4MGRA

The crystal structure of bacillus subtilis gabr, an autorepressor and plp- and gaba-dependent transcriptional activator of gabt
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
468
structure length
468
Chain Sequence
DITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHIDQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSKSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKENKRQTGRPALIIGFARLKEEDIQEGVQRLFKAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulatory protein GabR
publication title Crystal structure of Bacillus subtilis GabR, an autorepressor and transcriptional activator of gabT.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
total genus 135
structure length 468
sequence length 468
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4mgrA01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4mgrA02
2EA4A 1G3TA 4A6UA 4BHPA 3MEBA 1LC7A 4HX4A 1B59A 3WTWC 1BC8C 2EFQA 4O5VA 7AATA 3A9ZA 4H51A 1IUYA 3CLOA 5LHAA 4W91A 4HZFA 4MQPA 5HLHA 3OKSA 3T1BA 1KKJA 4F5MA 3ASBA 4P7YA 4WXDA 1LDJA 1IN5A 5CJ9A 2NMPA 1R58A 3NNKA 3FXQA 3BPXA 3Q9VA 3HTSB 3GZDA 5EIGA 2VMRA 5LRSA 1FYKA 1W7LA 4M74A 1PG8A 4ISYA 3RI6A 4RB2C 4KIFA 4KFCA 2OAZA 4MNUA 1EJIA 1R36A 1AKCA 1V4RA 3HRSA 3VFZA 3IRQA 2KJBA 3RKXA 4G7ZF 1AJRA 2JG2A 1E5FA 1AJSA 5FT5A 5LHHA 2ZNYA 1B1BA 4IXSA 4F5JA 4ZYHA 4OINF 4LB6B 2LKPA 2RFVA 1GXQA 2AY4A 4CICA 3MZHA 1S06A 5L3GA 5ILVA 1WSUA 2CTZA 4OT8A 2DPUA 1LNWA 1IXSB 3LQQA 2W7IA 5H20A 3LA7A 4DNCA 1D5VA 1GBNA 4KIGA 3K40A 4IPAA 1YLFA 4WXGA 2AY8A 3LA3A 4H0EA 4RJ0A 2W8UA 2VGWA 1W7PB 5H6QA 3GFJA 3CUOA 2LSOA 3E6BA 2E1CA 1N31A 2F2EA 4I0AA 4A6DA 1QISA 4LW4A 1VP4A 4AVPA 4BYYA 2QMAA 1ZLJA 2AEVA 4KXKA 3FRKA 1ZREA 1U5TC 1G3WA 2LF7A 2K7LA 2LDUA 1WQ2A 1X0MA 3FQ7A 4OYTA 1IN8A 3N0LA 4G94A 1AMSA 4I8AA 2GIVA 1QJ3A 4KYWA 1IN6A 1OYIA 4RS8A 3J80K 3LAJA 2EV6A 1IUGA 5HDMA 3ZRQA 2CG4A 3IWFA 2GMSA 3FMQA 4GYGA 1YS7A 2BBYA 3QHXA 3E6DA 3RTRA 4ZDLA 3Q5FA 3GSBA 1TOIA 5HLIA 2V1PA 1TATA 1IVRA 2P7CB 3EI9A 3E6GA 1DP7P 1XDSA 2R7FA 1H0MA 3PFIA 1AOYA 3P7NA 1MJBA 2OA4A 1XCBA 2STWA 3OP7A 3QPGA 1IN4A 3ZRRA 1KGSA 2EV5A 4J5UA 1ZRCA 3LVKA 1AY8A 1YNUA 3NUBA 3GFLA 3BN1A 4KNYA 1XSDA 2W8WA 4MTDA 5FLXK 5J8FA 1J04A 2CW0F 3F0HA 3IF2A 1MJ9A 3USFA 4ZASA 4KIBA 4WYCA 4OBVA 2HQNA 4R8DA 1G7WA 3BJ6A 4Q47A 1O3TA 1ASLA 3C18A 3P9KA 4D0PA 1JGSA 2R5EA 5HS7A 2HP1A 3R0AA 1CQ7A 3KP5A 2H94A 2H27A 3PIUA 2FE3A 3RKWA 3HIFA 4KA4A 2DU9A 3DR4A 4AO4A 3JTGA 1V2FA 3FZ8A 3MZYA 4BMKA 1OKRA 1IZ1A 3K0LA 3CQ5A 2P4WA 1Z7UA 1M7YA 2BI5A 5H6RA 3LAPA 3NYSA 1G7XA 2D66A 3HOSA 5K5QA 1BI0A 5EFSA 1JE8A 3PQKA 3FVXA 2YKUA 4O6JA 2QB2A 3K9TA 4OBUA 1JF9A 2JZYA 1PMOA 3I64A 3LY1A 3WCOA 4LNJA 1ASDA 2ETHA 3TFTA 2FBIA 2VLFA 2FNIA 2WV0A 4LLLA 3MEXA 2E7UA 5D8KB 2XROA 1SFUA 2W7HA 3TO7A 3I16A 3VK4A 1FYLA 5M46A 4HF8A 5DJ9A 4IW7A 4WLHA 4N0WA 3MWMA 4LJZF 1XGMA 4XEWA 2FBHA 3KE3A 1ASCA 1R1VA 3KE2A 9AATA 1J75A 3KETA 3F21A 2Z9VA 1BN5A 4HQEA 1J9IA 1ASMA 3NRVA 3DPTA 3DKWA 3BCXA 2QZ8A 3DFGA 1DPUA 1TOEA 3S2WA 1TOJA 4UHOA 1FC3A 4P96A 1R1TA 1T6SA 1UHWA 2ISZA 5M4BA 2HWVA 1O3QA 1AWCA 2RN7A 3PQJA 1GCKA 4NOGA 3ZMVA 3I4JA 3BZ6A 3VEPA 1WWXA 1S8NA 3B8XA 4MQRA 4WYFA 2XKOA 1FYMA 3VAXA 1HKTA 4ZZDA 4GYIA 3P1TA 4K2IA 1TQIA 4RGRA 1D7RA 3JW9A 1U5TB 1QNTA 3G8MA 2VMWA 4G7HF 1AAMA 3FZVA 1XGOA 5DJ1A 4B9BA 4F5FA 1ASGA 2OZ6A 4RKCA 3WZFA 1AMRA 3EQLF 2HZTA 2PFBA 4HLXA 1J7KA 2XVCA 3H3ZA 2F5DA 3RBLA 4CXQA 2J5PA 2OQRA 1H1CA 1XEYA 1SD5A 3U9GA 1ZHFA 2FN6A 4U1TA 5DX5A 3TDUC 3GW2A 3SQNA 2Q8KA 5F1RA 1IF1A 3FSLA 1ZH5A 5ICFA 1SFFA 1YG2A 1MGTA 3QOPA 4OIOF 2BWPA 3P9CA 1R5GA 2EZ1A 1JHHA 2K4JA 4OIQF 1NHAA 1BJOA 2VXZA 3M7GA 1SZSA 2EFNA 3LVJA 4A12A 4RM1A 2VLHA 3BWNC 4QGRA 3LQRA 1MZBA 3BWGA 2BIAA 5L3FA 5FO5A 2RQPA 2M1BA 1W4MA 5TJJA 2Z1ZA 4ITXA 3ASAA 1AHYA 1B5PA 3L44A 3E3VA 5E17F 2L4MA 2XHKA 4KN7X 2OKKA 4MY5A 3WCNA 2PMUA 1YW9A 2MH9A 2MC3A 4AH3A 5A2QZ 3R60A 4GO1A 1J2XA 4K2EA 2VGUA 4ON0A 1ODDA 2O3FA 3KGXA 2IJLA 2VBYA 4LG0B 4KMUX 2RVCA 3PDXA 5AX8A 3G0TA 3WY7A 2NYXA 4A0XA 4IYOB 2BWNA 1KMKA 3TO6A 1MDMA 5K1YA 3MBBA 5E5IA 5F8VA 5C6UA 2YCTA 4I2OA 2XAHA 2VT3A 4ZH4F 1YJSA 1QZYA 4Q6RA 4AIHA 2PI0A 4GRXA 4R1HA 2W8JA 3WTZA 1AY4A 3IKTA 2VI8A 1QBJA 3VK3A 1ELUA 2HP2A 3DPLC 1O62A 5G2QA 2O8XA 5M49A 3GZ6A 3GUDA 2DFIA 2PEXA 1HKSA 4BHBA 2VGVA 4RGSA 3BROA 1UU0A 5K5RA 1STZA 2QB3A 4W1WA 2IT0A 1BS0A 3QU3A 4YIIA 1R5HA 5HDKA 1BJ4A 2YCNA 2VN2A 1CQ8A 1CGPA 2R5CA 1LQ1A 5DDGA 1J59A 5J8QA 4Y13A 2W24A 4XBFA 1Q1HA 2VONA 1IW7F 3TQNA 4WYAA 1AMAA 2RNJA 1S7AA 2W25A 3O2PE 4EJUA 2IP2A 2Z9WA 1GC3A 2ZFWA 1Z6RA 1B9HA 4ESBA 4EM1A 4EB5A 3REOA 2Q0OA 1BW0A 2V1DA 2EJRA 1E17A 3E77A 2YU3A 5CVUA 2HQRA 2ZXJA 2HUIA 3DRDA 3NU8A 1DPRA 5LGTA 1KL1A 4BA5A 4P3MA 1S09A 4L5JA 4RB3C 1B9IA 1KU7A 4U7BA 2BYLA 2GA1A 2BI9A 2CO5A 3FX3A 4Q4ZF 2DI3A 1U6GA 3MCZA 4A5MA 4JEXA 3JW4A 4G6DA 1QGPA 4UVCA 1YO5C 2OGAA 2PJPA 3NU7A 3LG0A 1IAWA 5JI6A 1DUXC 2KKOA 5D5WB 5JFRA 3V8KA 2OZUA 3F8CA 1YJZA 3G3ZA 3RKYA 4B98A 1H0CA 3GETA 2P6SA 1ZG1A 1FWZA 5E3KA 4UQVA 1KQ9A 3IWZA 2V1UA 3I0TA 1DDNA 3WTYC 2VOOA 4M9XA 2VMNA 3KP4A 1FZPB 4JF0A 4WP0A 2DPDA 4DQ6A 1RVYA 1ZRDA 3QPTA 1S7OA 4KT5C 2AEUA 3AELA 2GXBA 3AEJC 3MAUA 4BAYA 3FHZA 1BC7C 1LC5A 1T98A 3MADA 4N9IA 1BQAA 1MAQA 2FM1A 1B6AA 3ZMSA 1LVAA 2W8VA 2QYOA 1UU2A 3B46A 4K2BA 5HHYA 3ECHA 3T8TA 2XUBA 5L3EA 4R8HA 5E18F 1AHFA 3JTXA 4ENNA 1USTA 2FQ3A 1OYYA 2D1HA 1O3RA 1ON1A 1O61A 1M4NA 1ZAOA 4UHMA 1BJNA 3FMSA 1ONVA 5AONA 3GFMA 1I6XA 4OIRF 1GHCA 3ATHA 1GC0A 3A2BA 1B9MA 1OATA 2JPBA 1RV3A 2W7KA 1H9GA 3RCHA 4RKDA 3D0SA 1SZKA 4M9SA 2XIGA 5BOXA 5IWQA 1LEAA 2VMTA 4EQQA 3HL2A 1BI1A 2RDPA 3V4GA 4XJPA 4L9JA 1Y0UA 4HV6A 1K78A 4TN4A 2X0LA 1F5TA 2VC1A 2L4AA 4RAYA 4LK0F 3U1DA 4BH9A 3ELEA 4GSAA 4LG0A 3BCBA 4EV0A 3HMUA 2KJCA 4PGHA 3BB8A 2TPLA 2D5YA 3JZLA 2FYFA 3TOAA 4JEZA 1AAWA 2HKOA 1Z91A 2DLLA 3FWEA 5HDGA 1G3SA 2YX4A 4HF0A 3R4KA 3H92A 2V1XA 2BKWA 2Z1YA 2CJGA 1BJAA 2NNNA 2VI9A 3AEMA 4IY7A 3LWFA 3MAJA 1FY7A 1M0QA 2GQQA 2YKYA 1LKCA 1I1GA 4GCVA 1SFXA 5FFZA 4I0BA 4W1XA 2DK8A 2QM3A 3IKVA 2OU2A 4DGTA 2IW5A 2CH2A 4Y17A 4HX8A 1C7GA 1XMKA 4KN4X 5L3BA 3K1MA 1D8KA 1KMJA 3KKIA 1C9CA 3F8FA 2YKVA 4K2MA 4LGWA 1A04A 3FVSA 2BGCA 2FMLA 1YAAA 3F9TA 2O03A 3JSPA 1GEXA 3WG9A 2Q7WA 3FFRA 2JGTA 2GMUA 2HR3A 2XASA 3WTUC 4EFFA 3CUQB 4ADBA 3IRRA 1S6LA 3DODA 4U88A 1G3YA 4HA8A 4A72A 1LS3A 2F8JA 2ESNA 1B4XA 1HW1A 4PIWA 1EQBA 8AATA 2ZYJA 3B1EA 5FLXZ 2YRRA 2ACJA 1DGEA 3FXUA 3KP6A 3EI7A 2VT2A 4EM2A 1CS1A 3W6JB 3F22A 3VK2A 1CF7A 1BIAA 4ADEA 1ARSA 2PG4A 5D5UB 4KMFA 1M6SA 1P4AA 3SHFA 5LLQA 4ZYEA 2YRIA 3ZMTA 3TATA 2C0RA 2Z67A 3CDHA 4WXHA 5DYMA 2X3LA 1DFOA 5HS8A 4G8XA 4QLCU 1CQ6A 2AY5A 4XJMA 1B8GA 2KRFA 4L5IA 3K1PA 4FHTA 3ZMZA 3T32A 2HYGD 4ZYDA 4I09A 2OKJA 1JXSA 3KFWX 5EUNA 4HDVA 5TF5A 3PD6B 4MTEA 1TASA 2PB2A 2W7LA 1LEBA 1OMIA 1OYWA 1S0AA 2ESHA 2D7YA 3DXWA 4LLNA 2OATA 4ZWVA 3E2ZA 1EG5A 4P55A 4EB7A 3MC6A 1O69A 2HTSA 4CZZA 5LHGA 3DC1A 2O0RA 2Z3YA 1Z7DA 3Q8NA 4FX0A 2HDCA 2A07F 3DR7A 2ADUA 1AICA 4A6RA 1QZ9A 1N2TA 3RIRA 3EDPA 3KEOA 1M32A 1XN7A 3GF2A 4HLYA 1ZGJA 1SZUA 1SAXA 4OOIA 1TOKA 1G6NA 1DTYA 4ZWMA 5FD6A 1U3EM 3HQTA 2XAGA 1AMQA 2ZP7A 4XJOA 4CXFA 2K4BA 1IRGA 1N8PA 1R1UA 3TO9A 2Z61A 1YIZA 3P9IA 3FM5A 3GR9A 4WB0B 3J81K 1O7FA 4U0VA 2G6WA 3ELPA 2A6EF 3FQ8A 3ISLA 4AD9A 4L18B 2HOEA 3BV0A 3AENB 3FM3A 4QWQA 1D2FA 4Y0IA 3BC8A 3F23A 2PB0A 1ASFA 2E7JA 4EGYA 4CBRA 2QA3A 2STTA 4YIFA 3KP7A 1H9TA 2VMOA 2BWOA 1REPC 4OC9A 3KP3A 3BS8A 4Z2YA 4ENJA 1K79A 2PQ8A 3ZN0A 2AY2A 1ZGAA 4BQAA 1DJ9A 1ASNA 3ECDA 2VOPA 1BI2A 2ZSLA 3F72A 3EUHA 3D6KA 4W5KA 5EUDA 5BJ3A 1ASBA 3WE3A 1AHEA 3RPQA 4WF2A 2DW4A 2WK7A 4XJLA 5BS6A 1JHFA 3ZPLA 1MGVA 4KDPA 3EETA 4WK8F 4HF2A 1DJUA 4LFUA 4RAZA 1ZRFA 1WI9A 3I4PA 5JHUA 4ZDOA 2JJFA 1MJAA 2EFOA 5D6EA 4EJVA 2YOBA 2M87A 4HOBA 4F5GA 4R5FA 2HEOA 2AXLA 1RVUA 5LH9A 4LMYA 2ZMEB 1WKHA 2RGVA 5E8IA 3EZSA 2P8TA 4JK1X 1SVVA 3NDNA 1L3LA 1RIOH 1IBJA 2CY8A 1WYVB 4IF4A 5FD5A 1YIYA 4M71A 5HXXA 3I59B 5LGNA 5HVQC 3GEZA 2OBPA 4XLNF 5LGUA 1QPMA 2YSRA 3UAKA 3QN6A 2JT1A 3CO7C 4A0GA 1RV4A 4LNMA 3CUQA 4L9NA 5I92A 4S04A 1ZLKA 5K8BA 1AIAA 4WLJA 1R00A 3GXOA 1CL1A 1W5SA 1RUNA 1W7PD 1I48A 1SD6A 3A9XA 4R79A 2OQGA 2ZBKA 5ICEA 4OMYA 1ZG5A 2FSWA 2X8UA 1S07A 4MGRA 3II0A 2CINA 3HSEA 4AIJA 1TTYA 2VE8A 4L9TA 4L9VA 3LSTA 1I41A 5FGMA 3VOEA 2CFBA 4HW0A 3F6TA 1TW3A 4WWCA 4L0OA 2R0TA 1EH8A 3NTJA 2NRAC 2XRNA 2W7JA 2PO3A 1CL2A 1SFEA 2DOUA 1BBYA 2QENA 1W7PA 2DO7A 1KKPA 4Y15A 3H7FA 4M73A 3T0YA 3V8LA 4EMYA 3ABTA 5DD8A 1KQ0A 2VC0A 4DQ2A 3TCMA 2F5EA 4FL0A 2Y0MA 3GWZA 2B0LA 3ZRPA 1C7NA 2A69F 3HVYA 3AEJA 3R6SA 3RYRA 3ROUA 3GWPA 4M6XA 3PD6A 4W8IA 3ZMDA 4A0FA 2QWWA 2K27A 4WXCA 4MQVA 4Q5SF 2FNAA 4KYOA 2IA2A 4CVQA 2XAFA 3LVMA 4OMAA 3EZ1A 2F5CA 3RJPA 4M9ZA 5HOOA 4L0YB 2O7CA 2E7XA 3L7WA 1Z9CA 2AY6A 3N4MA 3DXVA 3TKYA 2M5WA 2MA3A 4CBSA 1UU1A 1F1ZA 1IXRC 2KIFA 3GLXA 3HSRA 3RUYA 3F6OA 1C0WA 1XMAA 2IPQX 1W5TA 1IRFA 1FNNA 1W3UA 1HW5A 1AIBA 4EM0B 2Y48A 3GBXA 3M8FA 4WX9A 5D95A 1OHYA 3DV8A 1DKAA 1SMTA 3R61A 1FT9A 4RIZA 3B73A 1FG3A 4WYEA 3M1EA 3JWAA 2J5OA 3OV8A 3FF5A 5EEGA 2CB1A 1T3IA 3KLNA 2X5FA 4PCQA 3FKDA 3ISPA 3WE2A 3L8AA 3FCRA 3NYTA 1C4KA 2QLRA 3AENA 1O57A 1RNLA 3WGHA 5FB2A 5CVVA 2DTRA 4XLPF 1P4XA 4W1VA 2EFPA 3HBXA 4E1OA 4F5LA 3HDOA 2VIBA 3Q9SA 4MKJA 2CQKA 4I01A 1MDXA 1KYWA 1OHWA 2O0YA 5EAAA 4DBCA 5D8LB 3FD0A 1XCVA 2G9WA 3GX4X 3MAFB 3WLXA 4EU1A 3SZPA 3HSFA 4Y0DA 5CVRA 1QZZA 4A0HA 5G0AA 1Y4IA 3BJAA 1YQAA 2HYFA 1Z3ZA 3F8MA 3ECOA 2FA5A 1X28A 1XDUA 3V8JA 3E97A 1EV7A 1R7JA 4B09A 1FPQA 2BIEA 3E9KA 5KK1A 2XKPA 2ZCWA 3VODA 2UWMA 3ULQB 1BKGA 2EB7A 3NYUA 2XV4S 2YHKA 3N5MA 2D1VA 4AO9A 4P9FA 2A5YB 2DK5A 3EI6A 2C6YA 4ESFA 2C7TA 2DKBA 1YIOA 4HX7A 2FEZA 1CZCA 2P6TA 1YJYA 2CSTA 3WX9A 2ZC0A 2M30A 1W23A 2DBBA 3A9YA 3BDDA 2ZMEA 1T39A 5IT9Z 3PGYA 2E7IA 1MD0A 3CO6C 1E5EA 1HXDA 2L01A 4IRGA 4RJYA 3AV7A 2W7FA 4U0WA 5A2QK 2P5LC 1QIRA 1FP2A 3HYIA 1I1SA 2OQXA 1XD7A 2VIAA 3ZN1A 2A61A 4UHTA 5LBQA 4Q48A 4A2UA 3JAMZ 2Z33A 1BT4A 4ZYGA 2FU4A 3G7QA 3WKRA 4LC3A 2P5KA 3BJOA 2TDXA 4HVKA 2MLGA 1YOOA 5G09A 1DJEA 3RI4A 1FBQA 1SPAA 1U5TA 5ILUA 4HF1A 5E4ZA 2C44A 5DUKA 4RGXA 3WGIA 2V9VA 1GC2A 1OXOA 4OMZA 4I98B 2IA0A 3CAIA 2WK8A 3HTUA 1V72A 3NUIA 3VB2A 2GAUA 3K28A 3AOWA 2EWNA 3T5XA 2C81A 1QITA 2QLZA 2KIUA 2Z5UA 3ML6A 1TQMA 4JBAA 1ZN2A 1I29A 1UKJA 2H09A 2MBFA 3FZ6A 1S3JA 2VYCA 2G7HA 4F5IA 3M5UA 2ELHA 5G2PA 3WGBA 5CVJA 4YFXF 5K5OA 3COGA 3EYIA 3NX3A 4U2HA 1J32A 1M0OA 3FZ7A 1FG7A 3HUGA 1C7OA 1X3UA 1U78A 2YCPA 3L09A 4ATQA 4UNOA 2BI1A 1G4XA 2JRTA 2VMXA 3GZCA 1C0NA 4NB5A 4HBLA 3QAHA 4XK1A 3RPUA 4A6EA 4IXAA 3ZZKA 3C1DA 2CYYA 3COAC 4ZAHA 3ERED 2ZJGA 4ESJA 4AZJA 4PGGA 1PDNC 1MKMA 3NQOA 3WTTC 1AKAA 3PAAA 1WKMA 4JEYA 1IX7A 4L0ZB 3DP7A 1IX6A 5ILSA 1KYZA 1ZG3A 1HSTA 1F4KA 2AS5F 4GXOA 2ORDA 5LHIA 4EMSA 5G4JA 2MH2A 1W7NA 3MQ0A 4WD2A 1O7LA 1SD4A 1TBXA 3DQVC 4E3QA 3WU1B 4HYEA 2FXAA 1D7UA 4LB5A 1AHXA 1HSJA 3E2FA 2QBTA 1HQCA 1IX8A 3ABUA 1YTYA 2QQ9A 3SZTA 5D4RA 1R22A 4IYOA 4RITA 3UWCA 2FF4A 4M2MA 4FX4A 4MHGA 4IXOA 1I43A 1AX4A 1OXPA 1P4WA 2GA2A 1LW4A 1KU9A 3KZZA 1LC8A 5JR3A 2A6HF 1AY5A 1LW5A 3RQ1A 2ZKZA 1P6RA 3NEUA 3CBFA 4R5ZA 1FSHA 3ZQ7A 1VEFA 3B02A 3J80Z 1MLZA 3L2CA 3GZ5A 3V7SA 2YR2A 5EAVA 2GXGA 1G4VA 1XB4A 3FMRA 1TQPA 4JQFA 4ADDA 1CJ0A 4UHNA 3H3UA 5BPIA 1OPCA 4YFNF 2ZNZA 1AHGA 1QQIA 1ASEA 3IL2A 3ACZA 2ZUKA 5DEQA 4MKKA 5LEJA 1EH6A 3MAFA 4F5KA 2XAQA 1XGSA 3GJUA 2AY9A 4PFFA 1KL2A 5KVRA 1FBUA 1X2AA 2IA1A 1ULYA 5IT3A 4EJTA 3I5TA 3DF8A 1FBSA 4EJOA 2XGXA 2OGEA 2DGKA 3HHGA 1GXPA 2FQ6A 4XSXF 5HLGA 1IAYA 1B5OA 1MDOA 1YW8A 4U0YA 3O3KA 3J81Z 4LNLA 2CSOA 5DCMB 4M2KA 4OU0A 3EIBA 1IXCA 3IC7A 1YS6A 4CXRA 3FFHA 2O6GE 3RYPA 4IHSA 4A00A 4E70A 2VODA 1BQDA 3I71A 2EZ2A 4LW2A 4MEYF 4ASNA 5FT4A 1TW2A 5EEHA 3A8UX 3EUCA 1XSXA 4M6YA 5AIQA 3IHUA 1J0RA 4RGUA 1G4DA 2CJHA 4GDYA 4MEXF 1GD9A 1WYUB 1W7MA 3EIAA 5ICGA 4UXNA 3PPLA 4OIPF 3FXRA 4MQ9F 1QJ5A 2GWRA 3WGGA 3HOTA 2PN6A 2VMVA 3BY6A 1AKBA 1GEWA 3TFUA 2ZJ2A 1TNTA 3TOBA 2O61A 1PFFA 1KU3A 3DEUA 1USSA 5J8CA 1BJOB 5E1ZB 2WTEA 2Y75A 2O1BA 1IAXA 3BPVA 5G4IA 3DZZA 3BWNA 2X5DA 2HZPA 1ARTA 1Z05A 1D3YA 2GB3A 3QPHA 2FMYA 5F64A 3K7YA 2IRFG 3TGNA 4MSOA 3HRMA 2CH1A 2JJGA 5M4DA 1L0OC 3WKSA 1BJWA 2HS5A 1RZ4A 4GEBA 4A6TA 3W1JA 4JE5D 1EH7A 3V7CA 1KA8A 4I02A 2QQAA 4J8LA 1JS3A 2FNUA 1X29A 4GE7A 1T2KA 3EI5A 1XGNA 2Z9OA 2JTVA 4PZJA 1M0NA 3JSOA 1ZC9A 1GDEA 2R2NA 1UFMA 2BV6A 3AEPA 1S29A 1V2DA 2XBNA 3QI6A 1HBXG 1MDMB 5E1XA 1T38A 3M8EA 2D2WA 2LNBA 5D5XB 4RLGA 3FDBA 1P3WA 2D61A 2RV8A 5DV5A 3WU0A 3QP6A 3IHJA 1TNSA 4O6ZA 5D5VB 4JE5A 5TRDA 2UXXA 2BYVE 4AWXB 2EA2A 1WRJA 4YFKF 3E6MA 1VJOA 1ZYRF 2G7UA 1FC4A 2WK9A 3T8RA 3EYYA 2COMA 5F6FA 1WSTA 1ECXA 2F5FA 4CYDA 4ADCA 2VMSA 2CWEA 4R2NA 3HLMA 1ARGA 2PLYA 4IX8A 4ZM4A 3LFKA 3TDZC 2EGYA 5BPDA 2HFHA 2R5CB 4TV7A 1LJ9A 3VOMA 1Z6TA 2NS0A 5D4SA 4HV5A 5ERIA 4IRHA 1FLIA 3L9FA 3AEMC 1U08A 1UCRA 4P5OA 2ZSMA 3RBFA 1SMYF 4O3MA 2W7DA 1F9NA 2DQLA 2BIGA 4BQ0A 1S08A 2HUUA 2FRHA 3B1CA 4WXFA 4XAUA 3NRAA 4HAMA 1TPLA 4XRFA 4CO8A 4IRIA 2W7EA 1P92A 2UZKA 4ZM3A 2Z20A 3P6KA 3QGUA 2VGZA 3GZDC 3M9AA 4FFCA 4G9YA 2VBZA 1IJIA 1ARIA 2EFWA 4PFNA 1RUOA 5AIPA 2NNYA 2KIMA 4UVAA 4AZKA 4ZSWA 3AEOA 2BEOA 1O3SA 3DXJF 3KP2A 4IVNA 1GVJA 1XSVA 2A68F 1D7SA 4E77A 4XSZF 4Y0HA 2A3SA 3I58A 4IXZA 4KICA 3BWOA 1OR7A 3GFIA 4AOAA 1PP8F 1GEYA 3KLOA 4F4EA 2DGMA 5F9SA 1FP1D 2Q2EA 3LA2A 2XH1A 3DYDA 3CTAA 4ENKA 4A5NA 5FT8A 4UUVA 4WYGA 4CHUA 4EVIA 1ZOBA 5DCMA 5J6XA 3K2ZA 2VGSA 2HKXA 2LF8A 2VBWA 3RDIA 3PDBB 1D7VA 4G7OF 2WWYA 4M2JA 3TQXA 4HDUA 3C3WA 3ZP5A 1TOGA 4AIKA 5FFXA 3PJ0A 2RKHA 1E2XA 1V2EA 4KUMA 5FT6A 2EK5A 2VBXA 4HQMA 1VTNC 2AY3A 2DR1A 2EH6A 3AATA 3LV2A 1WKGA 1WYUA 4IHTA 3F8BA 4Q76A 3HHHA 3I5UA 2Z9XA 4ZSYA 4BXUA 3HRTA 2IVMA 1M0PA 1ELQA 4M72A 1ASAA 3C7JA 5EQCA 5BQTA 3MC6C 2MLKA 3F3XA 3W1HA 4ZLVA 2K02A 3FQAA 2VGTA 4OTLA 1FX7A 1YYVA 2QVOA 2D63A 2WKAA 3MKJA 5JVTA 2R3SA 5LEKA 3OOPA 1RI7A 3H14A 4EGZA 4I7HA 3FTBA 2E54A 1YW7A 1K6OA 3BCAA 4CGZA 3RCHB 2HOYA 2ZO4A 3O6BB 3BP8A 3HRUA 4OCAA 2V6CA 2Z9UA 2YKXA 4ZZLA 1BOAA 1QO0D 2P5VA 3CQ6A 1WYTB 3WTXC 1K78B 3KCCA 4WCGA 3K69A 4E3RA 3V7RA 2E7WA 4B8XA 2QBYB 1GC4A 2VMQA 4WB0A 1PP7U 1DGDA 3CJNA 1CZEA 3W1IA 3QRFF 3QBOA 1JG8A 3I53A 4Q31A 1U2WA 2VMYA 3R4TA 2WC2A 5E1WA 4N9HA 2FNPA 3J7AO 4EJWA 3ZZJA 1MLYA 2D7ZA 5L3DA 2GQNA 3N97A 3WTVC 2BE5F 5HS9A 1FSEA 4XQ2A 1ZODA 5LRRA 3JU7A 1MDZA 5BMZA 5CLSA 3HT4A 3QM2A 2H6CA 3AAFA 1SF2A 3KEQA 3LWSA 2RC4A 2HORA 4WXBA 2DAOA 1ORDA 5EIGB 1HW2A 2CJDA 2CGPA 2JPCA 4GE9A 2DGLA 2QUFA 2HGCA 1ON2A 1LDDA 3E6CC 1PMMA 4WBTA 1ZARA 2XAJA 1KQ8A 2VE9A 1I5ZA 1BM9A 3EI8A 3K1NA 3BOQA 5DB5A 1QGNA 3ZMUA 1LK9A 2FBKA 4NQWA 4PVFA 4F5HA 1AJSB 4ITGA 4YG2F 1KU2A 1ARHA 5ED4A 1V3FA 5E8GA 1R23A 3KGWA 4LK1F 2L02A 2AY7A 4LLGF 3SXYA 1CF7B 2VMPA 3GVAA 2UXNA 1UB9A 2YX7A 1JS6A 3CQ4A 2BI3A 1LDKB 2Z99A 2W85A 4UVBA 1UHMA 1WYVA 2AATA 4JF1A 4GGGA 2NAZA 3I59A 4A0ZA 2W57A 5BJ4A 3E5UA 3JTHA 5DD4A 1T0FA 4MQQA 1BIBA 1B4AA 4ETSA 2CFXA 3AOVA 4ENMA 3CUQC 5D6FA 2E1NA 2MD5A 1TARA 2V0YA 3VP6A 2EO5A 1J5YA 1K7AA 2VMZA 1SD7A 2YPRA 2BHXA 1I27A 3G73A 2QQBA 3ELKA 2DQRA 4S05A 2AY1A 5CVIA 3FVUA 1PUEE 2W7MA 4UV8A 3R9AA 2L54A 2HOZA 2HOXA 2GZWA 2D65A 6PAXA 2ISYA 3PA9A 1U8RA 1LB2A 3WGCA 1IN7A 4RB1A 2BI2A 3E2ZB 2W7GA 1TLHB 4NHJA 3L00A 1BI3A 3LVLB 3PDBA 2P7VB 5DCFA 5L3CA 3KZYA 3D5LA 3R0JA 2JJEA 5D5SA 3DU4A 2CANA 1MAPA 2GSAA 3WTSC 3QU6A 2W84A 4JEWA 5HDNA 3MFKA 4BHCA 2OD5A 4UV9A 5EUEA 4FT8A 2H6BA 3E5QA 5CYVA 2JISA 1Z1DA 4RAEA 4BNCA 2M8EA 3W6KB 2K86A 2JJHA 5E20A 2EPJA 3I54A 2L3DA 3U2RA 4GE4A 2DT5A 3QP5A 1HKQA 2HTJA 4ATPA 2DKJA 2R7DA 2JSCA 5ICCA 2X4HA 1YFHA 1OHVA 4U7DA 4G6QA 5IT9K 3UE8A 4LD5A 4IJAA 3N75A 1D8JA 3GO5A 3WODF 4N0BA 3SFZA 3E2YA 4ZDPA 2D45A 2HUFA 5DUIA 4WYDA 4RB0A 3F8NA 1FOKA 2PBIA 2VMUA 2PMHA 4KAMA 3JWBA 4PDKA 5JAYA 4JEVA 4A0YA 1O4SA 1WYTA 3JAMK 4UOYA 4F7ZA 2D64A 1B9NA 4A0RA 1XI9A 4BA4A 2M45A 1P2FA 2FOKA 3E5XA 3B1DA 4Q75A 3F6VA 4BHDA 2QBYA 3GYHX 4P9UA 4CDGA 4TMRA 2BYJA 2W8TA 2EV0A 2V79A
chains in the Genus database with same CATH superfamily
2NS8A 2EA4A 3DWLE 3IAM2 1G3TA 3PNVA 4GFBA 4BJTA 4A6UA 4BHPA 3MEBA 1LC7A 4HX4A 1B59A 5DTDA 3WTWC 1BC8C 2EFQA 4O5VA 7AATA 3A9ZA 4C2UA 3J7AY 4H51A 1X58A 1IUYA 5J4VA 3DBRB 3CLOA 3A1YA 5LHAA 4W91A 4HZFA 4MQPA 5HLHA 4N4NB 3PSFA 3OKSA 3T1BA 1KKJA 1Y1VJ 2HDDA 4UUSB 4F5MA 2CRGA 1XG1A 3ASBA 4P7YA 4WXDA 1LDJA 1IN5A 1EJ9A 5CJ9A 3HJEA 2NMPA 1R58A 3NNKA 3FXQA 3ASNH 4PJLA 5J4YA 3BPXA 3Q9VA 3HTSB 3GZDA 5EIGA 2VMRA 5LRSA 1FYKA 1W7LA 4M74A 5JHFA 1FOWA 1VQ8I 1PG8A 5EG0B 3OY9A 4ISYA 4XLEA 3RI6A 4RB2C 3OIOA 4KIFA 3E7LA 4KFCA 2OAZA 1WJBA 4MNUA 1EJIA 1R36A 1Y0NA 1V4RA 4PJNA 1AKCA 1D5YA 3HRSA 3VFZA 3IRQA 4PFOA 1D0ZA 5FKNA 2KJBA 3RKXA 4G7ZF 1AJRA 2JG2A 1E5FA 1AJSA 5FT5A 2JA2A 2VQHA 1OJLA 5LHHA 2ZNYA 3HOZJ 1B1BA 1YRNA 4IXSA 4F5JA 4Y3OA 1GUUA 1S72I 3H3VK 4DYCA 4ZYHA 4OINF 4LB6B 2LKPA 2RFVA 1GXQA 2NS7A 2AY4A 4CICA 3MZHA 5F04A 1S06A 5L3GA 5ILVA 1WSUA 2CTZA 4OT8A 1IRXA 2DPUA 1LNWA 1IXSB 2VKVA 3LQQA 4MO7A 5LFAA 2W7IA 2KIQA 3LA7A 5H20A 3CP8A 4DNCA 1D5VA 3MN2A 4KIGA 1GBNA 3K40A 2MW8A 4IPAA 1YLFA 2QA4I 4WXGA 2AY8A 3GTLJ 2M3AA 3LA3A 3HGYA 4H0EA 4RJ0A 1K61A 2W8UA 4MLOA 1H89C 2VGWA 1W7PB 5H6QA 3H5RA 5C4XJ 3GFJA 3CUOA 2LSOA 3I55I 1VQNI 3E6BA 2E1CA 1N31A 2F2EA 4I0AA 2ECBA 4A6DA 1QISA 4LW4A 2F4OB 1VP4A 4AVPA 4BYYA 3PUBA 2QMAA 1ZLJA 2AEVA 4KXKA 2DTZA 3FRKA 2KRCA 1ZREA 5JLWA 3QPSA 1U5TC 2CFOA 2E36A 1G3WA 3L2QA 2LF7A 2K7LA 3LSJA 2LDUA 1WQ2A 1X0MA 2BVMA 1N25A 5F0CA 3FQ7A 4OYTA 1UAAA 1IN8A 1QU3A 4G94A 1AMSA 3N0LA 4I8AA 2GIVA 1QJ3A 4KYWA 1IN6A 1OYIA 1ZELA 3WHBA 2ZSHB 4RS8A 2CH0A 3OYDA 3J80K 1MNEA 3LAJA 4Y7NJ 2EV6A 1IUGA 5HDMA 3ZRQA 2CG4A 3IWFA 2GMSA 4QPQA 3FMQA 4GYGA 2L7FP 1MBFA 1YS7A 2L7KA 2BBYA 3MZ8A 3QHXA 3E6DA 4NC7A 4NNJA 3RTRA 1J09A 4ZDLA 4I99C 1MSFC 1SVMA 3Q5FA 3GSBA 1TOIA 5HLIA 1TP4A 2V1PA 2IS4A 1TZLA 1TATA 1IVRA 2P7CB 5K7ZA 3EI9A 3E6GA 1DP7P 1XDSA 2W82A 2R7FA 4GRIA 3PFIA 3SJMA 1H0MA 1AOYA 5EJCA 4KITB 1IJWC 3P7NA 1MJBA 2OA4A 1XCBA 2STWA 3OP7A 3J7YJ 3QPGA 2AHQA 2KFDA 1IN4A 3ZRRA 1U9NA 2JWTA 1KGSA 2EV5A 1UMQA 4J5UA 1ZRCA 3LVKA 1AY8A 1BW6A 1YNUA 2DMNA 3NUBA 3GFLA 3BN1A 4KNYA 1XSDA 2W8WA 2W4SA 4MTDA 5FLXK 5J8FA 1J04A 2CW0F 3F0HA 3IF2A 2MYSA 3G6EI 4ZJZA 5HNFA 1VFCA 1MJ9A 4JX6A 3USFA 3H9GA 4ZASA 1RRJA 4KIBA 4WYCA 5H2FC 2HQNA 4OBVA 4R8DA 1G7WA 3A01A 3BJ6A 4Q47A 3ZRGA 1O3TA 1ASLA 3C18A 3W2WA 3P9KA 4D0PA 4ITVA 1DQUA 2NOGA 3OSGA 1JGSA 1HDPA 4QIWN 1DU0A 3PNYA 2R5EA 5HS7A 2HP1A 1OFCX 2VJIA 3R0AA 2DA4A 2O7OA 1CQ7A 1VI0A 3UNGC 3KP5A 2H94A 2DXIA 4LIVA 4V19K 2H27A 2DT6A 2VI6A 3S1MJ 3PIUA 2FE3A 1Z0XA 1MH4A 3RKWA 3HIFA 4KA4A 2DU9A 1WJAA 3DR4A 1WH7A 4AO4A 2K40A 3JTGA 3G4SI 1V2FA 2BZTA 2DMQA 3FZ8A 2FQ4A 3MZYA 4LOCA 4PK4A 4BMKA 1OKRA 4A3BJ 5JLXA 1IZ1A 3K0LA 1OCRH 4CYCA 3CQ5A 2P4WA 1Z7UA 1M7YA 2BI5A 5H6RA 3LAPA 3NYSA 3FK7A 5EDNA 1G7XA 2D66A 3HOSA 5K5QA 1BI0A 5EFSA 1JE8A 3PQKA 3FVXA 4ZTJA 2VKEA 5HODA 4O6JA 2QB2A 2IS1A 2YKUA 3K9TA 4OBUA 1JF9A 2JZYA 3FK6A 1PMOA 2LLKA 3I64A 3LY1A 5IYCJ 3WCOA 2XPVA 3CCJI 3P1TA 1ASDA 2ETHA 4LNJA 3TFTA 3TEDA 2FBIA 3VYTB 2VLFA 2FNIA 2WV0A 4LLLA 3MEXA 2E7UA 5D8KB 2XROA 1SFUA 2W7HA 3TO7A 3I16A 3RQ4A 3TW7A 3VK4A 4X6AJ 3O8HA 1FYLA 5M46A 4HF8A 5DJ9A 4IW7A 4WLHA 4IQ4A 4N0WA 1LFBA 3MWMA 4LJZF 1XGMA 4XEWA 4XRSA 2FBHA 3KE3A 1ASCA 2GLOA 3CCSI 1R1VA 3LSKA 5K7HA 3KE2A 9AATA 4A3DJ 1J75A 3KETA 1X2NA 3F21A 1BN5A 2Z9VA 4HQEA 1J9IA 1ASMA 3NRVA 3DPTA 4UUSA 1UG2A 3DKWA 4PJJA 3BCXA 2QZ8A 3DFGA 1IO2A 4XIDA 1DPUA 2MC4A 3D1NI 1TOEA 3S2WA 5HNHA 1TOJA 1IC8A 4UHOA 1FC3A 2QKMB 4P96A 1R1TA 1T6SA 1UHWA 1BR2A 3BZCA 2ISZA 5M4BA 2HWVA 1O3QA 1AWCA 3IH3A 2RN7A 3PQJA 3LNQA 1GCKA 4NOGA 3ZMVA 1K83J 2QSHX 1SC7A 3I4JA 3CCRI 3BZ6A 3CC2I 1M1EB 3VEPA 1OCPA 4HNUA 1B72B 1WWXA 3VWBA 1S8NA 3B8XA 1WH5A 3GTKJ 4MQRA 3O8GA 2FD5A 4CCNA 3TW6A 2CUZA 2XKOA 4WYFA 1FYMA 3VAXA 4HPQA 1HKTA 3TBIA 4ZZDA 3BT9A 3KIOA 4GYIA 4F91B 1TQIA 2DA7A 3CCYA 4RGRA 2NVXJ 1D7RA 3JW9A 5FLMJ 2VASA 1U5TB 4XLHA 1QNTA 2XPWA 3G8MA 2VMWA 3G1LA 4G7HF 1PJRA 2DA2A 1AAMA 3OMYA 3FZVA 2KISA 4CA0A 2B63J 1XGOA 2ME0A 5DJ1A 5IOZA 4B9BA 3JRBA 2I8DA 4F5FA 5E79C 1ASGA 2OZ6A 4RKCA 3WZFA 1AMRA 3EQLF 2F48A 2HZTA 3LOCA 2PFBA 4HLXA 4II2A 3GBGA 1J7KA 2XVCA 3CC7I 3H3ZA 2F5DA 3RBLA 4CXQA 2J5PA 1YJWI 2OQRA 1H1CA 3D5RC 1XEYA 4I6ZA 1V5GA 1SD5A 3U9GA 5J1UA 1ZHFA 2QF7A 2RQQA 4BXFA 2FN6A 4U1TA 1QHGA 5GAEJ 5DX5A 4X1EA 3TDUC 4LITA 3GW2A 2AQEA 3SQNA 5IP6A 2Q8KA 5F1RA 3NARA 3HUGB 5CQEA 1IF1A 1TWCJ 3FSLA 1ZH5A 5ICFA 3S14J 1E3HA 1YG2A 1SFFA 2QEXI 1MGTA 3QOPA 5E3OA 4OIOF 2BWPA 2E60A 1HF0A 3P9CA 1R5GA 2EZ1A 1JHHA 3WKSA 3A2KA 2K4JA 4RDUA 1WHUA 4OIQF 1NHAA 1BJOA 2VXZA 3M7GA 1SZSA 2EFNA 3A4CA 4A12A 3LVJA 4RM1A 2VLHA 3BWNC 4QGRA 3LQRA 1MZBA 3BWGA 3S8PA 4RBOA 4AUXA 3K4KA 2BIAA 3RCOA 5L3FA 4E7IA 5FO5A 2RQPA 2M1BA 1W4MA 5TJJA 2Z1ZA 4ITXA 3ASAA 4FCYA 1AHYA 1B5PA 3ASOH 1A31A 3K4LA 3L44A 3E3VA 3ZQGA 5E17F 5EZHA 1EF4A 2L4MA 2XHKA 4KN7X 2OKKA 2F5VA 1R6RA 2OCEA 4MY5A 2PMUA 3WCNA 1YW9A 2DODA 2IGKA 2LREA 2LK2A 2MH9A 2MC3A 4AH3A 5A2QZ 3R60A 4GO1A 4A3KJ 1J2XA 4K2EA 2NVQJ 2VGUA 4ON0A 1ODDA 2O3FA 1BA5A 2JK3A 3KGXA 2LR8A 2IJLA 2AQFA 2W48A 2VBYA 3WHCA 4LG0B 2QGUA 4KMUX 3LSGA 2RVCA 3PDXA 5AX8A 3G0TA 3WY7A 2NYXA 4A0XA 3A02A 3HPGA 4IYOB 2E35A 4MIMA 1WJDA 2BWNA 4RLQA 1KMKA 3TO6A 4XOTA 5K1YA 1MDMA 3MBBA 5E5IA 5F8VA 2K9LA 5C6UA 2YCTA 3Q0UA 4I2OA 4H4KC 2XAHA 2VT3A 4ZH4F 2VLAA 1QZYA 2CV2A 4AIHA 1YJSA 4Q6RA 4XN3A 2P81A 2HOTA 2PI0A 4GRXA 4R1HA 2AY6A 2W8JA 3LSPA 4W1UA 3WTZA 1A6QA 3VSLA 1AY4A 1MSEC 3IKTA 2VI8A 1QBJA 3VK3A 1MBJA 1ELUA 2HP2A 3DPLC 2GBYA 4PJMA 2BHYA 3OOUA 1P7IA 1O62A 3S16J 5G2QA 2O8XA 5M49A 3GZ6A 2RNGA 2M7BA 3RKQA 3GUDA 2DFIA 2PEXA 1YITI 3EUHC 1HKSA 4BHBA 5B5EC 3BR2A 2VGVA 3ABKH 4RGSA 3BROA 1UU0A 5K5RA 1STZA 3PO3J 3HC7A 2QB3A 2IGNA 2L2OA 2JUCA 4W1WA 2IT0A 3LL7A 2H1LA 3QU3A 2IAIA 3IH2A 1R5HA 4YIIA 5HDKA 4DIQA 1BJ4A 2YCNA 2VN2A 4DYQA 1CQ8A 2CW7A 1CGPA 3DTEA 3ZGKA 2R5CA 4U87A 1LQ1A 5DDGA 1J59A 5J8QA 4XRSG 4Y13A 2W24A 3TL4X 4XBFA 1FJLA 1Q1HA 3K70D 2VONA 1IW7F 3TQNA 4WYAA 1AMAA 2K3FA 2F4MB 1X3WB 2RNJA 1JUMA 1S7AA 2W25A 2ZFUA 3O2PE 4EJUA 2IP2A 5IOYA 4PFPA 2Z9WA 2ZB9A 1GC3A 2I5UA 2ZFWA 1Z6RA 3K4MA 2LOOA 3GMEA 3DEEA 1B9HA 4ESBA 4EM1A 4EB5A 3P5JA 3REOA 2Q0OA 2WV1A 1BW0A 2V1DA 2EJRA 3A0BC 4A3GJ 2X51A 4E7HA 1E17A 2CV0A 1DU6A 3E77A 2KZGA 2YU3A 5CVUA 4XMYA 5K7FA 2HQRA 2ZXJA 1TT0A 2HUIA 3DRDA 4JP0A 1Z3YA 3SEZA 3NU8A 4RA2A 1DPRA 5LGTA 3W6VA 4F3QA 1KL1A 4BA5A 3H9JA 1S09A 4P3MA 1MMGA 4L5JA 4J01A 4RB3C 1B9IA 3ZXSA 1KU7A 3FKIJ 4U7BA 2BYLA 2GA1A 2MFZA 1HLVA 2BY1A 2JA7J 1LUJB 4Y52J 1OR7C 2BI9A 2CO5A 3FX3A 4Q4ZF 3CCUI 5FLVA 2R7OA 2DI3A 2E2HJ 1U6GA 3PL8A 3MCZA 3S15J 3I3LA 4A5MA 4JEXA 2R93J 4CH7A 3JW4A 4G6DA 4NDLA 3HEFA 3GLLA 3FISA 2ID3A 1QGPA 4UVCA 1YO5C 3H35A 2XPUA 3FXJA 3OS0A 2OGAA 2PJPA 1E0EA 3NU7A 5IY5H 1B72A 2QSGX 3LG0A 2DMUA 1T8IA 1IAWA 1QHHD 5JI6A 5GP9A 1DUXC 3G1OA 3CDIA 2R7ZJ 2KKOA 5B3SH 5D5WB 2OPTA 5JFRA 3V8KA 4XICA 1ETYA 2OZUA 3F8CA 1V5FA 3G3ZA 4M3BA 3RKYA 4CCOA 1YJZA 4B98A 4B48A 1H0CA 3HGGA 3GETA 2P6SA 1ZG1A 2EIJH 1FWZA 2LRDA 5E3KA 4UQVA 1KQ9A 5CQGA 3IWZA 2E71A 3HM5A 3PIOF 1PUFA 2V1UA 1WJFA 3I0TA 1DDNA 2Y9ZA 3WTYC 2VOOA 4M9XA 2VMNA 3M3YJ 3KP4A 3JRHA 1FZPB 4JF0A 4WP0A 2COBA 1FIAA 2DPDA 4DQ6A 1RVYA 1ZRDA 2BXZA 2XF7A 3GTMJ 2B7EA 3G2BA 2BXYA 3QPTA 4BEHB 1S7OA 4KT5C 2AEUA 3AELA 1JT0A 5GTIC 2GXBA 3AEJC 3MAUA 4BAYA 3FHZA 1BC7C 1LC5A 1T98A 1X1CA 3MADA 3OIPA 4N9IA 1BQAA 1MAQA 3K4CA 5EGOB 1VQMI 2FM1A 1B6AA 3ZMSA 1LVAA 2W8VA 3U21A 2QYOA 1UU2A 4EATA 3B46A 2WA0A 4K2BA 5HHYA 3ECHA 3T8TA 2XUBA 3AFHA 5L3EA 4R8HA 5E18F 1AHFA 3JTXA 4ENNA 1USTA 1WCMJ 2FQ3A 3QYEA 1OYYA 2D1HA 1JKQC 1X3ZB 2VPLA 1VQ7I 4EEFG 3QWLA 1O3RA 1ON1A 1O61A 1M4NA 1ZAOA 4UHMA 1BJNA 3FMSA 1ONVA 3KYLA 5AONA 3GFMA 1I6XA 4OIRF 1GHCA 3ATHA 1GC0A 3A2BA 1B9MA 1OATA 2JPBA 1RV3A 2W7KA 1H9GA 4G6TB 4RKDA 3RCHA 3D0SA 5BNGA 1SZKA 4M9SA 4A69C 2XIGA 5BOXA 5IWQA 1LEAA 4LIUA 4B47A 4EQQA 2VMTA 3HL2A 1BI1A 4A3IJ 1W5CC 2RDPA 4FE4A 1T56A 1WVRA 1EKEA 1ACIA 2EINH 2LVSA 3V4GA 4F55A 4XJPA 4L9JA 2FUG2 1Y0UA 4HV6A 1K78A 2HYJA 4TN4A 3FBIB 3M07A 3S3MA 2X0LA 1F5TA 3HXLA 2VC1A 2L4AA 4RAYA 1SFKA 4LK0F 3U1DA 5B1BH 4BH9A 3ELEA 4GSAA 4LG0A 3HOXJ 3BCBA 1BOBA 4EV0A 1N77A 3HMUA 2KJCA 4PGHA 2M4KA 3AG2H 3BB8A 1SAUA 2E1MC 2D5YA 1RETA 2TPLA 3JZLA 1O4XA 4AM3A 3TOAA 2FYFA 4JEZA 1AAWA 2HKOA 2EIMH 1Z91A 2DLLA 3FWEA 5HDGA 1G3SA 2YX4A 4HF0A 2KDZA 3R4KA 2DFHA 3H92A 2V1XA 4NUBA 2BKWA 2Z1YA 2CJGA 3BV0A 1BJAA 2NNNA 2VI9A 3AEMA 3DLAA 2BVLA 4IY7A 2A5WA 3LWFA 4BGDA 2R0QC 3MAJA 4MKJA 1FY7A 1M0QA 2GQQA 2YKYA 1LKCA 5C4JJ 1I1GA 3BLYA 4GCVA 1SFXA 5FFZA 4I0BA 4W1XA 2DK8A 2ZXIA 2QM3A 2FX0A 3IKVA 2OU2A 4C9YA 4JYKA 4DGTA 5GADJ 2G0EA 2IW5A 3S1RJ 2CH2A 1GV2A 4Y17A 4HX8A 1C7GA 1XMKA 4KN4X 5L3BA 3K1MA 1D8KA 1KMJA 3KKIA 1C9CA 2E19A 1Y1WJ 2GM4A 1UJ8A 3F8FA 1VQOI 2YKVA 3PM1A 4LGWA 4K2MA 2Z2SB 1A04A 2O9LA 2WBMA 1Z21A 4S0HB 9ANTA 2BGCA 2FMLA 1YAAA 3F9TA 3FVSA 5J47A 2O03A 3JSPA 1GEXA 3WG9A 2Q7WA 3FFRA 4N4OB 2JGTA 2GMUA 2HR3A 2XASA 3WTUC 4EFFA 3CUQB 2LY2A 4ADBA 3IRRA 1S6LA 3DODA 4U88A 3ABLH 1G3YA 3H5NA 4HA8A 3MKWB 1LS3A 2ESNA 2F8JA 1B4XA 4A72A 1HW1A 2WAEA 4PIWA 1EQBA 1VZ0A 8AATA 3B6CA 2ZYJA 4XQFA 5FLXZ 1IG7A 2YRRA 3B1EA 3EUKL 2ACJA 2ZMEC 3BTJA 1DGEA 1TWHJ 3FXUA 3QOEA 2KDOA 4RAFA 3KP6A 3EI7A 2VT2A 4EM2A 1CS1A 3W6JB 5IYBJ 3F22A 1P9QC 2OCCH 2VQLA 1DGRM 2Y2ZA 4MFDA 2VJ4A 4D5FA 3VK2A 5EF6A 1CF7A 4KJZA 2WB1A 1BIAA 4ADEA 1ARSA 1Y39A 2PG4A 5D5UB 4KMFA 2X1EA 1M6SA 1P4AA 1T0FC 3SHFA 5LLQA 1ITYA 4ZYEA 1W36D 3ZMTA 2YRIA 2C0RA 3TATA 3BG5A 1FOXA 2Z67A 2IS6A 3CDHA 4WXHA 5DYMA 2X3LA 5CKTA 3OS2A 2V7FA 3BQYA 3WU2C 1DFOA 5HS8A 4G8XA 4QLCU 1H8AC 3L1PA 1CQ6A 4PJ0C 4C2MJ 2AY5A 4XJMA 3BTLA 1Z67A 3HOUJ 1B8GA 2KRFA 4L5IA 3K1PA 4FHTA 3ZMZA 3T32A 4A3JJ 2HYGD 4ZYDA 5M5XJ 3CCQI 4I09A 2OKJA 1JXSA 3OS1A 3KFWX 5EUNA 4IHVA 4HDVA 5GPAA 5TF5A 1OLTA 3PD6B 4MTEA 2FOWA 4CCLA 1TASA 2JA8J 2PB2A 2W7LA 3ZQQA 1OMIA 1OYWA 1LEBA 2WB1N 3V42A 1S0AA 2ESHA 3LSHA 5IYDJ 2BW3B 2H1KA 3RSNA 2D7YA 2VJJA 3DXWA 4LLNA 2OATA 4ZWVA 2K3PA 4DOZA 3PJRA 3E2ZA 1EG5A 4P55A 3HOVJ 4EB7A 4B3AA 3MC6A 4IEJA 2R7RA 1O69A 2HTSA 4CZZA 5LHGA 3DC1A 2O0RA 2Z3YA 1Z7DA 3Q8NA 4FX0A 5KHDA 2HDCA 3VPRA 2A07F 3DR7A 2ADUA 2LBFB 2DA5A 4IQJA 1AICA 4KT6A 4A6RA 1QZ9A 4DBQA 1R4MB 2WAFA 3RIRA 3EDPA 3KEOA 1N2TA 1M32A 1XN7A 3GF2A 4HLYA 1ZGJA 5KCMA 1SZUA 1SAXA 4OOIA 1TOKA 1X1PA 1G6NA 4MFEA 2CQQA 1DTYA 4ZWMA 1A36A 5FD6A 1U3EM 3HQTA 2XAGA 2RAEA 1AMQA 3X2QH 2ZP7A 2WAQA 4XJOA 1JI8A 4FQGA 2K4BA 4CXFA 2R7QA 3LSMA 1IRGA 2XGEA 5EGOA 1N8PA 1R1UA 3TO9A 1Y6IA 2TRTA 4RMNA 1N78A 1YIZA 3P9IA 3FM5A 3OYMA 2Z61A 2Y0SN 3GR9A 4WB0B 2ECCA 3J81K 1WJCA 1O7FA 1R9TJ 4U0VA 3CD6I 2G6WA 3ELPA 3CLQA 2A6EF 3FQ8A 3ISLA 1RC9A 2OV7A 2HOEA 3HBLA 4AD9A 5J1RA 1ZR2A 3FM3A 4L18B 3AENB 1ZTRA 3GTOJ 2K85A 4QWQA 1YE9A 2E1MB 2L9SA 1D2FA 2GOMA 4Y0IA 2CW8A 3BC8A 2YU9J 3F23A 2PB0A 1ASFA 2E7JA 4EGYA 4CBRA 1RR7A 2L0KA 2QA3A 4E7ZA 2STTA 4YIFA 3KP7A 3QYBA 2P0WA 1H9TA 2BWOA 2VMOA 1REPC 2KRHA 3DBHB 3KP3A 3BS8A 4OC9A 4Z2YA 4A3EJ 4ENJA 1K79A 2HI3A 2PQ8A 3ZN0A 2AY2A 2Y69H 1X4PA 3TP3A 2B9SA 1N75A 1ZGAA 4BQAA 1DJ9A 2WAQN 1ASNA 3ECDA 2VOPA 2LKXA 1BI2A 2ZSLA 3F72A 4IHWA 1HOMA 3CMMA 3EUHA 3D6KA 4W5KA 5EUDA 1I39A 5BJ3A 1ASBA 3WE3A 2BOLA 1AHEA 3RPQA 4WF2A 2DW4A 2EQRA 4DW6A 2WK7A 4XJLA 5BS6A 1IUFA 1JHFA 2PX9A 4QPOA 5JVGF 3ZPLA 1MGVA 5FRNA 4KDPA 2XGDA 1WJEA 3EETA 4WK8F 1JKRC 4HF2A 4LFUA 1DJUA 4RAZA 1ZRFA 1WI9A 3I4PA 2VKHA 3SFIA 5JHUA 4ZDOA 1I3QJ 2NVYJ 2JJFA 2QKLB 3GZNB 1MJAA 2EFOA 2H8WA 5D6EA 4EJVA 2YOBA 2M87A 2R4GA 2CUEA 2E34A 4HOBA 4F5GA 4R5FA 2HEOA 3Q0VA 2BHZA 4IOCF 2AXLA 2XDVA 2ID6A 1RVUA 2M0MA 2V9KA 5LH9A 1JTXA 4LMYA 2ZMEB 2EIKH 1WKHA 2RGVA 3HKZN 5E8IA 3EZSA 2P8TA 4JK1X 2ZC2A 1SVVA 3CP2A 3OYAA 1SEUA 3OYGA 3NDNA 4YIRX 1L3LA 1RIOH 1IBJA 3HZJA 4NC6A 4IO9F 4II3A 2JA6J 5F27A 2CY8A 1WYVB 4IF4A 5FD5A 1YIYA 4M71A 1NH3A 5HXXA 4XR6A 3I59B 1W0TA 5HVQC 5LGNA 3GEZA 2OBPA 4XLNF 4BY7J 2KPMA 1YHQI 3DPUA 1QPMA 4M3EA 5LGUA 5EG0A 2IS2A 2YSRA 3UAKA 4AVZA 1ERDA 1ORKA 2JT1A 3CO7C 5E3LA 3QN6A 3S2HJ 4A0GA 1RV4A 3OWTA 2DA1A 4LNMA 1MW7A 3TP0A 3CUQA 5E3NA 4L9NA 5I92A 4S04A 1ZLKA 2VKDA 2CS3A 5K8BA 2L5QA 1AIAA 4WLJA 1R00A 2MGQA 2E5ZA 2V1NA 3GXOA 1CL1A 1W5SA 1RUNA 1W7PD 1I48A 1SD6A 3A9XA 4AC0A 4R79A 2OQGA 2ZBKA 4XKWA 5ICEA 3S3OA 4OMYA 1ZG5A 2VQCA 2FSWA 3I9V2 2X8UA 1S07A 1YJ9I 4MGRA 3II0A 2CINA 3HSEA 4AIJA 1TTYA 2VE8A 4L9TA 4L9VA 5GAHJ 5DM6F 3VYRB 3OYKA 1LE8B 3LSTA 3K6GA 1I41A 3E1SA 1MBKA 5FGMA 3VOEA 2CFBA 2XF6A 4HW0A 3F6TA 1TW3A 2V4JC 2LTPA 1T95A 4WWCA 3DU6A 2IGMA 4L0OA 4BE1A 2R0TA 1EH8A 3NTJA 2NRAC 2XRNA 2W7JA 3H36A 5B66C 2PO3A 3JR9A 5E3MA 1CL2A 1SFEA 2DOUA 2D5VA 1BBYA 2QENA 2LC2A 1MBEA 1WZ2A 1W7PA 2DO7A 2JRMA 1VQ9I 1KKPA 4Y15A 3C2HA 3H7FA 3W2AA 4M73A 3T0YA 2HVRA 2ME6A 4C30A 3V8LA 3ABTA 5DD8A 1KQ0A 3OYLA 4EMYA 2VC0A 1UELB 2XRLA 3ERMA 2TCTA 3FIWA 4DZJA 5GPCA 1RESA 3AL0C 3GTQJ 4DQ2A 1ZR4A 1IGNA 3TCMA 2F5EA 4FL0A 2Y0MA 3GWZA 2B0LA 3ZRPA 4IOAF 1POGA 5C44J 1C7NA 2A69F 2L9VA 2BY0A 2HDWA 3AEJA 1K4TA 3HVYA 3R6SA 4A93J 3RYRA 3ROUA 3GWPA 4M6XA 1D0YA 3PD6A 2DOEA 1JUSA 3ZMDA 4W8IA 4A0FA 3CJRB 1FTTA 2QWWA 1KONA 2K27A 4WXCA 4BUPA 4CCJA 3SDGA 2K9NA 3PUFA 4MQVA 2Y30A 4Q5SF 2O5RA 2FNAA 5DM7F 4KYOA 2IA2A 4CVQA 2XAFA 1ETOA 2LFBA 3LVMA 2DT7B 4OMAA 3JRIA 3EZ1A 2F5CA 3CF5F 3RJPA 4M9ZA 5HOOA 4L0YB 2O7CA 2E7XA 3F0CA 3L7WA 1Z9CA 3BQZA 3N4MA 4XRMA 3TKYA 2HVSA 2M5WA 2MA3A 2DOAA 5FJ8J 1UU1A 4CBSA 1F1ZA 1TT5B 4QSHA 1IXRC 2KIFA 3GLXA 3HSRA 3RUYA 3F6OA 3A03A 1C0WA 1XMAA 2IPQX 2LBFA 1W5TA 1IRFA 1FNNA 1W3UA 1HW5A 1AIBA 1S5LC 2Y48A 4EM0B 3GBXA 3M8FA 2ZXWH 3ZQIA 4WX9A 1BW5A 5D95A 3NWTA 1OHYA 3DV8A 1FTZA 3ZQFA 4PSWA 1DKAA 1SMTA 3R61A 2R5YB 1FT9A 4RIZA 3B73A 1FG3A 4WYEA 1YI2I 3M1EA 1YJNI 2KL4A 3JWAA 5EEAA 2X6YA 2J5OA 3OV8A 3FF5A 5EEGA 2CB1A 1T3IA 1OCZH 1T08B 2M9HA 3KLNA 1I6HJ 4PCQA 2X5FA 3CCMI 3KX2A 1VQ5I 3FKDA 1GVDA 3ISPA 3WE2A 3BG7A 3L8AA 3FCRA 1ETKA 1Q1VA 3NYTA 1VQLI 1C4KA 4C3JJ 2QLRA 3AENA 1O57A 1RNLA 3WGHA 2BY2A 5FB2A 5J40A 5CVVA 2HQAA 3JRDA 2DTRA 4XLPF 1P4XA 4W1VA 1TWGJ 4NC8A 2EFPA 3HBXA 2HU9A 4E1OA 4F5LA 3HDOA 2VIBA 2DYSH 3Q9SA 1VNDA 2CQKA 4I01A 1KYWA 2EBIA 2O0YA 1MDXA 1OHWA 5EAAA 4DBCA 5D8LB 1VQ4I 2AXTC 3FD0A 4F92B 1RKWA 1XCVA 2G9WA 3GX4X 3MAFB 3WLXA 4EU1A 1AHDP 3SZPA 3HSFA 1SANA 5CVRA 1QZZA 4Y0DA 4A0HA 5G0AA 3BR6A 3AG3H 3NWSA 4Z6YA 1Y4IA 3BJAA 3JRFA 1YQAA 2HYFA 2ZJRF 1Z3ZA 2Z16A 3F8MA 2X1DA 3ECOA 2FA5A 1X28A 3S32A 4E7JA 1I50J 1XDUA 3V8JA 2CV1A 3E97A 3OYEA 1EV7A 1TWAJ 2A6TA 4BJ5C 1R7JA 3TMOA 2R7SA 4B09A 1FPQA 2BIEA 3E9KA 1R5ID 2R7VA 5KK1A 2XKPA 2ZCWA 3VODA 2UWMA 3ULQB 1BKGA 2EB7A 3NYUA 2XV4S 1FIPA 2YHKA 3N5MA 1HCRA 2D1VA 4AO9A 4P9FA 2A5YB 2DK5A 3EI6A 4AYBA 1JJ6C 2C6YA 4ESFA 1XX5A 2C7TA 1Z3XA 1PYVA 2DKBA 1YIOA 2DDAA 4HX7A 3PIPF 1JKOC 2ZJQF 2FEZA 1CZCA 2P6TA 4XLAA 2E1OA 1YJYA 2CSTA 2ZC0A 2VB6A 2M30A 1W23A 2DBBA 3A9YA 3WX9A 3BDDA 2Q1ZB 5M3FJ 2ZMEA 1T39A 5IT9Z 1WGXA 5F0HA 2E7IA 3PGYA 3LMMA 5M5YJ 1MD0A 3DCFA 3CO6C 1E5EA 2WY8Q 1HXDA 2L01A 4DZPA 2PMZN 3A0HC 4J19A 4IRGA 1SVLA 4RJYA 5F1JA 2JSPA 3AV7A 2W7FA 1YIJI 4U0WA 5A2QK 2P5LC 3VYUB 1FP2A 1QIRA 3HYIA 1I1SA 2OQXA 1XD7A 2VIAA 3ZN1A 2H8RA 1APLC 4BL0B 2A61A 1VQ6I 2A05A 1BJZA 4UHTA 4FASD 5LBQA 2V9PA 4Q48A 4A2UA 3JAMZ 2Z33A 1BT4A 4ZYGA 3K10A 2FU4A 3BR0A 4XL9A 3G7QA 3G1MA 3EUAA 3WKRA 1AA7A 4ANJA 4LC3A 2P5KA 3BJOA 2TDXA 4XN0A 5EYRA 2EZLA 4HVKA 4XM3A 2MLGA 1IRZA 1YOOA 5G09A 1IDYA 4AYBN 1TWFJ 1WI3A 1DJEA 2R7WA 3RI4A 1FBQA 1SPAA 3AL0B 2CU7A 1U5TA 3MMYB 5ILUA 3CCLI 1X1DA 4UB8C 4HF1A 5E4ZA 2EZIA 2C44A 5DUKA 4RGXA 3WGIA 3C2BA 4BBRJ 2V9VA 2XGCA 1GC2A 4OMZA 4I98B 2IA0A 1OXOA 3CAIA 1XMXA 2WK8A 3HTUA 1V72A 5TGTA 3NUIA 4Y4RA 3VB2A 2GAUA 3K28A 1XPXA 2K9SA 3HDDA 3AOWA 3RPUD 2EWNA 3T5XA 4BBSJ 2C81A 1QITA 2QLZA 2KIUA 2Z5UA 4D1QA 3ML6A 3CDLA 1TQMA 4JBAA 1ZN2A 1I29A 1UKJA 2H09A 2MBFA 4B44A 3FZ6A 1S3JA 2VYCA 2G7HA 4XLFA 4F5IA 3M5UA 2ELHA 1T33A 2CUJA 5G2PA 3WGBA 5CVJA 4YFXF 5K5OA 1JJ8C 2M0CA 1OCCH 3COGA 3EYIA 5DS9A 3NX3A 4U2HA 3UR3C 1J32A 1M0OA 3FZ7A 1D1BA 1FG7A 3HUGA 1C7OA 1X3UA 1U78A 2YCPA 4JX4A 1BR4A 3L09A 4ATQA 4UNOA 1X2MA 2BI1A 1G4XA 2JRTA 2VMXA 5IP7J 3GZCA 1C0NA 4NB5A 1JUPA 4HBLA 3QAHA 4XK1A 3RPUA 4OAZA 4A6EA 1UZCA 4IXAA 1UHSA 2FJ1A 3ZZKA 1V54H 3BR5A 3C1DA 2CYYA 3COAC 2LD5A 3ERED 4ZAHA 3BG3A 4ESJA 2ZJGA 4AZJA 1WPKA 4PGGA 2DA3A 1PDNC 1MKMA 3NQOA 3WTTC 1AKAA 3PAAA 1WKMA 4JEYA 1IX7A 4L0ZB 3DP7A 2KZVA 1IX6A 2ELKA 1KYZA 5ILSA 1AKHB 2X48A 1ZG3A 1HSTA 1F4KA 3VYSB 2XSJC 3J7ZI 2AS5F 4GXOA 2ORDA 4PUSA 2E2JJ 5LHIA 4EMSA 5G4JA 2MH2A 1I3AA 2VXDA 3ZCOA 1W7NA 3MQ0A 4WD2A 1O7LA 2OC6A 2QCOA 1SD4A 1TBXA 3DQVC 4E3QA 3FXMA 2LYCA 4HYEA 2FXAA 5F08A 3WU1B 1U8BA 1D7UA 2F4IA 5B1AH 4LB5A 3AKZA 1AHXA 1HSJA 2OJED 4C2TA 3E2FA 2CQNA 2QBTA 2R92J 1HQCA 1IX8A 3ABUA 1YTYA 2QQ9A 3SZTA 5D4RA 1R22A 4IYOA 1OISA 1R49A 3H9QA 2HNHA 2X1CA 4BY1J 4RITA 4A3MJ 3UWCA 2E2IJ 2FF4A 2NOJB 4M2MA 4FX4A 4MHGA 4IXOA 5FROA 4RM3A 1I43A 1AX4A 1OXPA 1P4WA 1EA3A 2GA2A 3CZ6A 4A3FJ 1LW4A 1KU9A 3KZZA 3FBNB 4YEJA 2X85A 1LC8A 3I4MJ 5JR3A 2KLOA 4Y33A 2A6HF 1AY5A 4FETA 1LW5A 3RQ1A 2ZKZA 1P6RA 3NEUA 3CBFA 4R5ZA 1FSHA 3ZQ7A 3JRCA 3B02A 1VEFA 3J80Z 1MLZA 1K4SA 3L2CA 2L9RA 3GZ5A 3S93A 3V7SA 2YR2A 5EAVA 2GXGA 4XKBA 1G4VA 1XB4A 3FMRA 1TQPA 4JQFA 4BDZA 1MBHA 1CJ0A 4UHNA 4ADDA 3H3UA 5BPIA 3W3CA 1OPCA 4YFNF 1A5JA 2ZNZA 1AHGA 3VDXA 1QQIA 4IHYA 1ASEA 3IL2A 3OL3A 3ACZA 5LD2C 2MABA 2ZUKA 3GTGJ 5DEQA 1B8IB 1MMNA 5LEJA 4IHXA 1EH6A 4MKKA 1JT6A 3MAFA 4F5KA 2XAQA 1XGSA 4XKVA 3GJUA 2AY9A 2VQGA 4PFFA 1KL2A 5KVRA 1QA6A 1FBUA 1D1CA 2CJJA 2M34A 1X2AA 3L2UA 4BACA 2IA1A 1ULYA 5IT3A 4EJTA 3I5TA 5TISC 3DF8A 1FBSA 4EJOA 3CMAI 2XGXA 3DKYA 2OGEA 1E3OC 2DGKA 2CMPA 3IAS2 3HHGA 1GXPA 2FQ6A 2Q2EB 3LSIA 4XSXF 5HLGA 2I10A 1IAYA 1B5OA 1MDOA 1YW8A 4U0YA 3O3KA 3J81Z 2W7NA 4X0GA 4V2GA 4LNLA 5FKKA 2CSOA 2R5ZB 5DCMB 4M2KA 3K70C 4OU0A 3EIBA 1IXCA 3IC7A 1YS6A 4CXRA 3FFHA 1QZEA 2O6GE 2VIXA 3RYPA 2ZJPF 3DTIA 4IHSA 4A00A 2LMDA 3NAUA 4BS9A 2HVQA 1OCOH 4E70A 1Y56A 2VODA 1LVKA 3N05A 5IPAA 1BQDA 3QPLA 3I71A 5KAFC 2EZ2A 4LW2A 4MEYF 4ASNA 5FT4A 3OYNA 1TW2A 2CUFA 1R4NB 5EEHA 3A8UX 3EUCA 1ETQA 1LPQA 1XSXA 4M6YA 3PFYA 5EZGA 5AIQA 5KAIC 3IHUA 1J0RA 4RGUA 1G4DA 2CJHA 3BR1A 4GDYA 4MEXF 1GD9A 1WYUB 1W7MA 3EIAA 4IKFA 5C3EJ 5ICGA 4UXNA 3PPLA 5HLTA 2HOAA 2KMUA 4E6KG 4OIPF 1W1WE 3FXRA 4B4CA 1XTAA 1G59A 2PJRB 4MQ9F 4BQOA 1QJ5A 2GWRA 4XORA 3WGGA 3ZR8X 3HOTA 2CQ7A 2PN6A 2Y0SA 2VMVA 3BY6A 2Y31A 2YUSA 1AKBA 2GIZA 1GEWA 3TFUA 1SFOJ 2ZJ2A 1TNTA 1Z7LA 3ZQHA 3TOBA 3M4OJ 2O61A 2R7TA 1PFFA 3BR3A 1KU3A 3DEUA 1USSA 5J8CA 3CESA 1BJOB 5E1ZB 2WTEA 2Y75A 1GV5A 2O1BA 1IAXA 4XK4A 2XC7A 3BPVA 3MKZA 3KYDB 1FMVA 5G4IA 3DZZA 3BWNA 2X5DA 2MSYA 2HZPA 1ARTA 1Z05A 1D3YA 2GB3A 3FXOA 3QPHA 2FMYA 2K9QA 2NVTJ 5F64A 3K7YA 2IRFG 3TGNA 4MSOA 3HRMA 2CH1A 2JJGA 2DMTA 3M1CA 5M4DA 1L0OC 3Q3SA 5J3LA 4BEHA 3K2AA 3IV5A 2HS5A 1RZ4A 3MD2A 1BJWA 4GEBA 4A6TA 3W1JA 4JE5D 1EH7A 3V7CA 1KA8A 1QVUA 3OSFA 2CQXA 4I02A 1IV6A 1GDTA 2QQAA 4J8LA 1JS3A 2JJ7A 2FNUA 1X29A 4GE7A 1T2KA 2KQRA 2HPMA 1XGNA 1Z77A 2Z9OA 3EI5A 2JTVA 2JVHA 2UUZA 3HOYJ 2X6XA 4PZJA 1M0NA 3JSOA 3DBLB 1TC3C 2LKSA 1ZC9A 1GDEA 2R2NA 1UFMA 2BV6A 3AEPA 1XS9A 3ABMH 1S29A 1V2DA 2XBNA 2Z1DA 4IZZA 1HBXG 3QI6A 1MDMB 3DLLF 5E1XA 1T38A 3M8EA 2D2WA 2HXIA 2LNBA 5D5XB 4RLGA 3FDBA 1Y8RB 1P3WA 2D61A 2RV8A 5DV5A 4HG2A 3WU0A 3QP6A 1JTYA 3IHJA 1TNSA 2DN0A 4E7KA 5D5VB 4YRVA 4O6ZA 3ZQCA 4JE5A 3GCMA 5TRDA 1VF9A 4UUTA 2UXXA 4L5EA 2BYVE 2LH9A 2EA2A 1WRJA 3BZKA 4AWXB 1RR8C 2VL8A 3E6MA 4ZYAA 4YFKF 1MNMC 1WFXA 1VJOA 1ZYRF 2G7UA 3K4JA 3H0DA 1FC4A 1AKHA 3T8RA 2WK9A 3M8JA 3K7AJ 1OQYA 3HKZA 3EYYA 2COMA 3QQAA 5F6FA 4B3XA 4FTHA 1WSTA 1ECXA 2F5FA 4CYDA 4ADCA 4QTRA 2VMSA 2CWEA 4R2NA 3HLMA 1ARGA 2PLYA 4IX8A 2L9NA 4ZM4A 1YOVB 4G12A 1S7EA 2BY3A 3I4NJ 3LFKA 3TDZC 2EGYA 5BPDA 2LG4A 2R7UA 1HDDC 2HFHA 2R5CB 1QVTA 1LJ9A 4TV7A 4B43A 3VOMA 1Z6TA 2NS0A 3G71I 4BQQA 2DJIA 5D4SA 3OIQA 2VJ5A 3JRGA 4NQWB 4HV5A 5ERIA 1UG0A 3B6AA 4IRHA 1FLIA 3L9FA 4M6VA 3AEMC 1U08A 1Y8QB 3Q0WA 1UCRA 4P5OA 2XF5A 2ZSMA 3RBFA 1ETVA 1SMYF 2IXSA 3SDBA 4O3MA 4CZCA 2W7DA 1F9NA 2DQLA 2BIGA 4BQ0A 2W1OA 2XB5A 1S08A 2FRHA 2HUUA 3B1CA 4WXFA 4XAUA 3BTCA 3NRAA 4HAMA 1KZHA 1TPLA 4XRFA 4CO8A 4IRIA 2W7EA 1P92A 2UZKA 3CCEI 2Z20A 4ZM3A 1ZGWA 3P6KA 3OYHA 3QGUA 2VGZA 3GZDC 3VSKA 3M9AA 4FFCA 1JGGA 4G9YA 2VBZA 1IJIA 2UV1A 1ARIA 2EFWA 4PFNA 1RUOA 5AIPA 2NNYA 2KIMA 4UVAA 4AZKA 4ZSWA 4JOMA 2VPRA 2KT0A 3AEOA 2M8GX 2BEOA 1O3SA 2JA5J 4BXXJ 3DXJF 3CJQB 3FHNA 2M4GA 3KP2A 4IVNA 1A35A 1GVJA 1XSVA 1BL0A 1B8IA 1NTCA 2A68F 1D7SA 4E77A 4RM2A 4XSZF 3S1NJ 1IDZA 3DXVA 4Y0HA 3FXLA 4OWRB 4YELA 4D7MA 2A3SA 3I58A 3CMYA 4IXZA 4A3LJ 3DTKA 4KICA 3BWOA 1OR7A 3GFIA 4AOAA 3L2RA 1PP8F 1G8XA 1GEYA 5CPRB 1OCTC 3KLOA 1XC5A 4F4EA 4FISA 3OR2C 2DGMA 5F9SA 1FP1D 1K6YA 2Q2EA 3LA2A 3PNTA 2XH1A 3DYDA 3CTAA 4ENKA 4ZTFA 3OYCA 4A5NA 2E5NA 2MG4A 5FT8A 5KNLA 4UUVA 4WYGA 4CHUA 4AU7A 2R5ZA 4C3IJ 4EVIA 1FEXA 1ZOBA 2HOSA 4HEA2 5DCMA 5J6XA 3K2ZA 2VGSA 3H5AA 3E0JB 2HKXA 2LF8A 3S3NA 1ZK8A 2VBWA 2M2EA 2HXOA 3BG6A 3RDIA 3PDBB 5GTHC 1MNDA 1D7VA 4C3HJ 4G7OF 2WWYA 1E3PA 4M2JA 3TQXA 4HDUA 3C3WA 3ZP5A 1TOGA 3FDYA 4AIKA 1PUFB 5FFXA 2KP6A 3PJ0A 1YX3A 2RKHA 1V5EA 1E2XA 4XKCA 1V2EA 4KUMA 4D9JA 5FT6A 2EK5A 1VQPI 2VBXA 4HQMA 4D5CA 2XAUA 3F9KA 1VTNC 2AY3A 2DR1A 2EH6A 2OTJI 3AATA 3LV2A 3KYCB 5F0FA 1WKGA 1IV8A 4J00A 1WYUA 4BJ6C 4IHTA 1W36C 4UY8I 1BS0A 3F8BA 4Q76A 1X19A 3HHHA 4DYRA 4HNTA 3D5SC 2PJRA 3I5UA 2Z9XA 4ZSYA 4BXUA 3JCUC 3HRTA 2IVMA 1GLNA 1M0PA 5FRMA 1ELQA 4LG3A 4M72A 1ASAA 3C7JA 5EQCA 3BTIA 2BW3A 5BQTA 2JVGA 3I56I 3MC6C 2MLKA 3F3XA 3W1HA 3PSIA 4B1RA 4ZLVA 2K02A 3OYFA 3FQAA 2JN6A 3L2WA 2VGTA 4OTLA 1FX7A 1YYVA 4RAGA 3GTPJ 2QVOA 3FXKA 4ZC3A 2D63A 2WKAA 3MKJA 1DGWY 2R3SA 5LEKA 3OOPA 1RI7A 3ONQA 5JVTA 4EGZA 3H14A 4I7HA 3FTBA 2E54A 1YW7A 1K6OA 1LFPA 3BCAA 3DU5A 4CGZA 3RCHB 4HSRA 2HOYA 2V26A 3AG4H 1R71A 2LP0A 4BE0A 3FKJA 2ZO4A 3O6BB 1X1BA 2GXAA 2L7ZA 3BP8A 3HRUA 2XB0X 4OCAA 2V6CA 2Z9UA 4A3CJ 4E4HA 4IX7A 4ZZLA 2YKXA 2N8GA 1BOAA 1QO0D 2P5VA 1LFUP 2EZKA 3CQ6A 3K4NA 1WYTB 2IGOA 2DYRH 3WTXC 1K78B 3KCCA 4WCGA 3K69A 3ZQLA 4E3RA 3V7RA 4F52A 2E7WA 4B8XA 2QBYB 1NG6A 1W0UA 1GC4A 2VMQA 3C2GA 4WB0A 1PP7U 1DGDA 2WY7Q 2F6CA 3CJNA 1CZEA 3W1IA 3KZIC 2NXNB 4OAYA 4XNFA 4BU2A 3QRFF 3QBOA 1JG8A 1AU7A 3IP4B 3RZDJ 3I53A 4Q31A 4NBQA 1U2WA 2VMYA 3R4TA 2WC2A 5E1WA 2K5CA 4N9HA 2FNPA 3J7AO 4EJWA 2JMWA 3K4BA 3HG9A 3ZZJA 2EZHA 2NVUB 1MLYA 1MMSA 2RREA 2D7ZA 3ZOBA 3DKXA 5L3DA 2GQNA 3N97A 3WTVC 2BE5F 3HB9A 2ZXHA 4M3FA 1FSEA 2ZSIB 5HS9A 1ZODA 5LRRA 1MH3A 3JU7A 1MDZA 4XQ2A 5BMZA 5CLSA 3MKLA 4BDYA 5M3MJ 4V2FA 2DFFA 2H6CA 3AAFA 3HT4A 3QM2A 1SF2A 4CCMA 3KEQA 3LWSA 2RC4A 2HORA 4WXBA 2ICWG 3ESWB 2DAOA 2EH3A 1ORDA 5J1YA 2PMZA 1HW2A 5EIGB 1U9OA 2CJDA 1DP3A 2CGPA 2JPCA 2QSFX 4CCKA 4FE7A 4GE9A 2DGLA 2QUFA 2HGCA 3BG9A 2OTLI 1ON2A 1LDDA 1MMAA 3E6CC 1NK2P 1PMMA 2EPFA 1H88C 4WBTA 1ZARA 2XAJA 1KQ8A 4JX5A 1ETWA 2VE9A 2LY9A 3DEWA 1I5ZA 1BM9A 3EI8A 3K1NA 1RKTA 3BOQA 5DB5A 2Y9YA 3IUOA 1G2HA 1QGNA 1A6IA 3ZMUA 1LK9A 2FBKA 4E7LA 3CC4I 4NQWA 3S2DJ 4BQNA 2ELJA 4PVFA 4F5HA 1AJSB 5GAGJ 4ITGA 1F36A 2JUGA 1YRNB 1HA8A 3MKYB 4YG2F 2XSDC 1V55H 1NG7A 1KU2A 1ARHA 4GDFA 5ED4A 1V3FA 1U0JA 5E8GA 1R23A 3KGWA 1ZKGA 4LK1F 1D0XA 2OF7A 2L02A 2O8KA 2AY7A 3CCVI 4LLGF 3SXYA 1CF7B 2VMPA 3GVAA 2UXNA 1UB9A 2YX7A 4XOPA 5FKMA 3JRAA 1JS6A 3CQ4A 2BI3A 1LDKB 2Z99A 2W85A 4XLCA 4UVBA 1UHMA 1WYVA 2DFEA 2IEKA 3OYBA 3RQIA 2AATA 4JF1A 3EPZA 4GGGA 3HPHA 4P1WA 2NAZA 3I59A 4A0ZA 1MIJA 2WADA 2W57A 5BJ4A 4ABZA 3E5UA 3JTHA 5DD4A 1T0FA 4MQQA 1BIBA 1B4AA 4ETSA 2CFXA 3OL4A 3AOVA 4ENMA 3CUQC 2IBDA 5D6FA 3WG7H 4DGWB 4K2IA 2E1NA 2MD5A 1TARA 2V0YA 3VP6A 2EO5A 1J5YA 1K7AA 2VMZA 1SD7A 2YPRA 2BHXA 1I27A 2QQ8A 1TL8A 3CF2A 4DBRA 3G73A 1MBGA 2QQBA 1RPWA 2DQRA 3ELKA 4S05A 2EILH 4W97A 2AY1A 5CVIA 3FVUA 4M3DA 2M7AA 1PUEE 2W7MA 4KISA 3KPHA 4UV8A 4XONA 3QODA 3R9AA 2L54A 3LSRA 2HOZA 4D7NA 2DDBA 3LFUA 4CUGA 2HZDA 2HOXA 2GZWA 2D65A 6PAXA 1ENHA 2LY1A 2K9MA 2ISYA 3PA9A 1PVEA 1D1AA 1U8RA 1LB2A 1FOYA 1LE8A 3UKGA 3WGCA 1WJ5A 1HC8A 1IN7A 5FKOA 1ZQ3P 4BE2A 4RB1A 1NK3P 2BI2A 3E2ZB 2W7GA 2HPIA 3OR1C 4F93B 1TLHB 4HRIA 2X9DA 3L00A 3SYTA 4CSWA 4NHJA 1BI3A 1F43A 1VQKI 3LVLB 3PDBA 1P7JA 2P7VB 5DCFA 2GOXB 5L3CA 4M3GA 1YX5A 3KZYA 2X6OA 3OYIA 2HQ5A 4UB6C 3D5LA 3R0JA 2AO9A 2JJEA 5D5SA 3H1CA 3DU4A 1QPIA 2CANA 1MAPA 3H0GJ 2GSAA 2X6WA 3WTSC 3QU6A 2W84A 4JEWA 5HDNA 3SZGA 4HSTA 3MFKA 3CQZJ 3CMEI 2OUMA 1FMWA 4BHCA 3SEQA 2OD5A 4UV9A 3OYJA 4FT8A 5FKLA 5EUEA 2H6BA 3E5QA 1X1AA 2DCEA 5CYVA 3JREA 2JISA 4BKXA 1MMDA 3A01B 1Z1DA 2YS9A 4RAEA 1CQTA 4BNCA 2M8EA 3U1KA 3W6KB 1LKXA 3MVPA 2L7MP 2K86A 2JJHA 4PSXA 5E20A 2EPJA 2DJNA 2L3DA 3I54A 3U2RA 4GE4A 2DOFA 2DT5A 5IP9J 2DA6A 3QP5A 1HKQA 2HTJA 4ATPA 2DKJA 4DJAA 2R7DA 2JSCA 4E7SA 3S17J 3AG1H 2JQ7A 5ICCA 2R7XA 2X4HA 2V6EA 1YFHA 1OHVA 3L2VA 4U7DA 4G6QA 5IT9K 3IH4A 3UE8A 4LD5A 4IJAA 2DMPA 3W2VA 1S9HA 1D8JA 3GO5A 3N75A 3WODF 5M5WJ 1BR1A 3CJTB 4N0BA 3SFZA 4ZDPA 3E2YA 2D45A 1ETXA 4CYCB 2HUFA 5DUIA 4WYDA 1GT0C 4RB0A 3F8NA 2KHMA 1FOKA 4I76A 2PBIA 2VMUA 2VUMJ 2MD0A 2PMHA 1SVOA 4KAMA 3JWBA 4PDKA 3GTJJ 5JAYA 2R5YA 4A0YA 4JEVA 1O4SA 3KEYA 3PO2J 1WYTA 3JAMK 4UOYA 4IL6C 4F7ZA 2D64A 1B9NA 1X4OA 4AIDA 1XI9A 3QYFA 4A0RA 4BA4A 2M45A 1P2FA 2FOKA 3E5XA 4HNVA 3B1DA 4Q75A 3F6VA 3HOWJ 4BHDA 2W00A 2QBYA 3GYHX 1QRYA 4P9UA 4CDGA 3S1QJ 4RLFA 3RZOJ 1JKPC 2BYJA 4TMRA 2W8TA 2EV0A 2V79A
chains in the Genus database with same