4MGRA

The crystal structure of bacillus subtilis gabr, an autorepressor and plp- and gaba-dependent transcriptional activator of gabt
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
468
structure length
468
Chain Sequence
DITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHIDQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSKSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKENKRQTGRPALIIGFARLKEEDIQEGVQRLFKAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulatory protein GabR
publication title Crystal structure of Bacillus subtilis GabR, an autorepressor and transcriptional activator of gabT.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
total genus 135
structure length 468
sequence length 468
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4mgrA01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4mgrA02
1B5OA 5E1XA 4U7DA 3QOPA 1ASCA 1R58A 3HOTA 1SAXA 1R36A 4OC9A 2UWMA 2HTJA 4JQFA 4AIKA 3LVLB 3K7YA 4G7OF 1P4XA 1RIOH 3GZ5A 1S08A 2Q7WA 4Y0HA 1ARSA 2GB3A 3GYHX 3LA2A 2IJLA 1G4VA 1HQCA 1UHWA 2VBYA 1FY7A 1YS6A 2W25A 2C7TA 5HLHA 8AATA 2WWYA 1G7XA 2R7DA 2VC1A 1ZRFA 3HSEA 1P2FA 2V1XA 2QQBA 5HS8A 4ESFA 3TDUC 3C7JA 5IT9K 5HDGA 3VB2A 4RB3C 2CJGA 1FLIA 4Y15A 1FOKA 5TRDA 3GW2A 3L9FA 2VBZA 3E77A 1KU3A 1I1GA 4B9BA 1CGPA 2F2EA 1KYWA 2JZYA 3HTSB 4PFFA 5HDMA 5A2QZ 4F4EA 2VGSA 4EV0A 4ENJA 4DQ2A 3CUQC 3KEOA 1ON1A 4ADCA 4ZM3A 2IA1A 2D1HA 1MDMB 5G2PA 5E1ZB 1C0WA 1KKJA 3GEZA 5D6EA 5K5OA 2P5VA 4Q4ZF 4LLNA 4NHJA 2BGCA 3DPTA 4GGGA 2E1NA 2HUFA 2AY5A 1B4XA 2NYXA 4G7HF 3RYRA 5H20A 5L3GA 3A9XA 4U1TA 1W7PB 1HW1A 1WSUA 2HUIA 2M5WA 1H0CA 2FQ3A 2VGWA 4U88A 1MGTA 2A6EF 2WV0A 4A0XA 4P9UA 5LGTA 4CGZA 3I4PA 3RCHB 2QB3A 4IXOA 2HGCA 1CS1A 1GXPA 2MLKA 1LB2A 3ZN1A 3F3XA 2L3DA 1AIBA 4E1OA 4U0YA 4WYDA 4HW0A 3LA3A 4P96A 2IA2A 1KL1A 4GRXA 4TN4A 3BB8A 4CXFA 3K1NA 3MCZA 1BC8C 3EYIA 1ARHA 2PFBA 4PZJA 1T2KA 2IRFG 1G6NA 1YIOA 3LVKA 3V8KA 1GEYA 1XGSA 1AOYA 2DO7A 3VK4A 4A0FA 1TOIA 5EAAA 1WI9A 3QAHA 1KL2A 2O1BA 4KUMA 1W23A 2QLZA 5D5XB 1LC7A 1V2FA 2DK5A 2X5DA 5K5QA 1BIAA 1W7NA 4M2JA 2OZUA 1GCKA 1KMJA 2EZ2A 1IN6A 3E2FA 1BOAA 3I0TA 2VE9A 2DQRA 3NNKA 2AY9A 1ASGA 3GWPA 2HP1A 4L5JA 7AATA 1Z1DA 2PI0A 4N0BA 3WTSC 2WKAA 3L2CA 3MEXA 3LVMA 3ML6A 4ESJA 1FPQA 1USTA 4PVFA 2D2WA 4L0YB 5D5UB 1DP7P 1LC5A 2MD5A 2DT5A 2ZYJA 3LG0A 4BH9A 5E20A 3BV0A 4F5MA 1FBUA 3ELEA 1TNTA 3WZFA 2K02A 2GIVA 1M0OA 3T32A 2YX4A 5AONA 2V1DA 1SPAA 4M9ZA 2L4AA 4J5UA 1M6SA 1IN8A 2AY3A 2JPCA 2EO5A 5KVRA 2PLYA 3B1DA 1D8JA 1IW7F 3ABUA 3NYUA 1DPRA 3R61A 1S3JA 3FD0A 1XEYA 1D2FA 2FA5A 4Q48A 1GDEA 2YCPA 3T8TA 4R8DA 1S0AA 2L4MA 3EETA 4ZLVA 2QMAA 3GLXA 3I54A 3ECOA 3FQ8A 5J6XA 5DCMB 2ZO4A 2PN6A 4EJOA 3H14A 3GZ6A 2JG2A 3KE2A 3RPQA 3F8NA 1IRGA 3TFTA 2OGAA 4CBRA 1YJSA 2CYYA 1MJBA 4RS8A 3BP8A 1HXDA 2DR1A 3F22A 2HUUA 2VMNA 1LK9A 1J0RA 3SXYA 2H27A 3MAJA 2AS5F 4EM0B 4A5NA 1USSA 3I59A 4QWQA 4UUVA 2MH2A 4EM1A 3C1DA 1C9CA 4OMYA 1RVUA 3KFWX 2P5KA 4MQVA 2XUBA 5LEKA 2Y48A 2OAZA 1KQ9A 1D8KA 3E6CC 1UFMA 3DPLC 1PFFA 1YJYA 2W57A 3SQNA 2WK9A 2FXAA 2NAZA 5FFXA 5E17F 1MAPA 1PUEE 1QZYA 4U0VA 1D5VA 4A2UA 3LWFA 4A6DA 5ILSA 4UV9A 3FZ8A 4IXZA 2VBXA 2X4HA 3BCAA 2DLLA 3VK2A 2XAFA 3JWBA 2VT2A 5DX5A 4Q75A 2CQKA 5D5SA 2COMA 4HYEA 2MBFA 1I27A 2P6TA 3RI6A 5DUKA 3RYPA 4PIWA 4UQVA 2XAQA 3L00A 3AEJC 1ZRCA 1D7SA 4CXRA 2EB7A 5ERIA 1ORDA 2K7LA 4R5ZA 2CANA 1M0PA 2KJBA 2L54A 5JVTA 2BYVE 2ZJGA 1M32A 1YQAA 5HLIA 2MH9A 3OKSA 4IRHA 4OIQF 2VC0A 1AICA 3VEPA 3I64A 3H3UA 4A0ZA 1BC7C 2ZCWA 3U2RA 2Z61A 4HDVA 5E1WA 2F5FA 4IVNA 2HOXA 1LC8A 2VYCA 3P9KA 4ITXA 1I41A 2CG4A 3BWOA 1REPC 3GX4X 5LLQA 1ARTA 1MD0A 2IW5A 2TDXA 4FX4A 3QHXA 2GQNA 3PD6B 1TOJA 4KNYA 3R6SA 1AAWA 2C44A 3ACZA 2D63A 4KIFA 3PDXA 2FSWA 4G8XA 2BIEA 1G3SA 3M7GA 2RN7A 3R4TA 1LNWA 2YRIA 5J8FA 1IF1A 1ASFA 1PG8A 3FQAA 1YJZA 3KZYA 2E7WA 3NRVA 4BA5A 1B9HA 4MTEA 4FHTA 1FP1D 4WXCA 1R1UA 4WP0A 3R60A 3CUOA 3HSRA 4AZJA 1RVYA 3NX3A 2HS5A 4L9NA 2K27A 1U78A 4LC3A 2HFHA 2XGXA 4XSZF 2YPRA 1O3SA 2OQGA 3W6KB 1BQAA 1WYVA 3NQOA 3TFUA 3EYYA 2BWOA 2BIAA 3ABTA 3R0JA 4F5GA 3OP7A 1S7AA 3JWAA 4IYOB 4RB2C 2AEUA 3TCMA 3KP7A 1ZOBA 2OA4A 2CJDA 2W7GA 4R2NA 1Z7UA 1XGNA 2DKJA 4GCVA 2VODA 4LB6B 4XEWA 3WY7A 1SFFA 2IA0A 2M45A 2HQRA 5DD8A 4CICA 1MKMA 2R3SA 3ZN0A 2ISZA 1W5SA 5H6RA 3D6KA 4BQ0A 1TOKA 3BJ6A 1OPCA 2STWA 5JHUA 4ENMA 3H7FA 2DGMA 4G7ZF 2AY2A 2HOYA 3ZP5A 2A6HF 5KK1A 2VI9A 1L3LA 1U3EM 4EVIA 3RUYA 3II0A 2RV8A 3JW4A 4W1XA 1OKRA 1J59A 1D7VA 4RJ0A 3HSFA 4LD5A 3ZMZA 4E70A 2VOOA 1W4MA 1LDKB 3DQVC 5LBQA 4EGYA 3O3KA 3G7QA 1B9MA 3VFZA 1GVJA 3P1TA 3TKYA 4O6JA 3KLOA 2FYFA 3K9TA 3GBXA 2V9VA 4EB7A 4M72A 1TNSA 3H3ZA 3FMQA 1ASEA 4ADBA 1G3YA 4PDKA 2BI9A 1AHGA 1DGEA 2GSAA 1O3QA 1IX7A 2H09A 1AY8A 1M4NA 4ASNA 3U1DA 2M8EA 1TPLA 1TOGA 4AZKA 3AAFA 1Z6TA 1WQ2A 3UAKA 4NOGA 1AHEA 1W5TA 3N0LA 1EV7A 4NQWA 4I09A 2YX7A 3TQXA 3CUQA 4JK1X 3BOQA 1WYUA 1J2XA 2EFPA 4MQ9F 2QWWA 2XVCA 3HRTA 2F5DA 1JHFA 2YCNA 3FDBA 3HHHA 1KQ8A 4A0YA 4WF2A 3I71A 2GZWA 5EIGA 6PAXA 3PIUA 3E2ZB 5DB5A 1AHFA 1HSTA 2UXNA 4GE4A 3EI9A 1YOOA 3GSBA 3FX3A 2KIUA 2EH6A 1XI9A 4RLGA 4KAMA 4E3RA 3GR9A 1BS0A 4S04A 1M7YA 1WYVB 3FZVA 1BKGA 5AIPA 1MDZA 2A69F 4WYEA 4A6TA 1S06A 3C18A 4RB1A 4OMAA 2B0LA 2CSTA 1YG2A 2VLHA 1MJ9A 4KT5C 1IX6A 1TQMA 1WRJA 2ZSMA 3ATHA 3JU7A 3ERED 2D5YA 4MHGA 3AV7A 1R1VA 3VODA 4AVPA 2VONA 1C7NA 4J8LA 2QLRA 4ZM4A 3P7NA 1XN7A 1IN7A 3FFRA 2PJPA 2XKPA 3JAMK 1AHXA 2OKJA 1ZG5A 3AEPA 5EEHA 3A9YA 5CVJA 5FB2A 4FFCA 2K4JA 5F1RA 4P3MA 4R1HA 1K79A 2HKXA 1QIRA 2EFNA 3W1JA 3IWFA 2D7YA 2AXLA 4JEVA 3DP7A 2VMVA 2HZPA 1S07A 5EEGA 3HIFA 1IUYA 3NUBA 5FD5A 1DJEA 2TPLA 4GDYA 1KKPA 3WX9A 5FLXK 1UB9A 2BKWA 2OGEA 3FMRA 2PB2A 2FNIA 3E6DA 1U6GA 1XMKA 3AENA 1ARGA 4HVKA 4HAMA 1IXCA 3AOWA 3FM5A 1OHYA 3RIRA 4LK0F 3IL2A 5CVUA 4G94A 4KFCA 4ZYEA 2ESHA 2BYJA 3AOVA 3PA9A 4WXFA 9AATA 3JZLA 4KN7X 1J04A 1YYVA 4QLCU 1AWCA 1XB4A 3I4JA 5D95A 2M30A 2ZC0A 5IT3A 1V3FA 4EMYA 5FD6A 3E6MA 2BHXA 4FT8A 3WU0A 2Z20A 3HMUA 1QPMA 5IT9Z 1CQ8A 4LJZF 4F7ZA 1BI1A 4M6XA 2F5CA 4ZASA 2ZBKA 3K2ZA 2DGKA 3WCOA 3BC8A 1LJ9A 4AO9A 4IW7A 3FF5A 1MJAA 3E5UA 2E54A 3KGXA 4HBLA 5D4SA 3TOAA 2Z9VA 3D0SA 4CZZA 3CUQB 3B1CA 1ON2A 5I92A 2L02A 4M9SA 3WGCA 2CW0F 1GXQA 1RI7A 4I2OA 3NYTA 4HLXA 4IPAA 4ZH4F 2HORA 2YR2A 2Z3YA 1I6XA 1V4RA 4LG0B 4JE5D 4P55A 4A12A 2EK5A 2H94A 1DTYA 1QZ9A 2ZNZA 1IX8A 1SZSA 4F5HA 3LWSA 4YIIA 3PJ0A 1CQ6A 4WYFA 5HS7A 5JAYA 4I0BA 3J80Z 2ZSLA 2DI3A 4RAEA 4W91A 5E8GA 1R00A 2DPDA 4N0WA 2QBYA 1FG7A 3E3VA 1CF7A 4UNOA 2ZFWA 5L3CA 3OOPA 2VMOA 4I01A 2JTVA 3N4MA 2CB1A 3BWGA 3WE2A 3NUIA 4AD9A 1FG3A 4WYCA 4RM1A 2QENA 1AY5A 2EFQA 5FGMA 4OU0A 3E97A 1MDOA 4A0HA 4HV5A 1K78A 5L3FA 2BI1A 3RQ1A 4B8XA 4BXUA 1XCVA 4WCGA 4EFFA 2FE3A 2XAGA 1X0MA 4IY7A 2VGVA 3HT4A 1H9TA 2LF8A 3BS8A 4PFNA 1O7FA 2GAUA 4UVBA 1QITA 1LKCA 5AIQA 3AEMA 2VMQA 3V7CA 4XK1A 2DU9A 1LQ1A 3AENB 3J7AO 3GFMA 1P4AA 5L3DA 2DPUA 1IAWA 3CO7C 2VOPA 5F64A 4RAYA 1XD7A 2VN2A 4MGRA 3K69A 3MAUA 2O03A 3QM2A 4UVCA 5JFRA 4MTDA 1LVAA 3FVUA 2Z99A 1EQBA 4HV6A 3M8FA 3HRSA 2Q2EA 3C3WA 2FOKA 1ECXA 3J81K 4BNCA 2C0RA 1K6OA 1C4KA 3RJPA 1W7LA 1FT9A 3BPXA 3GZDA 1BJAA 3QN6A 2Z5UA 2VXZA 4L5IA 3F23A 4L0ZB 1AKBA 3AEJA 3COGA 1V2EA 1B9NA 5J8QA 3G8MA 1B59A 4F5KA 4JBAA 1YNUA 4ZWMA 3DEUA 4RGXA 3WG9A 3FZ6A 2EZ1A 1LS3A 2BIGA 1G3TA 2FNUA 1YFHA 3BY6A 2XAHA 4WXDA 2YSRA 1UHMA 3OV8A 1BJNA 4LK1F 3FQ7A 5LHGA 5DD4A 4Q6RA 3QI6A 5C6UA 1YW8A 4MQPA 4O6ZA 2C6YA 2CY8A 4ADEA 5CVIA 4OINF 3DYDA 5E18F 1U8RA 2W8VA 3CO6C 5DJ9A 3HTUA 2PB0A 1YW9A 4OCAA 5HLGA 2OU2A 3VK3A 3D5LA 3EI6A 1Z9CA 3E6GA 3NU7A 4WXHA 5HHYA 3LFKA 5HVQC 1FC4A 3WGBA 4IHTA 5D8LB 1JHHA 5HXXA 2D45A 1EG5A 4L9TA 1X29A 1TARA 1BT4A 1B6AA 3HBXA 4KDPA 3EI5A 5F9SA 1R1TA 3DODA 5IWQA 2AY7A 5AX8A 3FXUA 3KZZA 4HOBA 4B09A 2YHKA 4WB0A 2QBTA 1ZARA 1CF7B 1STZA 4Y13A 4KIGA 1OHWA 1XSVA 2ZJ2A 1Y4IA 1HKQA 2P8TA 1ASDA 2BBYA 1VJOA 2NS0A 3DR4A 3EI7A 4BA4A 5BMZA 4Y0IA 4XRFA 4KA4A 1Q1HA 1KU2A 2JRTA 2ZMEA 3GUDA 4MKKA 2W8WA 1K78B 1SZUA 2YRRA 1IAYA 3RBFA 3B8XA 2K4BA 1LW5A 3BJOA 3O6BB 1BI0A 2VE8A 3V8JA 2Q8KA 1CZCA 4ZYGA 2XKOA 3RBLA 5M46A 3FKDA 4WYGA 2QQ9A 5DV5A 4JE5A 1O62A 4HDUA 1FSEA 1KGSA 1YTYA 2CGPA 4EM2A 3AEMC 2V1PA 1HBXG 4EJWA 5ICEA 1BM9A 5BJ4A 2ORDA 3KP5A 1XGOA 1G4XA 5CVVA 2IP2A 4CBSA 4M9XA 1O3RA 3F8CA 5BPIA 2XASA 4M73A 5EAVA 3FVSA 2VT3A 2E7IA 5G4JA 2O3FA 3KP2A 2NNYA 2Z9XA 1GEWA 1T38A 4JF0A 1DJUA 1FC3A 1IN4A 4L0OA 1O4SA 4AWXB 4F5IA 3LQQA 2VIAA 1QZZA 2CFXA 3GZDC 1R5HA 2FQ6A 1IN5A 1OATA 1H0MA 1WKGA 1WYTA 5BQTA 4AH3A 2BE5F 2QB2A 1S7OA 3LV2A 1PP8F 3WKSA 4ADDA 1M0NA 1YIZA 1QO0D 4JEXA 3ELKA 1FZPB 1OR7A 4Q47A 4JEZA 4XLNF 1EH8A 4HF1A 3PQJA 4IHSA 5DUIA 1TQPA 2X8UA 3BN1A 3PDBA 3GZCA 1EJIA 1F1ZA 5CLSA 1Y0UA 2W7FA 1BJWA 2PBIA 4M74A 3WGGA 2VMSA 2OBPA 2RDPA 4LW2A 1BBYA 1XGMA 1XCBA 4M71A 3L7WA 3WLXA 4ZDOA 4RGRA 2EGYA 2R5CA 1BW0A 1IVRA 4OTLA 4ZSYA 4ITGA 3F8BA 5DCFA 1V2DA 5FT6A 1BJOA 1JF9A 1TW3A 3SFZA 5L3BA 4RJYA 1GC0A 1ONVA 3F21A 4HX8A 2DGLA 4MSOA 2OATA 1CL1A 4WB0B 2DW4A 3HRUA 3ZZJA 1Z91A 3LA7A 1KU9A 1PMMA 1ZH5A 2HTSA 3KETA 3MZHA 2CO5A 1AMRA 4GO1A 3MAFA 4L9JA 1XSDA 4XSXF 2D1VA 2MA3A 2R0TA 4H51A 4RKCA 2ZMEB 4LLGF 1T39A 2O7CA 1R22A 3K40A 4R5FA 3FZ7A 1IBJA 4HF2A 3MFKA 4OBUA 2D64A 3I59B 4F5LA 3DV8A 1I48A 2WC2A 2JSCA 2O0YA 3BWNC 4WXGA 1MGVA 4W1WA 2HDCA 3MBBA 1ARIA 2VBWA 2P5LC 1X3UA 2H6CA 2QVOA 3KP3A 4A6UA 2YKXA 2A5YB 1HKSA 3HDOA 1HW2A 1QNTA 1IZ1A 4RAZA 3E2YA 4R79A 1FYLA 1OYIA 1ELQA 1OXOA 2KJCA 2UXXA 1J5YA 2EA4A 4UHOA 4G9YA 2EV6A 3PFIA 5D5WB 5E5IA 3FMSA 1G7WA 4WYAA 2O61A 2BV6A 4G6DA 1GC4A 3K1PA 3MZYA 4JEYA 4N9HA 1RUNA 3N75A 5LHAA 3ISPA 5LHIA 5ICFA 1AJSA 2ZKZA 3CQ6A 5J8CA 2NRAC 3GF2A 3AEOA 3HYIA 3IKVA 3F6TA 1IUGA 4I98B 3P9CA 3ZMSA 2VGZA 5JI6A 3QRFF 1B9IA 1QGPA 2AY1A 3HUGA 3EIAA 2HWVA 3WE3A 2W85A 4EU1A 4F5FA 3JW9A 1ZGJA 2L01A 4UV8A 4RB0A 3SZPA 3PDBB 1KA8A 3T8RA 5BJ3A 1G4DA 2GXBA 2FN6A 2JISA 1ZGAA 4LNJA 2Y75A 4HF8A 1S6LA 3R4KA 4E77A 1I1SA 3VOMA 1G3WA 1B4AA 3BDDA 3FWEA 2M87A 1IJIA 3E5QA 3B46A 1N31A 1PMOA 4U7BA 4ZYHA 1ASNA 2W8UA 4YG2F 2GA2A 3WKRA 3WODF 3FRKA 5EUNA 2HZTA 2PMUA 3WTTC 4UOYA 3CJNA 2PQ8A 1S09A 3GFLA 5BPDA 1OMIA 4CYDA 2W84A 1MLYA 2G7HA 4OT8A 4ZYDA 4EMSA 5F8VA 2CSOA 3TQNA 1TTYA 2HOEA 1XSXA 2Z9OA 4UHTA 1SFUA 3JTXA 3O2PE 3M5UA 2Z1YA 2RVCA 1XMAA 4ZAHA 4LNLA 1CQ7A 3F0HA 4A00A 3GJUA 4UVAA 3A9ZA 1ZREA 2QQAA 2A68F 1U5TC 4TV7A 2R5EA 5M4DA 3LSTA 4KMFA 4K2MA 1V72A 3JAMZ 4ZZLA 3N5MA 2MLGA 1MDMA 1S29A 2CFBA 2EA2A 4HQMA 3WTZA 2BEOA 1P92A 2H6BA 1D7RA 1FNNA 4NB5A 2KKOA 2BWNA 3RI4A 2XBNA 2PO3A 4Q76A 5D5VB 2OQRA 5FLXZ 2JGTA 3TO7A 4A0RA 3L09A 4YFXF 1IXSB 3CDHA 3RCHA 3JTHA 2FU4A 4KMUX 1OYYA 4IXAA 3M8EA 1R5GA 5FO5A 4LW4A 3R0AA 3WTUC 5K1YA 3DF8A 4EJUA 4K2BA 5EFSA 3CLOA 3T0YA 2HKOA 5E3KA 1ASAA 3ZMDA 4BAYA 4PGHA 4OMZA 1AJSB 4CHUA 3F8FA 1OYWA 2J5OA 5D8KB 1ASLA 4RKDA 2FMLA 1U08A 4ZWVA 2DFIA 1M0QA 2LNBA 3GVAA 4RITA 2G7UA 2VMTA 1HKTA 1AX4A 2EFOA 2XAJA 1CL2A 1ZLKA 5G2QA 3M1EA 2Z1ZA 4HF0A 2YKYA 2YCTA 2AEVA 3HRMA 3ZRQA 1F9NA 2GMSA 1F4KA 4EGZA 1GC3A 3V7RA 4M6YA 1PDNC 3V8LA 3Q8NA 3BCBA 4UHNA 1SMTA 1J75A 3G0TA 4BHBA 4MQRA 5K5RA 3B02A 1L0OC 1ZLJA 5D4RA 4HX7A 2CH1A 4E3QA 2VMUA 2FNAA 4U0WA 4RGSA 2VMRA 1YW7A 4GYIA 3CTAA 3IC7A 2FBKA 2VMXA 1Z3ZA 3T1BA 1WYUB 1Z6RA 1SD6A 2W7JA 1ZYRF 3SZTA 5F6FA 3GWZA 3QP6A 1D3YA 1YIYA 2GMUA 3GETA 1FWZA 5EIGB 3BZ6A 4ZZDA 4GSAA 1SFXA 4M2MA 1AMQA 3TDZC 3DC1A 2AY4A 2CINA 3TO6A 2PG4A 3Q9SA 2JJHA 3HVYA 2Q0OA 2IT0A 1EH7A 2RNJA 1JXSA 4W1VA 5EUDA 2DAOA 4GXOA 3W6JB 2GQQA 2D65A 1B5PA 3MKJA 2F5EA 4ZDPA 4MNUA 5H6QA 4UXNA 2KIFA 4GEBA 4RGUA 1AAMA 2IPQX 2XH1A 1FSHA 5G4IA 2O0RA 5A2QK 5LHHA 1J32A 1WSTA 2VI8A 4AOAA 2QYOA 1W3UA 3QU3A 4JF1A 3KLNA 5ICCA 4IRGA 2WK8A 1AKCA 3MQ0A 1SFEA 4ISYA 4LLLA 4KXKA 1NHAA 2OD5A 4XJLA 4BHPA 2KIMA 3WTXC 2XV4S 5DCMA 3EUHA 1DJ9A 4ATPA 3J80K 4CVQA 3GXOA 1ZN2A 3GFJA 4O3MA 3R9AA 2Z9UA 1GC2A 1TW2A 3A2BA 3WU1B 1SD4A 3JTGA 1FBQA 1BN5A 2K86A 2BWPA 3ZZKA 4BYYA 2V6CA 3J81Z 4S05A 1O69A 4IF4A 5ILUA 3QU6A 3U9GA 1XDSA 3VOEA 3NEUA 3T5XA 4AIHA 1H9GA 2J5PA 2BI2A 2HR3A 4ESBA 1ASMA 4CDGA 2BI3A 3Q9VA 1I5ZA 3KP6A 3DZZA 3EQLF 1UU1A 2RGVA 3RDIA 2UZKA 2VGUA 1LDJA 3EZ1A 4O5VA 1VP4A 2YKVA 3A8UX 4KICA 2DQLA 2V0YA 4GYGA 3WGIA 3FFHA 3RPUA 2QUFA 1N8PA 2VMPA 2VMZA 3ULQB 2E1CA 1FP2A 1Z05A 4W5KA 5DJ1A 1IRFA 5BS6A 2W8JA 2G9WA 1AHYA 2W7KA 3TOBA 3W1IA 1HSJA 3HQTA 3G3ZA 1SD5A 5FT8A 1DUXC 1J9IA 4U2HA 2E7UA 5DDGA 5E8IA 2C81A 1IXRC 4Y17A 4BHCA 3RKWA 1B1BA 1CJ0A 3KGWA 1VEFA 1RNLA 3ZMUA 1TOEA 3QPGA 3CQ4A 1BI3A 1KQ0A 2CWEA 4DBCA 3F9TA 4QGRA 3S2WA 3DXVA 1AIAA 5HDKA 4P7YA 3ZMTA 4MKJA 5CVRA 2HOZA 1O7LA 1F5TA 5EQCA 1J7KA 3F6VA 4IRIA 2EJRA 3TGNA 4LFUA 1ZHFA 3LAJA 2XHKA 1N2TA 4CXQA 1ELUA 1TBXA 4AO4A 3FXRA 3ECDA 2DK8A 4CO8A 2IVMA 4GE7A 4A5MA 2W8TA 2R7FA 3M9AA 2HP2A 3HLMA 3K28A 2QBYB 1R23A 4P5OA 4OOIA 5M49A 2FMYA 3BPVA 4ZSWA 1DPUA 4XLPF 3ZPLA 1B8GA 3DFGA 3PD6A 4XBFA 1S8NA 5FFZA 2ETHA 2Z67A 4AIJA 2A61A 4EB5A 2BI5A 3JSOA 4FL0A 2A07F 1O61A 2DBBA 3TATA 3UWCA 4KYOA 4BQAA 5K8BA 3BWNA 4G6QA 1ZRDA 2Z9WA 4XJOA 3WTWC 1SVVA 2W7EA 3EIBA 3L8AA 1ULYA 4MQQA 3LAPA 2M1BA 3AATA 3IWZA 1R7JA 4JEWA 4WK8F 4DNCA 1RZ4A 4HLYA 1TASA 1O57A 5JR3A 4ATQA 1GBNA 4XJMA 2FBHA 4PGGA 3KEQA 4ETSA 1WKHA 1WKMA 1RV3A 3GO5A 4YFNF 1C0NA 2ELHA 4IYOA 4IX8A 2JT1A 4HZFA 3UE8A 2VMYA 1U2WA 4F5JA 3NDNA 1ZG3A 2DOUA 2YOBA 3B73A 1JS3A 4MY5A 5LH9A 5ED4A 3NU8A 4W8IA 2EWNA 1JGSA 1SZKA 3SHFA 3FM3A 4B98A 4MEXF 3MWMA 1ZODA 2MC3A 3VAXA 3K0LA 3I5TA 1X2AA 1E17A 1FYMA 3ROUA 4OIPF 1RV4A 1SF2A 2VGTA 3LY1A 2E7XA 5BOXA 4LNMA 3L44A 2PEXA 3DR7A 1DGDA 4Q5SF 3KE3A 2A3SA 2NNNA 1P4WA 1AMSA 1LEBA 4WLJA 3ELPA 1JS6A 5ICGA 4HQEA 1YO5C 3FHZA 1BIBA 3B1EA 2EV5A 1T0FA 2EV0A 2LKPA 3EDPA 4GE9A 2VMWA 5LRRA 1C7OA 3G73A 4I7HA 2RQPA 1ZC9A 3COAC 1MAQA 4A0GA 4TMRA 2ZNYA 3IKTA 2WK7A 1KMKA 4DGTA 5FT5A 4K2EA 3BROA 5G0AA 1X28A 1W7PD 2GWRA 1QJ5A 4WXBA 3ASAA 3ECHA 4OIRF 4WLHA 3EI8A 1BQDA 2QM3A 3BJAA 1AMAA 3MC6A 3HL2A 3E6BA 1MZBA 3QPHA 3WGHA 4FX0A 4I0AA 2D61A 3RTRA 5LEJA 3QBOA 3HHGA 2F8JA 2DKBA 5LGNA 5DYMA 1XDUA 3F8MA 4ON0A 1W7MA 2JJEA 2LSOA 1UCRA 3V4GA 3E5XA 2X5FA 4BMKA 1U5TA 3FCRA 3E9KA 3FVXA 3QPTA 2W7MA 1MLZA 2YU3A 2FNPA 2AY8A 1HW5A 5TF5A 2RFVA 4KN4X 5CYVA 3EUCA 1SD7A 3FSLA 3IRRA 1ODDA 3F72A 2CH2A 1P6RA 5TJJA 2AY6A 4I8AA 1AKAA 2FEZA 3NYSA 1I43A 1TLHB 1SMYF 3I5UA 1BJ4A 1T98A 3E2ZA 2CTZA 2R2NA 4L18B 3P9IA 1CZEA 1Z7DA 2GA1A 3RKYA 4K2IA 4A6EA 4WWCA 2XROA 1KU7A 3N97A 3LQRA 4XJPA 2BYLA 2FM1A 1YS7A 2O6GE 1GEXA 3IHUA 2ZP7A 2OQXA 2P7CB 2ISYA 5L3EA 4M2KA 4EJTA 1GHCA 2E7JA 3DRDA 3IRQA 3KKIA 1YLFA 3I16A 2HYGD 3RKXA 3WTYC 3VP6A 4RIZA 3Q5FA 4WD2A 2DTRA 3ASBA 3ZMVA 3LVJA 2YKUA 3NRAA 2X3LA 2VIBA 1WYTB 4IXSA 2FBIA 4BHDA 3IF2A 5HDNA 1O3TA 3H92A 1VTNC 1PP7U 1H1CA 4OBVA 2ADUA 4D0PA 3FXQA 2HYFA 4L9VA 3JSPA 2OKKA 3CQ5A 3PGYA 4UHMA 1AY4A 4H0EA 1K7AA 2ZUKA 2W7IA 3ISLA 1T3IA 5FT4A 1BI2A 4MEYF 3MEBA 1QGNA 3TO9A 1I29A 4KYWA 4WBTA 1ZAOA 1RUOA 3P6KA 2R5CB 2KRFA 4PCQA 2STTA 2V79A 2HQNA 1LDDA 1JE8A 1BJOB 2D7ZA 5M4BA 2WTEA 2ACJA 1QISA 2P4WA 3F6OA 4XQ2A 2HEOA 4Y0DA 5G09A 3EZSA 1QBJA 1DDNA 1E5FA 2W7LA 2X0LA 1C7GA 4HX4A 1UU0A 3QGUA 4EJVA 2JPBA 3CAIA 4OYTA 3BCXA 4R8HA 1QQIA 2EFWA 3MC6C 1FX7A 3ZRPA 2V1UA 3QP5A 1ZG1A 3PQKA 3WTVC 5E4ZA 2Y0MA 3MAFB 2FRHA 3KCCA 3I53A 2W7DA 1U5TB 2GXGA 4HA8A 1A04A 4YFKF 2JJGA 3WCNA 1LEAA 2QA3A 3K1MA 2PMHA 2EPJA 1WWXA 4Z2YA 5EUEA 1TQIA 3KP4A 1GD9A 3GFIA 2OZ6A 2FF4A 1JG8A 3PAAA 3REOA 2P6SA 5LGUA 2LF7A 2LDUA 3IHJA 3USFA 4LG0A 1EH6A 2W24A 4ZDLA 5CJ9A 4EQQA 5ILVA 2VLFA 1FYKA 4P9FA 2W7HA 1TATA 1UU2A 1W7PA 1E2XA 1OHVA 1E5EA 1MDXA 3I58A 4KIBA 4YIFA 3NTJA 1FBSA 2XIGA 3DKWA 1ASBA 1D7UA 1UKJA 3PPLA 4ENKA 2P7VB 1AJRA 2D66A 2NMPA 1KYZA 1P3WA 2G6WA 1YAAA 4A6RA 5HS9A 1T6SA 4LMYA 4XAUA 1DKAA 4LGWA 4WX9A 3DU4A 4A72A 4OIOF 3DXWA 5LRSA 1QJ3A 3DXJF 1DFOA 2JJFA 2XRNA 4Q31A 4DQ6A 2Z33A 1LW4A 5HOOA 2AATA 2O8XA 3AELA 2CJHA 4N9IA 1IAXA 5D6FA 2ZXJA 3CBFA 3HOSA 5DEQA 3MADA 2ESNA 4ENNA 4IJAA 4I02A 3ZQ7A 3FTBA 3ZRRA 4LB5A 1OXPA 2QZ8A 2RKHA 3W1HA 3V7SA 2RC4A
chains in the Genus database with same CATH superfamily
2DT6A 1B5OA 5E1XA 4U7DA 3I4MJ 3QOPA 2K85A 2O8KA 2JA6J 1ASCA 1R58A 4MLOA 2MC4A 3PIPF 3HOTA 1SAXA 1VQ6I 1R36A 4XL9A 4OC9A 3HXLA 2UWMA 2HTJA 3FXLA 4JQFA 4AIKA 1X1PA 3LVLB 1FOXA 3K7YA 4G7OF 1P4XA 1RIOH 3GZ5A 1S08A 2Q7WA 4Y0HA 1ARSA 2GB3A 3BQYA 3GYHX 2OTJI 1D0YA 3LA2A 4XKBA 2IJLA 1G4VA 2VLAA 1HQCA 1UHWA 2VBYA 1FY7A 5K7HA 1YS6A 2W25A 2R7WA 1VQ7I 2C7TA 3ZXSA 3I3LA 5HLHA 8AATA 2WWYA 3EUAA 2DA3A 1A5JA 4BDYA 1G7XA 2R7DA 2VC1A 3KEYA 3PNYA 1ZRFA 2EPFA 3HSEA 3OR2C 5DS9A 1P2FA 1U9OA 2V1XA 2QQBA 5HS8A 4ESFA 3TDUC 3C7JA 2DOEA 2VXDA 3S16J 5IT9K 5HDGA 3VB2A 2KMUA 5F0FA 3CCYA 4RB3C 2CJGA 1FLIA 4Y15A 1FOKA 2JVHA 1X3WB 3FXKA 2KIQA 3GW2A 3L9FA 5TRDA 3E0JB 3H5AA 2VBZA 3E77A 1KU3A 1BR1A 1I1GA 3SEZA 4B9BA 2ZJQF 1JKRC 1CGPA 1W36C 2F2EA 1KYWA 2JZYA 5M5WJ 3HTSB 4PFFA 5HDMA 5A2QZ 2X51A 4DZJA 4F4EA 2VGSA 4EV0A 4ENJA 4DQ2A 3CUQC 4CA0A 2E2HJ 3KEOA 4A3LJ 1ON1A 4NDLA 4ADCA 4ZM3A 2BW3A 2IA1A 2D1HA 1MDMB 5G2PA 2BVLA 5E1ZB 1C0WA 3GEZA 5D6EA 1KKJA 5K5OA 2P5VA 4Q4ZF 4LLNA 4NHJA 1R9TJ 3FXMA 2BVMA 4BEHA 2HOAA 2BGCA 4EEFG 3DPTA 4GGGA 5EYRA 2E1NA 4RBOA 3G1LA 2AY5A 1B4XA 2NYXA 4G7HF 2HUFA 5IYCJ 3WU2C 3RYRA 2XAUA 5H20A 5L3GA 3A9XA 3N05A 4U1TA 1W7PB 4OAZA 3G6EI 1HW1A 1WSUA 2HUIA 2M5WA 3PFYA 2HXOA 1ERDA 2JA5J 3OIQA 1H0CA 3AG4H 2FQ3A 2VGWA 4U88A 1MGTA 2A6EF 1BR2A 2WV0A 4A0XA 4P9UA 5LGTA 1NK3P 3I4PA 4CGZA 3RCHB 1A35A 2QB3A 4B47A 4J19A 4IXOA 2VL8A 4E4HA 3C2HA 5DTDA 3UR3C 2HGCA 4A3MJ 1GXPA 1CS1A 2MLKA 1LB2A 3ZN1A 5HNHA 2CV1A 3F3XA 2L3DA 1AIBA 5GPCA 2L7ZA 1D0XA 2CH0A 5EZGA 4U0YA 4WYDA 4E1OA 4HW0A 5GTIC 3LA3A 4P96A 1U8BA 2IA2A 3FBNB 1KL1A 4GRXA 4TN4A 4XN0A 4DBRA 4B3XA 3BB8A 3FIWA 3K1NA 3MCZA 4CXFA 1BC8C 3M1CA 3L2UA 3SZGA 3EYIA 2PFBA 4PZJA 4AU7A 2VUMJ 1ARHA 1T2KA 2IRFG 1G6NA 3KYCB 1SVOA 1YIOA 3LVKA 3CCUI 4KITB 1OQYA 1V54H 2LMDA 3K4NA 3V8KA 1G59A 4BE1A 4AIDA 1GEYA 1XGSA 2IBDA 2DO7A 1AOYA 3VK4A 4A0FA 2X6YA 4BBRJ 2L9SA 3BTJA 2QSHX 1WI9A 3OYMA 1TOIA 5EAAA 3QAHA 1KL2A 2O1BA 2MD0A 1HDDC 3CJRB 4KUMA 1W23A 2QLZA 5D5XB 1LC7A 3HOUJ 1V2FA 2XPVA 1VQKI 4CUGA 2DK5A 1MBKA 2X5DA 5K5QA 1BIAA 1W7NA 2HYJA 4M2JA 2OZUA 1GCKA 1JUPA 1KMJA 2EZ2A 1IN6A 3E2FA 1BOAA 3I0TA 2VE9A 2DQRA 3NNKA 2DOFA 2AY9A 1ASGA 3GWPA 2HP1A 3BTCA 2R5YB 4L5JA 7AATA 2HDDA 1Z1DA 2PI0A 2NVYJ 2HXIA 3ASOH 4N0BA 3WTSC 4XLCA 3OMYA 3NARA 2WKAA 1XPXA 3L2CA 3MEXA 2H1KA 1D1AA 1DQUA 2L0KA 3ML6A 3MKLA 1FPQA 4ESJA 1USTA 2QKLB 3TW7A 2R7TA 4NC6A 4PVFA 2D2WA 4L0YB 1EA3A 5D5UB 3QODA 1DP7P 1LC5A 3I55I 3JRCA 2MD5A 2DT5A 2ZYJA 1SANA 3LG0A 4BH9A 5E20A 3BV0A 4F5MA 1FBUA 2IGOA 2QCOA 3ELEA 1TNTA 3WZFA 2CUFA 3L2RA 2WBMA 2K02A 2GIVA 2YS9A 4H4KC 1YRNA 1M0OA 3T32A 2P81A 1OISA 2ELJA 4XM3A 2YX4A 5AONA 2V1DA 2L9NA 1SPAA 1MIJA 4M9ZA 2L4AA 4J5UA 1M6SA 1MNDA 1IN8A 2AY3A 2KP6A 1NG7A 2FOWA 4FISA 2JPCA 2EO5A 5KVRA 2PLYA 1X3ZB 2JVGA 3VDXA 3B1DA 1D8JA 1HDPA 1IW7F 3ABUA 4XRSA 1OCOH 3GTPJ 1DPRA 4ZTJA 3S15J 3NYUA 3R61A 1S3JA 3FD0A 1XEYA 1RR7A 1D2FA 4CSWA 2FA5A 4FQGA 2E2JJ 2KRCA 3BR5A 4Q48A 1GDEA 2M0CA 1SFKA 3IH4A 4F52A 2YCPA 3T8TA 5LFAA 3CF5F 3LOCA 4BJ6C 3VSKA 4ZTFA 4R8DA 2K9SA 1I3QJ 2LLKA 1S0AA 4II3A 5HLTA 2L4MA 3EETA 3LMMA 2QMAA 1IDZA 4ZLVA 3GLXA 3I54A 3ECOA 4BBSJ 3FQ8A 5J6XA 5DCMB 2ZO4A 2PN6A 4EJOA 3H14A 3GZ6A 1QU3A 2JG2A 3KE2A 3RPQA 3F8NA 1IRGA 2AQEA 3TFTA 5FROA 4RLFA 2OGAA 4CBRA 3M07A 1YJSA 2CYYA 1QRYA 1MJBA 2CV0A 4RS8A 3BP8A 1HXDA 2DR1A 3F22A 2HUUA 2VMNA 1LK9A 1J0RA 4HPQA 3SXYA 2IS6A 4J01A 2H27A 4NBQA 3MAJA 4Y4RA 2IEKA 2DA4A 2VJ5A 2AS5F 4EM0B 4A5NA 1USSA 3I59A 2XPWA 4QWQA 2MH2A 4UUVA 3LNQA 3KZIC 4EM1A 1JTXA 1U0JA 3C1DA 1C9CA 2F4IA 4OMYA 1RVUA 3ZOBA 3KFWX 2KZGA 2P5KA 2XUBA 4MQVA 2Y48A 1TWGJ 5LEKA 3UKGA 2OAZA 1KQ9A 3AL0B 4IHVA 1D8KA 3OYAA 2E5NA 5IPAA 3E6CC 1UFMA 3DPLC 1PFFA 4BJ5C 1YJYA 2W57A 1TWCJ 3SQNA 2WK9A 2FXAA 4RDUA 1F36A 2NAZA 1OCTC 5FFXA 1MSEC 5E17F 1MAPA 1PUEE 1QZYA 4U0VA 3SDGA 3OL3A 1D5VA 4A2UA 3LWFA 4A6DA 5ILSA 4UV9A 4A3DJ 2V7FA 3FZ8A 4IXZA 2VBXA 2X4HA 3BCAA 3DEEA 2DLLA 2WAQN 1VQMI 1W36D 3VK2A 2XAFA 3OYLA 2VT2A 3JWBA 1WJCA 5DX5A 2DODA 3FBIB 4X6AJ 4Q75A 2FQ4A 2CQKA 3J7YJ 3G1OA 2COMA 5D5SA 4HYEA 2MBFA 1I27A 2VQLA 4XR6A 2VPRA 1B72B 2P6TA 3RI6A 5DUKA 3RYPA 1BL0A 2E35A 4PIWA 1RESA 4UQVA 2XAQA 3L00A 3AEJC 1ZRCA 1D7SA 4CXRA 1MBFA 2EB7A 5ERIA 1ORDA 2K7LA 3CDLA 4XLEA 2M34A 4PSXA 2IS2A 4R5ZA 1UELB 2NVUB 3PSIA 1M0PA 2KJBA 4DBQA 2CANA 2L54A 3GZNB 5JVTA 5E3NA 2BYVE 1QVUA 2VKDA 2ZJGA 1RKWA 1M32A 2TRTA 1YQAA 5HLIA 2MH9A 3D5RC 3OKSA 4IRHA 4G6TB 4OIQF 3BTLA 2COBA 2VC0A 5J4YA 1A31A 2VQCA 1OCZH 1AICA 3VEPA 3I64A 3H3UA 1BA5A 4A0ZA 1BC7C 2ZCWA 3U2RA 1E3PA 2Z61A 1VQ8I 3CF2A 4HDVA 1ACIA 5E1WA 5DM7F 2F5FA 4IVNA 1TWHJ 1LC8A 2HOXA 3DU5A 2VYCA 4L5EA 3P9KA 2B9SA 4YEJA 3S93A 3K70C 1TL8A 4ITXA 3QYFA 1I41A 1Y1WJ 2K40A 3JRGA 2CG4A 3BWOA 1REPC 3GX4X 1RKTA 5LLQA 1ARTA 1MD0A 2EIJH 2IW5A 2TDXA 4FX4A 3HOZJ 3QHXA 2GQNA 2DJIA 3PD6B 3RCOA 1IDYA 1TOJA 2IAIA 4KNYA 3R6SA 1AAWA 2M9HA 1EF4A 2C44A 3ACZA 2D63A 4KIFA 2ELKA 3PDXA 1ENHA 2XPUA 2FSWA 4G8XA 2ZJPF 2BIEA 1G3SA 4AYBN 1ETQA 3M7GA 2RN7A 3R4TA 1LNWA 2YRIA 5J8FA 1Z7LA 1IF1A 1ASFA 1PG8A 3FQAA 1YJZA 3KZYA 3HOXJ 2CW7A 2E7WA 3NRVA 3A0BC 4BA5A 1B9HA 3W6VA 4MTEA 4FHTA 2ZC2A 1FP1D 1V5EA 1R1UA 4WXCA 4WP0A 3R60A 4OAYA 3CUOA 2LG4A 3HSRA 1JJ8C 1RVYA 3NX3A 3CCEI 4AZJA 3J7AY 3EUKL 2HS5A 2X6WA 2K27A 3NWSA 4L9NA 4RMNA 1U78A 2ZFUA 3LSGA 2XDVA 1W1WE 2HFHA 4LC3A 2XGXA 2JN6A 2HPMA 4XSZF 3QOEA 4Z6YA 3JRHA 2YPRA 1O3SA 2OQGA 2W7NA 3W6KB 3K6GA 1BQAA 1WYVA 3NQOA 1XC5A 3TFUA 3EYYA 2BWOA 2BIAA 3ABTA 2W1OA 3R0JA 4F5GA 3QPSA 2LREA 2ZMEC 3OP7A 1S7AA 1TT5B 3JWAA 4IYOB 4RB2C 2AEUA 3TCMA 4M3GA 3KP7A 1ZOBA 4AUXA 2OA4A 2CJDA 1FMVA 3CCSI 2W7GA 4R2NA 1Z7UA 2VJ4A 1XGNA 2DKJA 4GCVA 2VODA 1MMAA 4QPOA 4LB6B 4XEWA 3WY7A 2XRLA 1SFFA 1BOBA 2IA0A 2M45A 2V26A 5JHFA 1MH4A 3S1NJ 2HQRA 5DD8A 4CICA 1MKMA 2R3SA 2WY7Q 3ZN0A 4D5CA 2ISZA 1MBJA 2CQXA 1W5SA 2LY9A 5H6RA 1MNMC 1A36A 3D6KA 4BQ0A 1TOKA 3BJ6A 3B6CA 1OPCA 2ECBA 2STWA 5JHUA 4ENMA 3H7FA 2DGMA 1SFOJ 4G7ZF 2AY2A 2HOYA 1JKPC 2A6HF 5KK1A 3ZP5A 1ZELA 3RZOJ 3H0GJ 2VI9A 1UJ8A 5EDNA 2DMQA 3OYGA 1L3LA 3OS2A 4EVIA 1U3EM 1TZLA 4F91B 3RUYA 3II0A 2RV8A 3JW4A 4RLGA 2QEXI 2R7OA 1K4TA 3ZQGA 3F0CA 4W1XA 2KRHA 3TP3A 1OKRA 1J59A 1D7VA 2DMNA 3PIOF 3DTKA 1BR4A 1DU6A 4RJ0A 2LFBA 3HSFA 4BUPA 4LD5A 1BW6A 2E36A 3ZMZA 4E70A 1GDTA 2VOOA 3MKWB 2LKXA 1W4MA 3CMMA 1LDKB 3DQVC 3DTIA 3JRFA 5LBQA 2QQ8A 4EGYA 3O3KA 3G7QA 1B9MA 3VFZA 3IH2A 1GVJA 4BACA 3P1TA 1OCRH 3TKYA 4O6JA 2KLOA 3KLOA 2LC2A 1G2HA 2FYFA 3K9TA 4CCMA 2ZSIB 4B4CA 2V9VA 2G0EA 3GBXA 4J00A 1DU0A 1YITI 4M72A 1TNSA 1MMSA 3H3ZA 3FMQA 4EB7A 3OOUA 2NS8A 2E5ZA 1ASEA 1DGWY 1G3YA 4ADBA 3B6AA 4PDKA 2BI9A 1AHGA 3ZQCA 1DGEA 1Z21A 2GSAA 1O3QA 3CCJI 1IX7A 2H09A 1T8IA 1Y56A 1AY8A 1M4NA 4ASNA 3U1DA 2M8EA 3K7AJ 1TPLA 1G8XA 1TOGA 4AZKA 3AAFA 1Z6TA 1WQ2A 5CKTA 3UAKA 4NOGA 3DLAA 1AHEA 1S7EA 1W5TA 3N0LA 3K4CA 3PNVA 2E1MC 3CJTB 4XKCA 1EV7A 4HNUA 4NQWA 2D5VA 4I09A 2YX7A 3TQXA 1O4XA 3CUQA 4JK1X 3BOQA 1WYUA 2OCCH 1J2XA 2EFPA 4MQ9F 2QWWA 2XVCA 3HRTA 1YHQI 2F5DA 1JHFA 2EH3A 4BL0B 2YCNA 3FDBA 3HHHA 1KQ8A 1Z3XA 4A0YA 4WF2A 3I71A 2GZWA 3JRBA 5EIGA 2DA5A 2R0QC 6PAXA 1IV8A 2W82A 1EJ9A 3WG7H 3PIUA 3E2ZB 5DB5A 1AHFA 1HSTA 3ABMH 1S9HA 1P7IA 1IV6A 2L7FP 2UXNA 4GE4A 4A3GJ 4AVZA 3EI9A 1YOOA 3GSBA 3FX3A 1POGA 2KIUA 4YELA 4D7MA 1XI9A 4PFPA 3QWLA 4ITVA 2EH6A 2HQ5A 1QPIA 3GR9A 4KAMA 1BS0A 3S1QJ 4S04A 4GDFA 1M7YA 1RETA 1WYVB 3HZJA 1AKHA 3FZVA 1BKGA 5AIPA 1MDZA 2A69F 3MN2A 4WYEA 1S06A 4A6TA 3C18A 4RB1A 5F0HA 4OMAA 2B0LA 2CSTA 1YG2A 2VLHA 1MJ9A 2CV2A 2AO9A 4KT5C 4PSWA 1IX6A 1AA7A 1TQMA 1WRJA 2ZSMA 3ATHA 3JU7A 3ERED 3HOYJ 4MHGA 2NVXJ 2D5YA 4BQOA 1R1VA 1T95A 3VODA 4AVPA 2VONA 5EZHA 1C7NA 2QLRA 4J8LA 1E3HA 4ZM4A 4C3IJ 3P7NA 1XN7A 1IN7A 1YE9A 4IYOA 2EIKH 3FFRA 2PJPA 2XKPA 4M3DA 3JAMK 1AHXA 2OKJA 1ZG5A 3AEPA 5EEHA 3A9YA 5CVJA 1ZK8A 5FB2A 4FFCA 2K4JA 5F1RA 4P3MA 3K2AA 3U1KA 4R1HA 1K79A 2HKXA 1QIRA 2EFNA 3W1JA 3IWFA 2D7YA 4RM2A 1S5LC 2AXLA 4JEVA 4JX4A 1TC3C 3DP7A 2VMVA 4I99C 2XGDA 3BR2A 2HZPA 1S07A 2AHQA 3HIFA 5EEGA 1IUYA 3NUBA 2GOXB 5FD5A 1DJEA 2TPLA 4GDYA 1KKPA 3WX9A 3SJMA 5FLXK 4IZZA 1UB9A 4II2A 2BKWA 3VYRB 5GADJ 2OGEA 3FMRA 2PB2A 1ZQ3P 2FNIA 3MMYB 3E6DA 3A0HC 1U6GA 3HEFA 1XMKA 3AENA 1ARGA 4HVKA 4HAMA 1IXCA 3K70D 3AOWA 5LH9A 4A3CJ 3FM5A 1ZGWA 1OHYA 3PNTA 3RIRA 4LK0F 2ZXHA 3IL2A 5CVUA 3PL8A 4G94A 1QZEA 2X1CA 4KFCA 1FIAA 2ESHA 4ZYEA 2R7ZJ 2E34A 2BYJA 3AOVA 1TWAJ 3PA9A 2BXYA 2DFHA 4WXFA 4W97A 1HF0A 5C3EJ 9AATA 1UHSA 3HG9A 4RM3A 3JZLA 4KN7X 2PJRA 1J04A 1YYVA 4QLCU 1AWCA 1XB4A 3I4JA 1R5ID 3DBHB 5D95A 2M30A 2ZC0A 3FXOA 5IT3A 1V3FA 3PO2J 4EMYA 2IGNA 5FD6A 3E6MA 2BHXA 4FT8A 3WU0A 2Z20A 3HMUA 1Y39A 1QPMA 5IT9Z 1CQ8A 4LJZF 4F7ZA 1JJ6C 1BI1A 3P5JA 4M6XA 2F5CA 1WVRA 4D5FA 4ZASA 1ITYA 2ZBKA 3OIPA 3GTOJ 3K2ZA 2BHZA 1Z0XA 2UUZA 5GP9A 2R92J 2DGKA 3WCOA 3BC8A 1LJ9A 3SFIA 1A6IA 4IW7A 4AO9A 3FF5A 1GUUA 1MJAA 2HZDA 3E5UA 2H8WA 2E54A 3KGXA 4UB8C 1JGGA 4HBLA 5D4SA 3TOAA 2Z9VA 1WPKA 4XLAA 5LD2C 3NAUA 4V2GA 4XRMA 3D0SA 4CZZA 3CUQB 3B1CA 1ON2A 2XB5A 5JVGF 3S2HJ 3H5RA 1MNEA 5I92A 1U9NA 2L02A 4M9SA 3WGCA 2CW0F 4V2FA 4XKWA 1GXQA 1RI7A 4I2OA 1WI3A 3NYTA 3PJRA 1Q1VA 2EZIA 3LSIA 4HLXA 4IPAA 4ZH4F 2HORA 3GTJJ 2YR2A 4ZYAA 3OWTA 1KZHA 2Z3YA 3ZQLA 1I6XA 1V4RA 1XS9A 4LG0B 2X1DA 4JE5D 2R7QA 4HG2A 4P55A 4A12A 2R7SA 3A2KA 2EK5A 2H94A 1DTYA 1QZ9A 4W1UA 3K4JA 2ZNZA 4CZCA 1IX8A 1SZSA 4U87A 2GBYA 4F5HA 3LWSA 4YIIA 3PJ0A 1FIPA 4ABZA 1CQ6A 5EGOA 1JI8A 4WYFA 3BR1A 1AKHB 3OL4A 2Y9ZA 5HS7A 5JAYA 4I0BA 2R5ZB 1X2MA 3J80Z 3CP2A 2ZSLA 2DI3A 1H89C 3S14J 4RAEA 4HNTA 5J4VA 3GTGJ 2Y0SN 5E8GA 4D9JA 4W91A 1R00A 2DPDA 2ZXIA 4N0WA 2QBYA 1FG7A 3ERMA 3BLYA 3E3VA 4MFEA 1CF7A 1LPQA 2QKMB 2ZFWA 3ZRGA 5L3CA 4UNOA 3OOPA 2VMOA 2ZB9A 4I01A 2VJJA 2WY8Q 2JTVA 3N4MA 2CB1A 1R4MB 3BWGA 1D5YA 3WE2A 2R7XA 3NUIA 4AD9A 4BQNA 3PUBA 5FKLA 1FG3A 2DDBA 4F3QA 2QENA 4RM1A 4WYCA 3CMEI 3D5SC 1AY5A 2EFQA 5FGMA 4OU0A 3E97A 1MDOA 2OC6A 3S2DJ 4A0HA 4HV5A 2K3PA 2M7AA 1K78A 1S72I 5L3FA 3V42A 2BI1A 2B63J 3RQ1A 4B8XA 4BXUA 1XCVA 4WCGA 4EFFA 2FE3A 2XAGA 1X0MA 4IY7A 2VGVA 3HT4A 1H9TA 2LF8A 2WV1A 3BS8A 4PFNA 1O7FA 2GAUA 4UVBA 1QITA 1LKCA 5AIQA 1VQ9I 2VMQA 3V7CA 3AEMA 4XK1A 2DU9A 1LQ1A 3AENB 3J7AO 3GFMA 1P4AA 5L3DA 2DPUA 1IAWA 3CO7C 2VOPA 5F64A 2VKVA 1VF9A 1T08B 2XB0X 3DBLB 4P1WA 4RAYA 1XD7A 1X19A 2VN2A 4MGRA 3K69A 3MAUA 2O03A 3QM2A 3A02A 3GTKJ 4UVCA 5JFRA 4MTDA 1LVAA 3FVUA 2Z99A 1EQBA 4HV6A 3RQIA 3M8FA 3HRSA 2Q2EA 5BNGA 3C3WA 2FOKA 1ECXA 2BY3A 3J81K 4BNCA 2C0RA 1K6OA 5M3MJ 1C4KA 5KAIC 3RJPA 1NTCA 1ETKA 1W7LA 5F1JA 1W0UA 1FT9A 3BPXA 3GZDA 1BJAA 3QN6A 2Z5UA 2VXZA 3Q0WA 4L5IA 3F23A 2LH9A 4L0ZB 2HI3A 1AKBA 3AEJA 3COGA 1V2EA 1B9NA 1AU7A 5J8QA 4B48A 3G8MA 1B59A 5IY5H 4F5KA 1SVLA 2HOTA 4JBAA 1N78A 1YNUA 3DEUA 4ZWMA 1OFCX 3HKZN 1WH7A 4C3JJ 4RGXA 3WG9A 3FZ6A 2EZ1A 2BHYA 1LS3A 3RKQA 2BIGA 1G3TA 1HC8A 3FISA 2FNUA 1YFHA 2WAEA 3BY6A 2XAHA 4WXDA 2YSRA 1UHMA 2ECCA 3OV8A 3Q0VA 3H9QA 3EPZA 1YX5A 2I5UA 4CCJA 1BJNA 4LK1F 3CC4I 3FQ7A 4F93B 5DD4A 5LHGA 3S3OA 4Q6RA 3QI6A 5C6UA 1YW8A 2LKSA 4MQPA 4O6ZA 3ONQA 2DFEA 2C6YA 2CY8A 4ADEA 5CVIA 1W5CC 4OINF 5E18F 3DYDA 1U8RA 2W8VA 4I76A 3CO6C 2BW3B 3BQZA 3HTUA 5DJ9A 5M5YJ 2EQRA 1YJ9I 2XC7A 2PB0A 1YW9A 4OCAA 2OTLI 5HLGA 2OU2A 3VK3A 3D5LA 4BEHB 3EI6A 3K4KA 1Z9CA 3CJQB 3E6GA 3NU7A 3E1SA 4WXHA 1SAUA 2F4OB 5HHYA 3LFKA 5HVQC 1FC4A 3WGBA 4IHTA 3DPUA 5D8LB 1LFUP 1JHHA 5HXXA 2D45A 1EG5A 4HNVA 4L9TA 1X29A 1TARA 1BT4A 1B6AA 3HBXA 4KDPA 3EI5A 2DMUA 5F9SA 3HPHA 1R1TA 3DODA 5IWQA 3A1YA 4DJAA 2AY7A 5AX8A 1P7JA 3FXUA 3KZZA 4HOBA 4CCNA 3OYDA 1FEXA 4B09A 4CYCA 2OF7A 2EILH 3W2VA 2YHKA 4WB0A 3ABLH 2A6TA 2QBTA 1ZARA 2DT7B 4BU2A 1CF7B 3OSFA 1FTTA 1STZA 4Y13A 2UV1A 3O8GA 4KIGA 1OHWA 1XSVA 2ZJ2A 4LIVA 1Y4IA 1HKQA 2P0WA 4B44A 2P8TA 1ASDA 3IH3A 3DU6A 2BBYA 4PJNA 1VJOA 2NS0A 4GRIA 3DR4A 1LVKA 2R93J 3EI7A 2DOAA 4BA4A 5BMZA 4Y0IA 2EZHA 3A03A 4XRFA 4XLFA 2FUG2 4KA4A 1Q1HA 3W2WA 1KU2A 2JRTA 2ZMEA 3GUDA 3W2AA 4MKKA 2W8WA 1K78B 4BY1J 1SZUA 1IAYA 2YRRA 3RBFA 3B8XA 3U21A 2K4BA 1LW5A 3BJOA 3O6BB 1BI0A 2VE8A 3V8JA 3LFUA 4FETA 2Q8KA 1CZCA 4ZYGA 3L2VA 2IXSA 2OCEA 2XKOA 3RBLA 4C2TA 4M3FA 2ID3A 4YIRX 5M46A 3FKDA 5GTHC 2KDZA 4WYGA 2QQ9A 5DV5A 3EUHC 1B8IA 1O62A 4JE5A 1T33A 4HDUA 1FSEA 1KGSA 2Y30A 1YTYA 4EM2A 3G1MA 2CGPA 3AEMC 2YUSA 2V1PA 1HBXG 4EJWA 5ICEA 4KISA 1BM9A 2RQQA 1ZKGA 5BJ4A 2L7KA 5FLVA 2ORDA 3KP5A 1XGOA 1G4XA 5CVVA 2IP2A 4CBSA 4LIUA 4M9XA 4PJMA 3VYUB 3F8CA 1O3RA 5BPIA 2XASA 1YIJI 3BG9A 4M73A 5EAVA 3FVSA 2VT3A 2E7IA 5G4JA 2O3FA 3PM1A 5F27A 3KP2A 2K5CA 2NNYA 2Z9XA 1GEWA 2Y31A 1T38A 4E3RA 3JRAA 2LP0A 2WAQA 4JF0A 1DJUA 1IN4A 1FC3A 4L0OA 1PUFA 1O4SA 4AWXB 4F5IA 4HSTA 4E7SA 2HPIA 2DMPA 3LQQA 2VIAA 1QZZA 2CFXA 3TW6A 4M3BA 4BGDA 3GZDC 1R5HA 2Y9YA 1JT0A 4UB6C 1IN5A 1J09A 2FQ6A 3S3MA 1TP4A 1ZR2A 1OATA 1H0MA 1WKGA 1WYTA 5BQTA 4AH3A 2BE5F 2ICWG 2VJIA 5IYDJ 1S7OA 2QB2A 3LV2A 1PP8F 3RQ4A 3WKSA 4ADDA 1M0NA 1YIZA 1QO0D 3FK7A 4JEXA 2HOSA 3ELKA 1FZPB 1OR7A 4Q47A 4JEZA 1HLVA 4MFDA 4XLNF 1EH8A 3CMYA 1T56A 3PQJA 4HF1A 4IHSA 5DUIA 1V55H 2JWTA 1YJNI 1TQPA 1IGNA 2X8UA 1YRNB 3ZQQA 3BN1A 4RA2A 3HOVJ 3GZCA 1EJIA 3PDBA 5HNFA 1F1ZA 2R7VA 5CLSA 1Y0UA 2W7FA 1GV5A 1BJWA 2PBIA 4M74A 3WGGA 2VMSA 2OBPA 2RDPA 5GAGJ 4LW2A 1BBYA 1XGMA 1XCBA 4M71A 3L7WA 3OYEA 3WLXA 5CQEA 2BY0A 4ZDOA 1Z77A 4RGRA 4CCLA 2EGYA 2R5CA 1BW0A 3MD2A 1IVRA 4B1RA 4OTLA 1X58A 4ZSYA 4ITGA 3F8BA 5DCFA 1V2DA 5FT6A 1BJOA 1Y0NA 3FXJA 1JF9A 4C2MJ 1TW3A 3SFZA 5EG0A 5L3BA 2CU7A 3KYLA 1X4PA 2AQFA 2V4JC 3AG3H 4RJYA 1GC0A 1ONVA 3F21A 4HX8A 2DGLA 4MSOA 2W00A 2OATA 5K7ZA 4AYBA 3QYBA 4CYCB 4A3BJ 1FJLA 1CL1A 4WB0B 2DW4A 3HRUA 3ZZJA 1Z91A 3LA7A 1KU9A 4IX7A 1PMMA 1UMQA 3ZQIA 1ZH5A 1XMXA 4FASD 3CESA 2HTSA 2XGEA 3KETA 3MZHA 2LBFA 2CO5A 2DYRH 1XTAA 1AMRA 4GO1A 3MAFA 2Q1ZB 1ETVA 3CQZJ 1QHHD 2KHMA 1I39A 2CUJA 4L9JA 2HVQA 1WFXA 2DTZA 3CCRI 4X0GA 1XSDA 4XSXF 3A01A 2D1VA 2MA3A 2R0TA 4H51A 4RKCA 2ZMEB 1IO2A 4LLGF 1T39A 2O7CA 5FKOA 1R22A 2KZVA 3K40A 2HNHA 4R5FA 1Z67A 1IBJA 3FZ7A 4HF2A 4X1EA 3MFKA 4BE2A 4OBUA 2D64A 2WB1N 4YRVA 3I59B 4F5LA 2LOOA 3DV8A 3TBIA 2WC2A 2JSCA 2O0YA 1I48A 3BG3A 3BWNC 4WXGA 1MGVA 4W1WA 2PMZN 2HDCA 3MBBA 2EIMH 1MMNA 1ARIA 2VBWA 2P5LC 1X3UA 2H6CA 2QVOA 3KP3A 3TEDA 3M8JA 1B8IB 2YKXA 4A6UA 2A5YB 1HKSA 3HDOA 1HW2A 2WADA 1QNTA 1IZ1A 4RAZA 3AV7A 3JRIA 3E2YA 1AHDP 3ABKH 5B1BH 4R79A 3DKYA 1FYLA 1K83J 4LOCA 4N4OB 3MZ8A 1OYIA 1ETOA 1ELQA 1OXOA 2KJCA 2UXXA 1J5YA 2EA4A 2K9LA 4UHOA 4G9YA 2RAEA 4NUBA 2EV6A 3PFIA 5D5WB 2CS3A 5E5IA 3FMSA 1G7WA 2DFFA 4WYAA 2O61A 4V19K 2CUZA 2BV6A 1PUFB 2DDAA 4G6DA 5FRMA 1GC4A 3K1PA 3MZYA 4JEYA 1DGRM 4N9HA 3LSRA 1RUNA 3HOWJ 3N75A 5LHAA 3ISPA 4XICA 3MVPA 5LHIA 3VYSB 3I4NJ 5ICFA 2O5RA 1AJSA 2ZKZA 3CQ6A 5J8CA 2DJNA 2NRAC 3GF2A 3AEOA 3HYIA 3IKVA 3F6TA 1IUGA 2O7OA 4I98B 3F9KA 3P9CA 3ZMSA 2HVSA 2VGZA 5JI6A 3QRFF 1B9IA 3S1MJ 1WGXA 1QGPA 2AY1A 3HUGA 2FD5A 3EIAA 2HWVA 3BZKA 3WE3A 1APLC 2W85A 3VYTB 4EU1A 4F5FA 3JW9A 1ZGJA 2JRMA 2L01A 4UV8A 4RB0A 3SZPA 3PDBB 4FCYA 1Y1VJ 1OR7C 1KA8A 3T8RA 5FKMA 5BJ3A 1G4DA 2V1NA 2GXBA 2FN6A 2JISA 2BY1A 5KHDA 1ZGAA 1GV2A 2Y75A 4LNJA 4IOCF 2M4GA 2ZJRF 1T0FC 4HF8A 2LVSA 1S6LA 3R4KA 2MABA 1I1SA 3VOMA 4C2UA 1G3WA 3BR0A 4E77A 1B4AA 3BDDA 3FWEA 2M87A 2EZLA 1RRJA 1IJIA 2E1MB 3E5QA 4NC7A 3S8PA 3B46A 5J1RA 4DOZA 1N31A 1PMOA 2A05A 4JYKA 4ZYHA 4U7BA 1ASNA 2W8UA 5EG0B 3GTQJ 4YG2F 1W0TA 2GA2A 3WKRA 3WODF 2GIZA 4XONA 2HZTA 2PMUA 3WTTC 3FRKA 3CJNA 4UOYA 2PQ8A 1S09A 5EUNA 3RSNA 3GFLA 5BPDA 1K61A 1OMIA 4IL6C 2W84A 4CYDA 1MLYA 2G7HA 4OT8A 4ZYDA 4EMSA 5F8VA 2CSOA 3TQNA 1TTYA 3FK6A 2HOEA 3H9GA 4PJJA 1XSXA 2NVTJ 2KPMA 2LBFB 3WHCA 2Z9OA 4UHTA 2V9PA 1SFUA 3JTXA 2WAFA 3O2PE 3OYHA 1VZ0A 3S17J 3M5UA 2Z1YA 5J40A 2X1EA 2RVCA 1XMAA 4ZAHA 4LNLA 3S32A 1D0ZA 1CQ7A 3F0HA 4A00A 3GJUA 3LSPA 2LK2A 4UVAA 3LL7A 4BKXA 1ZREA 2QQAA 2A68F 4C3HJ 1U5TC 4TV7A 4CCKA 4FTHA 3LSTA 2R5EA 5M4DA 4KMFA 2OJED 4K2MA 1VQ5I 1V72A 4BY7J 5IP6A 5GAEJ 3JAMZ 2VQGA 4ZZLA 3PO3J 3N5MA 2QSGX 4FE4A 2MLGA 1MDMA 4XORA 1S29A 1Z3YA 2CFBA 5KCMA 4XOPA 2EA2A 4HQMA 3WTZA 1MBEA 1UG2A 2BEOA 1P92A 2H6BA 1D7RA 2JUCA 1FNNA 4NB5A 3OS1A 2KKOA 2BWNA 3RI4A 2XBNA 2PO3A 4IEJA 4Q76A 2I10A 5D5VB 2IS1A 2OQRA 3IP4B 5FLXZ 2JGTA 3WHBA 1MSFC 3TO7A 4A0RA 3L09A 1RC9A 4YFXF 5FLMJ 1IXSB 3RPUD 4Y7NJ 3CDHA 3RCHA 4IXSA 3JTHA 2FU4A 2JQ7A 1IRZA 5IP7J 4KMUX 1OYYA 4IXAA 3M8EA 1R5GA 5KNLA 5FO5A 4LW4A 2JA8J 3R0AA 2AXTC 3WTUC 2IS4A 1JUSA 4OWRB 5F08A 5KAFC 5K1YA 3DF8A 4EJUA 4K2BA 5EFSA 3CLOA 3T0YA 2HKOA 5E3KA 1ASAA 3ZMDA 2KISA 4BAYA 4PGHA 1FTZA 4M6VA 3LSHA 3K4MA 3BG5A 4DYRA 2CQQA 3MKYB 4OMZA 1AJSB 4PFOA 4CHUA 3F8FA 1OYWA 2J5OA 1R4NB 5D8KB 2VQHA 1ASLA 2FMLA 5FRNA 4RKDA 4XIDA 1XX5A 1U08A 4ZJZA 4ZWVA 2DFIA 3HBLA 1M0QA 4JOMA 1H8AC 2LNBA 3GVAA 2L5QA 4RITA 2G7UA 3JR9A 2VMTA 1HKTA 3HUGB 1YOVB 1AX4A 2EFOA 4A3IJ 3BR6A 2XAJA 1CL2A 2NS7A 1ZLKA 3A4CA 4QTRA 5G2QA 3M1EA 3DCFA 2Z1ZA 4HF0A 5CPRB 1FOYA 1VQLI 2YKYA 1JKQC 2YCTA 2AEVA 3HRMA 3ZRQA 1F9NA 2GMSA 1F4KA 2H8RA 4EGZA 1GC3A 2HU9A 3ASNH 3V7RA 4M6YA 1PDNC 3V8LA 5E3OA 2MG4A 3BCBA 4BS9A 3Q8NA 3OYKA 4UHNA 1SMTA 1TT0A 3C2BA 1J75A 3G0TA 4BHBA 1R71A 4MQRA 3ZCOA 3HB9A 5K5RA 3B02A 1L0OC 1ZLJA 5D4RA 1WJEA 4HX7A 4BQQA 1ZR4A 2CH1A 4E3QA 4PJLA 2VMUA 2FNAA 2R5YA 3J7ZI 3CCLI 4U0WA 4RGSA 2X6XA 2VMRA 1N75A 1XG1A 1YW7A 3CTAA 4GYIA 3IC7A 2FBKA 4NQWB 4AM3A 2FJ1A 2XSJC 2Y2ZA 5EF6A 2VASA 3H3VK 1Z3ZA 2VMXA 3T1BA 1WYUB 1Z6RA 1SD6A 2W7JA 2HVRA 2K9MA 1IJWC 1VI0A 1I50J 1D1CA 1ZYRF 3SZTA 1ETYA 5F6FA 2DA1A 3GWZA 3QP6A 5GPAA 4E7KA 3KPHA 1D3YA 1YIYA 2GMUA 3GETA 1FWZA 5EIGB 3BZ6A 4G12A 4ZZDA 4BXXJ 4GSAA 1SFXA 2VPLA 3IUOA 4M2MA 2GLOA 1AMQA 3TDZC 3DC1A 2AY4A 2DCEA 2CINA 3TO6A 2PG4A 3Q9SA 2JJHA 3HVYA 2Q0OA 2IT0A 5B66C 2DA7A 1EH7A 2RNJA 3GBGA 3HGGA 1JXSA 2L7MP 4DYQA 3O8HA 4W1VA 5EUDA 3C2GA 2DAOA 3K4LA 4GXOA 3W6JB 2GQQA 2KFDA 2D65A 1B5PA 3MKJA 2F5EA 4ZDPA 2RNGA 2BXZA 3W3CA 4MNUA 4NC8A 5H6QA 4UXNA 4JX6A 2KIFA 4GEBA 4RGUA 2V6EA 2Y0SA 1AAMA 2IPQX 2XH1A 1FSHA 5G4IA 2O0RA 4E7JA 5A2QK 2X9DA 5LHHA 2NVQJ 1J32A 1WSTA 2VI8A 3HGYA 4AOAA 2QYOA 1W3UA 3OIOA 3CDIA 3QU3A 4JF1A 3KLNA 5ICCA 4IRGA 2WK8A 1AKCA 2EBIA 1MBHA 3MQ0A 1JUMA 2LY1A 5E3MA 2CUEA 3OYFA 1SFEA 2CW8A 4ISYA 2M0MA 4LLLA 2X48A 3KIOA 5FKKA 4KXKA 3I9V2 1I6HJ 1NHAA 2OD5A 2VI6A 4XJLA 4BHPA 2KIMA 2EINH 3WTXC 2XV4S 5CQGA 5DCMA 3EUHA 1DJ9A 4ATPA 3J80K 1WJFA 4IQ4A 3GXOA 4CVQA 1ZN2A 3GFJA 4O3MA 3R9AA 2Z9UA 1GC2A 1TW2A 3A2BA 3WU1B 1SD4A 3JTGA 1FBQA 1BN5A 2K86A 3HPGA 2BWPA 3ZZKA 4BYYA 1I3AA 2V6CA 4NNJA 3J81Z 4S05A 1O69A 4IF4A 1V5GA 5ILUA 3QU6A 2M8GX 1VFCA 4XNFA 3U9GA 4QPQA 1XDSA 2H1LA 3VOEA 3NEUA 3T5XA 4AIHA 1H9GA 3H0DA 3M4OJ 2J5PA 2BI2A 2R7RA 2ME0A 3DWLE 2HR3A 4ESBA 4QIWN 3GLLA 1ASMA 2PJRB 4CDGA 2QA4I 2BI3A 1ZTRA 3Q9VA 1I5ZA 3KP6A 1VQNI 3EQLF 3DZZA 1UU1A 2RGVA 3RDIA 4DZPA 2UZKA 3L2WA 2VGUA 2DMTA 1A6QA 4FE7A 3CD6I 1LDJA 5FJ8J 3HDDA 3EZ1A 4BJTA 5EEAA 2L9RA 4O5VA 1VP4A 2YKVA 1IUFA 3A8UX 2OV7A 4KICA 4IHWA 2DQLA 2JSPA 4Y33A 2V0YA 4GYGA 3WGIA 1RR8C 3FFHA 3RPUA 2QUFA 2R7UA 1BJZA 1N25A 1N8PA 3G71I 2VMPA 3SEQA 3HKZA 2VMZA 1SVMA 3ULQB 1P9QC 2E1CA 1FP2A 3D1NI 1Z05A 4BXFA 1N77A 4W5KA 5DJ1A 1IRFA 5BS6A 2X85A 2W8JA 2W48A 2G9WA 1X1AA 4A3KJ 4GFBA 1AHYA 3TOBA 3VPRA 1HSJA 4XMYA 2W7KA 3W1IA 3GTMJ 3G3ZA 1SD5A 4CH7A 3HQTA 5FT8A 1DUXC 1J9IA 4U2HA 2E7UA 5DDGA 5E8IA 1HCRA 1LFPA 3TMOA 2C81A 1IXRC 4Y17A 2E2IJ 4BHCA 1B72A 3OYIA 1LE8A 3UNGC 3RKWA 1B1BA 5C4XJ 2DN0A 1CJ0A 3VSLA 3KGWA 1NG6A 2ID6A 1VEFA 1SEUA 1RNLA 3JCUC 3ZMUA 1TOEA 3QPGA 2L9VA 3CQ4A 1BI3A 1KQ0A 2CWEA 4DBCA 1H88C 3F9TA 4A93J 4QGRA 2QSFX 3VWBA 1OLTA 3S2WA 4M3EA 4C30A 3DXVA 4XOTA 1BW5A 1AIAA 4UUTA 3ZGKA 3H1CA 5HDKA 4P7YA 4MO7A 3ZMTA 4MKJA 5CVRA 2HOZA 1O7LA 1F5TA 2V9KA 4C9YA 5EGOB 5EQCA 1J7KA 3F6VA 2Z16A 2EJRA 4IRIA 3TGNA 4LFUA 1ZHFA 3LAJA 2XHKA 1N2TA 4CXQA 2L2OA 1ELUA 1TBXA 4AO4A 3FXRA 3ECDA 2DK8A 4CO8A 4IQJA 2M2EA 2E1OA 2IVMA 1PYVA 4GE7A 4A5MA 2W8TA 2R7FA 3M9AA 2HP2A 3HLMA 3K28A 1MH3A 2QBYB 1R23A 4P5OA 2XF5A 4OOIA 5M49A 2FMYA 3BPVA 4ZSWA 1DPUA 4XLPF 3ZPLA 2F6CA 2LR8A 3DFGA 2ZXWH 4XK4A 5B5EC 1DP3A 5IOZA 1B8GA 3PD6A 3PSFA 2R4GA 4XBFA 4ZC3A 1S8NA 5FFZA 2ETHA 4KT6A 2Z67A 4AIJA 2A61A 4EB5A 2BI5A 3JSOA 4FL0A 2ME6A 2A07F 5FKNA 1O61A 1R6RA 2DBBA 3TATA 3UWCA 1M1EB 2EZKA 3AG2H 4KYOA 4BQAA 5K8BA 4D7NA 4G6QA 1ZRDA 3BWNA 3H35A 2Z9WA 4XJOA 3WTWC 1SVVA 2W7EA 3EIBA 1JKOC 3L8AA 4IOAF 4BDZA 3S3NA 1ULYA 3FKIJ 4MQQA 2LTPA 2BY2A 3LAPA 5IOYA 3QPLA 2M1BA 5M5XJ 3FDYA 1UAAA 3ZQFA 3AATA 5M3FJ 3IWZA 1R7JA 4JEWA 4WK8F 4DNCA 4A3EJ 1RZ4A 4HLYA 1TASA 2KL4A 1O57A 2CQ7A 5JR3A 3OY9A 4ATQA 1GBNA 4MIMA 4B3AA 4XJMA 4XN3A 2FBHA 2KDOA 1Y8QB 4PGGA 4I6ZA 3KEQA 2JK3A 4ETSA 1WKHA 1WKMA 1JTYA 2JA7J 1RV3A 2XSDC 3GO5A 4IHYA 4YFNF 1C0NA 2IGMA 2ELHA 3BTIA 1VQOI 1X1CA 2QGUA 4RAFA 2Q2EB 2TCTA 4BE0A 1QA6A 2JT1A 4IX8A 4HZFA 3UE8A 2VMYA 1U2WA 4F5JA 3NDNA 2MYSA 1MBGA 1ZG3A 2DOUA 2JA2A 3B73A 1JS3A 2YOBA 4MY5A 5ED4A 3NU8A 4W8IA 2EWNA 1JGSA 3CCMI 4IO9F 1SZKA 3SHFA 3FM3A 2VIXA 4MEXF 4B98A 3MWMA 1ZODA 2MC3A 3VAXA 2F48A 2F5VA 3K0LA 5IYBJ 3I5TA 5J1YA 1X2AA 2KT0A 4DW6A 4PK4A 3H9JA 1FYMA 3AL0C 1E17A 2I8DA 3ROUA 4OIPF 1RV4A 1SF2A 2VGTA 3LY1A 3JREA 2E7XA 5BOXA 1VQ4I 1H1CA 4LNMA 3L44A 2PEXA 3DR7A 1DGDA 4Q5SF 3JRDA 3KE3A 2A3SA 4HRIA 2XF7A 2M3AA 2CJJA 1P4WA 2NNNA 1AMSA 1LEBA 4WLJA 4N4NB 3ELPA 1JS6A 2CQNA 5ICGA 4HQEA 1YO5C 3FHZA 1BIBA 1SC7A 3HM5A 3B1EA 3SYTA 1WHUA 2EV5A 4F92B 1LE8B 2MFZA 3CMAI 4ANJA 1T0FA 3OYNA 2EV0A 2LKPA 3EDPA 4GE9A 5JLXA 2VMWA 1X1BA 2B7EA 5LRRA 4B43A 4EATA 1C7OA 2GM4A 3G73A 4I7HA 2RQPA 3K10A 1GVDA 3G2BA 3OYBA 3COAC 2MSYA 1MAQA 1ZC9A 4A0GA 4TMRA 2ZNYA 4E7ZA 3IKTA 1KMKA 2WK7A 2ZSHB 5FT5A 4DGTA 1LFBA 4K2EA 3BROA 5G0AA 3CCVI 2Z2SB 1FMWA 1X28A 1W7PD 1IG7A 2GWRA 3G4SI 2VB6A 4Y3OA 1QJ5A 4WXBA 2OPTA 3ASAA 2A5WA 3ECHA 4OIRF 4WLHA 3EI8A 1NH3A 2QM3A 3BJAA 1AMAA 2HDWA 1BQDA 3MC6A 3HL2A 3L2QA 3E6BA 1MZBA 3QPHA 2DYSH 1R49A 3WGHA 3DBRB 3BG7A 4FX0A 4I0AA 1Y6IA 3RTRA 5LEJA 2D61A 3HHGA 5F04A 3QBOA 3CCQI 2LRDA 2F8JA 3FHNA 5TISC 2DA6A 2DKBA 5LGNA 5DYMA 1XDUA 3F8MA 4ON0A 2WA0A 1W7MA 2LSOA 1UCRA 3V4GA 2JJEA 3E5XA 1WZ2A 2X5FA 4A69C 2QF7A 4BMKA 3CZ6A 1U5TA 3FCRA 1UZCA 2E71A 3E9KA 5HODA 3FVXA 4KJZA 3QPTA 3H36A 1E3OC 2CFOA 2W7MA 1UG0A 4HSRA 5IP9J 1MLZA 3OYCA 5B1AH 2YU3A 2FNPA 2AY8A 3Q3SA 1HW5A 5TF5A 2VKHA 2RFVA 4KN4X 5CYVA 3EUCA 1SD7A 3FSLA 3IRRA 1ODDA 3F72A 2CH2A 1P6RA 2WB1A 5TJJA 2AY6A 4I8AA 1MW7A 1AKAA 2FEZA 3S1RJ 3NYSA 3IAM2 1I43A 1TLHB 1SMYF 3I5UA 1BJ4A 2BZTA 2PMZA 1T98A 3E2ZA 2CTZA 2R2NA 4L18B 3P9IA 2N8GA 4RAGA 1CZEA 3BT9A 1Z7DA 2GA1A 3RKYA 2XGCA 1E0EA 3DTEA 4K2IA 1ORKA 4E7LA 4A6EA 4WWCA 2Y69H 1WJBA 3L1PA 2XROA 1Y8RB 3LQRA 3N97A 1KU7A 3LVMA 3RZDJ 4XJPA 1QVTA 2BYLA 2FX0A 2FM1A 3CC2I 1YS7A 2X6OA 2O6GE 3ZR8X 4UUSA 1GEXA 4F55A 3IHUA 2ZP7A 2OQXA 1V5FA 1YX3A 2P7CB 4JP0A 4DYCA 1WCMJ 2ISYA 5L3EA 4M2KA 4EJTA 3BG6A 3TL4X 4A3JJ 1GHCA 2E7JA 3BR3A 3IRQA 3DRDA 3KKIA 1YLFA 3I16A 2OUMA 2HYGD 3K4BA 2K9QA 3LSKA 3QYEA 3RKXA 3WTYC 4RIZA 3CC7I 3VP6A 3Q5FA 3LSMA 4CCOA 4WD2A 2DTRA 2W4SA 1MMDA 4HEA2 3Q0UA 1PJRA 3LSJA 2GOMA 3ASBA 3ZMVA 3LVJA 2YKUA 5F0CA 2X3LA 2VIBA 1CQTA 1WYTB 1PVEA 3NRAA 2MW8A 2FBIA 2IGKA 4BHDA 2K3FA 5E79C 3DEWA 3GMEA 3IF2A 5H2FC 3MKZA 5HDNA 1WH5A 1O3TA 3H92A 2K9NA 1VTNC 1VQPI 1PP7U 4IKFA 4UY8I 2ADUA 4D0PA 3FXQA 3OS0A 4OBVA 4LITA 2HYFA 5GAHJ 3AG1H 1FOWA 4L9VA 3JSPA 2OKKA 3CQ5A 3PGYA 1IRXA 4UHMA 1AY4A 4H0EA 1K7AA 2ZUKA 2W7IA 3ISLA 4IHXA 1T3IA 1LUJB 1X1DA 4QSHA 3FKJA 2KQRA 3KX2A 4XQFA 5FT4A 1BI2A 3QQAA 4MEYF 3MEBA 1QGNA 3TO9A 1I29A 4KYWA 4WBTA 1ZAOA 3GTLJ 4PUSA 3A9ZA 1WJDA 3CLQA 1RUOA 3P6KA 1D1BA 5C44J 1K6YA 4E7HA 2R5CB 2KRFA 4PCQA 1MMGA 2STTA 2V79A 2CRGA 2E19A 2HQNA 5J1UA 1LDDA 2M7BA 1JE8A 1BJOB 2D7ZA 5M4BA 4RLQA 2WTEA 2CMPA 2LYCA 4AC0A 1YI2I 4XRSG 2P4WA 3F6OA 3HJEA 2ACJA 1QISA 5TGTA 2HEOA 4XQ2A 3CP8A 4Y0DA 5G09A 4DGWB 3EZSA 1QBJA 1DDNA 1E5FA 2W7LA 2X0LA 1C7GA 4HX4A 1UU0A 3QGUA 4LG3A 2MGQA 4EJVA 2JPBA 3CAIA 4OYTA 3BCXA 4A3FJ 1TWFJ 1IC8A 4R8HA 1QQIA 3HC7A 2EFWA 3MC6C 1ETWA 1FX7A 3ZRPA 2RREA 1EKEA 5DM6F 2XF6A 2JUGA 2V1UA 3QP5A 3X2QH 4PJ0C 1ZG1A 3PQKA 2YU9J 3WTVC 3SDBA 4E7IA 1JT6A 2Y0MA 5E4ZA 4E6KG 3MAFB 2FRHA 3KCCA 3I53A 2W7DA 1U5TB 2GXGA 4HA8A 1A04A 4YFKF 2JJGA 3WCNA 3OSGA 1LEAA 2QA3A 3M3YJ 2JMWA 2PMHA 2DA2A 3K1MA 3A01B 2EPJA 1WWXA 2NOJB 4Z2YA 2BOLA 3AKZA 3AFHA 2Z1DA 5EUEA 1TQIA 3KP4A 1GD9A 3PUFA 3GFIA 2OZ6A 2E60A 1OCPA 1WJ5A 2FF4A 1JG8A 3H5NA 3PAAA 3REOA 2P6SA 1OCCH 5E3LA 5LGUA 2LF7A 4XKVA 3BZCA 2LDUA 2LY2A 2GXAA 3IHJA 3USFA 2VKEA 4LG0A 5K7FA 3GCMA 1EH6A 2W24A 4ZDLA 5EJCA 2HQAA 5CJ9A 4EQQA 5ILVA 2VLFA 1LKXA 1FYKA 3OR1C 4P9FA 1GLNA 2W7HA 1TATA 1UU2A 1W7PA 1QHGA 1E2XA 1OHVA 2M4KA 1E5EA 4Y52J 1MDXA 3I58A 4KIBA 4YIFA 3NTJA 1FBSA 2XIGA 3DKWA 2R5ZA 1ASBA 1VNDA 1D7UA 1UKJA 3PPLA 4ENKA 2P7VB 3TP0A 2DXIA 1AJRA 2D66A 4UUSB 1K4SA 2NMPA 1KYZA 3ESWB 1P3WA 2G6WA 1YAAA 4A6RA 1X2NA 5HS9A 1F43A 1T6SA 1WJAA 4LMYA 5C4JJ 4XAUA 2PX9A 1DKAA 4LGWA 5B3SH 4WX9A 3DU4A 4A72A 4OIOF 3DXWA 4D1QA 1GT0C 5LRSA 3IAS2 1QJ3A 3I56I 3OYJA 3DXJF 1X4OA 1DFOA 5J47A 2O9LA 2JJFA 9ANTA 2XRNA 1HA8A 4Q31A 4DQ6A 2LD5A 2Z33A 1LW4A 1RPWA 5HOOA 2AATA 5JLWA 3DKXA 2O8XA 1YJWI 3AELA 1OJLA 2CJHA 4N9IA 1HOMA 1IAXA 5D6FA 1NK2P 2ZXJA 2NOGA 3CBFA 2JJ7A 3KYDB 5DEQA 3HOSA 3MADA 2ESNA 2F4MB 4ENNA 4JX5A 4S0HB 3ZQHA 4IJAA 4XLHA 4I02A 4DIQA 5J3LA 3ZQ7A 3IV5A 1KONA 3NWTA 3FTBA 2NXNB 1ETXA 4LB5A 1OXPA 3ZRRA 2QZ8A 3DLLF 2RKHA 3W1HA 3E7LA 3V7SA 2RC4A
chains in the Genus database with same