4MGRA

The crystal structure of bacillus subtilis gabr, an autorepressor and plp- and gaba-dependent transcriptional activator of gabt
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
468
structure length
468
Chain Sequence
DITITLDRSEQADYIYQQIYQKLKKEILSRNLLPHSKVPSKRELAENLKVSVNSVNSAYQQLLAEGYLYAIERKGFFVEELDMFSAEEHPPFALPDDLKEIHIDQSDWISFSHMSSDTDHFPIKSWFRCEQKAASRSYRTLGDMSHPQGIYEVRAAITRLISLTRGVKCRPEQMIIGAGTQVLMQLLTELLPKEAVYAMEEPGYRRMYQLLKNAGKQVKTIMLDEKGMSIAEITRQQPDVLVTTPSHQFPSGTIMPVSRRIQLLNWAAEEPRRYIIEDDYDSEFTYDVDSIPALQSLDRFQNVIYMGTFSKSLLPGLRISYMVLPPELLRAYKQRGYDLQTCSSLTQLTLQEFIESGEYQKHIKKMKQHYKEKRERLITALEAEFSGEVTVKGANAGLHFVTEFDTRRTEQDILSHAAGLQLEIFGMSRFNLKENKRQTGRPALIIGFARLKEEDIQEGVQRLFKAVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Bacillus subtilis GabR, an autorepressor and transcriptional activator of gabT.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulatory protein GabR
total genus 135
structure length 468
sequence length 468
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00155 Aminotran_1_2 Aminotransferase class I and II
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4mgrA01
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 4mgrA02
5J8FA 2K4JA 3KFWX 5DCFA 1DTYA 3BWGA 4UHTA 3WLXA 3F8MA 2E7XA 1CQ7A 1PFFA 5H20A 5D4RA 4ETSA 1MD0A 5E3KA 4B09A 2KRFA 1TBXA 5BJ4A 2BKWA 4P7YA 4AO9A 1BQDA 4ZDPA 5FLXZ 1IRGA 3H14A 2HTJA 4N9IA 1MJAA 4LLGF 1YW9A 2ZYJA 1MAQA 4IXZA 2DI3A 4ZWMA 4UQVA 3F21A 2XIGA 3TOAA 5JI6A 3CUQA 1XN7A 2ACJA 4EJTA 1KQ8A 4BMKA 1GXQA 4LFUA 3NRAA 1ZG5A 1AHEA 1LDKB 1ASMA 1JGSA 3QHXA 1KQ0A 5BOXA 2OAZA 5J8CA 4R5ZA 3EZSA 3CO6C 4N9HA 4AVPA 3K2ZA 3F3XA 1GHCA 4F5LA 4UV8A 3BJAA 2HOEA 3J7AO 4OOIA 1YOOA 1TASA 3W1JA 2FYFA 3LQRA 2HYGD 1B9MA 2ESNA 4ZM4A 1ZOBA 3ASBA 1JHHA 3K9TA 3R4KA 1AIBA 3JSOA 2O0RA 1X2AA 4KN4X 4EB7A 2DQLA 2XAQA 3DR7A 4DGTA 2WTEA 1SMYF 3ECOA 2VC1A 3LWSA 1P4AA 2E7IA 1TQIA 4HOBA 4WLJA 4R5FA 1D7RA 3KLNA 1ARHA 4GXOA 1T38A 1TARA 1FYMA 1L3LA 5ERIA 1K78A 3ZPLA 2R0TA 5IWQA 1YJSA 1PP8F 3KP3A 3RDIA 1XD7A 5A2QZ 1BIAA 2Z61A 3ERED 2CINA 2VMWA 3MC6A 1BJWA 5LHHA 1KU9A 4EM2A 4EMSA 2O8XA 1W23A 5DB5A 5M4DA 3MZHA 2JGTA 5LGTA 2BIEA 2L01A 1LW5A 2Z9UA 4P9UA 3ZRRA 5BPIA 3MKJA 1JS3A 5CJ9A 1BI1A 3G0TA 3WU0A 4A0XA 2HOXA 4O6ZA 1FSEA 1K7AA 2ZP7A 5E20A 2STWA 3I4JA 1LW4A 1FY7A 5IT9Z 3KP6A 2PJPA 1S08A 3GF2A 2HDCA 2YOBA 2GXGA 2H6CA 1KA8A 1GCKA 4HV5A 1O3TA 4A12A 3E2YA 3BCBA 3KZZA 1CQ6A 1H0MA 2E1CA 4ENNA 2VMRA 5L3CA 2HKOA 2PN6A 1G3TA 4ESBA 4KYOA 1U2WA 1BW0A 3II0A 1HW5A 1G7WA 2O1BA 2VMSA 4ZSYA 2G7HA 1HW1A 4XJPA 3QP5A 2Z20A 3EUHA 4IRIA 2NS0A 1AJSA 2W7KA 5IT3A 1R5HA 4I02A 4IRGA 2VT2A 1DUXC 2Z99A 1EQBA 4OT8A 3QOPA 3HHHA 3GZ5A 4Q6RA 2QWWA 3E2ZB 2FSWA 3AEMA 2ZNYA 3W6JB 1R22A 1XSDA 1CJ0A 1VTNC 3D6KA 3ZZKA 4K2BA 1XCBA 2A07F 4EJWA 1I48A 4JE5A 4ENKA 2M87A 4WXHA 3QP6A 1Y4IA 2CH2A 3WTSC 5LLQA 1AY8A 4M6XA 1YFHA 1G7XA 1OHWA 5L3EA 3NX3A 3E6DA 2Q8KA 5FT5A 1MLYA 5FB2A 4IYOA 4HW0A 1C7GA 4RGRA 1S3JA 3T8TA 2IT0A 2VIAA 2R3SA 4OIQF 3PFIA 2X3LA 4GCVA 1P2FA 3H92A 4RGUA 1IZ1A 1ASCA 3EI6A 3HMUA 2EV0A 3K69A 2EFPA 4J8LA 3W1HA 1O3SA 1O4SA 4EMYA 1B5OA 4ZYGA 3JAMZ 2O03A 5HS7A 4LW4A 1V2DA 4MKKA 5DUIA 2HTSA 5HDKA 3ELKA 3DODA 4R8DA 3SFZA 1M0QA 4GYGA 2PFBA 3T8RA 3ELPA 4JE5D 1OXOA 1AMQA 3GX4X 2IVMA 2WK7A 3C1DA 1XEYA 3ULQB 1D3YA 4RLGA 4GO1A 2X5DA 1B9NA 1S07A 1Z7UA 5JAYA 3R4TA 4PGHA 1EJIA 3B1EA 3EZ1A 1ZRDA 3A2BA 4MTDA 1WYUB 4F5IA 2XAGA 2W8TA 1SFXA 4HAMA 4MTEA 1MGTA 3LWFA 1AKBA 2XHKA 1GBNA 3FZ8A 3UAKA 3VK4A 2NNNA 2DPDA 2G9WA 4G7ZF 4WYFA 3OKSA 3FZ6A 3PDXA 1RVUA 3K7YA 4HA8A 1LEAA 5HLGA 4AH3A 2QUFA 5D4SA 1D2FA 1N31A 3BWNC 1HKQA 3AV7A 1YNUA 3NEUA 3F6TA 2EFOA 4IW7A 2VBXA 3VOMA 1FBSA 3F6OA 2IA1A 4KMUX 4CXRA 1MDZA 1YTYA 1Z6TA 4RGXA 1M7YA 4JEXA 1ELUA 2JZYA 3KGWA 5EIGA 2IPQX 1F4KA 1HXDA 4F4EA 2DT5A 2RGVA 3N97A 3E5UA 3DFGA 1IW7F 3JU7A 4RAZA 2EV5A 3EIBA 1ZRFA 4Q4ZF 5E1WA 2CFBA 1LDDA 2QLZA 2M45A 2P6SA 2EA4A 4DQ6A 3FFHA 2OZUA 5EEHA 4AO4A 2D65A 2JTVA 5LBQA 4GE7A 2W8UA 1QITA 4IF4A 2FMLA 4MGRA 3GETA 1UFMA 5AIQA 2Z9VA 2J5OA 1WSUA 3DPLC 2WKAA 3C18A 3GEZA 1ASGA 3TO9A 3JW4A 1UHMA 1EG5A 5G2PA 4K2EA 3WG9A 3SQNA 4EQQA 1CL2A 5ILUA 5G2QA 4L0ZB 2WC2A 1D8KA 1SFEA 2ZKZA 2YKYA 1C0WA 4I0BA 1R36A 3R9AA 1RV3A 4IJAA 2GA2A 2CY8A 1E2XA 2FNIA 3PQJA 2GXBA 5G09A 1ZN2A 4HF1A 3I71A 2X8UA 2OD5A 1KMKA 3GJUA 1FG7A 1SD4A 1XGOA 5DEQA 4GGGA 3TFTA 1GDEA 2IJLA 4WXDA 1G3SA 2LDUA 1BJNA 2FEZA 3RKWA 1JG8A 5E1XA 3TFUA 3GWPA 2PMUA 1I43A 3P9CA 5HLIA 2HGCA 3VK2A 3DC1A 1LB2A 1LC5A 1WSTA 3FX3A 1RUNA 1WQ2A 1PG8A 3A9YA 4CO8A 1RUOA 2RV8A 4M74A 3Q9SA 4LNJA 4LLLA 1H9TA 1X28A 4KFCA 4GDYA 3MAFA 3RI4A 2BWPA 4CICA 4OU0A 3WTTC 1T6SA 3MC6C 2GB3A 4ON0A 2E7UA 3CQ6A 2DFIA 1T2KA 1XSVA 2M1BA 1B9IA 1Q1HA 1F1ZA 3GFLA 1KYZA 1P6RA 4EFFA 4UUVA 4E3RA 1K6OA 3FDBA 1ON2A 1FYLA 2L4AA 5LRRA 4OCAA 4TN4A 2EJRA 3VB2A 3LVMA 5EQCA 1STZA 2JJFA 3M8EA 1D5VA 4M71A 1Z91A 3F8FA 1LC8A 4UHMA 4WB0A 1UCRA 3K1PA 4IPAA 1B8GA 2JJHA 4A5NA 5DYMA 5JR3A 3TO6A 3O2PE 2COMA 3A9ZA 3RBLA 4XEWA 1ORDA 3G7QA 1WI9A 4M2JA 1ZODA 1GC0A 1WWXA 1B1BA 3WGCA 1O7FA 3FM3A 2PMHA 3WTXC 4G7OF 4JF1A 2NRAC 1V72A 4FT8A 3U1DA 3T32A 1P92A 2W84A 3K40A 4OIOF 1W7PA 1O57A 1MDMA 2AY5A 2BGCA 5J8QA 1FNNA 1UU0A 3ABUA 2DGLA 2W7HA 2XAJA 2ZSMA 3KLOA 1FYKA 5G4IA 3F8NA 4CZZA 2MBFA 3AATA 2Y48A 3I59A 4CDGA 4GEBA 1BM9A 2OKKA 3K1NA 2LKPA 3DP7A 3I54A 4CXFA 1OHYA 3HRMA 1WYTB 3L00A 2W7MA 5TJJA 2G6WA 1HSTA 1I29A 2E7WA 2OQGA 1M4NA 8AATA 3KETA 1S06A 2A6HF 3OV8A 1IN4A 3WY7A 4FX0A 3U9GA 3FWEA 2D63A 3A9XA 1HBXG 5DCMB 1FPQA 3DKWA 3LSTA 2IA0A 4R2NA 3PDBB 3LAPA 3QU3A 1R5GA 1GD9A 3WX9A 2PG4A 4WCGA 3RCHA 2QB3A 5JFRA 3CUQC 4Q75A 1OXPA 4GE9A 1S29A 5D8KB 2EZ1A 2ISYA 2FA5A 1AKAA 6PAXA 2ORDA 4ZLVA 1IXRC 4MEYF 4LG0B 3MZYA 4BHCA 4IY7A 3ISLA 1AX4A 2QZ8A 5EUDA 4HYEA 2IP2A 1YG2A 3FZ7A 2JT1A 2FMYA 3NUIA 1C4KA 3LA7A 4E3QA 3GWZA 4HDUA 4S04A 4RIZA 2XKOA 1IN6A 1DJEA 4E70A 3M1EA 1LK9A 2CJHA 4XJMA 1SVVA 2D64A 5EIGB 2XAHA 3GR9A 4I2OA 1S8NA 1MGVA 2DBBA 4R1HA 1J9IA 5CVUA 4IHTA 4IXAA 3EI8A 4YFKF 5L3DA 4CXQA 1YAAA 4HQEA 4F5KA 1U5TB 3GYHX 2F2EA 1DJ9A 3CTAA 2VMTA 3L7WA 1BI3A 4WYEA 2HZTA 5E17F 1UKJA 2OBPA 2XRNA 4WXCA 1ZH5A 2VGTA 4QGRA 3BN1A 1MZBA 2BYJA 4JF0A 1AMSA 3NU7A 3IKVA 3V7SA 2BIGA 3RJPA 2W85A 1BC7C 1YIYA 3J81K 1ECXA 1QJ3A 4HZFA 1M0PA 4EVIA 5EAVA 5EUEA 1QZYA 2FM1A 4ZDLA 1ZG1A 4K2IA 5LEKA 2HUFA 1Z1DA 2EWNA 3D5LA 4ATQA 2ZBKA 3JSPA 3ZRQA 4RKCA 3EQLF 3QM2A 1ARSA 2YHKA 3WODF 2WWYA 3ECDA 2OU2A 1Z3ZA 3NYSA 3BY6A 3AEJC 2OZ6A 1IAWA 2KIMA 1XMAA 2VMXA 3N75A 1EV7A 4QWQA 1PMOA 1DPUA 4YFXF 2VGUA 3E6GA 3F9TA 4KUMA 1ARGA 3HQTA 1JF9A 1ZRCA 2CQKA 3BCAA 1XDSA 2NNYA 2IRFG 2KKOA 4JBAA 1F5TA 4BHBA 4H51A 1J04A 3N0LA 5H6QA 2MD5A 3ZMTA 3FXRA 1PP7U 1W7MA 2W57A 3HOTA 3QBOA 3WCNA 3JW9A 4ATPA 3IRRA 7AATA 5TF5A 5D5WB 1QPMA 1ZAOA 1WYTA 2UXNA 3DR4A 3T5XA 3LV2A 4PIWA 4W5KA 2JSCA 3DF8A 2CJDA 4W1XA 5CYVA 4I8AA 3ZQ7A 4EJUA 1AY4A 2VGWA 2W7DA 3BWOA 4RGSA 5DV5A 1P4XA 2RNJA 3EETA 2AY1A 4UHOA 2MH9A 1MDMB 2YCTA 2K27A 1PMMA 4EJOA 4G9YA 1RIOH 4RKDA 5DCMA 3I64A 4HQMA 2VOPA 1FBQA 5LH9A 1U08A 5E1ZB 1AY5A 2HQNA 2AXLA 4XK1A 3HSRA 1HSJA 4S05A 1A04A 1X3UA 3ZMZA 5K1YA 4G7HF 3WKRA 4Y0IA 2R5CB 4KNYA 2HP1A 2ZXJA 4Y17A 1OHVA 2A69F 3NRVA 2YRIA 2O7CA 4XLNF 3JTGA 3MCZA 3WTZA 2DTRA 1ZC9A 1BT4A 5G0AA 1W7PD 1R00A 4WYGA 4KN7X 2BHXA 1QISA 2FNPA 2F5DA 1TOKA 2JPBA 2JJEA 2CH1A 4M9ZA 3PD6B 3QU6A 2MA3A 1TW3A 2VMUA 1VJOA 3ELEA 2F5FA 2CSOA 2L54A 2FNUA 1D8JA 2EH6A 3HOSA 3FMSA 5FFXA 2UZKA 3N5MA 3WGBA 2X4HA 2PLYA 2GMSA 4U2HA 1JHFA 3WTUC 2X0LA 1V2EA 3COGA 3GW2A 5L3FA 1BBYA 5D5VB 1MKMA 1F9NA 2VLHA 1ZGJA 4YG2F 1QIRA 3ZP5A 2HFHA 4UV9A 3TQNA 3MAFB 1I1GA 4ZZLA 5E4ZA 4A6DA 3H7FA 1R1VA 3FSLA 3A8UX 3C7JA 2VONA 2XVCA 4DNCA 3V8LA 4GSAA 5M4BA 4BQ0A 1YS6A 3P9KA 1C7NA 1U6GA 2W8JA 2DGKA 2KIUA 3ZN0A 4HX7A 1OPCA 5DD4A 2DPUA 2HP2A 3C3WA 2QLRA 2VMPA 3V7CA 4IXSA 5D5UB 4M72A 2Q2EA 1W7LA 4FX4A 2XBNA 1OKRA 3SHFA 3HBXA 3RPQA 4EM1A 2VI9A 2DW4A 3QN6A 4A0YA 2M30A 5ICFA 2BIAA 4AWXB 4Y0HA 3RQ1A 3BWNA 1IVRA 1Z7DA 1FX7A 4Y0DA 2Z9OA 4MSOA 2XV4S 2V1PA 1J5YA 4Y13A 5D5XB 1M6SA 5FFZA 4JEZA 4IX8A 1U5TA 2C44A 2JG2A 3QPHA 2MC3A 1S0AA 1GVJA 1CF7A 5F64A 1TNTA 1KL1A 1IX6A 4RAEA 1Z05A 3VK3A 1BN5A 3W6KB 2Z9XA 4GRXA 2EK5A 4E1OA 3ROUA 1Z6RA 4W1VA 3E6BA 2ZFWA 3FD0A 1P3WA 3AENA 2BYVE 4ASNA 3TKYA 3WGIA 5HLHA 3WTVC 2Z67A 1SFUA 4OC9A 5FT4A 4WYCA 2A68F 2BBYA 4LLNA 3BROA 4YIIA 4WYDA 3R0JA 1YYVA 1FP2A 2FNAA 4F7ZA 2ISZA 3ML6A 2W7IA 1QZ9A 4L9NA 4ADCA 3CUQB 2STTA 4OYTA 1MAPA 1ZLKA 4MQ9F 4FHTA 2O61A 2LNBA 1VP4A 2UWMA 1IN5A 4O5VA 3MADA 5F6FA 5LGUA 1ZGAA 3WGGA 3I58A 3HL2A 1KKPA 2TPLA 1ASDA 4M9SA 2XROA 2HKXA 3ACZA 3BS8A 4PVFA 5DD8A 3U2RA 4L0YB 4ZH4F 2A6EF 1WKMA 2JJGA 4BAYA 1JE8A 2W8WA 3E5QA 4WX9A 1C9CA 3HT4A 2UXXA 1IUYA 1N2TA 2EZ2A 4A0HA 3FMQA 5M49A 2F5EA 4BA5A 3S2WA 1V2FA 3RPUA 2XGXA 1M32A 3PIUA 4QLCU 2GQNA 3VAXA 3Q9VA 3ZN1A 3GXOA 3FQ7A 1S7AA 1AWCA 1LQ1A 4B8XA 1RVYA 1LNWA 1WYVB 2OQRA 3DU4A 1ZG3A 3HSEA 1TLHB 5L3BA 1SD6A 2HOYA 5F9SA 5K5RA 2E1NA 1IAXA 4MQPA 2G7UA 4UVAA 5CVVA 1CZCA 3CJNA 2FQ3A 2Z33A 2FRHA 3AELA 3J80K 1RZ4A 1IJIA 1ZHFA 1AHGA 4L18B 2EO5A 3NYTA 3IKTA 1E5EA 5FT6A 4EV0A 3WKSA 5A2QK 2D7ZA 2XUBA 3E77A 3R0AA 2R2NA 1D7VA 2AY8A 4LD5A 4LGWA 1ZREA 2M5WA 1FT9A 1BC8C 3EI7A 5DUKA 3FF5A 1R23A 3KE3A 5J6XA 3SZPA 2DKJA 3B46A 3DRDA 5LHAA 3FTBA 3E6MA 2BI2A 1BI2A 2VIBA 1AHYA 4GYIA 3VOEA 5IT9K 3F22A 4AIHA 1WYUA 3HVYA 2V1XA 4I09A 1DGEA 3CQ4A 1KKJA 5CVIA 3QI6A 2VBWA 3PGYA 2FE3A 2HORA 1J75A 4I0AA 5AIPA 2RC4A 1YQAA 3ISPA 2Z1YA 3PD6A 3LA2A 2ZC0A 4P55A 3B02A 1ASEA 1YS7A 2CB1A 2AY4A 2ZJ2A 1QGPA 3CDHA 5ICCA 5M46A 3ZMSA 4AD9A 1GC2A 2ETHA 1E5FA 5BJ3A 3H3UA 1FP1D 3QPGA 3FFRA 2W25A 3HRUA 4U0YA 1SZKA 4IVNA 1TPLA 4WWCA 4MEXF 1ELQA 3CLOA 1AIAA 4F5FA 4D0PA 2RQPA 2NAZA 1TOJA 3EI5A 3I59B 4LK0F 5BMZA 2CG4A 2QYOA 2VN2A 1DPRA 3BZ6A 2BI5A 3AEJA 2D66A 1REPC 3WZFA 4EM0B 3LVJA 1S7OA 2D2WA 2VLFA 2QQ9A 4EJVA 2E54A 4ZYEA 2Q0OA 4LW2A 2FN6A 3E2ZA 2DU9A 2LF8A 2RFVA 5ILVA 4KICA 1B6AA 4HVKA 3WCOA 3R6SA 1RNLA 4CBRA 4FFCA 3DZZA 1AHFA 2AEVA 1YIZA 3AENB 1LS3A 3FKDA 3WE3A 4I7HA 3ZZJA 1B59A 3VEPA 3COAC 1AAMA 3QPTA 5HOOA 4A6UA 4UNOA 3B1CA 5FD5A 3E3VA 3JAMK 3EUCA 3LVKA 1FC3A 5FO5A 3EDPA 4ADDA 4KT5C 3FZVA 4ADBA 1O3RA 3DXWA 2R7FA 2W7EA 1FLIA 2CJGA 2FQ6A 1J7KA 3VODA 2HS5A 5LHIA 1I27A 1LVAA 3TOBA 4RB2C 4A00A 4KIBA 1AKCA 3DXVA 3VFZA 4UOYA 1OMIA 1J0RA 2BV6A 3WGHA 4RM1A 2D61A 4YIFA 1CS1A 4EGYA 1LJ9A 3KGXA 2W7LA 3NDNA 5D8LB 1ASNA 3CBFA 4RS8A 4WK8F 1TQMA 3GZCA 4P9FA 2V6CA 2P5VA 5LRSA 1Z9CA 2FBIA 3RBFA 3TQXA 2A3SA 3FMRA 4NB5A 4KMFA 1V4RA 3GFJA 5K5QA 1TOIA 2HZPA 3IWFA 4XRFA 5ICGA 2HUUA 5BQTA 3AAFA 2BWNA 3LY1A 1MJBA 5ICEA 3GZDA 4MHGA 3HLMA 2VGSA 3CO7C 2FU4A 1HKTA 3L09A 4XSXF 1J59A 3F8BA 2VGZA 2AEUA 9AATA 5D95A 4XSZF 2E7JA 2PQ8A 2P5KA 1IX8A 3F6VA 1I1SA 1GC4A 2O6GE 3KKIA 1J32A 3RKXA 2Z9WA 2VI8A 1DFOA 3G8MA 2CYYA 1E17A 1ON1A 3F72A 3HRSA 4MQQA 4R79A 1GXPA 3G3ZA 3P7NA 1USTA 2EPJA 1PUEE 4LNMA 2QENA 4HBLA 3NTJA 1KMJA 2HQRA 2HEOA 2RN7A 1R58A 2QVOA 1J2XA 1KQ9A 5FGMA 2D7YA 1JXSA 4A0GA 3NQOA 4NOGA 4WXBA 1H9GA 1S6LA 2GMUA 3RUYA 2JRTA 1IXCA 1CF7B 1G6NA 3K0LA 4BQAA 1FWZA 3T0YA 4OMYA 1XGNA 2QMAA 2CFXA 4BH9A 2Z1ZA 1X29A 1YJZA 4RITA 5HS9A 1QNTA 1V3FA 4LMYA 1AMAA 4HLXA 1MJ9A 2BWOA 3TCMA 2CWEA 3CUOA 5E8IA 2H27A 4DBCA 3USFA 4XLPF 5ED4A 3RI6A 5LHGA 4J5UA 3CAIA 1DKAA 4H0EA 1LC7A 5HXXA 2D1HA 4XQ2A 4G6DA 2DR1A 3IC7A 2VBZA 3SZTA 4P96A 3TATA 1AJSB 3HYIA 4M2MA 2YKUA 4ITGA 3JWAA 3DPTA 1HW2A 3JTXA 3GUDA 2FBHA 1IAYA 4ESFA 3ASAA 3MAUA 2TDXA 1KU3A 2CSTA 3VP6A 3H3ZA 3HSFA 5FD6A 1YO5C 3KP5A 3KEQA 3PJ0A 2K02A 4IRHA 4DQ2A 4XAUA 4F5HA 3IRQA 4A6TA 1AJRA 4A0ZA 4LNLA 3E9KA 1WKGA 2VE8A 1SMTA 1M0OA 2AATA 3FVXA 4Q48A 1IF1A 2CW0F 1U78A 1SZSA 3GLXA 3NNKA 3E2FA 4PCQA 4A2UA 2QB2A 4LB6B 4GE4A 1W3UA 4JEVA 4FL0A 5CVJA 1BKGA 1WYVA 2BYLA 3E97A 3GFMA 3ZMVA 2H09A 2C7TA 2AS5F 1SZUA 4RB1A 4KAMA 2VMYA 5JVTA 1DP7P 4MY5A 2VMVA 1AICA 1BQAA 2EFQA 2PO3A 1RV4A 5HS8A 1SPAA 1SD5A 3BB8A 1WRJA 5E18F 2VMQA 1S09A 2VC0A 3V7RA 4ADEA 4E77A 3M8FA 3NUBA 4XBFA 1DGDA 3J80Z 1O7LA 4IYOB 4WYAA 5LGNA 2W7FA 4Q31A 3LVLB 1YW7A 4Q5SF 3P9IA 4AIJA 2BI1A 4PFNA 2V9VA 3BP8A 4OMZA 5DJ9A 4TV7A 2DOUA 3BOQA 4KIGA 2QQAA 1TQPA 3L8AA 3T1BA 2GQQA 4JK1X 2P4WA 5TRDA 1CL1A 2DK8A 2V79A 1U3EM 1IUGA 1I41A 4ZDOA 2FBKA 3I5UA 2P8TA 3BJOA 1CZEA 5BPDA 2YX4A 2L4MA 1FSHA 3PQKA 2OATA 5H6RA 1OYYA 3J81Z 2AY2A 4L5IA 4RAYA 4MNUA 4O6JA 2EB7A 3I16A 2BEOA 4G94A 2PEXA 1BS0A 1MDOA 4CGZA 4OMAA 4F5MA 1TNSA 2OKJA 4ZYDA 2J5PA 3BDDA 4JEWA 2VT3A 1T0FA 1EH8A 5KVRA 4Q47A 4OIPF 1JS6A 4L9TA 3EIAA 4P3MA 4U1TA 3KE2A 2YPRA 4I01A 2MH2A 2BI3A 5CLSA 1XGSA 3IHJA 1KYWA 3HHGA 2DKBA 1N8PA 2Z3YA 1KGSA 3LG0A 3GVAA 5F8VA 2V1DA 3WU1B 3FCRA 3BC8A 4W8IA 2PB2A 4BHDA 4AZKA 5AONA 3QRFF 4A6EA 1O61A 2V1UA 3PA9A 2YR2A 3GSBA 1GC3A 2EV6A 2IW5A 4RJ0A 3BPXA 4CBSA 2OGAA 3HDOA 4HF0A 4EB5A 5KK1A 1Y0UA 2W7GA 1G3YA 3V8KA 1BJAA 3ZMDA 2VODA 2Z5UA 1TOGA 3AEOA 4OBVA 3JTHA 2DO7A 2NMPA 1UU2A 1KL2A 2ADUA 3LFKA 3IHUA 4XJLA 3M7GA 2KIFA 4HV6A 1B4AA 3MEXA 4AOAA 4OINF 4A0RA 4M9XA 4ZZDA 1XDUA 2C6YA 1C0NA 1L0OC 4L9JA 5EAAA 1NHAA 4BHPA 1K78B 3KEOA 1BOAA 3I5TA 3Q5FA 1TW2A 3L2CA 2GZWA 1ASLA 4KXKA 2YKXA 2OA4A 2XH1A 3KCCA 3M5UA 2FF4A 2EGYA 2K7LA 3M9AA 1KU7A 1RI7A 3MFKA 4M2KA 2ZCWA 2FXAA 1QO0D 3DV8A 1B4XA 3KP4A 3GBXA 4LK1F 4P5OA 2GIVA 1MLZA 2C81A 2ZUKA 5D6FA 1AOYA 4NHJA 2F8JA 1BJ4A 3REOA 2HUIA 1IX7A 2P7VB 4ZAHA 3WTYC 1W4MA 3MBBA 4Q76A 3ECHA 1G4VA 3FQ8A 4IXOA 2K86A 2W7JA 2ELHA 3BCXA 2YCPA 1I6XA 5D6EA 2JISA 2FOKA 4WLHA 5G4JA 2QQBA 3GZ6A 1YW8A 1XB4A 1O62A 2ESHA 3HUGA 1ARIA 4RB0A 5F1RA 4ESJA 1OR7A 1R1TA 2KJCA 1C7OA 4F5JA 1ASAA 4ZWVA 5EEGA 3N4MA 4YFNF 4ZYHA 3TO7A 2EA2A 2WK9A 1FC4A 4G8XA 2ZMEB 1AHXA 5EUNA 4HLYA 3MAJA 2D45A 4RB3C 3MEBA 1LEBA 2GA1A 2DAOA 1D7UA 3CQ5A 1XSXA 4KIFA 5C6UA 2VBYA 4U7DA 3DQVC 4ITXA 3GZDC 4RJYA 2GWRA 2HWVA 2ZMEA 2H94A 4MQVA 3G73A 2L02A 2P7CB 2KJBA 1ZARA 3HIFA 4CYDA 3HTUA 3RKYA 1ONVA 1GEXA 4AIKA 1I5ZA 1X0MA 4A0FA 2OGEA 2F5CA 3PAAA 2ZJGA 2V0YA 4WP0A 1TTYA 2M8EA 2QM3A 2D1VA 2NYXA 3FQAA 1W5TA 4Z2YA 3UE8A 2P6TA 3QGUA 3B8XA 3DXJF 4PGGA 3EYYA 3P1TA 4MQRA 3F23A 3LQQA 4U0WA 4L0OA 1R1UA 4IHSA 4KA4A 3B73A 3LA3A 4WD2A 2VXZA 2OQXA 1IXSB 3FVUA 2VMNA 3E5XA 2EFNA 1W7NA 4EU1A 4BA4A 3OOPA 3RIRA 1W5SA 3MWMA 2WK8A 1W7PB 5K5OA 4LJZF 3NU8A 1IRFA 3JWBA 5DJ1A 4M6YA 4BYYA 3KP7A 4ENMA 2HOZA 3ZRPA 2MLKA 2A61A 2ZNZA 1TOEA 4LC3A 2XASA 4L5JA 2CGPA 3ZMUA 1O69A 5D5SA 1DJUA 1XI9A 3K1MA 1OATA 1SFFA 3SXYA 4TMRA 3WTWC 3RYRA 2GSAA 2O0YA 2R7DA 1H0CA 1MDXA 1QBJA 2CTZA 3EI9A 4AZJA 1CQ8A 4MKJA 3F8CA 3IF2A 1GEYA 1OYIA 1U8RA 2AY3A 4HX8A 2W8VA 4CVQA 2Q7WA 3EYIA 4W1WA 1FOKA 1G3WA 4G6QA 2DQRA 5K8BA 4HF8A 5HVQC 4U7BA 1CGPA 3FRKA 3I4PA 5CVRA 1AMRA 1T39A 3LAJA 3PPLA 4A6RA 5DDGA 1SF2A 4WF2A 4KYWA 1BIBA 2EFWA 3FM5A 4UXNA 4N0WA 2YRRA 1GEWA 3P6KA 2Y75A 4K2MA 1T3IA 2QBYA 1EH6A 5DX5A 2RDPA 5BS6A 5HDNA 2QBTA 3AEMC 2XKPA 2R5CA 1YLFA 1IN7A 4JEYA 3I53A 2LSOA 1BJOB 4JQFA 3MQ0A 1LDJA 1D7SA 2C0RA 3I0TA 3K28A 2ZO4A 3R61A 3AOVA 3O3KA 2IA2A 1ODDA 3DYDA 5HDGA 4BNCA 4PDKA 2XAFA 1B5PA 4N0BA 3IL2A 1QQIA 3GFIA 3GO5A 3FXUA 4UVBA 1UU1A 2CANA 3IWZA 3BPVA 3O6BB 4UHNA 4HDVA 2CO5A 1P4WA 2VMOA 4M73A 4NQWA 3ATHA 4ZM3A 1HKSA 3F0HA 3L9FA 2HYFA 4L9VA 1QZZA 5E8GA 5LEJA 5HHYA 2HR3A 4UVCA 1IBJA 3Q8NA 1BI0A 5EFSA 5HDMA 2BI9A 3HRTA 1U5TC 4ENJA 2D5YA 4O3MA 2L3DA 3FXQA 3TGNA 4PFFA 2DGMA 1XCVA 1ARTA 4WXGA 4W91A 5E5IA 3DEUA 1SAXA 1UB9A 2PBIA 2YU3A 1OYWA 1BJOA 3HTSB 1TATA 4HX4A 1M0NA 1UHWA 4HF2A 1QGNA 2YCNA 4OBUA 2QBYB 3D0SA 2RVCA 1KU2A 4U0VA 2YKVA 1USSA 2Y0MA 2B0LA 3FVSA 1FZPB 4R8HA 2VE9A 5FLXK 3TDUC 2RKHA 2YX7A 1LKCA 1DDNA 3NYUA 2K4BA 2X5FA 4Y15A 3BJ6A 5JHUA 1ULYA 1FG3A 3L44A 2DLLA 5AX8A 3KP2A 1YJYA 4A72A 3QAHA 3TDZC 2H6BA 4ZASA 3ABTA 2AY9A 3E6CC 3B1DA 1ZLJA 2AY7A 4ISYA 1K79A 2VYCA 4CHUA 1B9HA 1XMKA 4XJOA 4I98B 2VMZA 1ASFA 2R5EA 3W1IA 3V4GA 4WXFA 1ZYRF 5L3GA 2P5LC 3RTRA 2O3FA 4U88A 4ZSWA 1ASBA 2AY6A 1YIOA 4WB0B 4BXUA 3AEPA 2VGVA 1H1CA 2BE5F 1O3QA 3BV0A 4OIRF 2MLGA 3WE2A 1PDNC 1AAWA 1VEFA 5ILSA 1SD7A 4B9BA 1T98A 4B98A 2YSRA 4F5GA 4WBTA 2A5YB 2WV0A 1XGMA 2JPCA 2PI0A 4LG0A 1G4XA 4LB5A 4KDPA 3KZYA 1IN8A 1G4DA 2GAUA 2VOOA 2LF7A 4A5MA 3FHZA 1FBUA 3RYPA 3RCHB 3UWCA 1QJ5A 2QA3A 5I92A 2PB0A 4OTLA 2ZSLA 3PDBA 2W24A 3V8JA 4EGZA 1WKHA 5FT8A 3AOWA 1R7JA 3JZLA 4PZJA 2DK5A 3R60A 1HQCA 3OP7A 1EH7A
chains in the Genus database with same CATH superfamily
5J8FA 2MGQA 2K4JA 3KFWX 4YELA 5DCFA 5BNGA 1WH5A 3G4SI 5EYRA 2MFZA 1DTYA 3BWGA 3MZ8A 4UHTA 3WLXA 2I10A 3F8MA 1LFPA 2E7XA 3GZNB 3ZQFA 2R7TA 5H20A 1CQ7A 1PFFA 5HODA 5D4RA 4ETSA 1MD0A 1TP4A 2XF5A 2X6WA 1SC7A 1O4XA 2V26A 5E3KA 2BY2A 4B09A 5DS9A 2KRFA 1Z3XA 1MBFA 4A3JJ 1TBXA 2KZVA 5BJ4A 2BKWA 2GBYA 4P7YA 4AO9A 1BQDA 1S5LC 4ZDPA 5FLXZ 1IRGA 3H14A 2HTJA 3BR1A 4N9IA 1MJAA 4LLGF 1YW9A 3TW6A 2ZYJA 1MAQA 4IXZA 2DI3A 4ZWMA 5C4XJ 4UQVA 2F4MB 3F21A 2XIGA 3LSMA 3TOAA 5JI6A 2KHMA 2A5WA 2X6YA 2JN6A 3DTKA 3JRIA 1HOMA 3CUQA 1XN7A 2ACJA 4EJTA 3S1QJ 1KQ8A 3TP0A 4BMKA 1GXQA 2BOLA 4LFUA 3NRAA 1Z21A 1ZG5A 1AHEA 1LDKB 1ASMA 2F5VA 1JGSA 3QHXA 1RPWA 1KQ0A 5BOXA 1QVTA 2OAZA 3ERMA 5J8CA 4R5ZA 3EZSA 3CO6C 4QSHA 4N9HA 4AVPA 3L2RA 3K2ZA 3F3XA 1GHCA 4F5LA 4UV8A 3BJAA 2HOEA 3J7AO 5C4JJ 5LFAA 4OOIA 1YOOA 3CD6I 2CUFA 1TASA 3W1JA 3DU6A 2FYFA 3LQRA 1JI8A 2OJED 5KAFC 4JX6A 2HYGD 1B9MA 2ESNA 3B6CA 2W7NA 4ZM4A 1ZOBA 3ASBA 1JHHA 3K9TA 2ZFUA 4Y3OA 1IV6A 3R4KA 1AIBA 3JSOA 1U0JA 1X2AA 2O0RA 3CP8A 2VXDA 4KN4X 4EB7A 1P7IA 2DQLA 2IEKA 2XAQA 3DR7A 4DGTA 2WTEA 4PFOA 3TEDA 1SMYF 3ECOA 2VC1A 3LWSA 1P4AA 2E7IA 1TQIA 4E4HA 4HOBA 4WLJA 4R5FA 1D7RA 1WJEA 3KLNA 3CLQA 4G6TB 5E3OA 3A2KA 1ARHA 1D0XA 2E1MC 4GXOA 2O7OA 1T38A 1TARA 1FYMA 3ASNH 2KDZA 5ERIA 1L3LA 1K78A 3ZPLA 2R0TA 1R4NB 3BZCA 5IWQA 1YJSA 3BR2A 1PP8F 4I76A 3KP3A 4ZTFA 1ZKGA 3RDIA 1XD7A 3FXLA 5A2QZ 2BVMA 3KIOA 4IOAF 4XICA 1BIAA 2Z61A 3ERED 2CINA 2VMWA 3MC6A 1Y56A 2XGEA 1FMWA 4D1QA 1BJWA 5LHHA 1KU9A 4EM2A 4EMSA 2O8XA 2X6OA 1X1CA 2K9MA 2F6CA 4A3MJ 1W23A 2X48A 2I8DA 5DB5A 5M4DA 5FKMA 3MZHA 2JGTA 2ME0A 5LGTA 2BIEA 1YE9A 2L01A 2RAEA 1LW5A 2Z9UA 4P9UA 3ZRRA 3DU5A 5BPIA 3MKJA 1JS3A 5CJ9A 1BI1A 3G0TA 3WU0A 4A0XA 2HOXA 4O6ZA 3KPHA 4A69C 1W1WE 1FSEA 1K7AA 2ZP7A 5E20A 2STWA 3I4JA 1LW4A 2N8GA 1FY7A 3BR5A 5IT9Z 3KP6A 4II2A 2PJPA 4NC6A 1S08A 4CA0A 2ZSIB 1KZHA 2XPUA 3GF2A 2BHZA 4E7LA 4IOCF 2HDCA 2YOBA 2GXGA 2H6CA 2L7MP 3K70C 1TWHJ 1KA8A 3SEQA 1GCKA 2Y0SA 4YEJA 2BY3A 4HV5A 1O3TA 2ZSHB 4A12A 3E2YA 3BCBA 3KZZA 1CQ6A 3I9V2 1H0MA 2E1CA 4ENNA 2VMRA 5L3CA 2HKOA 4A3BJ 2CQ7A 1G3TA 2PN6A 1W5CC 4ESBA 4KYOA 1U2WA 3UNGC 1BW0A 2RNGA 2HI3A 3II0A 1HW5A 1E3HA 1I6HJ 1G7WA 2O1BA 1G8XA 3OY9A 2VMSA 4ZSYA 2G7HA 2WV1A 4BY7J 2DFFA 1HW1A 3ZR8X 4XJPA 3QP5A 2CV0A 1P9QC 2Z20A 3ZQLA 3EUHA 4IRIA 3S3MA 2M0MA 1NK3P 2NS0A 1AJSA 2W7KA 5IT3A 1R5HA 4I02A 4BEHB 2LTPA 4IRGA 2E2HJ 4CCKA 1MBKA 2VT2A 3H9JA 1DUXC 2Z99A 1EQBA 4OT8A 3QOPA 3HHHA 3GZ5A 4Q6RA 2QWWA 3E2ZB 1IC8A 1A6QA 4XRMA 2IGKA 2FSWA 3VYTB 3AEMA 2ZNYA 3W6JB 1R22A 1XSDA 1CJ0A 1VTNC 3D6KA 3ZZKA 4K2BA 1XCBA 2A07F 3KYCB 4I99C 2E60A 4EJWA 2HDDA 1I48A 4JE5A 5J40A 4ENKA 2IS4A 2M87A 4WXHA 1POGA 3QP6A 1TWGJ 2ZC2A 1Y4IA 2CH2A 2ID6A 3WTSC 3NAUA 5LLQA 1AY8A 4M6XA 1RR8C 1YFHA 1G7XA 1OHWA 1T56A 5L3EA 3NX3A 5EZGA 1BR2A 4NQWB 3E6DA 1SAUA 2GM4A 2Q8KA 5FT5A 2E5NA 4LIUA 1MLYA 5FB2A 4IYOA 4HW0A 1K83J 2BHYA 5J1RA 1C7GA 2KPMA 4RGRA 1S3JA 3T8TA 2IT0A 2VIAA 2R3SA 1NG6A 3PFIA 4OIQF 2X3LA 4GCVA 1P2FA 1K4SA 1WJFA 3H92A 1IZ1A 4RGUA 3I55I 1ASCA 3EI6A 5EGOB 3HMUA 2XF6A 2EV0A 4B43A 3K69A 5GTHC 2EFPA 3KZIC 4CCNA 4J8LA 1EKEA 3W1HA 4V19K 3VSLA 1O3SA 1O4SA 4DIQA 4EMYA 1B5OA 4ZYGA 4N4NB 3JAMZ 1APLC 2O03A 5HS7A 4LW4A 1V2DA 4MKKA 5DUIA 2HTSA 2CJJA 5HDKA 3ELKA 3DODA 4R8DA 3ZCOA 2LKSA 3SFZA 4CCJA 1M0QA 4GYGA 2PFBA 3T8RA 3ELPA 1FEXA 4JE5D 1OXOA 4GRIA 2EINH 3GX4X 1AMQA 2IVMA 3NWSA 2W48A 3C1DA 2CRGA 4D9JA 2OTLI 1XEYA 2WK7A 2EQRA 3ULQB 1D3YA 5GAEJ 1E0EA 4RLGA 4GO1A 3A0BC 2X5DA 1B9NA 1ERDA 1S07A 1Z7UA 2CV1A 3R4TA 4PGHA 1EJIA 5JAYA 1U9OA 4XLEA 3B1EA 3EZ1A 1ZRDA 3A2BA 3RZOJ 4MTDA 4E7KA 1WYUB 4BQQA 2LOOA 4F5IA 1MBGA 2XAGA 2W8TA 2M2EA 1SFXA 3RKQA 4KISA 3OL3A 3RQIA 1QRYA 4HAMA 5K7HA 3AG2H 4MTEA 1MGTA 3LWFA 3CC2I 1UG0A 3HZJA 1AKBA 2XHKA 1GBNA 3FZ8A 3UAKA 1R6RA 4BGDA 3VK4A 3OSGA 3H3VK 2NNNA 2DPDA 2G9WA 3CP2A 4G7ZF 4WYFA 5FJ8J 3OKSA 3FZ6A 3PDXA 1RVUA 3K7YA 4HA8A 1LEAA 2XDVA 5HLGA 4AH3A 2QUFA 5D4SA 1D2FA 4UUSB 1N31A 3BWNC 3A4CA 1HKQA 3AV7A 3EPZA 1YNUA 5J1UA 1IV8A 3NEUA 3F6TA 1DGRM 1X4OA 3DEEA 2EFOA 4IW7A 2R4GA 2VBXA 3QYBA 1EA3A 3VOMA 1FBSA 3F6OA 4BE2A 4XL9A 2IA1A 2KFDA 2Z2SB 4KMUX 4B3XA 4CXRA 1MDZA 1YTYA 3BG7A 2DN0A 1Z6TA 4RGXA 1G59A 1M7YA 2CS3A 3HJEA 3WHCA 2EZKA 4JEXA 1ELUA 4XOPA 5H2FC 2JZYA 3OYHA 3KGWA 5EIGA 2IPQX 1F4KA 3CESA 1HXDA 4F4EA 2DT5A 5C44J 3K10A 3D1NI 2RGVA 3N97A 3E5UA 3DFGA 4J01A 1IW7F 4IKFA 2DOFA 3JU7A 4RAZA 2EV5A 1ACIA 3EIBA 1ZRFA 4Q4ZF 3OIQA 1E3PA 1HDPA 5E1WA 2DFEA 2HOAA 2CFBA 1LDDA 2QLZA 2Y2ZA 5IP7J 2ICWG 2M45A 2P6SA 2EA4A 4DQ6A 3FFHA 4D7MA 2OZUA 4RM3A 5EEHA 1JKPC 1IDZA 4AO4A 2D65A 2JTVA 5IY5H 3CMMA 5LBQA 1X3WB 4GE7A 2W8UA 2K3FA 2NVUB 1QITA 4IF4A 1WPKA 2FMLA 4MGRA 2QF7A 1UFMA 5AIQA 2Z9VA 2J5OA 3BTIA 3GETA 3H0GJ 1WSUA 3DPLC 2WKAA 3C18A 3GEZA 1ASGA 3FK6A 3TO9A 3JW4A 1YRNB 1UHMA 4BKXA 1EG5A 4DGWB 5G2PA 4K2EA 4W1UA 3WG9A 4E7SA 3SQNA 2EBIA 4EQQA 1DQUA 1CL2A 2FX0A 5ILUA 1LKXA 4CCMA 2E1MB 3CF5F 5G2QA 5IOZA 4L0ZB 3PUFA 2WC2A 1D8KA 1SFEA 4II3A 3D5RC 2R7VA 2ZKZA 2YKYA 1C0WA 4I0BA 1R36A 3R9AA 1RV3A 3CZ6A 4IJAA 1ORKA 2GA2A 2CY8A 1E2XA 2FNIA 3H5NA 3PQJA 2GXBA 2VIXA 3CJRB 3VDXA 3GTLJ 1ZN2A 1S72I 4HF1A 3I71A 3M3YJ 5G09A 2NVTJ 2X8UA 2OD5A 1KMKA 3GJUA 1FG7A 1SD4A 1XGOA 5DEQA 4GGGA 3IAS2 3PNTA 2HVRA 3TFTA 2M8GX 2IJLA 3K2AA 1GDEA 4WXDA 1G3SA 1VQ6I 2LDUA 1BJNA 2FEZA 3RKWA 1JG8A 4OAZA 5E1XA 3TFUA 3GWPA 4I6ZA 2LVSA 2PMUA 3GTMJ 1I43A 3P9CA 5HLIA 2F4OB 2HGCA 3VK2A 3DC1A 2FQ4A 1LB2A 3CC7I 1LC5A 1WSTA 3FX3A 1RUNA 1WQ2A 2CUJA 1PG8A 3A9YA 4OMAA 4CO8A 1RUOA 1X2NA 2E2JJ 3PUBA 2RV8A 1YOVB 4ABZA 4M74A 2XPVA 3Q9SA 4LNJA 2BZTA 4LLLA 2BXZA 1H9TA 1GLNA 2YS9A 1X28A 4KFCA 4GDYA 3MAFA 3RI4A 3HC7A 2BWPA 4CICA 4OU0A 4V2FA 3WTTC 2OCEA 1T6SA 1JUSA 1Z3YA 3OYLA 4QPQA 1A6IA 3MC6C 2GB3A 4ON0A 2E7UA 3CQ6A 2DFIA 2O9LA 2R0QC 4F92B 1T2KA 1XSVA 2M1BA 5IP9J 1B9IA 1Q1HA 1F1ZA 3GFLA 1KYZA 1P6RA 5F1JA 4C2UA 4UUVA 4E3RA 2ZJRF 1K6OA 3FDBA 4EFFA 4G12A 1ON2A 1FYLA 2L4AA 2CH0A 5LRRA 3H0DA 4OCAA 4TN4A 2EJRA 3VB2A 3LVMA 5EQCA 1STZA 2DMQA 1PYVA 2JJFA 3IP4B 3M8EA 1D5VA 4M71A 1Z91A 3F8FA 1YIJI 1LC8A 4X6AJ 3OYBA 4UHMA 4WB0A 5FLMJ 1UCRA 3K1PA 2HVQA 3K6GA 4IPAA 1B8GA 2JJHA 2L5QA 4A5NA 5DYMA 5JR3A 3TO6A 2IAIA 3O2PE 2VKEA 3KYLA 2COMA 2ZJPF 3A9ZA 4XEWA 2DA1A 1ORDA 3RBLA 1MW7A 1WJBA 3HG9A 3OYAA 4HG2A 3G7QA 1WI9A 4M2JA 1BJZA 1GC0A 1WWXA 1RETA 1B1BA 2K5CA 5GTIC 1ZODA 1YHQI 3ZQIA 4IHYA 4LIVA 3WGCA 4HRIA 1I39A 4BL0B 1O7FA 3FM3A 1VQLI 2PMHA 3WTXC 4NUBA 4G7OF 4IX7A 2Y9YA 4E7ZA 2R5ZA 1WFXA 4D7NA 2DCEA 2DMNA 4DW6A 4JF1A 3EUKL 1GVDA 1Y0NA 2MD0A 1LFUP 2NRAC 1V72A 4FT8A 3U1DA 3T32A 1P92A 2W84A 3K40A 4OIOF 1W7PA 2FOWA 1O57A 2ID3A 2QSFX 1MDMA 3CJTB 2BGCA 2AY5A 1FNNA 4IQ4A 5J8QA 1A31A 1UU0A 3ABUA 2DGLA 2W7HA 2XAJA 2BW3B 4BBSJ 4XKWA 2ZSMA 3KLOA 1FYKA 5G4IA 2JA2A 3F8NA 2JWTA 4CZZA 2MBFA 5EG0A 3AATA 2Y48A 3I59A 2WADA 4CDGA 2R7WA 2WBMA 1WZ2A 1YJWI 4GEBA 4XLFA 1BM9A 1TWFJ 2OKKA 3K1NA 2LKPA 3DP7A 3I54A 4CXFA 1OHYA 3Q3SA 3HRMA 1NG7A 1WYTB 3L00A 2VJ5A 2W7MA 5TJJA 2G6WA 4DBQA 1HSTA 1I29A 2E7WA 2BW3A 2OQGA 1M4NA 3KETA 8AATA 1S06A 2A6HF 4NNJA 3S8PA 3OV8A 2JRMA 4XKBA 1IN4A 2E34A 3WY7A 3NARA 4FX0A 2TRTA 3FWEA 2CW7A 3U9GA 2D63A 2Z16A 1S9HA 2YUSA 2KQRA 1HBXG 4Y4RA 5DCMB 1FPQA 3DKWA 3LSTA 3DLLF 3A9XA 2JMWA 2IA0A 4R2NA 3PDBB 3LAPA 3QU3A 1R5GA 4DYRA 1GD9A 1V5FA 3WX9A 2PG4A 4WCGA 3RCHA 2QB3A 5JFRA 3CUQC 3LSJA 1OXPA 4Q75A 1D1BA 4GE9A 1S29A 2VJ4A 5D8KB 2EZ1A 2ISYA 2FA5A 1TL8A 1AKAA 6PAXA 3DWLE 3K4BA 2ORDA 1Y1VJ 3U21A 4ZLVA 1MH4A 2KRHA 3QOEA 1VQ4I 1OCZH 1IXRC 4MEYF 4LG0B 2AQFA 3MZYA 4BHCA 4IY7A 2HPMA 3ISLA 1AX4A 2QZ8A 5EUDA 4HYEA 2IP2A 4C9YA 1YG2A 3FZ7A 2JT1A 4L5EA 2FMYA 3NUIA 5LD2C 2KMUA 3I4NJ 3LA7A 1C4KA 4E3QA 3GWZA 4B4CA 3W2WA 1V5GA 4S04A 2XKOA 4HDUA 1W36D 1IN6A 1DJEA 4RIZA 4RBOA 4E70A 3LSGA 3M1EA 1LK9A 2CJHA 1FIAA 4XJMA 1SVVA 2D64A 5EIGB 3L2VA 2XAHA 1IRZA 1JKQC 2IGNA 3GR9A 4I2OA 1S8NA 5FROA 5HNFA 3HGYA 1IO2A 1ETYA 2DBBA 2VPRA 3LSPA 1MGVA 2DDBA 4R1HA 1J9IA 5CVUA 1FTTA 4XOTA 4IHTA 4IXAA 2VKHA 3EI8A 4YFKF 5L3DA 1OISA 2DYSH 4CXQA 1YAAA 4HQEA 4F5KA 1U5TB 2DMTA 3S93A 3GYHX 2F2EA 1DJ9A 1N25A 3CJQB 3CTAA 2VMTA 3L7WA 1BI3A 4WYEA 2HZTA 1Y1WJ 5E17F 3HPGA 4J00A 1UKJA 2OBPA 2XRNA 4WXCA 1ZH5A 2VGTA 4QGRA 1OCOH 1MZBA 2BYJA 3BN1A 1MH3A 1IG7A 3HBLA 4H4KC 1AKHB 4B3AA 1VQ5I 4JF0A 4S0HB 5K7ZA 1AMSA 3IKVA 2MYSA 3V7SA 3NU7A 2BIGA 3RJPA 1VFCA 3GTKJ 4HNUA 2W4SA 2W85A 1BC7C 1YIYA 3J81K 3PNYA 1B72A 1ECXA 1QJ3A 4HZFA 1M0PA 4EVIA 5EAVA 1N78A 3AG4H 1X2MA 1QZYA 5EUEA 3UKGA 2FM1A 3HB9A 4ZDLA 2LRDA 1ZG1A 5LEKA 2HUFA 1Z1DA 4K2IA 2DJNA 2EWNA 3D5LA 4ATQA 2ZBKA 3ASOH 3LOCA 3JSPA 3ZRQA 4RKCA 3K70D 3EQLF 3ZQGA 1YJ9I 3QM2A 1ARSA 2YHKA 3WODF 2NOJB 3OYDA 5E3NA 5EZHA 2QSGX 3PSFA 5CKTA 4AC0A 2WWYA 3ECDA 2OU2A 1Z3ZA 3NYSA 3BY6A 1MSEC 3AEJC 4W97A 2OZ6A 1IAWA 2KIMA 1XMAA 2VMXA 3N75A 1EV7A 2LBFB 3OR1C 1VQPI 4QWQA 2KLOA 2E71A 5GAGJ 1DPUA 1PMOA 4YFXF 2DFHA 4XLCA 2DTZA 2VGUA 4KUMA 1ARGA 3E6GA 3F9TA 3HQTA 1JF9A 1ZRCA 2CQKA 3BCAA 1XDSA 2NNYA 2IRFG 3OYNA 2KKOA 4JBAA 1F5TA 2E36A 4UB8C 4BHBA 4X1EA 5IYDJ 2Y0SN 4H51A 1J04A 3N0LA 2ZB9A 1VQ9I 5H6QA 2WY8Q 2CW8A 2MD5A 2HQ5A 3ZMTA 3FXRA 4F91B 1B8IA 3W2AA 2LY2A 1XMXA 1PP7U 1W36C 1W7MA 3LNQA 2W57A 2WAEA 3HOTA 3A02A 3QBOA 3WCNA 1D0ZA 3JW9A 4ATPA 3IRRA 7AATA 2V1NA 3TW7A 2ME6A 4AYBA 5TF5A 5D5WB 1QPMA 1ZAOA 5M5WJ 1IJWC 3VSKA 1WJCA 3I56I 1WYTA 1UAAA 2UXNA 1UG2A 3DR4A 2VL8A 3T5XA 3LV2A 4PIWA 4W5KA 2R7UA 2JSCA 3DF8A 2CJDA 4W1XA 5CYVA 4A3LJ 4I8AA 2L2OA 3ZQ7A 4EJUA 2LLKA 1AY4A 2VGWA 2W7DA 2VQGA 3BWOA 4RGSA 4ZYAA 5DV5A 4HEA2 1Y8RB 3K4CA 1P4XA 2RNJA 3EETA 2AY1A 1ETWA 2MH9A 4UHOA 1MDMB 2YCTA 2K27A 1ETKA 2HNHA 5FKLA 1PMMA 1B8IB 4EJOA 4PUSA 4G9YA 1RIOH 4RKDA 5DCMA 3I64A 2PMZA 3DBHB 2H8RA 4HQMA 3RCOA 3M07A 3MMYB 2VOPA 1FBQA 5LH9A 1K4TA 1U08A 2HZDA 5E1ZB 1AY5A 2HQNA 2AXLA 2VKVA 4XK1A 3HSRA 1HSJA 4S05A 1MBJA 3TP3A 1A04A 1X3UA 3QYEA 3ZMZA 2CUZA 5K1YA 1IDYA 4XRSA 3CCMI 4G7HF 2R5CB 4Y0IA 3WKRA 4DJAA 4FTHA 4KNYA 2HP1A 2ZXJA 4Y17A 2LREA 2M3AA 2RQQA 2A69F 1OHVA 3F0CA 3NRVA 2YRIA 2O7CA 4N4OB 4XLNF 2KZGA 3JTGA 3MCZA 3WTZA 2Y30A 2DTRA 1ZC9A 5E3LA 1BT4A 1W7PD 5G0AA 2KT0A 1R00A 4WYGA 4KN7X 2BHXA 2CMPA 4A93J 2FNPA 2F5DA 1QISA 2JPBA 1TOKA 2JJEA 4D5FA 2CH1A 1V55H 4M9ZA 3PD6B 3QU6A 2MA3A 2VASA 1TW3A 1U8BA 1Q1VA 1VJOA 2F5FA 2VMUA 2CSOA 3ELEA 3G1LA 3P5JA 2L54A 2KRCA 2FNUA 1D8JA 2EH6A 3HOSA 3FMSA 3PFYA 5FFXA 4AYBN 2UZKA 3N5MA 3WGBA 3QODA 4F93B 2X4HA 2PLYA 2EZLA 2GLOA 1WJAA 4UB6C 3HUGB 1XPXA 2GMSA 4U2HA 1JHFA 3BG3A 3WTUC 2X0LA 4MFDA 1V2EA 3COGA 3DLAA 1NK2P 3GW2A 5L3FA 1BBYA 5D5VB 1MKMA 1F9NA 5IP6A 2LBFA 2VLHA 1ZGJA 1RR7A 4YG2F 4YIRX 2IS6A 1QIRA 4F55A 3ZP5A 2HFHA 4UV9A 3TQNA 3MAFB 1I1GA 1X58A 4BXFA 4ZZLA 4HNTA 1IRXA 5E4ZA 1P7JA 4A6DA 3H7FA 1R1VA 3FSLA 5J3LA 3A8UX 3C7JA 2VONA 1X3ZB 2XVCA 4DNCA 4KT6A 1LFBA 3V8LA 3MKLA 1BA5A 3PO3J 2DMUA 4PJ0C 4GSAA 3BTJA 2M9HA 3GTQJ 4BQ0A 1YS6A 4Y7NJ 3N05A 4X0GA 2VQLA 3P9KA 1U6GA 3AKZA 1C7NA 2W8JA 3OYGA 2KIUA 3ZN0A 3JREA 2NVXJ 2EIKH 1OPCA 4HX7A 2JA6J 2DGKA 5DD4A 2DPUA 4FISA 3C3WA 5DM7F 2HP2A 2QLRA 3V7CA 2VMPA 2XGCA 4IXSA 5D5UB 3LFUA 4M72A 2Q2EA 1VI0A 3QWLA 1W7LA 4PFPA 4FX4A 2XBNA 1OKRA 3O8GA 2K9QA 3SHFA 3HBXA 3RPQA 3SYTA 4EM1A 2VI9A 2DW4A 3QN6A 4A0YA 2M30A 5ICFA 2BIAA 4AWXB 4A3FJ 1WHUA 3NWTA 4Y0HA 1HLVA 3RQ1A 3FXKA 3BWNA 1IVRA 1Z7DA 2F48A 1FX7A 2RREA 4Y0DA 2Z9OA 4MSOA 2XV4S 5FLVA 3HOYJ 2V1PA 1J5YA 4Y13A 2M34A 5D5XB 1M6SA 5FFZA 4JEZA 4IX8A 1U5TA 4PJNA 3KYDB 2C44A 2JG2A 3QPHA 2MC3A 1S0AA 1LUJB 2WAQN 1GVJA 1CF7A 5F64A 1TNTA 5KCMA 1KL1A 2M7AA 1IX6A 4RAEA 1Z05A 3VK3A 1BN5A 2E2IJ 3W6KB 1I3QJ 2CUEA 2Z9XA 1MMGA 4NDLA 4GRXA 2EK5A 3CDIA 4E1OA 3ROUA 1Z6RA 4W1VA 3E6BA 2ZFWA 1PUFB 3FD0A 1P3WA 3AENA 3HGGA 2BYVE 4ASNA 3TKYA 3WGIA 5HLHA 3WTVC 4MO7A 1SFUA 3C2BA 4ZC3A 2D5VA 3S1MJ 2Z67A 2Y31A 4OC9A 3MKYB 5FT4A 4WYCA 2A68F 2L9VA 4BE1A 2BBYA 4LLNA 3BROA 4PJLA 2R7RA 1R71A 4AM3A 3TL4X 4YIIA 4WYDA 2XAUA 3R0JA 1YYVA 1FP2A 2FNAA 4F7ZA 2ISZA 1OFCX 3ML6A 2W7IA 1QVUA 1QZ9A 4L9NA 4BQNA 1ETXA 5EG0B 4ADCA 3CUQB 2STTA 4OYTA 3H1CA 2FUG2 1MAPA 4MQ9F 5B66C 4FHTA 1ZLKA 1AU7A 2O61A 3DEWA 2LNBA 5IOYA 1R9TJ 5JLWA 1VP4A 3LL7A 3C2GA 3AL0C 2UWMA 1IN5A 1JUPA 2LG4A 4IEJA 4O5VA 3MADA 2L7FP 3Q0WA 5F6FA 5LGUA 1ZGAA 2LK2A 3WGGA 3I58A 3MKZA 3HL2A 1KKPA 2CU7A 1ASDA 2TPLA 2R5ZB 4A3IJ 3JR9A 4M9SA 2XROA 2HKXA 3ACZA 3BS8A 2DXIA 4PVFA 4EATA 5DD8A 2K9NA 1MNMC 3U2RA 1FTZA 3OYEA 1IGNA 4ZH4F 4L0YB 4A3CJ 2A6EF 1WKMA 1BOBA 2JJGA 4BAYA 1JE8A 1SVOA 2W8WA 3E5QA 4WX9A 1C9CA 3HT4A 2UXXA 1D1AA 1IUYA 1N2TA 2EZ2A 4A0HA 4OAYA 3FMQA 3ZQCA 3CCLI 5M49A 2F5EA 4BA5A 1QZEA 2NS7A 3S2WA 1V2FA 3RPUA 3MKWB 1VQ8I 2XGXA 4XR6A 5F0HA 1M32A 3PIUA 4QLCU 2GQNA 3VAXA 3IUOA 3Q9VA 3PL8A 3ZN1A 3CCVI 3GXOA 3FQ7A 3LSKA 1S7AA 3U1KA 3K7AJ 1AWCA 1LQ1A 4B8XA 4HSTA 1RVYA 1LNWA 2V9KA 1WYVB 2OQRA 1X4PA 3DU4A 1ZG3A 3HSEA 1TLHB 4FASD 5L3BA 1N75A 1SD6A 5M5YJ 4FETA 2X1EA 2HOYA 5F9SA 5K5RA 2E1NA 1IAXA 3LSRA 4MQPA 2G7UA 4UVAA 5CVVA 1CZCA 3CJNA 2FQ3A 3QPLA 2FRHA 5B1BH 1WJ5A 2Z33A 3AELA 3J80K 1MNEA 1RZ4A 1IJIA 1ZHFA 1AHGA 2HDWA 4L18B 2EO5A 3NYTA 3IKTA 1E5EA 5FT6A 4EV0A 3WKSA 5A2QK 1UJ8A 2EIJH 2D7ZA 2CFOA 2XUBA 2Q1ZB 1W0TA 3E77A 3R0AA 1KONA 1D7VA 2AY8A 2R2NA 4LD5A 4LGWA 1ZREA 2M5WA 3K4MA 5DM6F 2GOXB 1FT9A 2BY0A 1BC8C 3EI7A 5DUKA 3M4OJ 3MD2A 2MC4A 4XKVA 3FF5A 3AG1H 1R23A 4XMYA 1VQMI 3KE3A 5J6XA 3H36A 3SZPA 2DKJA 3B46A 3DRDA 5LHAA 2KDOA 5F04A 4XONA 3C2HA 2W1OA 3FTBA 3E6MA 2BI2A 1BI2A 2VIBA 1AHYA 2BXYA 4GYIA 3VOEA 5IT9K 3F22A 2R7OA 4AIHA 1WYUA 4RAGA 3HVYA 2V1XA 1PVEA 4I09A 4F52A 1DGEA 3CQ4A 1JT0A 5CQGA 2H1LA 1KKJA 5CVIA 1RC9A 3L2UA 3FHNA 3QI6A 2VBWA 5TGTA 3PGYA 2LY1A 2FE3A 2HORA 1J75A 4I0AA 1SEUA 1WI3A 5AIPA 2RC4A 3FKIJ 4J19A 1YQAA 3ISPA 2Z1YA 3PD6A 1TT5B 3LA2A 2ZC0A 4P55A 3X2QH 3B02A 1ASEA 1YS7A 2R5YB 1A36A 2X85A 2CB1A 1I3AA 5J47A 1TZLA 2AY4A 2ZJ2A 1QGPA 3CDHA 3GTJJ 5ICCA 3SZGA 5M46A 3ZMSA 4AD9A 2KIQA 1GC2A 2ETHA 4BEHA 1E5FA 5BJ3A 3H3UA 4Y33A 3S2HJ 3RPUD 3JRDA 1FP1D 3QPGA 3FFRA 1RKTA 1HC8A 4ZJZA 2W25A 2VQHA 2QSHX 3HRUA 4U0YA 1SZKA 2QCOA 4C30A 3OS0A 3SEZA 4IVNA 2XB5A 1UHSA 1TPLA 4WWCA 4MEXF 1ELQA 3CLOA 1AIAA 4F5FA 4D0PA 2RQPA 4CSWA 3PO2J 1BW5A 2NAZA 4M3FA 2R5YA 1TOJA 4MFEA 3FBIB 3EI5A 3I59B 4LK0F 4P1WA 5BMZA 5M3FJ 2CG4A 3LMMA 2QYOA 2VN2A 1DPRA 3BZ6A 3OWTA 3OR2C 2JA8J 2BI5A 3AEJA 3M8JA 3WG7H 2D66A 4AIDA 4RA2A 4RMNA 1REPC 4EM0B 3WZFA 3FKJA 3LVJA 1S7OA 4BDYA 2D2WA 2COBA 4ANJA 1W0UA 3G1OA 3G6EI 2VLFA 5EEAA 2QQ9A 2CQNA 4EJVA 2E54A 4ZYEA 2Q0OA 4LW2A 4FE7A 2FN6A 5F27A 2DU9A 3E2ZA 2LF8A 2RFVA 1JGGA 2HOTA 5ILVA 1T08B 4KICA 1B6AA 2GXAA 2JSPA 4V2GA 2ZJQF 4HVKA 3CDLA 3FXMA 3WCOA 3R6SA 3AL0B 1YJNI 1RNLA 4CBRA 4E7JA 1R49A 4FFCA 3DZZA 4C3JJ 1AHFA 2AEVA 1YIZA 3AENB 1LS3A 3FKDA 2M0CA 3WE3A 2QKMB 1QA6A 4UUTA 4I7HA 3ZZJA 1B59A 2XB0X 3VEPA 3COAC 2Y9ZA 3QPTA 5HOOA 1AAMA 4A6UA 4UNOA 3B1CA 5FD5A 3E3VA 3JAMK 3EUCA 3LVKA 1FC3A 2DT7B 5FO5A 3EDPA 5B3SH 4ADDA 4KT5C 2CQQA 2IS1A 3CCEI 5GP9A 3FZVA 3PIPF 3B6AA 4ADBA 3SFIA 1YX5A 2M7BA 1O3RA 1V54H 4IL6C 3DXWA 2R7FA 3OYJA 1FLIA 2W7EA 3JRBA 3BLYA 3GLLA 2CJGA 2FQ6A 1J7KA 2VKDA 3L1PA 3VODA 2HS5A 5LHIA 1I27A 1LVAA 2GIZA 3TOBA 1WGXA 4RB2C 4ZTJA 4A00A 1ENHA 4KIBA 1AKCA 3L2WA 3DXVA 3VFZA 4UOYA 2HU9A 1OMIA 1J0RA 2BV6A 5M5XJ 3WGHA 4RM1A 2D61A 2DMPA 4YIFA 1CS1A 4EGYA 5GADJ 4E7HA 2Q2EB 1LJ9A 3KGXA 2VI6A 2W7LA 3H9GA 1OJLA 3NDNA 2DJIA 5D8LB 1ZTRA 1ASNA 3CBFA 4RS8A 3QQAA 4WK8F 1TQMA 1T33A 4P9FA 1GDTA 1VQ7I 3GZCA 2V6CA 2P5VA 5LRSA 3JRFA 2FBIA 1Z9CA 3RBFA 3TQXA 2A3SA 3FMRA 4NB5A 3S1RJ 4KMFA 1X1AA 1V4RA 2V4JC 3GFJA 5K5QA 1TOIA 4IO9F 1AHDP 2M4GA 2HZPA 4DOZA 3G71I 4HPQA 4XNFA 3IWFA 4XRFA 5ICGA 3ONQA 2HUUA 5BQTA 3AAFA 2BWNA 3LY1A 1MJBA 1WH7A 3HKZN 5ICEA 1SFOJ 3GZDA 1XS9A 4MHGA 3HLMA 2VGSA 4KJZA 3S17J 2AHQA 3CO7C 1VQKI 2FU4A 1HKTA 5JVGF 3OL4A 1FIPA 4XN0A 3L09A 4XSXF 1J59A 3F8BA 2UUZA 2VGZA 2AEUA 9AATA 5D95A 4XSZF 2E7JA 4GFBA 3OSFA 1YX3A 2PQ8A 2P5KA 3OIOA 1IX8A 3F6VA 3S3NA 1DU6A 1I1SA 2NVQJ 1GC4A 2O6GE 3KKIA 2JUGA 2LC2A 3RKXA 1J32A 1CQTA 2DDAA 2Z9WA 2VI8A 1DFOA 3G8MA 1MMNA 2CYYA 1E17A 1ON1A 3F72A 3HRSA 2E19A 4MQQA 2JQ7A 4R79A 1GXPA 4XKCA 4M3BA 4A3DJ 2VLAA 3G3ZA 3P7NA 4HNVA 3JRAA 4XK4A 2MW8A 2VUMJ 1F36A 1USTA 2LD5A 4FE4A 2P81A 2EPJA 4ZWVA 3S14J 1PUEE 4LNMA 2QENA 4HBLA 3NTJA 1KMJA 2HQRA 2NS8A 2HEOA 2IBDA 1PUFA 2RN7A 1R58A 3G1MA 2QVOA 1J2XA 1KQ9A 5FGMA 2E5ZA 2L9NA 3TMOA 2D7YA 3W2VA 1JXSA 4A0GA 3NQOA 4NOGA 4WXBA 4DYCA 1H9GA 2LY9A 1ZR4A 1S6LA 2GMUA 2PMZN 3RUYA 2H1KA 2JRTA 1IXCA 1GUUA 3OYMA 1CF7B 1G6NA 2ZXHA 3K0LA 2HVSA 4BQAA 1FWZA 3T0YA 4OMYA 1XGNA 2KP6A 2QMAA 1SFKA 2CFXA 2XSJC 4BH9A 2Z1ZA 3J7AY 3ABMH 1X29A 1YJZA 2ECBA 4RITA 5HS9A 1QNTA 1V3FA 3HEFA 4LMYA 3HKZA 4HLXA 5FKNA 1MJ9A 1AMAA 2BWOA 2X9DA 1VQNI 3TCMA 2CWEA 5GPAA 5IPAA 4A3EJ 1HDDC 3ZOBA 3CUOA 4ITVA 5E8IA 3GTOJ 2LKXA 2H27A 2HYJA 4OTLA 3USFA 4DBCA 4XLPF 5ED4A 3RI6A 3I3LA 5LHGA 4J5UA 3CAIA 4B44A 3DTEA 4XQFA 1DKAA 4H0EA 1LC7A 5HXXA 2D1HA 4XQ2A 4G6DA 2DR1A 2DA5A 3IC7A 2VBZA 3SZTA 4P96A 3TATA 1AJSB 3HYIA 4M2MA 3FIWA 2YKUA 4ITGA 3JWAA 3DPTA 1HW2A 2EH3A 3GUDA 1Z7LA 2FBHA 2JVHA 3JTXA 1IAYA 4ESFA 2VB6A 3ASAA 3MAUA 2TDXA 1KU3A 4UUSA 2CSTA 2LYCA 2W00A 3BQYA 3DKYA 3VP6A 3H3ZA 4RM2A 5CQEA 4Z6YA 3HSFA 5FD6A 1YO5C 2Y69H 3KP5A 3KEQA 2K9SA 3PJ0A 4MLOA 2K02A 4IRHA 4DQ2A 4XAUA 4F5HA 1UZCA 2DA6A 1WCMJ 3IRQA 1AJRA 4A6TA 4A0ZA 3GTGJ 2FJ1A 1M1EB 4LNLA 3E9KA 1WKGA 3HXLA 2VE8A 5C3EJ 1SMTA 3CCRI 1M0OA 2AATA 3FVXA 4BQOA 4Q48A 4BE0A 1IF1A 3DPUA 2CW0F 3S2DJ 1U78A 1SZSA 3GLXA 3NNKA 1X19A 5JLXA 3E2FA 2KL4A 4PCQA 3MN2A 2F4IA 4A2UA 2VJIA 1BW6A 4LB6B 2QB2A 1A5JA 1TC3C 2ZXWH 4GE4A 2X1CA 1W3UA 2X51A 1RESA 3OYFA 4JEVA 3KEYA 5CVJA 1BKGA 1WYVA 2BYLA 4FL0A 1RKWA 3E97A 3GFMA 3ZMVA 3OMYA 4JYKA 4CZCA 3BR0A 2H09A 2C7TA 4BJTA 2AS5F 2JA7J 1SZUA 4RB1A 1YI2I 3PM1A 4KAMA 2VMYA 5JVTA 1DP7P 4MY5A 2VMVA 1AICA 2WAFA 1BQAA 2EFQA 3CMAI 4JOMA 2PO3A 3A03A 4AVZA 1RV4A 5HS8A 1SPAA 1SD5A 3SJMA 3BB8A 2QGUA 1WRJA 5E18F 4BY1J 2VMQA 1S09A 2BVLA 4DZJA 2WB1N 2LMDA 2VC0A 3V7RA 3I4MJ 4ADEA 4E77A 2XGDA 3M8FA 3NUBA 4XBFA 3V42A 5GPCA 1DGDA 3J80Z 1O7LA 1Z77A 4IYOB 4DBRA 4WYAA 5LGNA 1OCPA 2W7FA 2DA2A 4Q31A 3LVLB 1YW7A 4Q5SF 3P9IA 4PJMA 4AIJA 3TBIA 5M4BA 2BI1A 4PFNA 2V9VA 3BP8A 4OMZA 5DJ9A 1F43A 4TV7A 2DOUA 3BOQA 2P0WA 3OIPA 1UELB 4KIGA 2QQAA 1TQPA 3L8AA 3T1BA 3RZDJ 2GQQA 4JK1X 2P4WA 3UR3C 5TRDA 2WAQA 1CL1A 2DK8A 2V79A 1U3EM 4ZDOA 1IUGA 1I41A 2FBKA 3S15J 5FRMA 3I5UA 2P8TA 3BJOA 3LSHA 1CZEA 4BJ5C 5BPDA 2YX4A 2L4MA 3A01A 1FSHA 1T8IA 3PQKA 3LSIA 2OATA 2EZIA 5H6RA 1MBHA 4B47A 1OYYA 3J81Z 2AY2A 4L5IA 4RAYA 1Z0XA 1MMAA 2IGMA 2EB7A 4MNUA 2BEOA 4O6JA 4CUGA 3I16A 4C2MJ 4Y52J 3DBRB 4G94A 1ZK8A 4IHVA 3JRCA 1JTXA 2PEXA 4M3DA 2CQXA 2V7FA 4CGZA 1BS0A 1MDOA 1TNSA 2OKJA 4F5MA 4PSWA 4ZYDA 2J5PA 3BDDA 2G0EA 3BR6A 4JEWA 4IQJA 2VT3A 3BQZA 1T0FA 2DOEA 2L9SA 4BUPA 1EH8A 5KVRA 4Q47A 2QA4I 4OIPF 1JS6A 4L9TA 2IXSA 3CC4I 2AQEA 3EIAA 4P3MA 4U1TA 2WA0A 3KE2A 2YPRA 1TT0A 2MH2A 4I01A 2BI3A 1LVKA 5CLSA 1XGSA 3PIOF 3IHJA 1QHGA 1KYWA 3HHGA 4BU2A 3VWBA 4F3QA 1OLTA 3JCUC 2DKBA 3D5SC 1FJLA 2L9RA 3J7YJ 1N8PA 2L0KA 2Z3YA 1KGSA 2LP0A 3LG0A 3S1NJ 3GVAA 5F8VA 2V1DA 3WU1B 4B1RA 3FCRA 4A3KJ 3K4LA 3BC8A 3OS2A 4DYQA 3FXJA 4W8IA 2PB2A 4IHWA 1GT0C 4BHDA 4AZKA 5AONA 3QRFF 4A6EA 1GV5A 4E6KG 3DBLB 1PJRA 2V1UA 1O61A 3PA9A 2YR2A 1HF0A 3GSBA 1GC3A 5IYBJ 2EV6A 2IW5A 4RJ0A 3BPXA 4CBSA 2OGAA 3HDOA 4HF0A 4EB5A 1VNDA 2DODA 5KK1A 1Y0UA 4UY8I 2OUMA 1G3YA 3PJRA 2R93J 2W7GA 3V8KA 1BJAA 1S7EA 3Q0VA 3ZMDA 2VODA 4FCYA 5HNHA 2B9SA 5K7FA 2Z5UA 3BTLA 2XRLA 3SDGA 1ZELA 2K9LA 1TOGA 3AEOA 4OBVA 3JTHA 2DO7A 2NMPA 3ESWB 1KL2A 1UU2A 4U87A 3VPRA 1E3OC 2DA3A 2ADUA 1I50J 3LFKA 3IHUA 4XJLA 3M7GA 2KIFA 4EEFG 4HV6A 1T95A 3F9KA 3FISA 5EF6A 1B4AA 3MEXA 1MSFC 5B1AH 2CV2A 4AOAA 4OINF 4A0RA 4M9XA 2L7ZA 2MABA 1OCCH 1TWCJ 3Q0UA 4ZZDA 1XDUA 2C6YA 4NBQA 4B48A 2R7QA 4BS9A 1C0NA 3IH3A 4BACA 1L0OC 4L9JA 5EAAA 1NHAA 4BHPA 3BTCA 2X1DA 5J1YA 1K78B 3KEOA 1BOAA 2M4KA 3I5TA 3FBNB 2VJJA 1TW2A 3Q5FA 3L2CA 2JA5J 2GZWA 3K4JA 5CPRB 1ASLA 4KXKA 1FOWA 2ELKA 2YKXA 2OA4A 2XH1A 3KCCA 3H35A 1ITYA 2JUCA 3M5UA 2FF4A 2EGYA 1EJ9A 2K7LA 3M9AA 1KU7A 3CCJI 1RI7A 4XN3A 3MFKA 4M2KA 2HPIA 2ZCWA 4CCOA 2MG4A 3BG9A 1Y6IA 2WB1A 2FXAA 1QO0D 1K61A 3DV8A 2R92J 1UMQA 3KP4A 1B4XA 3GBXA 2WY7Q 2XF7A 4LK1F 4P5OA 2GIVA 3O8HA 1MLZA 2C81A 2ZUKA 4NC8A 5F08A 5D6FA 4A3GJ 1AOYA 4NHJA 2F8JA 1BJ4A 3CCSI 3REOA 1DGWY 2HUIA 2DT6A 3HM5A 1IX7A 2P7VB 3S3OA 1YITI 3WTYC 4ZAHA 1W4MA 3ZRGA 3MBBA 3RQ4A 4Q76A 1X1DA 3ECHA 1G4VA 1D1CA 4QPOA 3CF2A 3FK7A 3FQ8A 1GV2A 1X1BA 4IXOA 2K86A 3ABKH 2W7JA 2ELHA 3BCXA 1HA8A 1JUMA 1I6XA 5D6EA 5GAHJ 2JISA 2YCPA 3ZXSA 2FOKA 4WLHA 1J09A 1JJ6C 5G4JA 2QQBA 1LE8B 3GZ6A 1YW8A 1XB4A 1O62A 5FRNA 2ESHA 3HUGA 1ARIA 2KISA 4RB0A 2QQ8A 5F1RA 4ESJA 1OR7A 1R1TA 2KJCA 1C7OA 1LPQA 1ASAA 2L7KA 4CH7A 5EEGA 3N4MA 4F5JA 4YFNF 3AG3H 2DYRH 3WHBA 4ZYHA 3KX2A 2XSDC 3TO7A 2EA2A 2DA7A 2WK9A 1FC4A 4G8XA 2ZMEB 1AHXA 2LR8A 5EUNA 4CYCB 3GMEA 4HLYA 2OCCH 3MAJA 2D45A 1XC5A 4RB3C 3MEBA 3PSIA 1LEBA 2XPWA 3L2QA 2GA1A 2DAOA 3ZGKA 1D7UA 3CQ5A 1XSXA 4KIFA 5C6UA 2VBYA 1VQOI 4U7DA 2MSYA 5JHFA 1HCRA 3CCYA 1TWAJ 3DQVC 3GZDC 2IS2A 1XG1A 1FOXA 4ITXA 4RJYA 2GWRA 2HWVA 2ZMEA 4M6VA 2H94A 4MQVA 3G73A 2EZHA 2L02A 2P7CB 3EUAA 1SANA 2KJBA 4XLHA 1ZARA 5B5EC 3HIFA 4CYDA 1BR4A 3HTUA 2K85A 3RKYA 1ONVA 1GEXA 2O5RA 4AIKA 1I5ZA 1X0MA 4A0FA 2OGEA 2F5CA 3BZKA 3K4NA 2ZJGA 2V0YA 3PAAA 5F0CA 3FDYA 4IZZA 1TTYA 1G2HA 4WP0A 1MIJA 3HOVJ 2M8EA 2QM3A 4PSXA 2HOSA 3S32A 2D1VA 2NYXA 3FQAA 1WVRA 1BR1A 1W5TA 4Z2YA 3UE8A 2P6TA 4RAFA 1AA7A 4XLAA 5EJCA 3QGUA 3B8XA 3DXJF 3ABLH 4DZPA 2W82A 4PGGA 1OCRH 3EYYA 3IAM2 3P1TA 3F23A 4MQRA 1FOYA 2ECCA 2EIMH 3H9QA 3LQQA 1SVLA 4U0WA 4L0OA 1R1UA 3A01B 5E79C 3CMEI 4IHSA 3AFHA 3IH2A 3HOZJ 4KA4A 3B73A 2YU9J 3LA3A 4WD2A 2VXZA 2OQXA 1IXSB 4CYCA 2EILH 3FVUA 2VMNA 3E5XA 4CCLA 1D0YA 2EFNA 5TISC 1W7NA 3VYUB 3BG6A 4EU1A 2PJRB 4BA4A 3W3CA 3BR3A 3OOPA 3RIRA 1W5SA 3MWMA 2WK8A 1W7PB 2HQAA 5K5OA 3OOUA 4QIWN 4LJZF 4PJJA 1MMSA 3NU8A 1AKHA 1IRFA 3JWBA 3H5AA 2NOGA 4M6YA 3SDBA 1ZQ3P 5DJ1A 4JX4A 3KP7A 4BYYA 4ENMA 2HOZA 3ZRPA 5IYCJ 2MLKA 2A61A 2ZNZA 2OV7A 1TOEA 2K40A 1U9NA 2LFBA 2ZMEC 4LC3A 2XASA 3CMYA 4LITA 4L5JA 2CGPA 5FKOA 4FQGA 3ZMUA 1O69A 5D5SA 1NTCA 1DJUA 1XI9A 1VZ0A 3K1MA 1OATA 1SFFA 3SXYA 4TMRA 3CCQI 3WTWC 3RYRA 2GSAA 3BT9A 2O0YA 2R7DA 1H0CA 1MDXA 1QBJA 2X6XA 5M3MJ 2CTZA 3EI9A 3QYFA 4AZJA 4BBRJ 1OQYA 1CQ8A 4MKJA 3W6VA 3F8CA 3IF2A 3HOWJ 1GEYA 1OYIA 1U8RA 2VPLA 4HX8A 2PX9A 2AY3A 2W8VA 4CVQA 2Q7WA 3EYIA 4W1WA 1FOKA 1G3WA 1QPIA 1X1PA 2DQRA 4G6QA 3WU2C 1A35A 5K8BA 3A0HC 4HF8A 2AO9A 2OPTA 5HVQC 4U7BA 1CGPA 2I5UA 3GCMA 3FRKA 3I4PA 4M3GA 5CVRA 1B72B 1R4MB 2Z1DA 3LAJA 1T39A 1AMRA 3PPLA 1Y8QB 4A6RA 5DDGA 1SF2A 2GOMA 1JJ8C 3HPHA 4WF2A 4KYWA 1BIBA 3DCFA 2EFWA 2JVGA 3FM5A 4UXNA 1H88C 4N0WA 2YRRA 4AUXA 1GEWA 3ZQHA 3QPSA 3DTIA 3P6KA 2Y75A 4C3HJ 5KNLA 3J7ZI 1T3IA 5DTDA 2QBYA 4K2MA 1EH6A 5DX5A 2DOAA 4BXXJ 2RDPA 5BS6A 5HDNA 4GDFA 2OTJI 2QBTA 3AEMC 4LG3A 2XKPA 2R5CA 2UV1A 1YLFA 1IN7A 4JEYA 3I53A 2LSOA 2R7ZJ 1BJOB 4JQFA 3MQ0A 1LDJA 1D7SA 2C0RA 2DA4A 2LH9A 1ETVA 3I0TA 3K28A 2XC7A 2ZO4A 3R61A 2QEXI 3AOVA 3O3KA 3ZQQA 4PK4A 2IA2A 4LOCA 1ODDA 4E7IA 3DYDA 5HDGA 4BNCA 1YRNA 4IHXA 4PDKA 2XAFA 5J4VA 4XM3A 4N0BA 3IL2A 2PJRA 2OC6A 1QQIA 5EGOA 1B5PA 1ETOA 3VYRB 3GO5A 1OR7C 2NXNB 3FXUA 4UVBA 3GFIA 1UU1A 2IGOA 1MMDA 2CANA 5EDNA 3IWZA 3BPVA 3O6BB 1ZGWA 4UHNA 5E3MA 4HDVA 2E35A 4JP0A 1FMVA 4RLQA 1K6YA 2CO5A 2JJ7A 1P4WA 2VMOA 4NC7A 2A6TA 4M73A 4NQWA 3ATHA 2E1OA 4D5CA 4ZM3A 1HKSA 3F0HA 1MBEA 2HYFA 3L9FA 4L9VA 3OYIA 1QZZA 5F0FA 1R5ID 5E8GA 4BJ6C 5LEJA 2H8WA 5HHYA 2HR3A 4UVCA 2BY1A 1IBJA 3Q8NA 1BI0A 1IUFA 5EFSA 5HDMA 3MVPA 4M3EA 2BI9A 3HRTA 1U5TC 4ENJA 3GBGA 3HOUJ 2D5YA 4O3MA 4XRSG 2L3DA 2R7SA 3FXQA 1MNDA 3TGNA 1QHHD 4PFFA 2DGMA 1DP3A 1XCVA 1ARTA 3PNVA 4WXGA 4W91A 5E5IA 1LE8A 3JRHA 3DEUA 4RLFA 1SAXA 1UB9A 1XX5A 2PBIA 1OYWA 2YU3A 3EUHC 3K4KA 2O8KA 1BJOA 3HTSB 1JKRC 4C2TA 1TATA 3RSNA 1BL0A 4HX4A 3HOXJ 1M0NA 1UHWA 4HF2A 1QGNA 2YCNA 2K3PA 4OBUA 2QBYB 3D0SA 1H8AC 2RVCA 1KU2A 4U0VA 2YKVA 1T0FC 1WJDA 1USSA 2Y0MA 2B0LA 3FVSA 1FZPB 3IH4A 1Z67A 3H5RA 4R8HA 4AU7A 1JTYA 9ANTA 3VYSB 2VE9A 5FLXK 3TDUC 4QTRA 2RKHA 2YX7A 3FXOA 5FKKA 2HXOA 1LKCA 1N77A 1VF9A 1DDNA 3S16J 3NYUA 2FD5A 2K4BA 2X5FA 2V6EA 5J4YA 4Y15A 2AXTC 3BJ6A 5JHUA 2B63J 4KITB 1ULYA 3CQZJ 1FG3A 3L44A 2TCTA 3M1CA 2DLLA 1EF4A 5AX8A 3KP2A 1YJYA 4A72A 3QAHA 3TDZC 2H6BA 4OWRB 4ZASA 3ABTA 5HLTA 2AY9A 3E6CC 3B1DA 1NH3A 1ZLJA 3OYCA 1JT6A 2AY7A 4ISYA 1K79A 3HDDA 3GTPJ 2VYCA 4CHUA 3IV5A 1B9HA 3BG5A 1XMKA 2QKLB 4XJOA 4BDZA 4I98B 2VMZA 1ASFA 3E0JB 2R5EA 3W1IA 4HSRA 3V4GA 4WXFA 2B7EA 4C3IJ 1Y39A 1ZYRF 5L3GA 2P5LC 1QU3A 3RTRA 2O3FA 4U88A 3CCUI 1H89C 4ZSWA 2ELJA 1ASBA 1V5EA 2AY6A 4YRVA 1YIOA 4WB0B 2HXIA 3DKXA 4BXUA 3AEPA 3E7LA 2VGVA 1H1CA 2BE5F 1SVMA 2V9PA 1DU0A 4MIMA 1O3QA 3BV0A 4OIRF 2MLGA 2OF7A 3WE2A 1PDNC 1AAWA 1VEFA 2R7XA 5ILSA 2ZXIA 1SD7A 1RRJA 4B9BA 1T98A 4B98A 2YSRA 4F5GA 4WBTA 1OCTC 2A5YB 2WV0A 1XGMA 2JPCA 2PI0A 4LG0A 1G4XA 4XORA 3E1SA 2JK3A 4LB5A 2EPFA 5KAIC 4KDPA 3A1YA 3KZYA 1IN8A 2NVYJ 4RDUA 1G4DA 2GAUA 2VOOA 3JRGA 2LF7A 4A5MA 1JKOC 3FHZA 1D5YA 5KHDA 1ZR2A 1FBUA 3RYPA 3RCHB 3UWCA 1ETQA 1QJ5A 2QA3A 5I92A 2PB0A 1XTAA 2A05A 3OYKA 2W24A 3V8JA 4EGZA 3OS1A 2VQCA 1WKHA 2ZSLA 3PDBA 3AOWA 3G2BA 5FT8A 1R7JA 4XIDA 3JZLA 4PZJA 2DK5A 4JX5A 3R60A 1HQCA 3OP7A 1EH7A
chains in the Genus database with same