ZG1A 1AY4A 3ASOH 4I2OA 3L9FA 4D9JA 3FXMA 4A3GJ 5BJ3A 2VN2A 1HDPA 1V4RA 2YU3A 5F04A 1AOYA 2KZVA 2L9SA 4UQVA 1LKCA 4A3DJ 5FLXZ 1ARIA 3K4LA 4HSTA 2RN7A 3TGNA 1GV5A 2R5YB 3BC8A 1BW5A 3EUAA 2WK7A 3ZCOA 4M3BA 1BW0A 1I41A 2JJHA 2RVCA 2HPIA 2ZKZA 4XLHA 3MZ8A 1U9NA 3JRFA 1TLHB 5F27A 4IXSA 3ABLH 3JZLA 3WU0A 3N97A 2HOEA 4RAYA 4WXCA 2F5CA 1AJSB 1I48A 1E0EA 4IL6C 3FVSA 3CAIA 5A2QZ 2BXYA 1WYVA 2ZMEC 5DCFA 3ZMUA 4NC7A 3E2YA 1SVVA 4A0GA 1ONVA 4A69C 2AXLA 2PEXA 1ASFA 1KL1A 4OT8A 3Q3SA 5FKKA 1ETKA 1YI2I 3CMMA 2ZFWA 2DFEA 3T1BA 4EGYA 9AATA 4LB6B 4WYDA 4V2GA 1R58A 4EQQA 4IHSA 3WGIA 4AIHA 1M4NA 2YKXA 1R5GA 3PNVA 1D0XA 3HOUJ 2R7ZJ 2D5YA 1RKTA 1J32A 4XR6A 1K83J 1YJWI 1X0MA 2XIGA 3WX9A 3HL2A 4FFCA 2CFOA 5TGTA 1IN8A 3C3WA 5J4YA 2W7GA 3NYSA 3A1YA 2IGOA 3FX3A 1I1SA 5M46A 1DU0A 1FPQA 1S29A 2XPUA 4OOIA 2W1OA 1YJYA 3NDNA 3Q0VA 4C30A 3TATA 1MDXA 2R2NA 2FQ4A 2OU2A 3QYEA 5E8GA 5L3BA 3GTGJ 3IRRA 1R9TJ 2VGZA 1B9MA 4HA8A 4KICA 1HKSA 3DXVA 1WHUA 1XSXA 1BM9A 4E7ZA 4XRMA 5HS9A 3K6GA 4Q47A 3SZPA 1C9CA 1QVTA 1H9GA 2AQEA 1S07A 2DODA 1RI7A 1R5HA 3BG9A 5HDGA 2EIMH 4G7HF 4XKVA 2BE5F 2GLOA 1WYTA 4LFUA 1X4OA 3WHBA 1OHYA 4B4CA 1AKCA 4IF4A 4OINF 3FXLA 3FKJA 3CMEI 4A72A 3WE2A 5DJ9A 2FBHA 1DTYA 4Q76A 4A0YA 1F4KA 4BJTA 3R61A 5EAVA 3IC7A 1W7PD 3MKLA 5D4SA 1MBKA 2PN6A 2OKKA 3ZMZA 1N25A 1HSJA 2KRCA 4BA5A 2JN6A 1EA3A 2E1CA 4MQVA 4KIFA 4YEJA 3HOYJ 4XORA 1ZHFA 5DB5A 1NK2P 3UWCA 2E1NA 4AVZA 4IKFA 2L7FP 3B1DA 1WVRA 4XMYA 2GA2A 4HV6A 1N31A 4BE1A 1G3YA 4M3DA 1Z7LA 2VKHA 3G3ZA 3E6CC 3EUCA 1XMAA 1PUFB 1KQ9A 1W7PB 1V2FA 2CRGA 5LFAA 1A6IA 4ZJZA 3PDBB 1E2XA 1U3EM 4GGGA 1RRJA 1J04A 2COMA 2QEXI 1RR8C 1ZOBA 3RPQA 3CD6I 3HC7A 3I56I 2DYRH 3DKWA 1SZUA 4IXOA 1VQ4I 1FG3A 4PCQA 4NHJA 4GDFA 2EO5A 4XEWA 5ILUA 5ICGA 4XIDA 2W84A 2W85A 2OPTA 3N5MA 3SFIA 4B44A 5L3CA 4KAMA 3EQLF 3LA7A 1AJRA 3P9IA 1YFHA 1G4VA 5ERIA 2EFQA 2CJDA 2CYYA 4W8IA 5B5EC 1D0ZA 4HV5A 5J8FA 1JTXA 1LPQA 1LQ1A 2BYVE 5FKMA 2JSCA 1MAQA 5HHYA 2W25A 3ZN0A 3BLYA 3DXWA 1LDJA 2VMWA 2FE3A 2H1LA 2V6CA 4JBAA 3F6VA 2K5CA 2F4MB 3D5RC 3GYHX 2IS2A 4IJAA 2HVRA 4IX8A 1UU1A 2HWVA 2X5FA 1YE9A 3ECDA 2IA0A 4I76A 2DOFA 2JJGA 2L9RA 3DF8A 5CKTA 1O62A 2H09A 3JTGA 4HSRA 4BBSJ 3AAFA 2D1VA 1ZAOA 4XKCA 4WYAA 1TP4A 2X85A 1Q1HA 4ZH4F 3OYIA 3MAFB 4NNJA 3PGYA 2D1HA 3I71A 5LGUA 1DGEA 5CVIA 2L54A 3NAUA 5EDNA 2VGVA 4HAMA 3JSOA 5FT8A 3O3KA 1YW7A 2AQFA 3TW7A 5B66C 3HOTA 4CCLA 3G73A 1IDZA 1AHGA 3CBFA 2W7HA 2WTEA 1Z67A 4WLHA 3RSNA 3ZRQA 3A0BC 5HDMA 3V7RA 2BI2A 3FZ8A 2MC3A 3FK7A 4ADCA 4IRGA 1ORKA 1FIAA 2OD5A 4WB0A 1ERDA 1VQOI 1OPCA 3GMEA 4RGRA 3B02A 4DQ2A 2DGKA 5IPAA 3I3LA 5FROA 5JLWA 5HOOA 3JRIA 4O6ZA 1FNNA 1ZARA 2PO3A 3JSPA 3CCJI 2VGWA 3BTLA 3TQNA 1X3WB 2AY6A 4GFBA 1NHAA 2VI6A 1IXRC 1W1WE 1LDKB 4Z2YA 5DS9A 5LBQA 2D65A 2ZNZA 2EQRA 3ERMA 3V4GA 3M8EA 5B1BH 1QHHD 3FXUA 2TDXA 4CYDA 1FZPB 4KN7X 4KFCA 3HLMA 1DPRA 2M3AA 3HGYA 1ASBA 1O61A 4RS8A 4WXGA 3CJNA 3TCMA 3NU7A 2CFXA 5D4RA 3HTSB 1P92A 4KYWA 4I09A 3UKGA 2UWMA 4IHTA 2PB2A 3OP7A 1B4XA 4M3GA 4HRIA 4C9YA 4AH3A 2BW3A 5F0CA 4IHVA 3HG9A 1IAXA 2IW5A 1WYUA 2NVUB 2P7CB 2DDAA 1MMAA 1V54H 4Y0DA 5FO5A 1GCKA 2NS7A 4XJOA 2ZXHA 3HRSA 5DUIA 4JE5D 3FMSA 4EV0A 4HNVA 3HUGA 2Y0SN 4BYYA 2KLOA 2BW3B 4YELA 5DYMA 2BGCA 1O57A 2X6XA 3HYIA 5TJJA 2GIZA 3CCRI 1VQNI 2CQNA 3QYFA 2V9VA 2QVOA 2ESHA 1M0NA 3F9TA 1T6SA 5G4IA 2F5VA 2VBZA 2KIMA 2LY1A 2XRNA 2LF8A 3FXJA 2H94A 3COGA 2NRAC 3VYTB 1FOXA 5G2QA 3MAFA 3L7WA 1C0WA 4LB5A 3WTYC 2XBNA 4FX4A 4IQ4A 1SFUA 4JYKA 4B8XA 4FX0A 1A04A 1QJ5A 3K40A 2PX9A 3RJPA 1AKHB 2D66A 1ZELA 4MQQA 2W8TA 2DLLA 1W36D 1DKAA 3WCOA 3LSPA 1WH7A 3CMAI 1HQCA 1ZG3A 1TL8A 1D7UA 3DWLE 3LSMA 2ELKA 3ZQQA 1VP4A 1IC8A 2ZJPF 4ADEA 2YSRA 5F1JA 2BVLA 2XAHA 4HNTA 3S14J 2CB1A 5J6XA 2JRTA 4CYCB 1MNMC 1UMQA 3M1CA 3IKVA 5ILSA 1S06A 3G1OA 1GV2A 4BS9A 2FD5A 1ZREA 2QLRA 3GZ5A 5G09A 3NEUA 2WB1N 1W3UA 3KEOA 2VGSA 3WG9A 2HPMA 2VPRA 3HDDA 3NNKA 5GP9A 2PJPA 1M0PA 4HLXA 2LSOA 4CYCA 5LHAA 2DJNA 1SFXA 2H27A 3F21A 3E0JB 1R7JA 3CJQB 2VLHA 3IV5A 3F9KA 4AIDA 4J8LA 4Q48A 2DA1A 1WSUA 4BAYA 1UU2A 5DX5A 1DFOA 3MMYB 2BI3A 2XV4S 3MZYA 4XQFA 3BJOA 2MFZA 1VI0A 4CICA 1H88C 2F5EA 3GFMA 2MA3A 1S9HA 3CQ4A 3FQ7A 3LSRA 1BR2A 1I5ZA 2K86A 4A0ZA 2R7VA 3VSKA 1JHHA 1MBFA 2KJBA 2MLGA 3A01B 2E71A 2OZ6A 3ASBA 4M72A 3GWZA 4PFNA 1ASDA 3AG2H 3GTMJ 4FHTA 4KT5C 1JS6A 4R5FA 1XMXA 2VMVA 1KZHA 2LKSA 2X9DA 3WHCA 3H1CA 4EMYA 3HZJA 2NNYA 1ZGWA 1AY8A 3HHGA 1MH4A 2X1EA 1W5SA 3GFJA 4ZWVA 4BU2A 1Z0XA 1H0MA 3WG7H 2QZ8A 1FWZA 4UHNA 1TQIA 2E2JJ 2M0MA 2M8EA 4P1WA 3E6BA 5EFSA 1V2DA 2BWPA 2CJGA 4JF0A 4IY7A 3K4NA 3HKZN 5LHIA 3OOPA 5E1ZB 2CW0F 2VI9A 3LVLB 4AZKA 1HXDA 1QU3A 1P7IA 1DQUA 2EH3A 2HUFA 1K78A 1OCPA 4R1HA 4ENKA 3K69A 3DZZA 1Y0NA 4P96A 2M7AA 1H1CA 4WLJA 3KZYA 2JTVA 5L3EA 1K61A 1W36C 2GA1A 2CH1A 2JG2A 3JWAA 1G4DA 1UB9A 1ZRCA 1U0JA 3TDUC 2AY5A 5E3KA 4NDLA 4M3FA 3HIFA 2P4WA 1ZK8A 1U5TB 3TEDA 1K4TA 2M4KA 4BQAA 4MNUA 3DXJF 1UFMA 4CZCA 3HOZJ 1DJEA 5E3NA 3TO7A 3ASAA 2ZFUA 5E79C 1O3TA 1HDDC 2KFDA 3ZXSA 3B1CA 4MQRA 1XSVA 3I4JA 2GAUA 3FXKA 4C2MJ 2ZJQF 3EDPA 1WGXA 5FFZA 3DV8A 4LIUA 3HRTA 5JR3A 1ZLJA 3QU3A 2CMPA 5H2FC 4OBVA 3KCCA 4WXFA 2HS5A 4L18B 4UVCA 2DFFA 2IPQX 3IUOA 1E3HA 3KGXA 4E3RA 2KMUA 1BKGA 2M8GX 1EV7A 1WCMJ 4QPOA 1W7PA 4EMSA 4UUTA 1ETQA 2LC2A 1UU0A 2DU9A 5JVGF 1W23A 4AZJA 2M5WA 4BE0A 3IHUA 5HS7A 4PUSA 4M2JA 2EWNA 4CXQA 1YHQI 1IUFA 2BY0A 2EFNA 3HGGA 3MQ0A 5J8CA 1SEUA 1CF7A 1DGDA 3CP2A 3I4PA 4NBQA 5EGOA 2JA7J 3VB2A 4MQ9F 3RCHB 4XAUA 2K9MA 4HX4A 2LMDA 5F0FA 3LV2A 2VMNA 3AENA 2ECBA 1OMIA 2HVQA 3GEZA 3FQ8A 2HVSA 2A3SA 2XB0X 3IHJA 1U8RA 2O9LA 3JTXA 2VB6A 3CQ6A 2LYCA 5I92A 4IXAA 2YU9J 4I01A 1ZC9A 3MC6A 3HPGA 1CQTA 2YX7A 3TQXA 3L1PA 4U0VA 1TATA 3VAXA 2H8WA 3I64A 1M0OA 1WKMA 2FMLA 4GEBA 3ZMSA 5DD4A 3CO7C 2VGTA 3FZVA 2BHZA 3GJUA 3LVKA 2LKXA 1STZA 1MBJA 5KAIC 3GTOJ 2A6HF 2DMUA 2RDPA 4C3JJ 3GTPJ 1LC5A 2Z9WA 3G8MA 1OR7A 4F55A 1SVMA 1LUJB 1UJ8A 4P3MA 1U6GA 2ZO4A 1KKJA 1XD7A 4G6QA 3CC2I 2Z9VA 3IAM2 5FLMJ 5L3FA 5EZHA 4D1QA 2HQNA 2D45A 2P5LC 4ZZLA 1T2KA 4IYOB 3PUBA 1Z9CA 4X6AJ 1UAAA 1V3FA 2EZ1A 5E3MA 4RB3C 2CJJA 1G3WA 1UHSA 3Q8NA 3VYUB 5D5UB 3NX3A 3G1LA 3OY9A 4OC9A 2XUBA 1UHWA 1GLNA 1R4NB 3C1DA 3OOUA 4A3JJ 3ELKA 4A3MJ 2EGYA 3FXQA 5EZGA 4D7NA 4EJWA 3S16J 1MJ9A 3I5TA 4A6EA 3DTIA 2VMZA 5BJ4A 1T08B 1S7AA 1RIOH 1X1CA 4GO1A 3U21A 3WTVC 4CGZA 3KPHA 3S3MA 1YS6A 5BMZA 1O7LA 2NVYJ 5FB2A 4LG0B 2A5WA 3TP3A 2ACJA 3I0TA 4Y17A 4WCGA 3KX2A 4JP0A 1AHFA 1S08A 4BHDA 2QKMB 3HBXA 1FOYA 1HBXG 1PVEA 1TC3C 1KMKA 4F4EA 2GOXB 1YAAA 2FNPA 1OCZH 1KONA 4P5OA 3K4MA 1BIBA 2CW7A 2X6YA 2IA2A 5EGOB 2RREA 2LREA 2W7DA 2XH1A 3EI9A 6PAXA 2O8XA 3G4SI 3CF2A 2L01A 1QPIA 4IRIA 1I6XA 2CUZA 3GR9A 2FBKA 4E7LA 1G8XA 4Y0IA 1SFEA 4AYBA 2GMSA 5FJ8J 2F2EA 2VJ5A 3U1KA 3ZQHA 2L3DA 3AV7A 4PIWA 2Z9UA 4GRIA 5EIGB 2DK8A 3Q5FA 4OAZA 4V19K 1GC0A 5D95A 5FD6A 1ZQ3P 3E77A 3V7SA 4CHUA 4ITGA 5H20A 1RC9A 1SD4A 2HOYA 3NYUA 1BI1A 2DPUA 1EJIA 5E4ZA 3AG4H 2D7YA 2BYJA 1YRNB 1IVRA 3F8FA 4F92B 2LG4A 1YS7A 3PAAA 4E7IA 2JRMA 1EG5A 2VMPA 3R4TA 5GAGJ 1KU7A 1XTAA 4UVBA 4ZSYA 2HFHA 4DZJA 3VPRA 5IY5H 1LEAA 1AWCA 3ELEA 3CO6C 2CV1A 3G71I 4XOTA 2QF7A 3LA3A 1JJ8C 1ETWA 1DGRM 4WX9A 3HXLA 3S1QJ 3RBFA 2JA8J 3A2BA 3V8JA 4EM2A 3T0YA 4L5EA 2F48A 2HXOA 3DCFA 3HOXJ 2B0LA 1QA6A 5IT9K 4L0OA 2P81A 2VBWA 3OYHA 2QSGX 1WRJA 4E4HA 1R1VA 2D7ZA 3FFRA 1T98A 1WZ2A 4BXXJ 2D61A 4I0AA 2HP1A 4RAEA 4LIVA 4ZTJA 1JKQC 1B72B 4AD9A 5CJ9A 2CJHA 3TBIA 4LNJA 4IZZA 2QUFA 4RIZA 2G7UA 1QBJA 3CUOA 4O5VA 3ESWB 1QITA 3H9QA 5K5OA 3I9V2 3P5JA 2CV0A 3OIQA 3L2WA 5FKLA 3V7CA 1WFXA 2EINH 1G3TA 5E3LA 2Q0OA 4G6DA 2OBPA 1XEYA 4Q5SF 2HOZA 5BPIA 4XJLA 5EUDA 3U9GA 3I54A 1QGPA 4MTDA 4M73A 3KGWA 4ZYGA 3H5RA 2HI3A 4MFEA 1EF4A 1BS0A 2VKEA 2XSDC 3CC4I 4YIIA 1C7OA 2DGLA 1X1AA 2GXAA 2EB7A 4IO9F 5DV5A 2AY2A 1AIBA 1D5YA 4I99C 5D5VB 1SZSA 4G9YA 1LB2A 4K2IA 4A6UA 3T8TA 2R7DA 3E2ZB 2YS9A 4ENNA 1RV4A 2AY1A 5JAYA 3T8RA 3LAPA 1LJ9A 1I43A 2J5PA 4BH9A 1BJOB 2ZMEA 3KP2A 3HRMA 4E77A 1RUNA 2RKHA 2D5VA 3BWNC 2KL4A 3OS0A 2F5FA 1OISA 2AATA 4W91A 4WYFA 2V79A 2R4GA 3L44A 1YRNA 4AO4A 2Z99A 2XAJA 3JRBA 4KIBA 4LD5A 1XGNA 2DN0A 3IH4A 5M5YJ 2ELHA 3KEYA 1GT0C 1IUGA 4LK0F 2O3FA 1Y4IA 2ISZA 2L9VA 2P6TA 2CQXA 2JVGA 2WV1A 2DMPA 4OBUA 3PIOF 2WAEA 4A3EJ 3ZOBA 2K02A 4ZDLA 2KKOA 3H7FA 3WGCA 3M7GA 1UG2A 1ITYA 3CLQA 1FMWA 2LBFA 2W7NA 3EUHA 1WKHA 4RMNA 3DBLB 3K70C 3M8FA 4FL0A 2IGMA 2NXNB 1JUPA 1XGSA 3OIPA 1ASEA 4G8XA 2EV5A 4U87A 4DQ6A 2DMNA 4OIRF 1MSEC 2Y30A 4CCMA 1YIYA 1VQKI 4HDUA 3OYEA 3VEPA 4PFFA 2V26A 1MLZA 2E7WA 1IX8A 3O2PE 4A3LJ 2V0YA 1OKRA 1QZZA 5EYRA 5GPAA 1RV3A 3B8XA 1OJLA 3IWFA 2CGPA 4AUXA 1X19A 1PMOA 1RUOA 4UY8I 4CVQA 1J7KA 5KVRA 4ESJA 3FMRA 1D1BA 2R5ZA 3H9JA 3FK6A 2COBA 3FFHA 4RLFA 1MMDA 4XSXF 2EZLA 3M3YJ 3KP5A 3PA9A 2FM1A 3P6KA 3NYTA 3BPXA 1M32A 3LY1A 5KHDA 2HDWA 4XICA 4WYEA 4BJ5C 2HDDA 3FKDA 2EFWA 4GE9A 2E2HJ 2BY2A 3BTCA 1GXQA 5HDKA 5ED4A 2IRFG 1W0TA 1VJOA 3P7NA 1VQ7I 3OYMA 3DEWA 4DNCA 2KRHA 2MBFA 3QYBA 3TMOA 1ELQA 3W2WA 4HEA2 1D3YA 1Z91A 1DPUA 4OAYA 4R79A 1G3SA 4QLCU 3FZ6A 1ARGA 3TOBA 4I02A 3ULQB 1K7AA 1X28A 4CO8A 1LC7A 2I5UA 3PFYA 3KEQA 4PGHA 2IXSA 3CDHA 3GO5A 3GTLJ 2Q2EB 1A36A 4XBFA 3WTUC 3R9AA 3DU5A 2W7FA 1USSA 1TZLA 2A07F 3TP0A 3WTZA 4MFDA 4FE7A 3JRHA 5HDNA 1K6OA 2WK8A 3I16A 2Z9XA 2O0RA 1XMKA 2DFHA 3N05A 2R0TA 3OYAA 1SMYF 4IXZA 2R5ZB 3ZR8X 3HSEA 1FY7A 1WJAA 9ANTA 4ZDOA 1ECXA 3JW4A 3TO9A 4FT8A 3DR7A 2BXZA 2EA4A 5J3LA 3KLOA 3RTRA 3WY7A 1R71A 3SFZA 3H92A 3AKZA 3OYKA 1MBGA 4CA0A 4I6ZA 1FMVA 1X1PA 1U78A 3HOSA 1DU6A 1TWAJ 3C7JA 4F3QA 3SDGA 4XJMA 1D1AA 3ZQFA 2RNJA 2IS4A 1ETOA 3C2HA 5LD2C 3BWOA 1L0OC 4QPQA 3EUKL 2JUGA 3ZZKA 2QA3A 4UV8A 2M2EA 1FBSA 4IRHA 4U2HA 2CANA 3NU8A 3ZPLA 2EIJH 1PMMA 5C3EJ 5JHUA 1O3QA 5JVTA 4M2MA 1P6RA 2IT0A 4F93B 2GBYA 3D0SA 2QA4I 1IG7A 4PDKA 2VE9A 1BIAA 1TW2A 2PMZN 4Q4ZF 4C2TA 2BWOA 4D5CA 3FM3A 3FBNB 3FWEA 5LEJA 4LW4A 1Z1DA 1H8AC 5D5SA 2PMUA 2V9KA 4RGXA 4PJ0C 3OYFA 1Z05A 4BHCA 2AY3A 5K7HA 4E1OA 4EB5A 1LE8A 4Y52J 4RJYA 3BDDA 5E1XA 1LC8A 5BNGA 2PI0A 2FYFA 1IN6A 3G6EI 1J59A 5C4XJ 2NS0A 1I50J 4KT6A 1T0FC 4II3A 3I5UA 4NQWB 4RLQA 3EETA 2JPBA 2YX4A 1HLVA 3S15J 1W7NA 2CU7A 4F5JA 4X0GA 4MY5A 2X1CA 3HDOA 1HW2A 4GDYA 3K9TA 4IW7A 2XAFA 1AY5A 4JX4A 1XX5A 5HODA 2FJ1A 3PPLA 2AHQA 1HOMA 4XSZF 2OQGA 3W6KB 4Y0HA 2FQ6A 1HSTA 1ZR4A 4F5FA 3CF5F 3LOCA 3LSIA 2KJCA 4CZZA 4DOZA 4CXFA 1SD5A 4I0BA 1CJ0A 3RBLA 3A8UX 2LFBA 1PFFA 5GAHJ 2TRTA 5J8QA 4FISA 5FRNA 1S09A 2PQ8A 5E8IA 2VMQA 4XLFA 1IX6A 1R23A 2E60A 4XRSA 3B1EA 2BI9A 4Y33A 4XLEA 4AOAA 4A3FJ 3N0LA 1S7EA 5TF5A 1FSEA 4BXFA 1XGMA 4P9FA 4BACA 1LNWA 5FLXK 1QISA 1E3OC 4WWCA 2BEOA 3FM5A 1J9IA 4QGRA 1CZEA 1QGNA 4R8DA 3U1DA 1XDSA 4ITVA 1C0NA 2ORDA 1RKWA 2W8UA 2ME0A 1EH8A 1JG8A 3E5UA 2Z1YA 1TWFJ 1PG8A 3PJ0A 1SMTA 5D8LB 1K6YA 4H0EA 4W1XA 5J1RA 5M4BA 5HNHA 4EJTA 4U1TA 3S32A 2KIFA 1VQ8I 2DXIA 2UUZA 5BS6A 1WJCA 2GMUA 1YX5A 3QPSA 1SD6A 1IJWC 1S0AA 3FTBA 3A9XA 4TV7A 3PD6A 1GVJA 3AG1H 3BR1A 3DEEA 5IP6A 1LS3A 1YIZA 2VMOA 2M1BA 1YYVA 2EPFA 1QHGA 1XGOA 1AHYA 3L2UA 1YNUA 3MCZA 1I39A 4A3BJ 2JMWA 2VASA 4K2BA 2W7EA 4ZZDA 3VFZA 3LSJA 1O3RA 2Z1DA 1FOKA 3MKJA 3I53A 2K9QA 4DYCA 1OCCH 2BKWA 4EEFG 4TN4A 3ZMDA 2I8DA 3OWTA 4WXDA 1IF1A 2LTPA 3ROUA 1R5ID 3BJ6A 4G7OF 4E6KG 4KXKA 5CPRB 4XN3A 2AO9A 2W8JA 1VQMI 4S0HB 1K79A 1TPLA 2D63A 3WTWC 3J7ZI 4F5KA 5F1RA 3A9ZA 2G7HA
chains in the Genus database with same