4MGSA

Bixyn10a cbm1 apo
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
DKVDYEIDYSTAGYSFWNEVNEEVKETTTIGKNDTEGCLEIKTSVAASQNHFIQYHTADNLPIEIGKEYKLKMMVRGSAEGKLNFGVGPWSGRAEGSFSFNTEWKEYEFSFKAVADGGHVMTQSGLFVGTIQIKYVKITHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Xylan utilization in human gut commensal bacteria is orchestrated by unique modular organization of polysaccharide-degrading enzymes.
pubmed doi rcsb
source organism Bacteroides intestinalis
molecule tags Hydrolase
molecule keywords Putative glycosyl hydrolase family 10
total genus 34
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2013-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4mgsA00
4W8JA 2WN3A 3FHQA 1T2XA 1UXZA 1DP0A 3OEAA 4W4ZA 3I2HA 2XQXA 1D7PM 3UESA 4XZUG 3T0DA 1CZSA 3GGLA 1CX1A 4CU7A 4ARXA 1NX9A 1GQPA 3WF1A 3CDZB 1JZ2A 4RN5A 3VDAA 2E26A 3DYMA 4BJ0A 2WO3A 5G04L 3I3DA 4TXWA 5JMOA 1UZ0A 1W9TA 3C7FA 1JZ5A 3A21A 3A22A 1K42A 3T2PA 3UNPA 1PX3A 3WNLA 2YB7A 3JXSA 4XUQA 1SDDB 3SKVA 4D0QA 4XVHA 1H6YA 1UY3A 3LPGA 4FI9A 2WZEA 2Y6KA 4BDVB 3MUY1 2EIBA 2QBXA 1NUKA 5HXMA 1JZ8A 1GOHA 4KMQA 4BXSV 4QDSA 1XNTA 2JD9A 3THDA 2VMCA 3MO4A 5DQ0A 5JR2A 1PMJX 2VZUA 2VQTA 3PUIA 1HN1A 1UY1A 1CIYA 4BK4A 2VMDA 2VZ1A 4DUWA 5IYYA 1F4HA 4OUEA 4UI9L 5CYYA 3MBWA 2XOMA 2LS6A 3T2OA 4CU8A 3OB8A 3OGSA 2VCBA 3NNGA 1W8OA 4CU6A 3NJXA 3T09A 3OG2A 3VDBA 3NRUA 3VD4A 1JI6A 1GOGA 3WQBA 3WNPA 3OGVA 2VO5A 3WF4A 2ZEXA 1XPWA 1BHGA 3K77A 2W87A 3OEBA 3J7HA 2QQLA 3IIIA 3LE0A 4P08A 5IFTA 2BGPA 4GWIA 2EICA 5JXJA 3WF0A 3HNMA 1UYYA 3FHAA 2Y64A 2QQMA 3SEEA 2J1SA 1PMHX 2ZEYA 2PQSA 4A3ZA 1XC6A 3VDCA 2V4VA 5C71A 1DYOA 4ARYA 2J1AA 2ZEZA 4QX2A 4KI5M 5EJ1B 2VC9A 4YPJA 3WNOA 1US3A 2ID4A 2QQJA 3HJRA 3LEKA 1CZVA 3I3EA 3MV01 4DUXA 3BN6A 4QDQA 5JUVA 2W1UA 1JHJA 1KEXA 3CQOA 1IQDC 1JYVA 5IFPA 5LA0A 2JKXA 1ULPA 3I2GA 4CVUA 4DEVA 3C7HA 3T0AA 2HLEA 4A41A 4QX0A 2Y8KA 3T08A 3ACGA 3GXUA 4CU9A 5C7GA 1GMMA 1WKYA 3NJVA 2VZQA 2VCAA 3VD9A 2W1WA 3NQHA 4DXTA 3I97A 3FN9A 2W46A 2VQUA 2R7EB 3SKJE 4RYDA 1YQ2A 2J7MA 4DXSA 3HOBA 2WBKA 5F7UA 4UOJA 3ECQA 1R64A 5J1XA 2J22A 2W1QA 2VR4A 2VZSA 3ZM8A 4XUTA 2BERA 2J1EA 4IUGA 2E32A 4XUPA 1OT5A 5EJZB 2W95A 3I2IA 2X10A 1J84A 4MO3M 2V72A 2VMFA 4GWJA 4OZOA 3EYPA 1W9SA 3WF3A 1NAEA 4CUAA 2B9VA 2QQKA 1UMHA 3CZJA 1SHWB 3EB7A 5LA1A 3K75B 1JYWA 1KGYA 1L7QA 2ORZA 4GZ9A 1WCQA 5B4XA 4W50A 5EIYB 2L9LA 1W0NA 5CZKA 3CZUA 3P1IA 2EIDA 4OMCA 1EUUA 5I0DA 5LCWL 4MOAA 3OGRA 3HPNA 3WF2A 3VD5A 2ZXQA 4BK5A 3ABZA 3A23A 1UYXA 2E33A 3LQCA 5IJRA 1SG3A 4QAWA 4A4AA 2W92A 4DUVA 4A42A 3C8XA 3HEIA 3A7QA 1JYNA 1OD3A 2Z4FA 2WYSA 1GUIA 3UETA 1K3IA 3HNYM 4MGSA 3D3AA 3GDBA 1OF3A 2QQOA 1O8SA 2DCJA 2J1RA 4A6OA 4DXRA 2J1TA 5JXGA 2W1SA 4ZZ8A 2JDAA 1O8PA 4QB2A 5LA2A 1J83A 2WDBA 2V5DA 2CDOA 2LW8A 2Y6LA 2BBAA 1W9WA 1UYZA 2Y6GA 3CMGA 2VOTA 1UWWA 3VD3A 1JZ6A 2XONA 1H6XA 5FUIA 5A1AA 3DYPA 3IB3A 3K4ZA 3LEGA 3E1F1 2VZVA 2BZDA 4LKSA 3MUZ1 2W9XA 5HPOA 1L7RA 2DDUA 4ZXEA 2VZ3A 1UMIA 2YFUA 2XHNA 4P02B 4A45A 4DEQA 2C4XA 4QX1A 2W3JA 2B4KA 2WABA 2RVAA 3C7EA 5G05L 1GNYA 2WZ8A 3ETPA 1EUTA 1UX7A 4LPLA 4QDRA 1ULOA 4M4PA 1DLCA 2VM9A 3FL7A 3LEIA 3MV11 2VL4A 4XURA 4QX3A 1TVGA 2WN2A 3I2JA 3P6BA 4P00B 3W5MA 3ACIA 3I3BA 1UXXX 2W47A 4JKLA 3T2QA 3T0BA 2QQIA 2VZPA 3WEZA 2Y6JA 1O59A 2RJ2A 4JKMA 4UAPA 2HYXA 1JU3A 2C26A 3C7GA 4QB6A 4XUOA 3SEPA 4D8MA 1PX4A 4HG6B 1US2A 3WNNA 4OYUA 5JXHA 1OH4A 1UY2A 2VZOA 4AG4A 4JHZA 4PF1A 2C9KA 3BGAA 4M4RA 2VCCA 2VZTA 1JU4A 2X09A 3ACHA 4JKKA 1CZTA 2VZRA 2J1VA 2E31A 4ZY9A 2RV9A 4Z2AA 2W94A 3AC0A 4AAXA 1W99A 4CUBA 3F2ZA 1K12A 4P5YA 5DPNA 2OKXA 1MPXA 2J1UA 2YFZA 3ACFA 1NKGA 3GM8A 3IDAA 2YC2A 2JE8A 2WAOA 1JZ3A 2BGOA 1UY0A 2VTFA 3VD7A 1P8JA 3HN3A 1W8NA 1OF4A 4LQRA 3LPFA 1JZ7A 2YG0A 1I5PA 1RYYA 3CIHA 2KD7A 3IAPA 2X05A 3C7OA 4ET7A 3OBAA 5DN2A 3THCA 4CUCA 4L0PA 4PQQA 2W5FA 4KWUA 5B4NA 2ZEWA 1F4AA 4PT6A 3K4DA 4QB1A 3U37A 3HNBM 2ORXA 2WQ8A 3K4AA 3WNKA 2DCKA 3WNMA 2VJXA 2WO1A 5JXIA 2W91A 4TTGA 2Y6HA 2WAAA 4QPWA 4A44A 4E8DA 3W5NA 3DYOA 2YC4A 3WSOA 4LHSA 1LNSA 1XNAA 5IHRA 1TG7A 5DMYA 1GU3A 3I2KA 2EIEA 1UY4A 2VMEA 3IAQA 4MADA 3K46A 2WUHA 2QQNA 3PUHA 1K45A 4JX0A 1GOFA 1JYXA 2CDPA 3DECA 4OMDA 4E8CA 4XUNA 1JZ4A 4MGQA 4ZZ5A 3CKHA 3I2FA 2WO2A 5C70A
chains in the Genus database with same CATH superfamily
1HIXA 3IPVA 1GBGA 1LGBA 4Q2FA 1VMFA 5JIUA 3OEAA 2JENA 1V6OA 4AZZA 2ZPXA 1BZWA 2XL7A 1MS1A 5HV4A 2VNVA 2JDNA 4JRLA 5FLJA 3HD8B 2A6VA 3RS6A 3AX4A 3M8LA 5I0RA 4YVSC 3UGHA 2EIGA 1KRIA 2GC3A 2Z5WA 4URTA 4OHYA 1BLZA 4HONA 1QJX1 2WFF1 2UY9A 1D4M2 2CGNA 4KBZA 3ZYFA 1PGW2 1AR71 5CFDC 3ME2A 5F2WA 1NX9A 1ND3B 4LLOA 1AR61 1DQ1A 3N9PA 1XNKA 4QQPA 5EYYA 2VMIA 2E26A 4YGDA 3ZX7A 1N1VA 2D43A 2RR12 2YGMA 3WVJA 5LB6A 3I3DA 2VE1A 5FK8A 5A32A 5J48A 3VDDA 3MICA 2JB8A 1QXPA 4LXLA 3ZPYA 2Z2SB 3O12A 1AZDA 2XBO2 2YC0A 3J8F2 3A22A 5DAWA 1LECA 2I07B 1YFUA 5L36A 1LCLA 3AYDA 4H14A 1AXZA 4M3CF 2AYHA 2DUQA 5FUNA 1BJQA 1SDDB 1XE7A 1C1FA 1RVF3 4IEZA 1B35A 2FDIA 1OLMA 5FPBA 1XE0A 2VULA 2ZGSA 3D8CA 2C24A 1PIV1 4AEDC 1QH7A 1DZTA 3MI8A 4XVHA 4CCNA 1O6UA 5FO9B 1AR92 1IQAA 2HWD1 4MHRA 4IEVA 4EWAA 2Y6KA 5C3RA 3ORJA 4QM9A 1CAUB 4ZU4A 1D2QA 1ZZ7A 1RXFA 4QMAA 2GSYA 4P14A 1BKZA 5CFCA 5A70A 1H2NA 5A7SA 1GOHA 4KMQA 4PIXA 4QGLA 3ZPOA 5H9SA 1XNTA 5J36A 5JZGA 3S57A 5JOXA 3O1VA 1OLME 2WFF3 4FPYA 1V6LA 1PMJX 2G9FA 3NJZA 2DVAA 1QQP2 4XFFA 5SV5A 4BE3A 1DQ2A 4NHXA 3UV9A 4HPKB 1TME2 1QJFA 1PGL1 3PUIA 1HV1A 1G9DA 4IQPA 5A33B 5JCTA 5FZIA 2VMDA 1WUVA 2Z79A 2VZ1A 4F83A 1F4HA 4OUEA 4UI9L 5CYYA 4AK3A 3MBWA 2XOMA 4CRQA 4CU8A 3T2OA 3RZMA 5JOWA 3H8XA 3OGSA 3EMRA 1BEV3 1RJ8A 1DHKB 2Y34A 1W8OA 4Q4W3 5A7PA 1PGW1 5J3UA 4LORA 3NJXA 3T30A 3T09A 3CNAA 2ZCWA 1RMU2 2ENRA 1OVSA 2D6LX 4BCUA 4EROA 3BTZA 1QKQA 2XJVA 3VBOB 1YQ6A 1Q8OA 3U10A 4QU2A 1VBB3 1RUC3 2Q8CA 1XPWA 2D3PA 5E16A 3AP9A 5A7NA 3B00A 4E27A 3I54A 2CTVA 4HN0A 2B39A 3OEBA 4CSWA 4CP0A 2LALA 4ATEA 2FCVA 3KQ4B 3WV6A 3E6CC 2ES3A 2VW0A 4AHXA 3LE0A 4P08A 4TYSA 2BGPA 2H6CA 4NAOA 2JDUA 3KWVA 3HNMA 1O4TA 1H8TA 3INAA 2BU9A 1ZM1A 2A3XA 2WS92 3H3ZA 2GMEA 2W52A 4CEYA 1VBD3 4CDUC 3MIGA 2V4VA 5FREA 5C71A 2ZMLA 4FVVA 4MXWB 3TWIA 5JPMB 4KI5M 1WMDA 2JEMA 2XPJA 2XGXA 3J4UH 1EAH3 4MSVA 4LBQB 1W6QA 3N7LA 4LTAA 1US3A 2BV4A 3HJRA 3QLQA 3V0AB 3EO6A 5D8AC 1TME3 2D6NA 3GJAA 1GYKA 4UW3A 3HIFA 4DUXA 4ES8A 4XETA 1PMIA 2DV9A 1V9U1 5F37A 1KFXL 3DPRA 1IS4A 3ZIXA 1NCRA 1MS9A 2ZHLA 4E2GA 2FDKA 3ZDVA 4QXHA 3T0AA 3FHIB 3LWCA 4OHXA 1K5MB 3IDEA 4LE3A 2ZX0A 4Q4Y3 3T08A 3GXUA 5C7GA 1GMMA 2E7QA 4E4HA 1W9FA 2VNRA 5FZOB 4XIOA 4Q0UA 1GZ9A 4RR3B 3RWNA 4YM2A 1POV1 4Q29A 4DXTA 5DUXA 5FKCA 2WT2A 3H8UA 2XJPA 4GKYA 1AX0A 4I0WB 4R9BA 4Q8KA 1CAXB 4KGQA 3SKJE 3VZNA 2IVJA 1YQ2A 2J7MA 2IZWA 3PUSA 5FP8A 3RMYA 2WBKA 4KQ7A 3DN7A 3NNMA 3M4FA 1N1SA 1WLCA 4QGMA 5DAQA 1Y43B 4L9BA 1NQJA 5DZGA 1EAH1 4YW2A 3OD4A 5CISA 5J1XA 4IXLA 3T2TA 1R091 2J22A 2W1QA 5TSWA 3TEWA 1WD4A 3N9QA 2E32A 4P9LA 5FZ4A 3ZFGC 1CAVA 1VMHA 3GF6A 3PJYA 4QKDA 4UFLA 1ZBA1 1UAIA 1RC6A 3OUJA 2D40A 2IVIB 5LY1A 3VZJA 1WLWA 4EYUA 3ZMNA 5A6XA 4FFIA 3AZZA 3ZSEA 4E4SA 1HXS3 5KC6A 4D6QA 1RUE3 1WW5A 4WVMA 2VOWA 4Y5TA 2H6BA 3K75B 1NCQA 2C0ZA 1PO12 2HKXA 1LESA 1KGYA 1DLLA 1L7QA 3OBTA 1RUC2 5I8SA 3W21A 2O14A 3KV5A 4QHOA 4UFMA 2XMLA 2ZACA 3K51A 4W50A 1HRI1 1CJPA 4FPCA 2VXJA 4XF4A 5EIYB 1W0NA 1PZ9A 3VKMA 3D6EA 3WG1A 2Y0IA 3CZUA 2Y6FA 2VOXA 3P1IA 3AP6A 1CPMA 4NIIA 5L7OB 1U5ZA 4OMCA 1ODMA 2ZAHA 5FYCA 5BNPB 1HQLA 1RUD1 3KMHA 1YI7A 2K9ZA 4PI2A 1ZA7A 4EZ4A 3VD5A 3N9MA 1LU2A 1HW5A 4XJ8A 4BK5A 3MLLA 2DFCA 1UD1A 3LSDA 5C3QA 1SG3A 1PIV3 2R073 3FZ3A 4QX5A 3ZKYA 3VBUB 2D6MA 3B02A 3ZVXA 5KWRA 2VU9A 1KITA 4NIAA 2A3YA 2VBPA 1AX1A 4I02A 2BVVA 4HN1A 5EXOA 3U0ZA 3CJIA 3NV1A 4KGGA 1WA4A 1V6IA 1VBE2 1H2KA 2DURA 3N9OA 1JYNA 1OD3A 5FP4A 1ZBE1 3AZXA 3MF9A 4IE0A 2GAUA 4J25A 4C1WA 3I4IA 4WVWA 1H4GA 2JG8B 3USSA 2BWAA 3GDBA 5JOZA 1ASJ3 1OF3A 3M3EA 4LE4A 4JRAA 1Y4WA 2JECA 4YW3A 4AWDA 1UKGA 4QXKA 1MS5A 4BMBA 1W2TA 4A6OA 4Q4Y1 5IVFA 5FOJB 4ZS3A 1MS4A 3VZKA 5LK7B 2JDAA 5K0UC 2VOVA 3EXUA 2Y38A 2OUJA 5F8PA 4PCRA 5ISLA 4QXCA 3PDQA 2UWBA 1PVC3 3GZUC 1ZRFA 3ILNA 1MQTA 2IXHA 3H3LA 4YGEA 2AC1A 3WXPA 1SLBA 2DCTA 2HBUA 1FATA 1UWWA 1OA3A 4AFCA 4Q5OA 5ACA2 5HCAA 5KHGA 2G9GA 4XF0A 1OPMA 5LK5A 4AFMA 3J26N 4AVCA 2A71A 5A1AA 3AFKA 2VTXJ 4SLIA 1ZVFA 1NLSA 2BZDA 3IT8A 1RUG1 4WM8B 5I0SA 4BQ2A 1UN1A 1QEXA 3HT2A 4UW5A 3ZSLA 1HJGA 2D3SA 3HQRA 1DQ4A 3WT3A 3V56A 4NIDA 2CV6A 4UBGA 5AFBA 5DUWA 4YWAA 4QQOA 2R063 3IBMA 4AHWA 2WNVA 3O0XA 1UNBA 4RA0A 2HWB2 2W3JA 3JQXA 1H1MA 1S0IA 3FUQA 4XF1A 2VCMA 1V70A 2OT7A 2D6PA 3GCWA 2RVAA 2WYFA 2ZZJA 3LDKA 2V5YA 2WZ8A 4OI4A 1DYPA 5DAPA 4YW7A 3BUCA 1WW4A 1OURA 4K8FA 1RUE1 4CPBA 1BBT1 3DL3A 3NO8A 2BFUL 2WNUB 2EXKA 4KWJA 3FL7A 5BV6A 3KSCA 2ARXA 5F5CA 1MEC2 5BNNB 1TVGA 3I2JA 2R6QA 4CEYC 2NMNA 4DZGA 1MS0A 4NIGA 4O9GA 1UZZA 5EPAA 1UXXX 2DVDA 4JKLA 3ZSKA 2BGCA 1NXD1 2DYCA 4NROA 4RR3A 4FSJA 4GJYA 1QJU3 3O0VA 4B4QA 2YPDA 2CNAA 2Y6JA 3LIGA 3POEA 2YU1A 3SITA 1GZWA 1PZ7A 4AEJA 4EE2A 2WFPA 4PHZA 1RUH3 4UAPA 2WT0A 1JU3A 4RD7A 1BK1A 5GZDA 4WM8A 4MZUA 3ZN6B 1AL0G 3PJQA 4HSJA 4NVPA 3ZXJA 3KGLA 1V9U2 1H9PA 1IS6A 5T5PA 3SQOA 3JBG2 1J3RA 5K0UB 3ATGA 4B4RA 5DDJ2 1QXRA 4AG4A 2BJSA 1GICA 1Z7S3 1UYPA 2VVDA 2E6VA 3BGAA 1AL23 3GBGA 1LOCA 1QJY2 1WBFA 4QX7A 5FQ0A 2P34A 4N53C 3OTFA 4IEOA 1BBT3 1ULDA 2R49A 2RV9A 4XJUA 1JXNA 2W94A 3AC0A 1SFYA 3KCCA 3ZLIA 4UWDA 3TBDA 1S0DA 1RUC1 1OFNA 5JDBA 2OKXA 4K1YA 2J1UA 5FYSA 2YFZA 1F35A 2EXJA 3GM8A 4HSLA 3NKGA 1YRZA 1K5MA 2VVFA 1RVF1 3N9LA 2CGOA 3LA7A 3HQXA 3CO2A 4XCAA 1RUG3 1A78A 1FPN2 2VTFA 2CY6A 4AI8A 5LATA 4BQ3A 5C8WA 3AKPA 1RHI1 3R4SA 2VXRA 5L7OA 1CWPA 1OFSA 2ADEA 2YG0A 3CIHA 3IAPA 5L9VA 2BBVA 2BWCA 4FOQA 4ET7A 2JJ6A 2UYBA 3GNEA 1PVC2 4LK7A 4PQQA 3S5AA 2W5FA 1TMF2 1RMU3 4OLLA 3VBFA 4ASKA 4NHKA 4ZONA 4D69A 2A1XA 3ZR6A 1Q56A 3VBHC 4B7EA 1G9AA 3U37A 2ORXA 5C8CB 4YM0A 3HQUA 3VBHB 5FZLA 2DVGA 3U4XA 4TN7A 5FMOL 5H9PA 1FPN1 1UZVA 2HWE3 4B3NA 3N35A 1GWKA 4BA6A 1UOFA 1QIQA 4E4ZA 2VUDA 2Y6HA 2WAAA 4A44A 4E8DA 4K1ZA 4I09A 1UW8A 4ITCA 3UKTA 1QQP1 1SLLA 1OHFA 3VBRC 4NHYA 2IXIA 3FBYA 5CKNA 3WSOA 1GZWB 1ND2C 1SBFA 1TNRA 1UX6A 2WLPA 1S0GA 5DMYA 4GMP0 1RUJ1 4WVMB 1DQ6A 1STMA 5ABJB 2EAKA 2F6BA 2QQVA 2VMEA 1UIJA 3ASIA 1W06A 3WUDA 1CGPA 3MPPG 5F1RA 2WUHA 4DOUA 1S2EA 4HKLA 5T5JA 3ZN4A 1VBD2 2ZAAA 5JAXA 5HCFA 2QJVA 5LASA 4FPLA 4JX0A 1GOFA 3CU7A 1JYXA 2ZGTA 2UURA 3WHTA 3VDDC 3AP5A 2NN8A 3DECA 2D5FA 4L8QA 4YZ2A 1TZOA 1DIWA 1VBC3 4KH9A 4UFKA 4HVQA 1SLTA 2OZJA 4FPEA 4EN0A 5FXVA 4Z82A 2C6SA 2WN3A 3RZLA 3FHQA 4CCOA 2VAUA 3UJOA 2XBO1 1UXZA 4S2DA 3TN91 3WP3A 1DP0A 3QACA 5FLIA 3RI8A 3TEZA 2TUNA 3MIEA 4K3UA 4K6BA 4ZXKA 3CF6E 4W4ZA 2MEV3 1MVEA 5A3UA 1RXGA 2RR13 2VQAA 4J1WA 1ENXA 3P5BA 1N47A 2PXJA 1OOPC 4ONUA 5T50A 4GB31 4Q4V2 4BPZA 1BXHA 4Q4W2 3EQEA 4QPIC 1AR72 2JIJA 4PLOA 1ZRRA 1BEV2 4FP2A 2A70A 1AR81 1SCSA 2WNOA 4YVWC 3AJZA 3U4SA 4NJ4A 1DFQA 2WWSA 1QJX2 1ZBA3 5FP9A 5FYBA 1AYM1 3CDZB 5FY7A 1OC1A 4GIQA 4RN5A 3VDAA 4AQTA 5K9YA 4IL7A 3ZXDA 2KM2A 3DYMA 3G6JB 1XOYA 4BJ0A 4IV1B 2IFRA 2OPWA 5G04L 1RMU1 3DKWA 4TXWA 3I7DA 1NLRA 4BIOA 3PUAA 3C7FA 5C33A 3A21A 4FCAA 1H2LA 1DZRA 2LTNA 4FPFA 1K42A 5FZ3A 3VZLA 2ET1A 4Y1YA 1AF9A 2B8MA 3VBHA 2PHTA 3NV4A 4DIQA 1W6NB 4XUQA 3JXSA 4FPOB 3N3HA 4CCMA 2VVEA 2A3WA 4WVVA 3VL8A 5A1LA 2BTVC 4O61A 5A32B 3SKVA 5FPVA 1UQXA 1W6QB 2PAMA 4LBKA 2IXCA 4LT5A 1IHMA 5FYZA 3ZN6A 3NNFA 2XDVA 5BYNA 2ZTNA 3WCRA 4Q8LA 2IC1A 4FI9A 4NWVA 3DCQA 2WZEA 3OUIA 1ASJ2 1JYIA 3MUY1 2ZHMA 3K48A 4FTBA 3ZXLA 2XJUA 3SNMA 3RFRA 2K0GA 4YFWA 2R0FA 4GQ7A 1R093 3MPBA 2WZR1 5T5OA 3ZXEA 4MG2A 1VBE3 2VUCA 2X53S 3KV6A 2A5ZA 2X8KA 3KF3A 4FPGA 3THDA 2DBIA 4LULA 4U36A 5FXZA 4XAEA 2E51A 4OHVA 2BRTA 1PO13 4TSVA 4XCBA 4Y4YA 1OUSA 1URXA 5BNNC 3RYKA 5CFDA 5FO8B 1GNHA 1MACA 5H9RA 2BW8A 3NSTA 2BP6A 4YG6A 4B29A 5FWJA 1LOFA 1NQDA 4B1LA 4DUWA 3VL9A 4IEQA 4KWLA 1HX6A 2LS6A 2WR9A 4LKEA 3WZ1A 1V00A 2XVGA 3POYA 2V09A 1VBA2 4I0AA 4Y26A 1IG0A 4IEWA 2VCBA 3RJ2X 3U11A 3KS7A 1YFXA 3PIGA 5E1RA 1W3XA 1BEV1 5DXDA 1Z78A 5F5AA 3KVAA 5GJ6A 3KCYA 4QKNA 5LBBA 1NOVA 4GB32 3KV4A 4Q4V1 4R4ZA 2A75A 1RUF3 3MHZA 4XZPA 4AQSA 3K2OA 5JI9A 4XFBA 1O3QA 2RR11 3ILRA 2VO5A 1A8MA 4J1XA 2OX0A 2A6WA 3W59A 3JB8A 3ZXGA 1PK6A 3PVBB 4C91A 4Z92B 2WWJA 1RUI3 4CDUA 5L73A 1SLIA 3WCSA 3RZJA 4DPNA 2XUMA 3K77A 5K8SA 1XNCA 2PAEA 2ADDA 2FBEA 3OCPA 3HT1A 4RSUA 4D7TA 3IIIA 4JGYC 1G9CA 4GWIA 1PHMA 4AEDB 1EYBA 3WF0A 1XQNA 4MVTA 4PBOA 3SEEA 4NHLA 3ZFFC 1W6PB 4UF0B 4GB33 4UXAA 1GFF2 3WUCA 4MH0E 4XIKA 2IWGB 5FBZA 2AACA 1LKNA 5FAXA 1DU3D 1XC6A 3VDCA 5C3OA 2JICA 1VBD1 2AEYA 4BZ4A 1VB4A 4G9SB 4ARYA 2J1AA 4QX2A 2CWSA 3NJYA 4YZ3A 1ZZ6A 4MGIE 4WZFA 2VC9A 2MNGA 1A34A 2R043 3GCXA 4IGOA 1N1YA 3ZFGA 2Q1FA 3ZFEC 1B35B 5FTTC 4RL7A 4XF3A 2MPFA 3LEKA 2OW4A 2PHLA 4DNYA 5E6HA 2WQZC 4BQWA 3MV01 2RS31 5FCCA 2Q4SA 3AKQA 4PQ9A 2HJIA 5GZFA 4TLFA 5JUVA 2HYKA 1JHJA 1H1IA 1KEXA 4HXCA 3GYDA 5CFCB 2P2KA 1IQDC 3JZVA 3VBUA 5IFPA 2UYAA 5LA0A 1JH5A 1R092 5AVPA 4QPGB 3WR0A 4URAA 1AR62 2HWF1 3QH7A 5FZKA 5L9BA 1FAYA 1VMJA 4YZ4A 2JWPA 3UL2A 2HLEA 4A41A 1YJKA 2Y8KA 4Z8BA 2WRAA 3ACGA 3S5QA 2XR4A 4AFBA 4LMFA 1ENRA 4XXPA 3NNJA 1QU0A 1FMD2 3IPVB 3TNQA 2GNMA 4YVSA 1U5YA 4P9GA 3OSDA 3FN9A 2W46A 4XJ9A 3ZN5A 1ULGA 1PM7A 4OZXA 1OMIA 5F2SA 3RGBA 3MGUA 1RB8G 1WZXA 5JIAA 4LBQA 4QGNA 3J8F3 1KFUL 1FPN3 2QFEA 2XJQA 4UOJA 2NPIA 4AXOA 1MQTC 1YNAA 5IVEA 1R64A 3ITQA 1ZRDA 5E88A 4G4FA 3GZTB 4HKWA 3SH3A 2HH9A 1O5UA 4IEXA 3BYWA 4JAAA 4YW1A 3H42B 3LOBA 5EJZB 2W95A 2X10A 1G9FA 2BNOA 5AC92 4GMP3 4GWJA 1PO21 4OQ9A 4D7YA 3DXUA 3EYPA 3WF3A 1AR73 1VLNA 1AXYA 1NAEA 4EN9B 2WSVA 3DUIA 2W68A 4K7JA 1UMHA 3ES1A 1AL22 1R1ZA 1SCRA 1W6PA 1QJY1 1RUJ3 1JTZX 1SHWB 1W8HA 3NWKA 3PVNA 2PHXA 2VBDA 2PHFA 4CCEA 2NP0A 3OPTA 5FMOS 2RS32 2AR6A 1X8EA 2ARCA 4WM7C 4YW5A 3ZFFA 5A3OA 3AL5A 4FAGA 5JI7A 2GMPA 4XMAA 1N3PA 3KB5A 2Y0OA 4N9HA 1C1LA 4I3PA 3WP5A 1VBC2 3D4KA 3B7MA 3E5QA 1S55A 4F8AA 1EUUA 4WZCA 4AVBA 2AUYA 4KG8A 3ZR5A 3FWEA 4I30A 5LCWL 3VV1A 5A3PA 1AR82 5F5QA 5KHHA 5JZGB 1GV9A 5CVRA 3KV9A 3CL1A 1AYN3 1ZX5A 3AVSA 3I49A 1AYN1 5FZFA 1NCRC 3ABZA 1WA6X 3A23A 1QXJA 3GZAA 2E33A 3LQCA 5FPAA 3ZYHA 3USUB 1SPPB 2PHUA 4QAWA 1QH6A 1R082 5H9QA 2A7AA 2ERFA 2UU8A 3BI3A 1SMVA 1DDLA 1C4RA 1VRH2 2XLAA 1T6GC 3HEIA 1LRHA 3A7QA 3JCIA 3R0RA 3TRSB 3NAPC 5CADA 2Z4FA 1GUIA 3ZIWA 1W9YA 1TMF1 1VALA 3A4UA 1K3IA 3N7MA 2HWE2 1POV3 4Y24A 3RNSA 3D3AA 1OQ1A 3N7JA 1JYTA 2ARAA 2QQOA 5FP7A 4HVRA 4AGGA 2XB6C 1ZYBA 4Y4RA 4EN8B 2DCJA 2J1RA 4FTSA 1S2KA 2PYTA 2DTWA 5JXGA 5IVVA 2AEZA 1AXKA 3DXTA 1O8PA 5LA2A 1U5IA 2WDBA 5FV3A 3WINE 1Q5OA 3OBRA 5IAXA 2YV8A 4UBHA 4EZHA 1HLCA 1W9WA 4GKXA 4R4XA 4JGYB 3SMHA 3EJKA 2UWAA 4AEKA 2PMWB 2VOTA 3U14A 5K4LA 5ANNA 1JZ6A 1NT0A 2XONA 4R52A 3CEWA 3WQ0A 1X36A 1X9PA 2RS52 2GP5A 2NMOA 2A6XA 3CLPA 3THTA 4M3CA 1E5RA 4CXWA 4YW4A 3WDYA 3LEGA 4MGKE 4LKSA 4XTMA 3DEMA 5B2GB 3AK0A 3ILFA 2B7YA 2W9XA 4UW4A 4CDQA 2ET7A 2DDUA 4NO4A 5FYHA 4JCKA 4D6SA 1NCQB 1UMIA 3W58A 5IK4A 2YFUA 3RI9A 4FPHA 2XHNA 2P6CA 4P02B 1QJU1 3E6DA 5AC91 3BTYA 4U2AA 5DG2A 4A45A 4LA3A 5FYYA 3VKNA 1HRV1 3B5LB 2WABA 3RYPA 4FT8A 4QKBA 3WX5A 1G7YA 3ETPA 1E5HA 2GU9A 1UX7A 4PIZA 1PVC1 4CCKA 4CP1A 2FHRA 1CAVB 3HBKA 2FMDA 1DLCA 4XXAA 2VM9A 1OI6A 3AYCA 1U5XA 3MFAA 1IPSA 1GP5A 3VGIA 3MV11 1C28A 3ZDSA 1JW6A 3GZEA 4QX3A 2WN2A 1HRI3 3JB4C 1W05A 2D44A 2WFF2 5EFUA 1S0CA 2JXAA 2XKOA 2OZ6A 3K3NA 4PDWB 2J42A 3T0BA 2XJTA 1AX2A 1W6MB 1QHDA 2QQIA 1N3OA 3VHOA 4GALA 1RUD3 3OJBA 2QZ2A 4DS0A 4COUA 3AVRA 3LFMA 4HMZA 4V2WA 1O59A 2R16A 4X8PA 1V6KA 2PA7A 1UZWA 3KM5A 2XKPA 1CAWB 5T55A 1S0FA 5CG9A 4OI2A 5KHKA 3M2MA 4QB6A 1XXNA 3W9AA 3SEPA 3AZYA 3O1TA 2W0XA 2R30A 2AREA 4EWEA 1LU1A 4D7SA 2HEVF 2P3JA 4L97A 1W03A 4TWTA 4UFHA 3KF5A 3WNNA 2ZJCA 3TN92 4OYUA 1RL3A 4XJAA 1OH4A 4CCLA 4JHZA 5BNOA 1LHOA 4RQPC 5BNQA 4NPRA 2GC1A 1YJLA 3L2YA 4M4RA 1JU4A 1ZZ8A 3ACHA 1H8VA 3BVCA 2VZRA 4MLOA 4A7KA 3QH6A 4QPYA 4JDOA 1HB2A 1O3RA 1PZ8A 1VR3A 4YNIA 4AAXA 4XFAA 1W99A 4CUBA 3CHXA 5HCBA 3F2ZA 4LLFA 2VQ0A 2DTYA 4A3XA 3ZYBA 4HLTA 2K2SA 4M00A 4LO4B 3AZWA 1JOPA 4M3CB 1W6NA 5IVJA 3HR9A 5FPZA 5GALA 5CKMA 4AI3A 2WAOA 2YUEA 1JZ3A 2BGOA 4DINB 2EALA 4ASLA 4CA9A 4C0HA 3VBFB 4JV4A 2BEOA 4I3GA 2NQYA 1HXS1 1MEC1 2Q0AA 1OF4A 1D4VB 3FX3A 4LQRA 4H55A 3AKRA 4XFCA 1VAVA 1XYOA 2RM21 1W6OA 4Y22B 1JZ7A 4CPBD 1CAUA 1J3PA 4C90A 3C7OA 1V0AA 2X5IC 4IV3A 4CUCA 4CDXA 4KWUA 3BODA 2G4IA 3VHRA 5FPUA 1ZBE2 1UPSA 1QDOA 2ZEWA 3ZXAC 3IMNA 2HWB1 4LO8A 4PT6A 3K4DA 3VBSB 4LBOA 3HNBM 3SISA 1REDA 3LFIA 1HJFA 4OHWA 5FZBA 4FO9A 5KBFA 2JG8C 3U1XA 1IOAA 3E5UA 3QCWA 3WNKA 2CAVA 1NCQC 1VBA1 3WNMA 1KDMA 2VJXA 5FWEA 3RRDA 5JXIA 1BYHA 1OKQA 4XJZA 5HXVA 3WP4A 4FFFA 3AXDA 4XPVA 3VN4A 5LWBA 1CN1A 3OGJA 4TTGA 1CESA 1E5SA 1W6MA 2GH8A 3AM2A 5JOYA 4BH9A 3TOJA 3DYOA 5FY9A 3D0SA 1XU2A 2D5HA 3SCGA 3FE5A 4Z1VA 1RHI2 4HK8A 1RUOA 1OOPB 4CXYA 1R083 5IHRA 2ZS6B 3RSJA 3J7NA 1GU3A 2YHJA 2OA2A 4D3WA 2IUWA 2YBSA 2WLQA 4I0BA 2ZMKA 4C1XA 2A6YA 3IAQA 3A0KA 3LA3A 1V6MA 1ST8A 4KNCA 5C6CA 5F32A 3PUHA 2D3RA 4XILA 1K45A 1DQ5A 1YLLA 5FZEA 2Y26A 3B01A 3AMNA 4FPJA 4OULA 4XDPA 1V6NA 1WW7A 4NRQA 1QOSA 4CP9B 2ZX4A 4MHUA 4R9CA 5FMCA 3JQWA 1SFPA 2BUKA 2DVFA 4Y5SA 3ZFEB 3ZYPA 3ACLA 3M3IA 3JUUA 3WQ7A 4MGQA 3ZYGA 5FYTA 1JZ4A 3CKHA 3I2FA 2WO2A 5C70A 3RZGA 4KU8A 4NR1A 4AW7A 4W8JA 2B46X 1T2XA 4XAAA 2Q1ZB 1ACCA 3BALA 3I2HA 5GLVA 4FXGB 2MEV1 4EN6B 3GALA 1O4ZA 1ENSA 1UF2C 2XQXA 5FYMA 1FOD2 3HWJA 1OLRA 2YBKA 1H9WA 2RS13 1OSGA 1REEA 2A6ZA 4XZUG 3AYEA 1AYM2 4EQVA 4S2GA 4JGYA 1O3TA 4P9YA 3GGLA 5CFCC 5I91A 1IS3A 4PF5A 4HFSA 5FZ1A 2HWF3 4OI0A 2Q5TA 1GQPA 3WF1A 1AJKA 1COV3 3RYRA 1SZBA 3LD8A 4YGCA 5KC5A 4IDZA 4GXLA 2O8OA 2WO3A 1OVPA 4IV3B 4XBLA 2W2IA 3DGTA 2E7TA 3BIWE 4YSFA 2B5HA 2RS53 3E5XA 4O7XA 5DDJ3 1LULA 1W9TA 2OIIA 5GZEA 3AXEA 4BLIA 1JZ5A 3M3QA 5F5IA 1QWRA 1IPKA 3BPZA 3MF6A 2ETEA 2RM23 3O7OA 4QQLA 4A7ZA 3T2PA 2RHPA 3POBA 1PK6C 3HAGA 4Z07A 5FZCA 3VLBB 3UNPA 4CEWC 4Y20A 3WNLA 2YB7A 5JSOA 4E2QA 1RUNA 4E9KA 1W3VA 2RMU1 1QOOA 2PQQA 5I0TA 4C0BA 4D0QA 4DFSA 1W2UA 4Y1VA 5C9AA 2EXIA 1UY3A 3LPGA 5DZEA 2EF6A 3NV2A 3BU7A 1ZREA 1WMFA 3PU8A 4QPGC 3WQ1A 3I2OA 4BMEA 2IXLA 3MLKA 2NLRA 1NUKA 4LOSA 4Z2WA 1H1AA 5HXMA 2CWMA 2GMMA 3DPRC 2JB4A 4Q0VA 4QDSA 1EV11 1VAKA 2VMCA 4UYBA 4V1PA 5IK7A 2OVUA 5IWFA 5A3NA 1JBCA 3MW4A 2RS11 5JR2A 3J8F1 4QPIA 1IPJA 4UFIA 3V0BB 2VD7A 3POWA 2ZOEB 1H8TB 2VZUA 4RGAA 4YVWA 1VB2A 2V73A 4QX8A 4EV0A 1HRV3 3LEMA 3TEYA 1LODA 1UY1A 4XBQA 3OY8A 2ZGNA 3DF0A 4MGZE 4CEWB 5IYYA 2ZHNA 4YARA 4O9EA 5FZ9A 4KG0A 1F2NA 3OB8A 3VBOA 3WDUA 5GLUA 4AF9A 4FQZA 2AENA 4NN0A 2JG9A 3OGGA 3ZFFB 3ROUA 3AJYA 2PTMA 3AMQA 3S7EA 3B9CA 3HMYA 4PDWA 2OYZA 1R1A3 4IV1C 2Q30A 4HETA 4UFJA 1JI6A 1GOGA 3WQBA 3WNPA 3SLIA 4GA9A 2VH9A 3WF4A 1FMD1 1WMEA 2ARBA 4LR4A 1BHGA 2P3IA 2VBBA 1QGLA 1RUI2 4I01A 5BNPA 2D93A 2W87A 3RG0A 4GD4A 3EHKA 1NZIA 4V2VA 3MFCA 5IK8A 1I9RA 4HKOA 4XYXA 2DU0A 1EV13 2YXSA 2WZR3 5DABA 1PNGA 1SFNA 3KQRA 1RUG2 5IFTA 2EICA 4AVSA 2BOJA 1LB2A 1UYYA 3FHAA 1R1A2 4HVOA 4Q27A 4F7ZA 1FI2A 1EPWA 4HPKA 1PMHX 3JD71 1I5ZA 3QOPA 4P5HA 4PBPA 1Q8PA 2Q1MA 3WG4A 3AP4A 5FMBA 1YCIA 5BNPC 1KJLA 3H8OA 1JOJA 5AC93 5C3PA 4MGYE 3UGGA 2WO7A 1QJEA 4DRRA 3N7KA 2QZ3A 2OS2A 2VY0A 2ZMNA 4AR2A 2FCUA 1AHSA 5ERLA 4A7YA 1DG6A 4LITA 5BY5A 2ZHKA 4XW3A 1UU5A 4Y3OA 3SH5A 1XRUA 3OOXA 4AVAA 1NY71 5KXCA 2C9AA 5C3SA 3D82A 4EJRA 5EYXA 5HBAA 3O1SA 1IGOA 1VJ2A 4JVAA 3ES4A 1VAMA 1W2AX 2GC2A 1ENQA 4WBBA 4BU2A 2QUOA 4QDQA 2EAAA 2GN3A 2JKBA 2W1UA 1PIV2 4K21A 3JBG1 4OVEA 5LEJA 5DAVA 3RPQA 1FNYA 4RGKA 2QKDA 5C4WB 2GALA 5ABJC 3CQOA 4X8NA 4QHBA 3BCWA 2JKXA 3H0OA 3I2GA 3WNXA 1GZTA 4YLZA 1QJZA 1YQ5A 3WOGA 1XB9A 3TB0A 1O5LA 4BWOA 4CVUA 4F3JA 1PGSA 1PM4A 3LDBA 1VBE1 4FOVA 3ST7A 1RUH2 4NHMA 1YUDA 3R05A 5A7WB 1NG0A 5SV8A 3TNPB 2WWUA 1S0JA 2ZA9A 5HI0A 1WKYA 4L2NA 2VZQA 2CHHA 4IEYA 1AR93 4DXZA 3POIA 4FBFA 3MDPA 4IW3A 3HVDA 3R4DB 3JD73 3I97A 3ON7A 4YG3A 5BPXA 1ULCA 1W8FA 1A8DA 2QVSB 3D5OA 3IKWA 1O3SA 1PVXA 2R7EB 4WM7A 4YW6A 4K20A 3KGZA 4RYDA 5DUUA 5FPLA 1KD7A 2JDKA 4DXSA 1OD5A 2W08A 1H8TC 2RDNA 1JOBA 2FDJA 2JG9B 1HXS2 3H50A 1RUE2 3T3YA 3ECQA 4CCCA 3PIJA 3OPWA 3TYJA 5K0UA 5LRSA 4NPLA 2XG3A 3SCFA 2ZABA 5APAA 2BERA 2LUWA 2J1EA 3WP6A 4IV1A 1OT5A 4XUPA 5LY2A 2BPA2 1BQPA 3PTYA 3J7MA 1J84A 4MO3M 1LENA 1WCUA 4S2FA 5AVAA 1AYM3 2HBTA 4LHKA 3I3MA 2AZ5A 3POJA 1D4M3 1W9SA 3PVOA 5FXXA 3WDVA 4CUAA 5FZAA 1CX4A 1EV12 3CZJA 5FY1A 4MGTA 3SC7X 2BVBA 5KHIA 2CGPA 4WVZA 5KXDA 4N7UA 2JDYA 1LOGA 1KS5A 3QD6A 1JN2P 1ASJ1 2KXLA 1X33A 3R4UA 3VB9A 5ACA1 1X7NA 4Q1RA 2JDZA 1HQWA 1H2MA 1YFYA 1SLAA 3F95A 4ASMB 4BQ4A 1LHWA 2L9LA 3QBQA 5FIXA 2HWE1 4DB5A 3BKZA 4A6SA 2H0VA 3I3QA 2EIDA 2AGSA 2E63A 4PLMA 3P3NA 1AR83 4RS5C 3PL0A 2YPJA 2VW1A 3OGRA 5CFDB 4BQYA 2ZGRA 2JE7A 1GP6A 2RJLA 3IZOA 2ZXQA 4RHV2 1LOFC 1AVBA 3FUOA 4EN7B 3VBUC 5CA6A 3O5SA 1KQRA 1UYXA 3N9NA 5D21A 1GQGA 4QU1A 5FZ6A 3VBFC 1OA4A 1UCXA 3O1MA 1F8VA 3TEXA 5A1FA 5CBLA 3OY8B 4CEWA 4A4AA 2XVKA 1OQEA 4CUGA 4AQ2A 3NV3A 1CPNA 5GKAC 2PHWA 4JGZC 3T1MA 4HZFA 2Q8OA 3VKOA 2ZKLA 3L2HA 4XOGA 1LOBA 2WYSA 5CU1A 3UETA 1VBC1 2VTXA 3WG2A 5CNAA 3MW2A 3S0MA 4LNVA 4MGSA 1B09A 5FJKA 4FPKA 4N43A 4SBVA 1XE8A 1O8SA 2QDRA 1GQHA 1W6OB 4LBMA 1HB4A 4J6GA 1OKOA 4XDQA 5J7MA 1FYUA 2Z42A 3UKNA 2FZ2A 1RUD2 2HWF2 2J1TA 2P37A 3H3UA 1ZRCA 2W1SA 4RR3C 3NW4A 2C1FA 5BXXA 1YXWA 1J83A 2ZKNA 2V5DA 1AL21 4M0NA 1SBEA 2G9ZA 5I93A 2YDEA 3AZVA 2VNGA 4HK9A 2VUJA 2Y6LA 3WW3A 2PLV3 1UYZA 3CMGA 2PFWA 4AVTA 4KBBA 5JLVA 2RS33 1UOJA 3FFQA 3SH4A 1HB1A 5J09A 3MZHA 4DY3A 1COV1 3IB3A 3K4ZA 1GKBA 3OPZA 1F5JA 1COV2 3E1F1 1RUJ2 2VZVA 1JUHA 3BPSA 3CJIC 3ZXFA 3MUZ1 2X5IA 3WHUA 1L7RA 4ZXEA 2K46A 1LOAA 3BU0A 1OLQA 1QJX3 1H4HA 1ZBA2 4BHPA 4IE4A 4AAPA 3B69A 2P1BA 4YGBA 3HBZA 2O0OA 4QX1A 1Q8VA 5GZGA 1JZ8A 1MZEA 3AL6A 2ZGMA 4BQ5A 4Q0SA 1IG3A 1DGWA 2QQPA 4ISRA 1OOPA 1EUTA 1FOD3 4EWDA 1G8WA 2E53A 2XH6A 1O7FA 2KR2A 1H0BA 1CVNA 1WCKA 2D7FA 3D0JA 4LIVA 4W6XA 3URFA 1Z7S2 4R8HA 2WNVB 2XWBB 1LJ7A 1OUXA 1Z7S1 4FFHA 3POSA 2LROA 5F3IA 1ODNA 3NVCA 3GBFA 3ACIA 3JBG3 1V9U3 2OPKA 2W47A 4AI9A 1NYWA 1XSRA 5FR3A 2WZPP 1ND3C 3T2QA 5JSPA 5K7PA 2E9QA 3AB0A 1TME1 1OH3A 2VZPA 1YEWA 3B3QE 2GP3A 5FK7A 4RGGA 4P9JA 1RUH1 3PURA 3BB6A 2RJ2A 1W8TA 4LO5B 4NE9A 3VZMA 2JIGA 3SXWA 4AL9A 4W6WA 2C26A 3C7GA 4AFAA 3ZSMA 5GLTA 4DQAA 5ANQA 2WNEA 2XQRA 5IVCA 1B35C 4GWNA 4YM1A 1Q8QA 2WNVC 2ZX2A 5F6LB 1US2A 2LRPA 3BOWA 5C5UA 2IXKA 4JTNA 3RVHA 4CDQB 1UY2A 5J96B 3IWZA 1AR91 1NA1C 2HWD2 2WKKA 1DYKA 3Q8AA 2IFWA 3WD5A 3PLQA 4PF1A 2C9KA 4OFGA 5FYVA 2VZTA 2FZ1A 3AKSA 5IVYA 2X09A 3VHPA 3IM0A 1O4YA 1N1TA 2J1VA 2E31A 2YROA 4ZY9A 2HEWF 2YBPA 1KJRA 2QCSB 3IMMA 3S30A 4Z2AA 5FOBB 3VUOA 5CKQA 3KHCA 5FZ0A 2GDFA 1N3QA 4B8EA 1WCSA 2GH2A 5A3MA 1K12A 4P5YA 2ILMA 3BOPA 2FCTA 2JDMA 4JQTA 1TEIA 5DPNA 4G3YC 1MPXA 3CJIB 1S4CA 4NWWA 1JODA 5A3WA 4JZRA 3UK9A 1MVQA 1R1A1 1NKGA 4Y20B 3FMGA 2YC2A 4Q1PA 1UZYA 1SEFA 4K40A 4CDXC 2JE8A 4FAHA 2RMU3 1ULEA 3R6SA 5GZCA 2YY1A 1J3QA 3LAGA 2ZGPA 5FZGA 1UY0A 1YFWA 1QJY3 1E5IA 1W8NA 2BQPA 3J9SA 5D1IA 1U0AA 3FLTA 3VBSA 4BQXA 3KZ4C 3A0NA 1RYYA 2ZX3A 5FLHA 2KD7A 2RJKA 5DN2A 4LO6B 5D8AA 1FX5A 5FY0A 5T52A 3THCA 5FMDA 2WA4A 2JDPA 3NNLA 1LAJA 3WW2A 5B4NA 1MQTB 1ZRIA 2CL2A 4M0HA 2G1MA 1XJAA 4ZU7A 1J58A 2GZWA 3GHMA 4BQ1A 4K8RB 4UW6A 5FUPA 2NM1A 5FY4A 1I1EA 1AUYA 3VBSC 2WQ8A 1WLDA 4Q4W1 1QMJA 2DF7A 5LRRA 3K4AA 4QXBA 4RQPA 2P3YA 2DCKA 2Q8DA 1QY4A 2DCZA 2XXZA 4Q26A 4QWNA 4AGRA 2WO1A 1OA2A 5JPNB 3T4VA 5GLWA 1G6NA 1OPOA 2UWCA 1HN0A 4NRPA 2HWD3 2W91A 4QPWA 4B4PA 3Q8EA 1BMV1 1JYCA 3W5NA 4P9XA 3LDRA 3OUHA 2YC4A 2PLV1 4ES9A 1HKDA 2RDSA 4NOTA 4JTOA 4LHSA 4MXWA 1XNAA 2QQWA 4JDNA 4Q4X3 5T54A 3TN93 2CAUA 3I2KA 2DCYA 2O1QA 4IETA 1UY4A 4L11A 3LCPA 4ZKTB 1MS8A 4AHZA 2WC2A 2PELA 4MADA 3K46A 4R9DA 2R071 1ZZBA 2QQNA 2RS51 2YMZA 4RHV3 1XU1A 1W0OA 2WNUA 5FZ8A 4ZHNA 1LGNA 4LBQD 4LHLA 3IDBB 3KHBA 3DKQA 4YZ1A 5BNNA 1NY72 1AR63 4Q4V3 2GNBA 2CDPA 3I59B 3WG3A 3MLJA 1ZBE3 2PHRA 2R1BA 3LKJA 2Q8EA 1LGCA 3V65A 4XMIA 4LOTA 1IKPA 1CJDA 3NAPB 3U07A 5FZOA 2WIIB 2JD4A 2X5IB 1GANA 2D6OX 1KS4A 2JX9A 1K5JA 4I2OA 4CCJA 5C9AC 2Y60A 1K5MC 4AYUA 4R9AA 1DZQA 4AEMA 1D7PM 1RUF1 2XJSA 3T1LA 4XJWA 2FDGA 3MIHA 5F3EA 2R042 3UESA 1YHFA 4D94A 2P4EA 2XVLA 3T0DA 1Q3EA 1CZSA 1G86A 2Z69A 1CX1A 4CU7A 2FDFA 4LJHA 2ZGOA 4ARXA 5LBCA 4XDOA 1D4M1 5CB7A 2DWRA 3LGRA 1LTEA 3IDCB 3U78A 3VBOC 3ZYRA 2VMGA 1S0BA 3MYXA 2HWC2 1JZ2A 4COZA 2RDRA 1POV0 2OQ7A 4M01A 5F39A 1HRV2 5D8AB 2MEV2 1UU4A 2I74A 2WINB 5JMOA 1W8ZA 4LBNA 1UZ0A 4INDA 4IE5A 3LA2A 1MZ5A 1LR5A 1I6XA 4NRMA 2JG8A 1UOBA 2W39A 3N4MA 3B94A 4QPGA 5FZ7A 1MS3A 4N8MA 2X29A 1Y9MA 3DV8A 4RQPB 5IATA 4H7MA 5A7OA 3J7LA 1PX3A 1HQNA 3FBMA 2F4PA 5I8YA 1DGLA 1C8M2 2HEYF 1OQDA 3I2DA 4XE9A 5F6KA 2B9UA 1Y3TA 2OUHA 1ZNPA 3MEPA 1XNBA 1W39A 1S0EA 1E57A 1H6YA 1OBNA 2D98A 5E8AA 1YQCA 1GWLA 2CYFA 2XHKA 1G9BA 5BNOB 1YQ8A 5DZFA 4BDVB 3AFGA 1J59A 4Y5Z0 2EIBA 4GJZA 5GM0A 1VBA3 1UO9A 2QBXA 3O1UA 1MZ6A 3DPRB 4XQ4A 1IKQA 1QOTA 1UU6A 1FV3A 4MV2A 4WV8A 4UF0A 3ZYIB 4BIFA 4N7IA 4BXSV 5KHJA 2PHDA 2JD9A 4FXKB 5LW9A 3BIEA 3MO4A 5FPXA 1VRH3 1SLCA 5DQ0A 1GSLA 3T4HB 3V64A 4YFZA 2JG9C 3AMHA 3M3OA 5A3TA 3PVEA 1RUI1 1UPIA 3KD4A 2XL9A 4JC1A 3PTRB 2A73B 2VQTA 4OQ8A 4IGPA 1TE1B 1HN1A 4BK4A 1CIYA 2WNUC 3AP7A 3ELNA 2YYOA 1BVVA 2YZ4A 1EAH2 1S1AA 1SPPA 3M7AA 3H7JA 3I59A 1YYNA 1VRBA 2ZX1A 3PUQA 3NNGA 4AGVA 3PNAA 4CU6A 5FKBA 4XHBA 3ZO0B 4COVA 1TQ5A 2R1DA 4CP2A 3ZMOA 2H0BA 4GMP1 3OG2A 3VDBA 1D0GA 1M06G 3NRUA 3RDIA 5AFEA 4NUBA 3VD4A 4LUMA 3OGVA 1POQA 3FLPA 3WDXA 1YC61 1ULFA 2ZEXA 3RZZA 1Y9QA 4CDXB 1A6CA 4RHV1 1X82A 2RM22 4B7KA 5J37A 1F5FA 3WW1A 3J7HA 3ZKUA 5DAXA 2JDHA 1SBDA 2O8QA 2QQLA 4H7LA 4JQRA 1QF3A 3AMMA 3OBZA 1UMZA 4Q4X1 5FBJA 1PO23 3B9IA 3POFA 4Q0PA 2GC0A 1FOD1 5A80A 5JXJA 1YIFA 2Y64A 2QQMA 3IIAA 4HT1T 1C3HA 2J1SA 5CAZA 3E6BA 1J1TA 1D0HA 2ZEYA 5I8TA 2PQSA 1CAXA 3C3VA 2TEPA 3VBRA 4A3ZA 1DYOA 1X9TA 3KCXA 4RFRB 4IEPA 2ZEZA 3KVBA 4LBLA 3VZOA 5EJ1B 4DMIA 1ZZ9A 3MIBA 4YPJA 3WNOA 5ABJA 2WT1A 5IK5A 4LHNA 4FFGA 2ZBJA 2QQJA 2ID4A 4TZDA 3ALQA 3I8TA 4AI0A 4Q4X2 1ALYA 1RINA 4IV3C 1RJ7A 4XFGA 3FJSA 1CZVA 2QQUA 5JWPA 4X6RB 1QQP3 3H9AA 1NLQA 1YWKA 3I3EA 3BN6A 1SACA 1RITA 1DGRA 1WLTA 2WS91 2TBVA 3Q8CA 5IAVA 3H8RA 4LBJA 1F31A 1BK0A 4NIHA 4QD2A 1WGPA 1XBFA 1JYVA 4COWA 1ULPA 4YZ5A 2ZGQA 1XYNA 5EJ3A 4JHTA 4DEVA 4YVSB 1TNFA 3MIDA 1VIWB 3C7HA 3IN9A 4CDWC 5FYIA 2FMYA 5KXEA 4QX0A 1WBLA 3M70A 4CU9A 5FDBA 1WWYA 4GH4C 4XHXA 5JZGC 3NJVA 2VCAA 1JUIA 4RS5B 3VD9A 2W1WA 3NQHA 4TLGA 5LEKA 1S2BA 2DUPA 4AQ6A 2VQUA 2AH2A 1TMF3 4O65A 5KR7A 3UGFA 2I2SA 2XWJB 3AYAA 5J98B 4AHYA 1WCDJ 4K9SA 4D6RA 4QT6A 2XBO3 1RHI3 3HOBA 3POGA 2SLIA 5A3LA 1LEMA 5F7UA 3H1MA 4P9WA 4OI1A 2V4AA 5FY8A 1A3KA 3C2UA 1L7LA 4WM8C 1O91A 2VR4A 2VZSA 3OYWB 1FV2A 2PAKA 4FP3A 4JGZB 4OUSA 4XFHA 4XUTA 4ZPIA 1VE0A 5A6YA 5IUQA 4YM3A 5F9TA 4IUGA 5A6ZA 2HWC3 3GJBA 1UIKA 3APBA 3NAPA 3Q8FA 2BDRA 2D97A 3I2IA 2QE3A 4CDWB 4CTEA 2PN5A 3P3PA 4CXXA 1VPHA 2V72A 3NMBA 2VMFA 5BNOC 1Z0HA 4OHZA 4OZOA 3ZSJA 4M3CE 4N43C 1UL9A 2B9VA 1XNDA 2QQKA 4NPMA 4GWMA 5FQ0B 3X29B 1W90A 3SCHA 3ZOIA 4BOWA 3EB7A 4BXFA 1KXGA 2EA7A 4IE6A 1YI9A 1HV0A 2D6KA 5T5LA 3OD0A 2VECA 5CIRA 1J1LA 1JMUB 4ZS2A 5EQUA 5LA1A 1W28A 1M4WA 2RDQA 1NE4A 3BTAA 1JYWA 2ZGLA 2P6HA 3CJXA 2B42B 1CAWA 4B1MA 2ORZA 5DDJ1 4GZ9A 3ZXKA 5ACA3 1WCQA 3JD72 5B4XA 1HDKA 4OCTA 4YG0A 4N53B 5CZKA 4MX3A 1PNFA 4Q0QA 5FXWA 4WM7B 4PIYA 4XTPA 4Y22A 5HCHA 1WMXA 4XQDA 3WW4A 1NA1B 3RMXA 1X8MA 4LUKA 5I0DA 4AOCA 4P9IA 4X6QB 4CDUB 4MOAA 2EVXA 4YVWB 3RZHA 3HPNA 3WF2A 3LIHA 1ZA4A 4COYA 3AKTA 2FD8A 5C4WA 5CG8A 4QPIB 3V0BA 1CD3G 2IXJA 2JE9A 4XBNA 5FYUA 5IJRA 5IVBA 2BNNA 4ISQA 5F3GA 3O1PA 1I3HA 1NCRB 2W92A 3S6PA 1X50A 1VRH1 2Y33A 4GULA 1DGRN 2UY8A 4HBNA 4BYYA 1MEC3 5C8CA 4H3WA 1T6BX 1C57A 5C5TA 4DUVA 4A42A 2VPVA 3C8XA 2DU1A 1FXZA 1R081 2R0HA 1QNWA 3VKFC 4PJYA 1W2OA 1DQ0A 1ZZCA 2VGDA 5FO7B 5IT6A 5LBEA 2BFUS 5CEHA 4CE8A 1AYN2 3HNYM 1DCSA 4ORFA 3V0AA 5A6QA 3RJRA 1FT9A 5FZMA 4L99A 2BYVE 4XC9A 2VW2A 1CR7A 4META 4DXRA 1REFA 4HL0A 4JDMA 4LKFA 2RS12 4ZZ8A 1IZ3A 5EP9A 3SHRA 1HB3A 2WJSA 2WZR2 4QB2A 4E4DX 4PI0A 4DY5A 1LEDA 2CU5A 2GN7A 4Y1XA 2CDOA 2LW8A 3L9JT 4GH4B 2N7GA 4CCDA 3JU9A 2EXHA 3ENRA 1LOEA 2WL1A 5A7WA 4CZSA 1LHUA 2BBAA 1SQ4A 4XQWA 4YYOA 2Y6GA 1YO8A 4Y1ZA 3Q8BA 2PLV2 3ETQA 1JHNA 3VD3A 4N9IA 3M1HA 1BMV2 1H6XA 1DF0A 1Q8SA 1ND3A 3M3CA 2MHFA 4RFT0 5FRAA 3VBRB 3ZFGB 5FUIA 4LIUA 3DYPA 5C4WC 1W0PA 2RMU2 1BCXA 3CBNA 4BLJA 3H7YA 2NZ9A 4PDWC 2F4LA 5KXBA 1UKRA 4ATFA 5HPOA 3USUA 5EHDA 2VZ3A 5FP3A 4Q4Y2 1XSQA 2B45X 3RZKA 2DBNA 3GHNA 3O14A 4DEQA 2C4XA 3ZM8A 1MR5A 1W8UA 5L19A 4AI2A 1UOGA 4N53A 2B4KA 2ZGUA 4LA2A 1NZCA 3PHMA 3RWKX 1JS9A 2GNTA 3C7EA 1LHVA 4IGQA 5G05L 1GNYA 2YU2A 4AFDA 2G19A 1NA1A 4LPLA 1C5HA 1ULOA 3OF1A 4M4PA 2VMHA 4QDRA 4YRDA 2XUEA 1CONA 4KU7A 5IW0A 3B93A 3VHNA 4BISA 1XYPA 1FNZA 4LKDA 3THPA 5JSRA 4Y1UA 4H2AA 3LEIA 2VL4A 4QQ2A 3WDWA 4XURA 4P00B 3P6BA 4LK6A 3U75A 1KDKA 4KL1A 3S7IA 3I3BA 3FFZA 3FLRA 5I0UA 3W5MA 3KT1A 1VBB1 3PMEA 1FMD3 1Y7BA 2XLFA 2HWC1 3WDTA 1DGWX 1C5IA 3GBWA 2LM3A 4W65A 3Q9OA 4XF9A 5D2AA 4DO0A 2I45A 3G7DA 2QNKA 3MIFA 2FQPA 1QJU2 3FC0A 3WEZA 1C8NA 3N36A 4UT5A 1W8WA 1RIRA 3K3OA 1ND2A 2R041 4JKMA 3HN1A 2HYXA 2RE9A 4XUOA 5FY5A 1W2NA 4D8MA 3AMPA 4IEUA 5FJHA 1PX4A 3ZYJB 4IE7A 4KWKA 4HANA 1GZCA 4HG6B 1PGL2 4QKFA 1HRI2 2XJRA 5EV7A 1IS5A 2P5BA 3OYWA 3O1RA 3UYJA 4DRVA 4A2UA 2R32A 5JXHA 2NYYA 2VZOA 5JVVA 1PO11 2VG9A 4CDQC 3RQ0A 5L7OC 4CDWA 1GNZA 2FDHA 2VCCA 4JKKA 1CZTA 3NKTA 4BM8A 4ZU5A 1C8M1 4AVVA 4GH4A 4IESA 2GNDA 4MYEA 4PLNA 3BTXA 3WY6A 1EP0A 4FQ4A 3UKVA 4AI1A 1NXMA 1VP6A 1WD3A 4GAZA 1V6JA 1H30A 2DVBA 5LZ6A 3TAYA 4CYDA 4QM8A 2P17A 2QTWB 1SDWA 2OQ6A 3ACFA 3PU3A 4HOOA 2RG4A 1RTVA 3LOIA 2WS93 3IDAA 4L92A 2DFBA 4FOYA 5DG1A 5L9RA 5E89A 4N43B 5LBFA 4FTEA 2P3KA 2SBAA 1EY2A 1DBNA 1PO22 2WSUA 2OXBA 2VUAA 3VD7A 5FFOC 1P8JA 3HN3A 3VKLA 1F15A 4RS5A 4CEYB 4FOWA 3LPFA 5C9AB 3O1OA 1QNYA 4IERA 2KA3A 4QQHA 4XEZA 1I5PA 3WLUA 3MW3A 2E7AA 4NAMA 2X05A 3E97A 3OBAA 5A7QA 1L3JA 1Q43A 2WA3A 5FZHA 3KLSA 1PK6B 4L0PA 1VBB2 1RUF2 4CP9A 4LO7A 4MUVA 1F4AA 3KT7A 3LSEA 5BUVA 4NMIA 4QB1A 2VNOA 4OUMA 3VDDB 5F3CA 1D2SA 4E2SA 1W04A 1Y9GA 2DUOA 4XABA 1BBT2 3KT4A 5EZWA 1GR3A 3W20A 4AEDA 1OXCA 4AE2A 1RVF2 1GP4A 4MXVA 1APNA 4QHZA 4XFIA 4BB3A 4LEJA 1ONAA 2ZGKA 2YGLA 5T3NA 1F9KA 4N90A 5M0TA 4W6YA 5HV0A 3PMSA 3UT0A 1MZFA 1LNSA 2ATFA 1ND2B 2C5DA 4S2HA 3UJQA 1TG7A 2BOIA 1CIWA 2R072 5GLZA 2EIEA 1GLHA 3LB9A 2QDNA 1EPZA 1NE6A 3ZFEA 5JMCA 2CSGA 3O0WA 1LHNA 2R062 2F17A 2ZZQA 2BNMA 2HWB3 1AJOA 1BVP1 3LF7A 5JR7B 2TNFA 3H1YA 2XLGA 1CQ9A 5EWSA 2R061 2VOKA 5FZDA 4Y33A 5A33A 5C8CC 1GWMA 1RGSA 4C8DA 3EBRA 4OMDA 3LZZA 4XUNA 5DUVA 5LA9A 1QDCA 2WQ4A 1WW6A 4E8CA 1YIPA 3NL1A 1C8M3 4JGZA 4ZZ5A 3H1WA 1U12A 4XACA
chains in the Genus database with same CATH topology
4W8JA 2WN3A 3FHQA 1T2XA 1UXZA 1DP0A 3OEAA 4W4ZA 3I2HA 2XQXA 1D7PM 3UESA 4XZUG 3T0DA 1CZSA 3GGLA 1CX1A 4CU7A 4ARXA 1NX9A 1GQPA 3WF1A 3CDZB 1JZ2A 4RN5A 3VDAA 2E26A 3DYMA 4BJ0A 2WO3A 5G04L 3I3DA 4TXWA 5JMOA 1UZ0A 1W9TA 3C7FA 1JZ5A 3A21A 3A22A 1K42A 3T2PA 3UNPA 1PX3A 3WNLA 2YB7A 3JXSA 4XUQA 1SDDB 3SKVA 4D0QA 4XVHA 1H6YA 1UY3A 3LPGA 4FI9A 2WZEA 2Y6KA 4BDVB 3MUY1 2EIBA 2QBXA 1NUKA 5HXMA 1JZ8A 1GOHA 4KMQA 4BXSV 4QDSA 1XNTA 2JD9A 3THDA 2VMCA 3MO4A 5DQ0A 5JR2A 1PMJX 2VZUA 2VQTA 3PUIA 1HN1A 1UY1A 1CIYA 4BK4A 2VMDA 2VZ1A 4DUWA 5IYYA 1F4HA 4OUEA 4UI9L 5CYYA 3MBWA 2XOMA 2LS6A 3T2OA 4CU8A 3OB8A 3OGSA 2VCBA 3NNGA 1W8OA 4CU6A 3NJXA 3T09A 3OG2A 3VDBA 3NRUA 3VD4A 1JI6A 1GOGA 3WQBA 3WNPA 3OGVA 2VO5A 3WF4A 2ZEXA 1XPWA 1BHGA 3K77A 2W87A 3OEBA 3J7HA 2QQLA 3IIIA 3LE0A 4P08A 5IFTA 2BGPA 4GWIA 2EICA 5JXJA 3WF0A 3HNMA 1UYYA 3FHAA 2Y64A 2QQMA 3SEEA 2J1SA 1PMHX 2ZEYA 2PQSA 4A3ZA 1XC6A 3VDCA 2V4VA 5C71A 1DYOA 4ARYA 2J1AA 2ZEZA 4QX2A 4KI5M 5EJ1B 2VC9A 4YPJA 3WNOA 1US3A 2ID4A 2QQJA 3HJRA 3LEKA 1CZVA 3I3EA 3MV01 4DUXA 3BN6A 4QDQA 5JUVA 2W1UA 1JHJA 1KEXA 3CQOA 1IQDC 1JYVA 5IFPA 5LA0A 2JKXA 1ULPA 3I2GA 4CVUA 4DEVA 3C7HA 3T0AA 2HLEA 4A41A 4QX0A 2Y8KA 3T08A 3ACGA 3GXUA 4CU9A 5C7GA 1GMMA 1WKYA 3NJVA 2VZQA 2VCAA 3VD9A 2W1WA 3NQHA 4DXTA 3I97A 3FN9A 2W46A 2VQUA 2R7EB 3SKJE 4RYDA 1YQ2A 2J7MA 4DXSA 3HOBA 2WBKA 5F7UA 4UOJA 3ECQA 1R64A 5J1XA 2J22A 2W1QA 2VR4A 2VZSA 3ZM8A 4XUTA 2BERA 2J1EA 4IUGA 2E32A 4XUPA 1OT5A 5EJZB 2W95A 3I2IA 2X10A 1J84A 4MO3M 2V72A 2VMFA 4GWJA 4OZOA 3EYPA 1W9SA 3WF3A 1NAEA 4CUAA 2B9VA 2QQKA 1UMHA 3CZJA 1SHWB 3EB7A 5LA1A 3K75B 1JYWA 1KGYA 1L7QA 2ORZA 4GZ9A 1WCQA 5B4XA 4W50A 5EIYB 2L9LA 1W0NA 5CZKA 3CZUA 3P1IA 2EIDA 4OMCA 1EUUA 5I0DA 5LCWL 4MOAA 3OGRA 3HPNA 3WF2A 3VD5A 2ZXQA 4BK5A 3ABZA 3A23A 1UYXA 2E33A 3LQCA 5IJRA 1SG3A 4QAWA 4A4AA 2W92A 4DUVA 4A42A 3C8XA 3HEIA 3A7QA 1JYNA 1OD3A 2Z4FA 2WYSA 1GUIA 3UETA 1K3IA 3HNYM 4MGSA 3D3AA 3GDBA 1OF3A 2QQOA 1O8SA 2DCJA 2J1RA 4A6OA 4DXRA 2J1TA 5JXGA 2W1SA 4ZZ8A 2JDAA 1O8PA 4QB2A 5LA2A 1J83A 2WDBA 2V5DA 2CDOA 2LW8A 2Y6LA 2BBAA 1W9WA 1UYZA 2Y6GA 3CMGA 2VOTA 1UWWA 3VD3A 1JZ6A 2XONA 1H6XA 5FUIA 5A1AA 3DYPA 3IB3A 3K4ZA 3LEGA 3E1F1 2VZVA 2BZDA 4LKSA 3MUZ1 2W9XA 5HPOA 1L7RA 2DDUA 4ZXEA 2VZ3A 1UMIA 2YFUA 2XHNA 4P02B 4A45A 4DEQA 2C4XA 4QX1A 2W3JA 2B4KA 2WABA 2RVAA 3C7EA 5G05L 1GNYA 2WZ8A 3ETPA 1EUTA 1UX7A 4LPLA 4QDRA 1ULOA 4M4PA 1DLCA 2VM9A 3FL7A 3LEIA 3MV11 2VL4A 4XURA 4QX3A 1TVGA 2WN2A 3I2JA 3P6BA 4P00B 3W5MA 3ACIA 3I3BA 1UXXX 2W47A 4JKLA 3T2QA 3T0BA 2QQIA 2VZPA 3WEZA 2Y6JA 1O59A 2RJ2A 4JKMA 4UAPA 2HYXA 1JU3A 2C26A 3C7GA 4QB6A 4XUOA 3SEPA 4D8MA 1PX4A 4HG6B 1US2A 3WNNA 4OYUA 5JXHA 1OH4A 1UY2A 2VZOA 4AG4A 4JHZA 4PF1A 2C9KA 3BGAA 4M4RA 2VCCA 2VZTA 1JU4A 2X09A 3ACHA 4JKKA 1CZTA 2VZRA 2J1VA 2E31A 4ZY9A 2RV9A 4Z2AA 2W94A 3AC0A 4AAXA 1W99A 4CUBA 3F2ZA 1K12A 4P5YA 5DPNA 2OKXA 1MPXA 2J1UA 2YFZA 3ACFA 1NKGA 3GM8A 3IDAA 2YC2A 2JE8A 2WAOA 1JZ3A 2BGOA 1UY0A 2VTFA 3VD7A 1P8JA 3HN3A 1W8NA 1OF4A 4LQRA 3LPFA 1JZ7A 2YG0A 1I5PA 1RYYA 3CIHA 2KD7A 3IAPA 2X05A 3C7OA 4ET7A 3OBAA 5DN2A 3THCA 4CUCA 4L0PA 4PQQA 2W5FA 4KWUA 5B4NA 2ZEWA 1F4AA 4PT6A 3K4DA 4QB1A 3U37A 3HNBM 2ORXA 2WQ8A 3K4AA 3WNKA 2DCKA 3WNMA 2VJXA 2WO1A 5JXIA 2W91A 4TTGA 2Y6HA 2WAAA 4QPWA 4A44A 4E8DA 3W5NA 3DYOA 2YC4A 3WSOA 4LHSA 1LNSA 1XNAA 5IHRA 1TG7A 5DMYA 1GU3A 3I2KA 2EIEA 1UY4A 2VMEA 3IAQA 4MADA 3K46A 2WUHA 2QQNA 3PUHA 1K45A 4JX0A 1GOFA 1JYXA 2CDPA 3DECA 4OMDA 4E8CA 4XUNA 1JZ4A 4MGQA 4ZZ5A 3CKHA 3I2FA 2WO2A 5C70A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W8J A;  2WN3 A;  3FHQ A;  1T2X A;  1UXZ A;  1DP0 A;  3OEA A;  4W4Z A;  3I2H A;  2XQX A;  1D7P M;  3UES A;  4XZU G;  3T0D A;  1CZS A;  3GGL A;  1CX1 A;  4CU7 A;  4ARX A;  1NX9 A;  1GQP A;  3WF1 A;  3CDZ B;  1JZ2 A;  4RN5 A;  3VDA A;  2E26 A;  3DYM A;  4BJ0 A;  2WO3 A;  5G04 L;  3I3D A;  4TXW A;  5JMO A;  1UZ0 A;  1W9T A;  3C7F A;  1JZ5 A;  3A21 A;  3A22 A;  1K42 A;  3T2P A;  3UNP A;  1PX3 A;  3WNL A;  2YB7 A;  3JXS A;  4XUQ A;  1SDD B;  3SKV A;  4D0Q A;  4XVH A;  1H6Y A;  1UY3 A;  3LPG A;  4FI9 A;  2WZE A;  2Y6K A;  4BDV B;  3MUY 1;  2EIB A;  2QBX A;  1NUK A;  5HXM A;  1JZ8 A;  1GOH A;  4KMQ A;  4BXS V;  4QDS A;  1XNT A;  2JD9 A;  3THD A;  2VMC A;  3MO4 A;  5DQ0 A;  5JR2 A;  1PMJ X;  2VZU A;  2VQT A;  3PUI A;  1HN1 A;  1UY1 A;  1CIY A;  4BK4 A;  2VMD A;  2VZ1 A;  4DUW A;  5IYY A;  1F4H A;  4OUE A;  4UI9 L;  5CYY A;  3MBW A;  2XOM A;  2LS6 A;  3T2O A;  4CU8 A;  3OB8 A;  3OGS A;  2VCB A;  3NNG A;  1W8O A;  4CU6 A;  3NJX A;  3T09 A;  3OG2 A;  3VDB A;  3NRU A;  3VD4 A;  1JI6 A;  1GOG A;  3WQB A;  3WNP A;  3OGV A;  2VO5 A;  3WF4 A;  2ZEX A;  1XPW A;  1BHG A;  3K77 A;  2W87 A;  3OEB A;  3J7H A;  2QQL A;  3III A;  3LE0 A;  4P08 A;  5IFT A;  2BGP A;  4GWI A;  2EIC A;  5JXJ A;  3WF0 A;  3HNM A;  1UYY A;  3FHA A;  2Y64 A;  2QQM A;  3SEE A;  2J1S A;  1PMH X;  2ZEY A;  2PQS A;  4A3Z A;  1XC6 A;  3VDC A;  2V4V A;  5C71 A;  1DYO A;  4ARY A;  2J1A A;  2ZEZ A;  4QX2 A;  4KI5 M;  5EJ1 B;  2VC9 A;  4YPJ A;  3WNO A;  1US3 A;  2ID4 A;  2QQJ A;  3HJR A;  3LEK A;  1CZV A;  3I3E A;  3MV0 1;  4DUX A;  3BN6 A;  4QDQ A;  5JUV A;  2W1U A;  1JHJ A;  1KEX A;  3CQO A;  1IQD C;  1JYV A;  5IFP A;  5LA0 A;  2JKX A;  1ULP A;  3I2G A;  4CVU A;  4DEV A;  3C7H A;  3T0A A;  2HLE A;  4A41 A;  4QX0 A;  2Y8K A;  3T08 A;  3ACG A;  3GXU A;  4CU9 A;  5C7G A;  1GMM A;  1WKY A;  3NJV A;  2VZQ A;  2VCA A;  3VD9 A;  2W1W A;  3NQH A;  4DXT A;  3I97 A;  3FN9 A;  2W46 A;  2VQU A;  2R7E B;  3SKJ E;  4RYD A;  1YQ2 A;  2J7M A;  4DXS A;  3HOB A;  2WBK A;  5F7U A;  4UOJ A;  3ECQ A;  1R64 A;  5J1X A;  2J22 A;  2W1Q A;  2VR4 A;  2VZS A;  3ZM8 A;  4XUT A;  2BER A;  2J1E A;  4IUG A;  2E32 A;  4XUP A;  1OT5 A;  5EJZ B;  2W95 A;  3I2I A;  2X10 A;  1J84 A;  4MO3 M;  2V72 A;  2VMF A;  4GWJ A;  4OZO A;  3EYP A;  1W9S A;  3WF3 A;  1NAE A;  4CUA A;  2B9V A;  2QQK A;  1UMH A;  3CZJ A;  1SHW B;  3EB7 A;  5LA1 A;  3K75 B;  1JYW A;  1KGY A;  1L7Q A;  2ORZ A;  4GZ9 A;  1WCQ A;  5B4X A;  4W50 A;  5EIY B;  2L9L A;  1W0N A;  5CZK A;  3CZU A;  3P1I A;  2EID A;  4OMC A;  1EUU A;  5I0D A;  5LCW L;  4MOA A;  3OGR A;  3HPN A;  3WF2 A;  3VD5 A;  2ZXQ A;  4BK5 A;  3ABZ A;  3A23 A;  1UYX A;  2E33 A;  3LQC A;  5IJR A;  1SG3 A;  4QAW A;  4A4A A;  2W92 A;  4DUV A;  4A42 A;  3C8X A;  3HEI A;  3A7Q A;  1JYN A;  1OD3 A;  2Z4F A;  2WYS A;  1GUI A;  3UET A;  1K3I A;  3HNY M;  4MGS A;  3D3A A;  3GDB A;  1OF3 A;  2QQO A;  1O8S A;  2DCJ A;  2J1R A;  4A6O A;  4DXR A;  2J1T A;  5JXG A;  2W1S A;  4ZZ8 A;  2JDA A;  1O8P A;  4QB2 A;  5LA2 A;  1J83 A;  2WDB A;  2V5D A;  2CDO A;  2LW8 A;  2Y6L A;  2BBA A;  1W9W A;  1UYZ A;  2Y6G A;  3CMG A;  2VOT A;  1UWW A;  3VD3 A;  1JZ6 A;  2XON A;  1H6X A;  5FUI A;  5A1A A;  3DYP A;  3IB3 A;  3K4Z A;  3LEG A;  3E1F 1;  2VZV A;  2BZD A;  4LKS A;  3MUZ 1;  2W9X A;  5HPO A;  1L7R A;  2DDU A;  4ZXE A;  2VZ3 A;  1UMI A;  2YFU A;  2XHN A;  4P02 B;  4A45 A;  4DEQ A;  2C4X A;  4QX1 A;  2W3J A;  2B4K A;  2WAB A;  2RVA A;  3C7E A;  5G05 L;  1GNY A;  2WZ8 A;  3ETP A;  1EUT A;  1UX7 A;  4LPL A;  4QDR A;  1ULO A;  4M4P A;  1DLC A;  2VM9 A;  3FL7 A;  3LEI A;  3MV1 1;  2VL4 A;  4XUR A;  4QX3 A;  1TVG A;  2WN2 A;  3I2J A;  3P6B A;  4P00 B;  3W5M A;  3ACI A;  3I3B A;  1UXX X;  2W47 A;  4JKL A;  3T2Q A;  3T0B A;  2QQI A;  2VZP A;  3WEZ A;  2Y6J A;  1O59 A;  2RJ2 A;  4JKM A;  4UAP A;  2HYX A;  1JU3 A;  2C26 A;  3C7G A;  4QB6 A;  4XUO A;  3SEP A;  4D8M A;  1PX4 A;  4HG6 B;  1US2 A;  3WNN A;  4OYU A;  5JXH A;  1OH4 A;  1UY2 A;  2VZO A;  4AG4 A;  4JHZ A;  4PF1 A;  2C9K A;  3BGA A;  4M4R A;  2VCC A;  2VZT A;  1JU4 A;  2X09 A;  3ACH A;  4JKK A;  1CZT A;  2VZR A;  2J1V A;  2E31 A;  4ZY9 A;  2RV9 A;  4Z2A A;  2W94 A;  3AC0 A;  4AAX A;  1W99 A;  4CUB A;  3F2Z A;  1K12 A;  4P5Y A;  5DPN A;  2OKX A;  1MPX A;  2J1U A;  2YFZ A;  3ACF A;  1NKG A;  3GM8 A;  3IDA A;  2YC2 A;  2JE8 A;  2WAO A;  1JZ3 A;  2BGO A;  1UY0 A;  2VTF A;  3VD7 A;  1P8J A;  3HN3 A;  1W8N A;  1OF4 A;  4LQR A;  3LPF A;  1JZ7 A;  2YG0 A;  1I5P A;  1RYY A;  3CIH A;  2KD7 A;  3IAP A;  2X05 A;  3C7O A;  4ET7 A;  3OBA A;  5DN2 A;  3THC A;  4CUC A;  4L0P A;  4PQQ A;  2W5F A;  4KWU A;  5B4N A;  2ZEW A;  1F4A A;  4PT6 A;  3K4D A;  4QB1 A;  3U37 A;  3HNB M;  2ORX A;  2WQ8 A;  3K4A A;  3WNK A;  2DCK A;  3WNM A;  2VJX A;  2WO1 A;  5JXI A;  2W91 A;  4TTG A;  2Y6H A;  2WAA A;  4QPW A;  4A44 A;  4E8D A;  3W5N A;  3DYO A;  2YC4 A;  3WSO A;  4LHS A;  1LNS A;  1XNA A;  5IHR A;  1TG7 A;  5DMY A;  1GU3 A;  3I2K A;  2EIE A;  1UY4 A;  2VME A;  3IAQ A;  4MAD A;  3K46 A;  2WUH A;  2QQN A;  3PUH A;  1K45 A;  4JX0 A;  1GOF A;  1JYX A;  2CDP A;  3DEC A;  4OMD A;  4E8C A;  4XUN A;  1JZ4 A;  4MGQ A;  4ZZ5 A;  3CKH A;  3I2F A;  2WO2 A;  5C70 A; 
#chains in the Genus database with same CATH topology
 1HIX A;  3IPV A;  1GBG A;  1LGB A;  4Q2F A;  1VMF A;  5JIU A;  3OEA A;  2JEN A;  1V6O A;  4AZZ A;  2ZPX A;  1BZW A;  2XL7 A;  1MS1 A;  5HV4 A;  2VNV A;  2JDN A;  4JRL A;  5FLJ A;  3HD8 B;  2A6V A;  3RS6 A;  3AX4 A;  3M8L A;  5I0R A;  4YVS C;  3UGH A;  2EIG A;  1KRI A;  2GC3 A;  2Z5W A;  4URT A;  4OHY A;  1BLZ A;  4HON A;  1QJX 1;  2WFF 1;  2UY9 A;  1D4M 2;  2CGN A;  4KBZ A;  3ZYF A;  1PGW 2;  1AR7 1;  5CFD C;  3ME2 A;  5F2W A;  1NX9 A;  1ND3 B;  4LLO A;  1AR6 1;  1DQ1 A;  3N9P A;  1XNK A;  4QQP A;  5EYY A;  2VMI A;  2E26 A;  4YGD A;  3ZX7 A;  1N1V A;  2D43 A;  2RR1 2;  2YGM A;  3WVJ A;  5LB6 A;  3I3D A;  2VE1 A;  5FK8 A;  5A32 A;  5J48 A;  3VDD A;  3MIC A;  2JB8 A;  1QXP A;  4LXL A;  3ZPY A;  2Z2S B;  3O12 A;  1AZD A;  2XBO 2;  2YC0 A;  3J8F 2;  3A22 A;  5DAW A;  1LEC A;  2I07 B;  1YFU A;  5L36 A;  1LCL A;  3AYD A;  4H14 A;  1AXZ A;  4M3C F;  2AYH A;  2DUQ A;  5FUN A;  1BJQ A;  1SDD B;  1XE7 A;  1C1F A;  1RVF 3;  4IEZ A;  1B35 A;  2FDI A;  1OLM A;  5FPB A;  1XE0 A;  2VUL A;  2ZGS A;  3D8C A;  2C24 A;  1PIV 1;  4AED C;  1QH7 A;  1DZT A;  3MI8 A;  4XVH A;  4CCN A;  1O6U A;  5FO9 B;  1AR9 2;  1IQA A;  2HWD 1;  4MHR A;  4IEV A;  4EWA A;  2Y6K A;  5C3R A;  3ORJ A;  4QM9 A;  1CAU B;  4ZU4 A;  1D2Q A;  1ZZ7 A;  1RXF A;  4QMA A;  2GSY A;  4P14 A;  1BKZ A;  5CFC A;  5A70 A;  1H2N A;  5A7S A;  1GOH A;  4KMQ A;  4PIX A;  4QGL A;  3ZPO A;  5H9S A;  1XNT A;  5J36 A;  5JZG A;  3S57 A;  5JOX A;  3O1V A;  1OLM E;  2WFF 3;  4FPY A;  1V6L A;  1PMJ X;  2G9F A;  3NJZ A;  2DVA A;  1QQP 2;  4XFF A;  5SV5 A;  4BE3 A;  1DQ2 A;  4NHX A;  3UV9 A;  4HPK B;  1TME 2;  1QJF A;  1PGL 1;  3PUI A;  1HV1 A;  1G9D A;  4IQP A;  5A33 B;  5JCT A;  5FZI A;  2VMD A;  1WUV A;  2Z79 A;  2VZ1 A;  4F83 A;  1F4H A;  4OUE A;  4UI9 L;  5CYY A;  4AK3 A;  3MBW A;  2XOM A;  4CRQ A;  4CU8 A;  3T2O A;  3RZM A;  5JOW A;  3H8X A;  3OGS A;  3EMR A;  1BEV 3;  1RJ8 A;  1DHK B;  2Y34 A;  1W8O A;  4Q4W 3;  5A7P A;  1PGW 1;  5J3U A;  4LOR A;  3NJX A;  3T30 A;  3T09 A;  3CNA A;  2ZCW A;  1RMU 2;  2ENR A;  1OVS A;  2D6L X;  4BCU A;  4ERO A;  3BTZ A;  1QKQ A;  2XJV A;  3VBO B;  1YQ6 A;  1Q8O A;  3U10 A;  4QU2 A;  1VBB 3;  1RUC 3;  2Q8C A;  1XPW A;  2D3P A;  5E16 A;  3AP9 A;  5A7N A;  3B00 A;  4E27 A;  3I54 A;  2CTV A;  4HN0 A;  2B39 A;  3OEB A;  4CSW A;  4CP0 A;  2LAL A;  4ATE A;  2FCV A;  3KQ4 B;  3WV6 A;  3E6C C;  2ES3 A;  2VW0 A;  4AHX A;  3LE0 A;  4P08 A;  4TYS A;  2BGP A;  2H6C A;  4NAO A;  2JDU A;  3KWV A;  3HNM A;  1O4T A;  1H8T A;  3INA A;  2BU9 A;  1ZM1 A;  2A3X A;  2WS9 2;  3H3Z A;  2GME A;  2W52 A;  4CEY A;  1VBD 3;  4CDU C;  3MIG A;  2V4V A;  5FRE A;  5C71 A;  2ZML A;  4FVV A;  4MXW B;  3TWI A;  5JPM B;  4KI5 M;  1WMD A;  2JEM A;  2XPJ A;  2XGX A;  3J4U H;  1EAH 3;  4MSV A;  4LBQ B;  1W6Q A;  3N7L A;  4LTA A;  1US3 A;  2BV4 A;  3HJR A;  3QLQ A;  3V0A B;  3EO6 A;  5D8A C;  1TME 3;  2D6N A;  3GJA A;  1GYK A;  4UW3 A;  3HIF A;  4DUX A;  4ES8 A;  4XET A;  1PMI A;  2DV9 A;  1V9U 1;  5F37 A;  1KFX L;  3DPR A;  1IS4 A;  3ZIX A;  1NCR A;  1MS9 A;  2ZHL A;  4E2G A;  2FDK A;  3ZDV A;  4QXH A;  3T0A A;  3FHI B;  3LWC A;  4OHX A;  1K5M B;  3IDE A;  4LE3 A;  2ZX0 A;  4Q4Y 3;  3T08 A;  3GXU A;  5C7G A;  1GMM A;  2E7Q A;  4E4H A;  1W9F A;  2VNR A;  5FZO B;  4XIO A;  4Q0U A;  1GZ9 A;  4RR3 B;  3RWN A;  4YM2 A;  1POV 1;  4Q29 A;  4DXT A;  5DUX A;  5FKC A;  2WT2 A;  3H8U A;  2XJP A;  4GKY A;  1AX0 A;  4I0W B;  4R9B A;  4Q8K A;  1CAX B;  4KGQ A;  3SKJ E;  3VZN A;  2IVJ A;  1YQ2 A;  2J7M A;  2IZW A;  3PUS A;  5FP8 A;  3RMY A;  2WBK A;  4KQ7 A;  3DN7 A;  3NNM A;  3M4F A;  1N1S A;  1WLC A;  4QGM A;  5DAQ A;  1Y43 B;  4L9B A;  1NQJ A;  5DZG A;  1EAH 1;  4YW2 A;  3OD4 A;  5CIS A;  5J1X A;  4IXL A;  3T2T A;  1R09 1;  2J22 A;  2W1Q A;  5TSW A;  3TEW A;  1WD4 A;  3N9Q A;  2E32 A;  4P9L A;  5FZ4 A;  3ZFG C;  1CAV A;  1VMH A;  3GF6 A;  3PJY A;  4QKD A;  4UFL A;  1ZBA 1;  1UAI A;  1RC6 A;  3OUJ A;  2D40 A;  2IVI B;  5LY1 A;  3VZJ A;  1WLW A;  4EYU A;  3ZMN A;  5A6X A;  4FFI A;  3AZZ A;  3ZSE A;  4E4S A;  1HXS 3;  5KC6 A;  4D6Q A;  1RUE 3;  1WW5 A;  4WVM A;  2VOW A;  4Y5T A;  2H6B A;  3K75 B;  1NCQ A;  2C0Z A;  1PO1 2;  2HKX A;  1LES A;  1KGY A;  1DLL A;  1L7Q A;  3OBT A;  1RUC 2;  5I8S A;  3W21 A;  2O14 A;  3KV5 A;  4QHO A;  4UFM A;  2XML A;  2ZAC A;  3K51 A;  4W50 A;  1HRI 1;  1CJP A;  4FPC A;  2VXJ A;  4XF4 A;  5EIY B;  1W0N A;  1PZ9 A;  3VKM A;  3D6E A;  3WG1 A;  2Y0I A;  3CZU A;  2Y6F A;  2VOX A;  3P1I A;  3AP6 A;  1CPM A;  4NII A;  5L7O B;  1U5Z A;  4OMC A;  1ODM A;  2ZAH A;  5FYC A;  5BNP B;  1HQL A;  1RUD 1;  3KMH A;  1YI7 A;  2K9Z A;  4PI2 A;  1ZA7 A;  4EZ4 A;  3VD5 A;  3N9M A;  1LU2 A;  1HW5 A;  4XJ8 A;  4BK5 A;  3MLL A;  2DFC A;  1UD1 A;  3LSD A;  5C3Q A;  1SG3 A;  1PIV 3;  2R07 3;  3FZ3 A;  4QX5 A;  3ZKY A;  3VBU B;  2D6M A;  3B02 A;  3ZVX A;  5KWR A;  2VU9 A;  1KIT A;  4NIA A;  2A3Y A;  2VBP A;  1AX1 A;  4I02 A;  2BVV A;  4HN1 A;  5EXO A;  3U0Z A;  3CJI A;  3NV1 A;  4KGG A;  1WA4 A;  1V6I A;  1VBE 2;  1H2K A;  2DUR A;  3N9O A;  1JYN A;  1OD3 A;  5FP4 A;  1ZBE 1;  3AZX A;  3MF9 A;  4IE0 A;  2GAU A;  4J25 A;  4C1W A;  3I4I A;  4WVW A;  1H4G A;  2JG8 B;  3USS A;  2BWA A;  3GDB A;  5JOZ A;  1ASJ 3;  1OF3 A;  3M3E A;  4LE4 A;  4JRA A;  1Y4W A;  2JEC A;  4YW3 A;  4AWD A;  1UKG A;  4QXK A;  1MS5 A;  4BMB A;  1W2T A;  4A6O A;  4Q4Y 1;  5IVF A;  5FOJ B;  4ZS3 A;  1MS4 A;  3VZK A;  5LK7 B;  2JDA A;  5K0U C;  2VOV A;  3EXU A;  2Y38 A;  2OUJ A;  5F8P A;  4PCR A;  5ISL A;  4QXC A;  3PDQ A;  2UWB A;  1PVC 3;  3GZU C;  1ZRF A;  3ILN A;  1MQT A;  2IXH A;  3H3L A;  4YGE A;  2AC1 A;  3WXP A;  1SLB A;  2DCT A;  2HBU A;  1FAT A;  1UWW A;  1OA3 A;  4AFC A;  4Q5O A;  5ACA 2;  5HCA A;  5KHG A;  2G9G A;  4XF0 A;  1OPM A;  5LK5 A;  4AFM A;  3J26 N;  4AVC A;  2A71 A;  5A1A A;  3AFK A;  2VTX J;  4SLI A;  1ZVF A;  1NLS A;  2BZD A;  3IT8 A;  1RUG 1;  4WM8 B;  5I0S A;  4BQ2 A;  1UN1 A;  1QEX A;  3HT2 A;  4UW5 A;  3ZSL A;  1HJG A;  2D3S A;  3HQR A;  1DQ4 A;  3WT3 A;  3V56 A;  4NID A;  2CV6 A;  4UBG A;  5AFB A;  5DUW A;  4YWA A;  4QQO A;  2R06 3;  3IBM A;  4AHW A;  2WNV A;  3O0X A;  1UNB A;  4RA0 A;  2HWB 2;  2W3J A;  3JQX A;  1H1M A;  1S0I A;  3FUQ A;  4XF1 A;  2VCM A;  1V70 A;  2OT7 A;  2D6P A;  3GCW A;  2RVA A;  2WYF A;  2ZZJ A;  3LDK A;  2V5Y A;  2WZ8 A;  4OI4 A;  1DYP A;  5DAP A;  4YW7 A;  3BUC A;  1WW4 A;  1OUR A;  4K8F A;  1RUE 1;  4CPB A;  1BBT 1;  3DL3 A;  3NO8 A;  2BFU L;  2WNU B;  2EXK A;  4KWJ A;  3FL7 A;  5BV6 A;  3KSC A;  2ARX A;  5F5C A;  1MEC 2;  5BNN B;  1TVG A;  3I2J A;  2R6Q A;  4CEY C;  2NMN A;  4DZG A;  1MS0 A;  4NIG A;  4O9G A;  1UZZ A;  5EPA A;  1UXX X;  2DVD A;  4JKL A;  3ZSK A;  2BGC A;  1NXD 1;  2DYC A;  4NRO A;  4RR3 A;  4FSJ A;  4GJY A;  1QJU 3;  3O0V A;  4B4Q A;  2YPD A;  2CNA A;  2Y6J A;  3LIG A;  3POE A;  2YU1 A;  3SIT A;  1GZW A;  1PZ7 A;  4AEJ A;  4EE2 A;  2WFP A;  4PHZ A;  1RUH 3;  4UAP A;  2WT0 A;  1JU3 A;  4RD7 A;  1BK1 A;  5GZD A;  4WM8 A;  4MZU A;  3ZN6 B;  1AL0 G;  3PJQ A;  4HSJ A;  4NVP A;  3ZXJ A;  3KGL A;  1V9U 2;  1H9P A;  1IS6 A;  5T5P A;  3SQO A;  3JBG 2;  1J3R A;  5K0U B;  3ATG A;  4B4R A;  5DDJ 2;  1QXR A;  4AG4 A;  2BJS A;  1GIC A;  1Z7S 3;  1UYP A;  2VVD A;  2E6V A;  3BGA A;  1AL2 3;  3GBG A;  1LOC A;  1QJY 2;  1WBF A;  4QX7 A;  5FQ0 A;  2P34 A;  4N53 C;  3OTF A;  4IEO A;  1BBT 3;  1ULD A;  2R49 A;  2RV9 A;  4XJU A;  1JXN A;  2W94 A;  3AC0 A;  1SFY A;  3KCC A;  3ZLI A;  4UWD A;  3TBD A;  1S0D A;  1RUC 1;  1OFN A;  5JDB A;  2OKX A;  4K1Y A;  2J1U A;  5FYS A;  2YFZ A;  1F35 A;  2EXJ A;  3GM8 A;  4HSL A;  3NKG A;  1YRZ A;  1K5M A;  2VVF A;  1RVF 1;  3N9L A;  2CGO A;  3LA7 A;  3HQX A;  3CO2 A;  4XCA A;  1RUG 3;  1A78 A;  1FPN 2;  2VTF A;  2CY6 A;  4AI8 A;  5LAT A;  4BQ3 A;  5C8W A;  3AKP A;  1RHI 1;  3R4S A;  2VXR A;  5L7O A;  1CWP A;  1OFS A;  2ADE A;  2YG0 A;  3CIH A;  3IAP A;  5L9V A;  2BBV A;  2BWC A;  4FOQ A;  4ET7 A;  2JJ6 A;  2UYB A;  3GNE A;  1PVC 2;  4LK7 A;  4PQQ A;  3S5A A;  2W5F A;  1TMF 2;  1RMU 3;  4OLL A;  3VBF A;  4ASK A;  4NHK A;  4ZON A;  4D69 A;  2A1X A;  3ZR6 A;  1Q56 A;  3VBH C;  4B7E A;  1G9A A;  3U37 A;  2ORX A;  5C8C B;  4YM0 A;  3HQU A;  3VBH B;  5FZL A;  2DVG A;  3U4X A;  4TN7 A;  5FMO L;  5H9P A;  1FPN 1;  1UZV A;  2HWE 3;  4B3N A;  3N35 A;  1GWK A;  4BA6 A;  1UOF A;  1QIQ A;  4E4Z A;  2VUD A;  2Y6H A;  2WAA A;  4A44 A;  4E8D A;  4K1Z A;  4I09 A;  1UW8 A;  4ITC A;  3UKT A;  1QQP 1;  1SLL A;  1OHF A;  3VBR C;  4NHY A;  2IXI A;  3FBY A;  5CKN A;  3WSO A;  1GZW B;  1ND2 C;  1SBF A;  1TNR A;  1UX6 A;  2WLP A;  1S0G A;  5DMY A;  4GMP 0;  1RUJ 1;  4WVM B;  1DQ6 A;  1STM A;  5ABJ B;  2EAK A;  2F6B A;  2QQV A;  2VME A;  1UIJ A;  3ASI A;  1W06 A;  3WUD A;  1CGP A;  3MPP G;  5F1R A;  2WUH A;  4DOU A;  1S2E A;  4HKL A;  5T5J A;  3ZN4 A;  1VBD 2;  2ZAA A;  5JAX A;  5HCF A;  2QJV A;  5LAS A;  4FPL A;  4JX0 A;  1GOF A;  3CU7 A;  1JYX A;  2ZGT A;  2UUR A;  3WHT A;  3VDD C;  3AP5 A;  2NN8 A;  3DEC A;  2D5F A;  4L8Q A;  4YZ2 A;  1TZO A;  1DIW A;  1VBC 3;  4KH9 A;  4UFK A;  4HVQ A;  1SLT A;  2OZJ A;  4FPE A;  4EN0 A;  5FXV A;  4Z82 A;  2C6S A;  2WN3 A;  3RZL A;  3FHQ A;  4CCO A;  2VAU A;  3UJO A;  2XBO 1;  1UXZ A;  4S2D A;  3TN9 1;  3WP3 A;  1DP0 A;  3QAC A;  5FLI A;  3RI8 A;  3TEZ A;  2TUN A;  3MIE A;  4K3U A;  4K6B A;  4ZXK A;  3CF6 E;  4W4Z A;  2MEV 3;  1MVE A;  5A3U A;  1RXG A;  2RR1 3;  2VQA A;  4J1W A;  1ENX A;  3P5B A;  1N47 A;  2PXJ A;  1OOP C;  4ONU A;  5T50 A;  4GB3 1;  4Q4V 2;  4BPZ A;  1BXH A;  4Q4W 2;  3EQE A;  4QPI C;  1AR7 2;  2JIJ A;  4PLO A;  1ZRR A;  1BEV 2;  4FP2 A;  2A70 A;  1AR8 1;  1SCS A;  2WNO A;  4YVW C;  3AJZ A;  3U4S A;  4NJ4 A;  1DFQ A;  2WWS A;  1QJX 2;  1ZBA 3;  5FP9 A;  5FYB A;  1AYM 1;  3CDZ B;  5FY7 A;  1OC1 A;  4GIQ A;  4RN5 A;  3VDA A;  4AQT A;  5K9Y A;  4IL7 A;  3ZXD A;  2KM2 A;  3DYM A;  3G6J B;  1XOY A;  4BJ0 A;  4IV1 B;  2IFR A;  2OPW A;  5G04 L;  1RMU 1;  3DKW A;  4TXW A;  3I7D A;  1NLR A;  4BIO A;  3PUA A;  3C7F A;  5C33 A;  3A21 A;  4FCA A;  1H2L A;  1DZR A;  2LTN A;  4FPF A;  1K42 A;  5FZ3 A;  3VZL A;  2ET1 A;  4Y1Y A;  1AF9 A;  2B8M A;  3VBH A;  2PHT A;  3NV4 A;  4DIQ A;  1W6N B;  4XUQ A;  3JXS A;  4FPO B;  3N3H A;  4CCM A;  2VVE A;  2A3W A;  4WVV A;  3VL8 A;  5A1L A;  2BTV C;  4O61 A;  5A32 B;  3SKV A;  5FPV A;  1UQX A;  1W6Q B;  2PAM A;  4LBK A;  2IXC A;  4LT5 A;  1IHM A;  5FYZ A;  3ZN6 A;  3NNF A;  2XDV A;  5BYN A;  2ZTN A;  3WCR A;  4Q8L A;  2IC1 A;  4FI9 A;  4NWV A;  3DCQ A;  2WZE A;  3OUI A;  1ASJ 2;  1JYI A;  3MUY 1;  2ZHM A;  3K48 A;  4FTB A;  3ZXL A;  2XJU A;  3SNM A;  3RFR A;  2K0G A;  4YFW A;  2R0F A;  4GQ7 A;  1R09 3;  3MPB A;  2WZR 1;  5T5O A;  3ZXE A;  4MG2 A;  1VBE 3;  2VUC A;  2X53 S;  3KV6 A;  2A5Z A;  2X8K A;  3KF3 A;  4FPG A;  3THD A;  2DBI A;  4LUL A;  4U36 A;  5FXZ A;  4XAE A;  2E51 A;  4OHV A;  2BRT A;  1PO1 3;  4TSV A;  4XCB A;  4Y4Y A;  1OUS A;  1URX A;  5BNN C;  3RYK A;  5CFD A;  5FO8 B;  1GNH A;  1MAC A;  5H9R A;  2BW8 A;  3NST A;  2BP6 A;  4YG6 A;  4B29 A;  5FWJ A;  1LOF A;  1NQD A;  4B1L A;  4DUW A;  3VL9 A;  4IEQ A;  4KWL A;  1HX6 A;  2LS6 A;  2WR9 A;  4LKE A;  3WZ1 A;  1V00 A;  2XVG A;  3POY A;  2V09 A;  1VBA 2;  4I0A A;  4Y26 A;  1IG0 A;  4IEW A;  2VCB A;  3RJ2 X;  3U11 A;  3KS7 A;  1YFX A;  3PIG A;  5E1R A;  1W3X A;  1BEV 1;  5DXD A;  1Z78 A;  5F5A A;  3KVA A;  5GJ6 A;  3KCY A;  4QKN A;  5LBB A;  1NOV A;  4GB3 2;  3KV4 A;  4Q4V 1;  4R4Z A;  2A75 A;  1RUF 3;  3MHZ A;  4XZP A;  4AQS A;  3K2O A;  5JI9 A;  4XFB A;  1O3Q A;  2RR1 1;  3ILR A;  2VO5 A;  1A8M A;  4J1X A;  2OX0 A;  2A6W A;  3W59 A;  3JB8 A;  3ZXG A;  1PK6 A;  3PVB B;  4C91 A;  4Z92 B;  2WWJ A;  1RUI 3;  4CDU A;  5L73 A;  1SLI A;  3WCS A;  3RZJ A;  4DPN A;  2XUM A;  3K77 A;  5K8S A;  1XNC A;  2PAE A;  2ADD A;  2FBE A;  3OCP A;  3HT1 A;  4RSU A;  4D7T A;  3III A;  4JGY C;  1G9C A;  4GWI A;  1PHM A;  4AED B;  1EYB A;  3WF0 A;  1XQN A;  4MVT A;  4PBO A;  3SEE A;  4NHL A;  3ZFF C;  1W6P B;  4UF0 B;  4GB3 3;  4UXA A;  1GFF 2;  3WUC A;  4MH0 E;  4XIK A;  2IWG B;  5FBZ A;  2AAC A;  1LKN A;  5FAX A;  1DU3 D;  1XC6 A;  3VDC A;  5C3O A;  2JIC A;  1VBD 1;  2AEY A;  4BZ4 A;  1VB4 A;  4G9S B;  4ARY A;  2J1A A;  4QX2 A;  2CWS A;  3NJY A;  4YZ3 A;  1ZZ6 A;  4MGI E;  4WZF A;  2VC9 A;  2MNG A;  1A34 A;  2R04 3;  3GCX A;  4IGO A;  1N1Y A;  3ZFG A;  2Q1F A;  3ZFE C;  1B35 B;  5FTT C;  4RL7 A;  4XF3 A;  2MPF A;  3LEK A;  2OW4 A;  2PHL A;  4DNY A;  5E6H A;  2WQZ C;  4BQW A;  3MV0 1;  2RS3 1;  5FCC A;  2Q4S A;  3AKQ A;  4PQ9 A;  2HJI A;  5GZF A;  4TLF A;  5JUV A;  2HYK A;  1JHJ A;  1H1I A;  1KEX A;  4HXC A;  3GYD A;  5CFC B;  2P2K A;  1IQD C;  3JZV A;  3VBU A;  5IFP A;  2UYA A;  5LA0 A;  1JH5 A;  1R09 2;  5AVP A;  4QPG B;  3WR0 A;  4URA A;  1AR6 2;  2HWF 1;  3QH7 A;  5FZK A;  5L9B A;  1FAY A;  1VMJ A;  4YZ4 A;  2JWP A;  3UL2 A;  2HLE A;  4A41 A;  1YJK A;  2Y8K A;  4Z8B A;  2WRA A;  3ACG A;  3S5Q A;  2XR4 A;  4AFB A;  4LMF A;  1ENR A;  4XXP A;  3NNJ A;  1QU0 A;  1FMD 2;  3IPV B;  3TNQ A;  2GNM A;  4YVS A;  1U5Y A;  4P9G A;  3OSD A;  3FN9 A;  2W46 A;  4XJ9 A;  3ZN5 A;  1ULG A;  1PM7 A;  4OZX A;  1OMI A;  5F2S A;  3RGB A;  3MGU A;  1RB8 G;  1WZX A;  5JIA A;  4LBQ A;  4QGN A;  3J8F 3;  1KFU L;  1FPN 3;  2QFE A;  2XJQ A;  4UOJ A;  2NPI A;  4AXO A;  1MQT C;  1YNA A;  5IVE A;  1R64 A;  3ITQ A;  1ZRD A;  5E88 A;  4G4F A;  3GZT B;  4HKW A;  3SH3 A;  2HH9 A;  1O5U A;  4IEX A;  3BYW A;  4JAA A;  4YW1 A;  3H42 B;  3LOB A;  5EJZ B;  2W95 A;  2X10 A;  1G9F A;  2BNO A;  5AC9 2;  4GMP 3;  4GWJ A;  1PO2 1;  4OQ9 A;  4D7Y A;  3DXU A;  3EYP A;  3WF3 A;  1AR7 3;  1VLN A;  1AXY A;  1NAE A;  4EN9 B;  2WSV A;  3DUI A;  2W68 A;  4K7J A;  1UMH A;  3ES1 A;  1AL2 2;  1R1Z A;  1SCR A;  1W6P A;  1QJY 1;  1RUJ 3;  1JTZ X;  1SHW B;  1W8H A;  3NWK A;  3PVN A;  2PHX A;  2VBD A;  2PHF A;  4CCE A;  2NP0 A;  3OPT A;  5FMO S;  2RS3 2;  2AR6 A;  1X8E A;  2ARC A;  4WM7 C;  4YW5 A;  3ZFF A;  5A3O A;  3AL5 A;  4FAG A;  5JI7 A;  2GMP A;  4XMA A;  1N3P A;  3KB5 A;  2Y0O A;  4N9H A;  1C1L A;  4I3P A;  3WP5 A;  1VBC 2;  3D4K A;  3B7M A;  3E5Q A;  1S55 A;  4F8A A;  1EUU A;  4WZC A;  4AVB A;  2AUY A;  4KG8 A;  3ZR5 A;  3FWE A;  4I30 A;  5LCW L;  3VV1 A;  5A3P A;  1AR8 2;  5F5Q A;  5KHH A;  5JZG B;  1GV9 A;  5CVR A;  3KV9 A;  3CL1 A;  1AYN 3;  1ZX5 A;  3AVS A;  3I49 A;  1AYN 1;  5FZF A;  1NCR C;  3ABZ A;  1WA6 X;  3A23 A;  1QXJ A;  3GZA A;  2E33 A;  3LQC A;  5FPA A;  3ZYH A;  3USU B;  1SPP B;  2PHU A;  4QAW A;  1QH6 A;  1R08 2;  5H9Q A;  2A7A A;  2ERF A;  2UU8 A;  3BI3 A;  1SMV A;  1DDL A;  1C4R A;  1VRH 2;  2XLA A;  1T6G C;  3HEI A;  1LRH A;  3A7Q A;  3JCI A;  3R0R A;  3TRS B;  3NAP C;  5CAD A;  2Z4F A;  1GUI A;  3ZIW A;  1W9Y A;  1TMF 1;  1VAL A;  3A4U A;  1K3I A;  3N7M A;  2HWE 2;  1POV 3;  4Y24 A;  3RNS A;  3D3A A;  1OQ1 A;  3N7J A;  1JYT A;  2ARA A;  2QQO A;  5FP7 A;  4HVR A;  4AGG A;  2XB6 C;  1ZYB A;  4Y4R A;  4EN8 B;  2DCJ A;  2J1R A;  4FTS A;  1S2K A;  2PYT A;  2DTW A;  5JXG A;  5IVV A;  2AEZ A;  1AXK A;  3DXT A;  1O8P A;  5LA2 A;  1U5I A;  2WDB A;  5FV3 A;  3WIN E;  1Q5O A;  3OBR A;  5IAX A;  2YV8 A;  4UBH A;  4EZH A;  1HLC A;  1W9W A;  4GKX A;  4R4X A;  4JGY B;  3SMH A;  3EJK A;  2UWA A;  4AEK A;  2PMW B;  2VOT A;  3U14 A;  5K4L A;  5ANN A;  1JZ6 A;  1NT0 A;  2XON A;  4R52 A;  3CEW A;  3WQ0 A;  1X36 A;  1X9P A;  2RS5 2;  2GP5 A;  2NMO A;  2A6X A;  3CLP A;  3THT A;  4M3C A;  1E5R A;  4CXW A;  4YW4 A;  3WDY A;  3LEG A;  4MGK E;  4LKS A;  4XTM A;  3DEM A;  5B2G B;  3AK0 A;  3ILF A;  2B7Y A;  2W9X A;  4UW4 A;  4CDQ A;  2ET7 A;  2DDU A;  4NO4 A;  5FYH A;  4JCK A;  4D6S A;  1NCQ B;  1UMI A;  3W58 A;  5IK4 A;  2YFU A;  3RI9 A;  4FPH A;  2XHN A;  2P6C A;  4P02 B;  1QJU 1;  3E6D A;  5AC9 1;  3BTY A;  4U2A A;  5DG2 A;  4A45 A;  4LA3 A;  5FYY A;  3VKN A;  1HRV 1;  3B5L B;  2WAB A;  3RYP A;  4FT8 A;  4QKB A;  3WX5 A;  1G7Y A;  3ETP A;  1E5H A;  2GU9 A;  1UX7 A;  4PIZ A;  1PVC 1;  4CCK A;  4CP1 A;  2FHR A;  1CAV B;  3HBK A;  2FMD A;  1DLC A;  4XXA A;  2VM9 A;  1OI6 A;  3AYC A;  1U5X A;  3MFA A;  1IPS A;  1GP5 A;  3VGI A;  3MV1 1;  1C28 A;  3ZDS A;  1JW6 A;  3GZE A;  4QX3 A;  2WN2 A;  1HRI 3;  3JB4 C;  1W05 A;  2D44 A;  2WFF 2;  5EFU A;  1S0C A;  2JXA A;  2XKO A;  2OZ6 A;  3K3N A;  4PDW B;  2J42 A;  3T0B A;  2XJT A;  1AX2 A;  1W6M B;  1QHD A;  2QQI A;  1N3O A;  3VHO A;  4GAL A;  1RUD 3;  3OJB A;  2QZ2 A;  4DS0 A;  4COU A;  3AVR A;  3LFM A;  4HMZ A;  4V2W A;  1O59 A;  2R16 A;  4X8P A;  1V6K A;  2PA7 A;  1UZW A;  3KM5 A;  2XKP A;  1CAW B;  5T55 A;  1S0F A;  5CG9 A;  4OI2 A;  5KHK A;  3M2M A;  4QB6 A;  1XXN A;  3W9A A;  3SEP A;  3AZY A;  3O1T A;  2W0X A;  2R30 A;  2ARE A;  4EWE A;  1LU1 A;  4D7S A;  2HEV F;  2P3J A;  4L97 A;  1W03 A;  4TWT A;  4UFH A;  3KF5 A;  3WNN A;  2ZJC A;  3TN9 2;  4OYU A;  1RL3 A;  4XJA A;  1OH4 A;  4CCL A;  4JHZ A;  5BNO A;  1LHO A;  4RQP C;  5BNQ A;  4NPR A;  2GC1 A;  1YJL A;  3L2Y A;  4M4R A;  1JU4 A;  1ZZ8 A;  3ACH A;  1H8V A;  3BVC A;  2VZR A;  4MLO A;  4A7K A;  3QH6 A;  4QPY A;  4JDO A;  1HB2 A;  1O3R A;  1PZ8 A;  1VR3 A;  4YNI A;  4AAX A;  4XFA A;  1W99 A;  4CUB A;  3CHX A;  5HCB A;  3F2Z A;  4LLF A;  2VQ0 A;  2DTY A;  4A3X A;  3ZYB A;  4HLT A;  2K2S A;  4M00 A;  4LO4 B;  3AZW A;  1JOP A;  4M3C B;  1W6N A;  5IVJ A;  3HR9 A;  5FPZ A;  5GAL A;  5CKM A;  4AI3 A;  2WAO A;  2YUE A;  1JZ3 A;  2BGO A;  4DIN B;  2EAL A;  4ASL A;  4CA9 A;  4C0H A;  3VBF B;  4JV4 A;  2BEO A;  4I3G A;  2NQY A;  1HXS 1;  1MEC 1;  2Q0A A;  1OF4 A;  1D4V B;  3FX3 A;  4LQR A;  4H55 A;  3AKR A;  4XFC A;  1VAV A;  1XYO A;  2RM2 1;  1W6O A;  4Y22 B;  1JZ7 A;  4CPB D;  1CAU A;  1J3P A;  4C90 A;  3C7O A;  1V0A A;  2X5I C;  4IV3 A;  4CUC A;  4CDX A;  4KWU A;  3BOD A;  2G4I A;  3VHR A;  5FPU A;  1ZBE 2;  1UPS A;  1QDO A;  2ZEW A;  3ZXA C;  3IMN A;  2HWB 1;  4LO8 A;  4PT6 A;  3K4D A;  3VBS B;  4LBO A;  3HNB M;  3SIS A;  1RED A;  3LFI A;  1HJF A;  4OHW A;  5FZB A;  4FO9 A;  5KBF A;  2JG8 C;  3U1X A;  1IOA A;  3E5U A;  3QCW A;  3WNK A;  2CAV A;  1NCQ C;  1VBA 1;  3WNM A;  1KDM A;  2VJX A;  5FWE A;  3RRD A;  5JXI A;  1BYH A;  1OKQ A;  4XJZ A;  5HXV A;  3WP4 A;  4FFF A;  3AXD A;  4XPV A;  3VN4 A;  5LWB A;  1CN1 A;  3OGJ A;  4TTG A;  1CES A;  1E5S A;  1W6M A;  2GH8 A;  3AM2 A;  5JOY A;  4BH9 A;  3TOJ A;  3DYO A;  5FY9 A;  3D0S A;  1XU2 A;  2D5H A;  3SCG A;  3FE5 A;  4Z1V A;  1RHI 2;  4HK8 A;  1RUO A;  1OOP B;  4CXY A;  1R08 3;  5IHR A;  2ZS6 B;  3RSJ A;  3J7N A;  1GU3 A;  2YHJ A;  2OA2 A;  4D3W A;  2IUW A;  2YBS A;  2WLQ A;  4I0B A;  2ZMK A;  4C1X A;  2A6Y A;  3IAQ A;  3A0K A;  3LA3 A;  1V6M A;  1ST8 A;  4KNC A;  5C6C A;  5F32 A;  3PUH A;  2D3R A;  4XIL A;  1K45 A;  1DQ5 A;  1YLL A;  5FZE A;  2Y26 A;  3B01 A;  3AMN A;  4FPJ A;  4OUL A;  4XDP A;  1V6N A;  1WW7 A;  4NRQ A;  1QOS A;  4CP9 B;  2ZX4 A;  4MHU A;  4R9C A;  5FMC A;  3JQW A;  1SFP A;  2BUK A;  2DVF A;  4Y5S A;  3ZFE B;  3ZYP A;  3ACL A;  3M3I A;  3JUU A;  3WQ7 A;  4MGQ A;  3ZYG A;  5FYT A;  1JZ4 A;  3CKH A;  3I2F A;  2WO2 A;  5C70 A;  3RZG A;  4KU8 A;  4NR1 A;  4AW7 A;  4W8J A;  2B46 X;  1T2X A;  4XAA A;  2Q1Z B;  1ACC A;  3BAL A;  3I2H A;  5GLV A;  4FXG B;  2MEV 1;  4EN6 B;  3GAL A;  1O4Z A;  1ENS A;  1UF2 C;  2XQX A;  5FYM A;  1FOD 2;  3HWJ A;  1OLR A;  2YBK A;  1H9W A;  2RS1 3;  1OSG A;  1REE A;  2A6Z A;  4XZU G;  3AYE A;  1AYM 2;  4EQV A;  4S2G A;  4JGY A;  1O3T A;  4P9Y A;  3GGL A;  5CFC C;  5I91 A;  1IS3 A;  4PF5 A;  4HFS A;  5FZ1 A;  2HWF 3;  4OI0 A;  2Q5T A;  1GQP A;  3WF1 A;  1AJK A;  1COV 3;  3RYR A;  1SZB A;  3LD8 A;  4YGC A;  5KC5 A;  4IDZ A;  4GXL A;  2O8O A;  2WO3 A;  1OVP A;  4IV3 B;  4XBL A;  2W2I A;  3DGT A;  2E7T A;  3BIW E;  4YSF A;  2B5H A;  2RS5 3;  3E5X A;  4O7X A;  5DDJ 3;  1LUL A;  1W9T A;  2OII A;  5GZE A;  3AXE A;  4BLI A;  1JZ5 A;  3M3Q A;  5F5I A;  1QWR A;  1IPK A;  3BPZ A;  3MF6 A;  2ETE A;  2RM2 3;  3O7O A;  4QQL A;  4A7Z A;  3T2P A;  2RHP A;  3POB A;  1PK6 C;  3HAG A;  4Z07 A;  5FZC A;  3VLB B;  3UNP A;  4CEW C;  4Y20 A;  3WNL A;  2YB7 A;  5JSO A;  4E2Q A;  1RUN A;  4E9K A;  1W3V A;  2RMU 1;  1QOO A;  2PQQ A;  5I0T A;  4C0B A;  4D0Q A;  4DFS A;  1W2U A;  4Y1V A;  5C9A A;  2EXI A;  1UY3 A;  3LPG A;  5DZE A;  2EF6 A;  3NV2 A;  3BU7 A;  1ZRE A;  1WMF A;  3PU8 A;  4QPG C;  3WQ1 A;  3I2O A;  4BME A;  2IXL A;  3MLK A;  2NLR A;  1NUK A;  4LOS A;  4Z2W A;  1H1A A;  5HXM A;  2CWM A;  2GMM A;  3DPR C;  2JB4 A;  4Q0V A;  4QDS A;  1EV1 1;  1VAK A;  2VMC A;  4UYB A;  4V1P A;  5IK7 A;  2OVU A;  5IWF A;  5A3N A;  1JBC A;  3MW4 A;  2RS1 1;  5JR2 A;  3J8F 1;  4QPI A;  1IPJ A;  4UFI A;  3V0B B;  2VD7 A;  3POW A;  2ZOE B;  1H8T B;  2VZU A;  4RGA A;  4YVW A;  1VB2 A;  2V73 A;  4QX8 A;  4EV0 A;  1HRV 3;  3LEM A;  3TEY A;  1LOD A;  1UY1 A;  4XBQ A;  3OY8 A;  2ZGN A;  3DF0 A;  4MGZ E;  4CEW B;  5IYY A;  2ZHN A;  4YAR A;  4O9E A;  5FZ9 A;  4KG0 A;  1F2N A;  3OB8 A;  3VBO A;  3WDU A;  5GLU A;  4AF9 A;  4FQZ A;  2AEN A;  4NN0 A;  2JG9 A;  3OGG A;  3ZFF B;  3ROU A;  3AJY A;  2PTM A;  3AMQ A;  3S7E A;  3B9C A;  3HMY A;  4PDW A;  2OYZ A;  1R1A 3;  4IV1 C;  2Q30 A;  4HET A;  4UFJ A;  1JI6 A;  1GOG A;  3WQB A;  3WNP A;  3SLI A;  4GA9 A;  2VH9 A;  3WF4 A;  1FMD 1;  1WME A;  2ARB A;  4LR4 A;  1BHG A;  2P3I A;  2VBB A;  1QGL A;  1RUI 2;  4I01 A;  5BNP A;  2D93 A;  2W87 A;  3RG0 A;  4GD4 A;  3EHK A;  1NZI A;  4V2V A;  3MFC A;  5IK8 A;  1I9R A;  4HKO A;  4XYX A;  2DU0 A;  1EV1 3;  2YXS A;  2WZR 3;  5DAB A;  1PNG A;  1SFN A;  3KQR A;  1RUG 2;  5IFT A;  2EIC A;  4AVS A;  2BOJ A;  1LB2 A;  1UYY A;  3FHA A;  1R1A 2;  4HVO A;  4Q27 A;  4F7Z A;  1FI2 A;  1EPW A;  4HPK A;  1PMH X;  3JD7 1;  1I5Z A;  3QOP A;  4P5H A;  4PBP A;  1Q8P A;  2Q1M A;  3WG4 A;  3AP4 A;  5FMB A;  1YCI A;  5BNP C;  1KJL A;  3H8O A;  1JOJ A;  5AC9 3;  5C3P A;  4MGY E;  3UGG A;  2WO7 A;  1QJE A;  4DRR A;  3N7K A;  2QZ3 A;  2OS2 A;  2VY0 A;  2ZMN A;  4AR2 A;  2FCU A;  1AHS A;  5ERL A;  4A7Y A;  1DG6 A;  4LIT A;  5BY5 A;  2ZHK A;  4XW3 A;  1UU5 A;  4Y3O A;  3SH5 A;  1XRU A;  3OOX A;  4AVA A;  1NY7 1;  5KXC A;  2C9A A;  5C3S A;  3D82 A;  4EJR A;  5EYX A;  5HBA A;  3O1S A;  1IGO A;  1VJ2 A;  4JVA A;  3ES4 A;  1VAM A;  1W2A X;  2GC2 A;  1ENQ A;  4WBB A;  4BU2 A;  2QUO A;  4QDQ A;  2EAA A;  2GN3 A;  2JKB A;  2W1U A;  1PIV 2;  4K21 A;  3JBG 1;  4OVE A;  5LEJ A;  5DAV A;  3RPQ A;  1FNY A;  4RGK A;  2QKD A;  5C4W B;  2GAL A;  5ABJ C;  3CQO A;  4X8N A;  4QHB A;  3BCW A;  2JKX A;  3H0O A;  3I2G A;  3WNX A;  1GZT A;  4YLZ A;  1QJZ A;  1YQ5 A;  3WOG A;  1XB9 A;  3TB0 A;  1O5L A;  4BWO A;  4CVU A;  4F3J A;  1PGS A;  1PM4 A;  3LDB A;  1VBE 1;  4FOV A;  3ST7 A;  1RUH 2;  4NHM A;  1YUD A;  3R05 A;  5A7W B;  1NG0 A;  5SV8 A;  3TNP B;  2WWU A;  1S0J A;  2ZA9 A;  5HI0 A;  1WKY A;  4L2N A;  2VZQ A;  2CHH A;  4IEY A;  1AR9 3;  4DXZ A;  3POI A;  4FBF A;  3MDP A;  4IW3 A;  3HVD A;  3R4D B;  3JD7 3;  3I97 A;  3ON7 A;  4YG3 A;  5BPX A;  1ULC A;  1W8F A;  1A8D A;  2QVS B;  3D5O A;  3IKW A;  1O3S A;  1PVX A;  2R7E B;  4WM7 A;  4YW6 A;  4K20 A;  3KGZ A;  4RYD A;  5DUU A;  5FPL A;  1KD7 A;  2JDK A;  4DXS A;  1OD5 A;  2W08 A;  1H8T C;  2RDN A;  1JOB A;  2FDJ A;  2JG9 B;  1HXS 2;  3H50 A;  1RUE 2;  3T3Y A;  3ECQ A;  4CCC A;  3PIJ A;  3OPW A;  3TYJ A;  5K0U A;  5LRS A;  4NPL A;  2XG3 A;  3SCF A;  2ZAB A;  5APA A;  2BER A;  2LUW A;  2J1E A;  3WP6 A;  4IV1 A;  1OT5 A;  4XUP A;  5LY2 A;  2BPA 2;  1BQP A;  3PTY A;  3J7M A;  1J84 A;  4MO3 M;  1LEN A;  1WCU A;  4S2F A;  5AVA A;  1AYM 3;  2HBT A;  4LHK A;  3I3M A;  2AZ5 A;  3POJ A;  1D4M 3;  1W9S A;  3PVO A;  5FXX A;  3WDV A;  4CUA A;  5FZA A;  1CX4 A;  1EV1 2;  3CZJ A;  5FY1 A;  4MGT A;  3SC7 X;  2BVB A;  5KHI A;  2CGP A;  4WVZ A;  5KXD A;  4N7U A;  2JDY A;  1LOG A;  1KS5 A;  3QD6 A;  1JN2 P;  1ASJ 1;  2KXL A;  1X33 A;  3R4U A;  3VB9 A;  5ACA 1;  1X7N A;  4Q1R A;  2JDZ A;  1HQW A;  1H2M A;  1YFY A;  1SLA A;  3F95 A;  4ASM B;  4BQ4 A;  1LHW A;  2L9L A;  3QBQ A;  5FIX A;  2HWE 1;  4DB5 A;  3BKZ A;  4A6S A;  2H0V A;  3I3Q A;  2EID A;  2AGS A;  2E63 A;  4PLM A;  3P3N A;  1AR8 3;  4RS5 C;  3PL0 A;  2YPJ A;  2VW1 A;  3OGR A;  5CFD B;  4BQY A;  2ZGR A;  2JE7 A;  1GP6 A;  2RJL A;  3IZO A;  2ZXQ A;  4RHV 2;  1LOF C;  1AVB A;  3FUO A;  4EN7 B;  3VBU C;  5CA6 A;  3O5S A;  1KQR A;  1UYX A;  3N9N A;  5D21 A;  1GQG A;  4QU1 A;  5FZ6 A;  3VBF C;  1OA4 A;  1UCX A;  3O1M A;  1F8V A;  3TEX A;  5A1F A;  5CBL A;  3OY8 B;  4CEW A;  4A4A A;  2XVK A;  1OQE A;  4CUG A;  4AQ2 A;  3NV3 A;  1CPN A;  5GKA C;  2PHW A;  4JGZ C;  3T1M A;  4HZF A;  2Q8O A;  3VKO A;  2ZKL A;  3L2H A;  4XOG A;  1LOB A;  2WYS A;  5CU1 A;  3UET A;  1VBC 1;  2VTX A;  3WG2 A;  5CNA A;  3MW2 A;  3S0M A;  4LNV A;  4MGS A;  1B09 A;  5FJK A;  4FPK A;  4N43 A;  4SBV A;  1XE8 A;  1O8S A;  2QDR A;  1GQH A;  1W6O B;  4LBM A;  1HB4 A;  4J6G A;  1OKO A;  4XDQ A;  5J7M A;  1FYU A;  2Z42 A;  3UKN A;  2FZ2 A;  1RUD 2;  2HWF 2;  2J1T A;  2P37 A;  3H3U A;  1ZRC A;  2W1S A;  4RR3 C;  3NW4 A;  2C1F A;  5BXX A;  1YXW A;  1J83 A;  2ZKN A;  2V5D A;  1AL2 1;  4M0N A;  1SBE A;  2G9Z A;  5I93 A;  2YDE A;  3AZV A;  2VNG A;  4HK9 A;  2VUJ A;  2Y6L A;  3WW3 A;  2PLV 3;  1UYZ A;  3CMG A;  2PFW A;  4AVT A;  4KBB A;  5JLV A;  2RS3 3;  1UOJ A;  3FFQ A;  3SH4 A;  1HB1 A;  5J09 A;  3MZH A;  4DY3 A;  1COV 1;  3IB3 A;  3K4Z A;  1GKB A;  3OPZ A;  1F5J A;  1COV 2;  3E1F 1;  1RUJ 2;  2VZV A;  1JUH A;  3BPS A;  3CJI C;  3ZXF A;  3MUZ 1;  2X5I A;  3WHU A;  1L7R A;  4ZXE A;  2K46 A;  1LOA A;  3BU0 A;  1OLQ A;  1QJX 3;  1H4H A;  1ZBA 2;  4BHP A;  4IE4 A;  4AAP A;  3B69 A;  2P1B A;  4YGB A;  3HBZ A;  2O0O A;  4QX1 A;  1Q8V A;  5GZG A;  1JZ8 A;  1MZE A;  3AL6 A;  2ZGM A;  4BQ5 A;  4Q0S A;  1IG3 A;  1DGW A;  2QQP A;  4ISR A;  1OOP A;  1EUT A;  1FOD 3;  4EWD A;  1G8W A;  2E53 A;  2XH6 A;  1O7F A;  2KR2 A;  1H0B A;  1CVN A;  1WCK A;  2D7F A;  3D0J A;  4LIV A;  4W6X A;  3URF A;  1Z7S 2;  4R8H A;  2WNV B;  2XWB B;  1LJ7 A;  1OUX A;  1Z7S 1;  4FFH A;  3POS A;  2LRO A;  5F3I A;  1ODN A;  3NVC A;  3GBF A;  3ACI A;  3JBG 3;  1V9U 3;  2OPK A;  2W47 A;  4AI9 A;  1NYW A;  1XSR A;  5FR3 A;  2WZP P;  1ND3 C;  3T2Q A;  5JSP A;  5K7P A;  2E9Q A;  3AB0 A;  1TME 1;  1OH3 A;  2VZP A;  1YEW A;  3B3Q E;  2GP3 A;  5FK7 A;  4RGG A;  4P9J A;  1RUH 1;  3PUR A;  3BB6 A;  2RJ2 A;  1W8T A;  4LO5 B;  4NE9 A;  3VZM A;  2JIG A;  3SXW A;  4AL9 A;  4W6W A;  2C26 A;  3C7G A;  4AFA A;  3ZSM A;  5GLT A;  4DQA A;  5ANQ A;  2WNE A;  2XQR A;  5IVC A;  1B35 C;  4GWN A;  4YM1 A;  1Q8Q A;  2WNV C;  2ZX2 A;  5F6L B;  1US2 A;  2LRP A;  3BOW A;  5C5U A;  2IXK A;  4JTN A;  3RVH A;  4CDQ B;  1UY2 A;  5J96 B;  3IWZ A;  1AR9 1;  1NA1 C;  2HWD 2;  2WKK A;  1DYK A;  3Q8A A;  2IFW A;  3WD5 A;  3PLQ A;  4PF1 A;  2C9K A;  4OFG A;  5FYV A;  2VZT A;  2FZ1 A;  3AKS A;  5IVY A;  2X09 A;  3VHP A;  3IM0 A;  1O4Y A;  1N1T A;  2J1V A;  2E31 A;  2YRO A;  4ZY9 A;  2HEW F;  2YBP A;  1KJR A;  2QCS B;  3IMM A;  3S30 A;  4Z2A A;  5FOB B;  3VUO A;  5CKQ A;  3KHC A;  5FZ0 A;  2GDF A;  1N3Q A;  4B8E A;  1WCS A;  2GH2 A;  5A3M A;  1K12 A;  4P5Y A;  2ILM A;  3BOP A;  2FCT A;  2JDM A;  4JQT A;  1TEI A;  5DPN A;  4G3Y C;  1MPX A;  3CJI B;  1S4C A;  4NWW A;  1JOD A;  5A3W A;  4JZR A;  3UK9 A;  1MVQ A;  1R1A 1;  1NKG A;  4Y20 B;  3FMG A;  2YC2 A;  4Q1P A;  1UZY A;  1SEF A;  4K40 A;  4CDX C;  2JE8 A;  4FAH A;  2RMU 3;  1ULE A;  3R6S A;  5GZC A;  2YY1 A;  1J3Q A;  3LAG A;  2ZGP A;  5FZG A;  1UY0 A;  1YFW A;  1QJY 3;  1E5I A;  1W8N A;  2BQP A;  3J9S A;  5D1I A;  1U0A A;  3FLT A;  3VBS A;  4BQX A;  3KZ4 C;  3A0N A;  1RYY A;  2ZX3 A;  5FLH A;  2KD7 A;  2RJK A;  5DN2 A;  4LO6 B;  5D8A A;  1FX5 A;  5FY0 A;  5T52 A;  3THC A;  5FMD A;  2WA4 A;  2JDP A;  3NNL A;  1LAJ A;  3WW2 A;  5B4N A;  1MQT B;  1ZRI A;  2CL2 A;  4M0H A;  2G1M A;  1XJA A;  4ZU7 A;  1J58 A;  2GZW A;  3GHM A;  4BQ1 A;  4K8R B;  4UW6 A;  5FUP A;  2NM1 A;  5FY4 A;  1I1E A;  1AUY A;  3VBS C;  2WQ8 A;  1WLD A;  4Q4W 1;  1QMJ A;  2DF7 A;  5LRR A;  3K4A A;  4QXB A;  4RQP A;  2P3Y A;  2DCK A;  2Q8D A;  1QY4 A;  2DCZ A;  2XXZ A;  4Q26 A;  4QWN A;  4AGR A;  2WO1 A;  1OA2 A;  5JPN B;  3T4V A;  5GLW A;  1G6N A;  1OPO A;  2UWC A;  1HN0 A;  4NRP A;  2HWD 3;  2W91 A;  4QPW A;  4B4P A;  3Q8E A;  1BMV 1;  1JYC A;  3W5N A;  4P9X A;  3LDR A;  3OUH A;  2YC4 A;  2PLV 1;  4ES9 A;  1HKD A;  2RDS A;  4NOT A;  4JTO A;  4LHS A;  4MXW A;  1XNA A;  2QQW A;  4JDN A;  4Q4X 3;  5T54 A;  3TN9 3;  2CAU A;  3I2K A;  2DCY A;  2O1Q A;  4IET A;  1UY4 A;  4L11 A;  3LCP A;  4ZKT B;  1MS8 A;  4AHZ A;  2WC2 A;  2PEL A;  4MAD A;  3K46 A;  4R9D A;  2R07 1;  1ZZB A;  2QQN A;  2RS5 1;  2YMZ A;  4RHV 3;  1XU1 A;  1W0O A;  2WNU A;  5FZ8 A;  4ZHN A;  1LGN A;  4LBQ D;  4LHL A;  3IDB B;  3KHB A;  3DKQ A;  4YZ1 A;  5BNN A;  1NY7 2;  1AR6 3;  4Q4V 3;  2GNB A;  2CDP A;  3I59 B;  3WG3 A;  3MLJ A;  1ZBE 3;  2PHR A;  2R1B A;  3LKJ A;  2Q8E A;  1LGC A;  3V65 A;  4XMI A;  4LOT A;  1IKP A;  1CJD A;  3NAP B;  3U07 A;  5FZO A;  2WII B;  2JD4 A;  2X5I B;  1GAN A;  2D6O X;  1KS4 A;  2JX9 A;  1K5J A;  4I2O A;  4CCJ A;  5C9A C;  2Y60 A;  1K5M C;  4AYU A;  4R9A A;  1DZQ A;  4AEM A;  1D7P M;  1RUF 1;  2XJS A;  3T1L A;  4XJW A;  2FDG A;  3MIH A;  5F3E A;  2R04 2;  3UES A;  1YHF A;  4D94 A;  2P4E A;  2XVL A;  3T0D A;  1Q3E A;  1CZS A;  1G86 A;  2Z69 A;  1CX1 A;  4CU7 A;  2FDF A;  4LJH A;  2ZGO A;  4ARX A;  5LBC A;  4XDO A;  1D4M 1;  5CB7 A;  2DWR A;  3LGR A;  1LTE A;  3IDC B;  3U78 A;  3VBO C;  3ZYR A;  2VMG A;  1S0B A;  3MYX A;  2HWC 2;  1JZ2 A;  4COZ A;  2RDR A;  1POV 0;  2OQ7 A;  4M01 A;  5F39 A;  1HRV 2;  5D8A B;  2MEV 2;  1UU4 A;  2I74 A;  2WIN B;  5JMO A;  1W8Z A;  4LBN A;  1UZ0 A;  4IND A;  4IE5 A;  3LA2 A;  1MZ5 A;  1LR5 A;  1I6X A;  4NRM A;  2JG8 A;  1UOB A;  2W39 A;  3N4M A;  3B94 A;  4QPG A;  5FZ7 A;  1MS3 A;  4N8M A;  2X29 A;  1Y9M A;  3DV8 A;  4RQP B;  5IAT A;  4H7M A;  5A7O A;  3J7L A;  1PX3 A;  1HQN A;  3FBM A;  2F4P A;  5I8Y A;  1DGL A;  1C8M 2;  2HEY F;  1OQD A;  3I2D A;  4XE9 A;  5F6K A;  2B9U A;  1Y3T A;  2OUH A;  1ZNP A;  3MEP A;  1XNB A;  1W39 A;  1S0E A;  1E57 A;  1H6Y A;  1OBN A;  2D98 A;  5E8A A;  1YQC A;  1GWL A;  2CYF A;  2XHK A;  1G9B A;  5BNO B;  1YQ8 A;  5DZF A;  4BDV B;  3AFG A;  1J59 A;  4Y5Z 0;  2EIB A;  4GJZ A;  5GM0 A;  1VBA 3;  1UO9 A;  2QBX A;  3O1U A;  1MZ6 A;  3DPR B;  4XQ4 A;  1IKQ A;  1QOT A;  1UU6 A;  1FV3 A;  4MV2 A;  4WV8 A;  4UF0 A;  3ZYI B;  4BIF A;  4N7I A;  4BXS V;  5KHJ A;  2PHD A;  2JD9 A;  4FXK B;  5LW9 A;  3BIE A;  3MO4 A;  5FPX A;  1VRH 3;  1SLC A;  5DQ0 A;  1GSL A;  3T4H B;  3V64 A;  4YFZ A;  2JG9 C;  3AMH A;  3M3O A;  5A3T A;  3PVE A;  1RUI 1;  1UPI A;  3KD4 A;  2XL9 A;  4JC1 A;  3PTR B;  2A73 B;  2VQT A;  4OQ8 A;  4IGP A;  1TE1 B;  1HN1 A;  4BK4 A;  1CIY A;  2WNU C;  3AP7 A;  3ELN A;  2YYO A;  1BVV A;  2YZ4 A;  1EAH 2;  1S1A A;  1SPP A;  3M7A A;  3H7J A;  3I59 A;  1YYN A;  1VRB A;  2ZX1 A;  3PUQ A;  3NNG A;  4AGV A;  3PNA A;  4CU6 A;  5FKB A;  4XHB A;  3ZO0 B;  4COV A;  1TQ5 A;  2R1D A;  4CP2 A;  3ZMO A;  2H0B A;  4GMP 1;  3OG2 A;  3VDB A;  1D0G A;  1M06 G;  3NRU A;  3RDI A;  5AFE A;  4NUB A;  3VD4 A;  4LUM A;  3OGV A;  1POQ A;  3FLP A;  3WDX A;  1YC6 1;  1ULF A;  2ZEX A;  3RZZ A;  1Y9Q A;  4CDX B;  1A6C A;  4RHV 1;  1X82 A;  2RM2 2;  4B7K A;  5J37 A;  1F5F A;  3WW1 A;  3J7H A;  3ZKU A;  5DAX A;  2JDH A;  1SBD A;  2O8Q A;  2QQL A;  4H7L A;  4JQR A;  1QF3 A;  3AMM A;  3OBZ A;  1UMZ A;  4Q4X 1;  5FBJ A;  1PO2 3;  3B9I A;  3POF A;  4Q0P A;  2GC0 A;  1FOD 1;  5A80 A;  5JXJ A;  1YIF A;  2Y64 A;  2QQM A;  3IIA A;  4HT1 T;  1C3H A;  2J1S A;  5CAZ A;  3E6B A;  1J1T A;  1D0H A;  2ZEY A;  5I8T A;  2PQS A;  1CAX A;  3C3V A;  2TEP A;  3VBR A;  4A3Z A;  1DYO A;  1X9T A;  3KCX A;  4RFR B;  4IEP A;  2ZEZ A;  3KVB A;  4LBL A;  3VZO A;  5EJ1 B;  4DMI A;  1ZZ9 A;  3MIB A;  4YPJ A;  3WNO A;  5ABJ A;  2WT1 A;  5IK5 A;  4LHN A;  4FFG A;  2ZBJ A;  2QQJ A;  2ID4 A;  4TZD A;  3ALQ A;  3I8T A;  4AI0 A;  4Q4X 2;  1ALY A;  1RIN A;  4IV3 C;  1RJ7 A;  4XFG A;  3FJS A;  1CZV A;  2QQU A;  5JWP A;  4X6R B;  1QQP 3;  3H9A A;  1NLQ A;  1YWK A;  3I3E A;  3BN6 A;  1SAC A;  1RIT A;  1DGR A;  1WLT A;  2WS9 1;  2TBV A;  3Q8C A;  5IAV A;  3H8R A;  4LBJ A;  1F31 A;  1BK0 A;  4NIH A;  4QD2 A;  1WGP A;  1XBF A;  1JYV A;  4COW A;  1ULP A;  4YZ5 A;  2ZGQ A;  1XYN A;  5EJ3 A;  4JHT A;  4DEV A;  4YVS B;  1TNF A;  3MID A;  1VIW B;  3C7H A;  3IN9 A;  4CDW C;  5FYI A;  2FMY A;  5KXE A;  4QX0 A;  1WBL A;  3M70 A;  4CU9 A;  5FDB A;  1WWY A;  4GH4 C;  4XHX A;  5JZG C;  3NJV A;  2VCA A;  1JUI A;  4RS5 B;  3VD9 A;  2W1W A;  3NQH A;  4TLG A;  5LEK A;  1S2B A;  2DUP A;  4AQ6 A;  2VQU A;  2AH2 A;  1TMF 3;  4O65 A;  5KR7 A;  3UGF A;  2I2S A;  2XWJ B;  3AYA A;  5J98 B;  4AHY A;  1WCD J;  4K9S A;  4D6R A;  4QT6 A;  2XBO 3;  1RHI 3;  3HOB A;  3POG A;  2SLI A;  5A3L A;  1LEM A;  5F7U A;  3H1M A;  4P9W A;  4OI1 A;  2V4A A;  5FY8 A;  1A3K A;  3C2U A;  1L7L A;  4WM8 C;  1O91 A;  2VR4 A;  2VZS A;  3OYW B;  1FV2 A;  2PAK A;  4FP3 A;  4JGZ B;  4OUS A;  4XFH A;  4XUT A;  4ZPI A;  1VE0 A;  5A6Y A;  5IUQ A;  4YM3 A;  5F9T A;  4IUG A;  5A6Z A;  2HWC 3;  3GJB A;  1UIK A;  3APB A;  3NAP A;  3Q8F A;  2BDR A;  2D97 A;  3I2I A;  2QE3 A;  4CDW B;  4CTE A;  2PN5 A;  3P3P A;  4CXX A;  1VPH A;  2V72 A;  3NMB A;  2VMF A;  5BNO C;  1Z0H A;  4OHZ A;  4OZO A;  3ZSJ A;  4M3C E;  4N43 C;  1UL9 A;  2B9V A;  1XND A;  2QQK A;  4NPM A;  4GWM A;  5FQ0 B;  3X29 B;  1W90 A;  3SCH A;  3ZOI A;  4BOW A;  3EB7 A;  4BXF A;  1KXG A;  2EA7 A;  4IE6 A;  1YI9 A;  1HV0 A;  2D6K A;  5T5L A;  3OD0 A;  2VEC A;  5CIR A;  1J1L A;  1JMU B;  4ZS2 A;  5EQU A;  5LA1 A;  1W28 A;  1M4W A;  2RDQ A;  1NE4 A;  3BTA A;  1JYW A;  2ZGL A;  2P6H A;  3CJX A;  2B42 B;  1CAW A;  4B1M A;  2ORZ A;  5DDJ 1;  4GZ9 A;  3ZXK A;  5ACA 3;  1WCQ A;  3JD7 2;  5B4X A;  1HDK A;  4OCT A;  4YG0 A;  4N53 B;  5CZK A;  4MX3 A;  1PNF A;  4Q0Q A;  5FXW A;  4WM7 B;  4PIY A;  4XTP A;  4Y22 A;  5HCH A;  1WMX A;  4XQD A;  3WW4 A;  1NA1 B;  3RMX A;  1X8M A;  4LUK A;  5I0D A;  4AOC A;  4P9I A;  4X6Q B;  4CDU B;  4MOA A;  2EVX A;  4YVW B;  3RZH A;  3HPN A;  3WF2 A;  3LIH A;  1ZA4 A;  4COY A;  3AKT A;  2FD8 A;  5C4W A;  5CG8 A;  4QPI B;  3V0B A;  1CD3 G;  2IXJ A;  2JE9 A;  4XBN A;  5FYU A;  5IJR A;  5IVB A;  2BNN A;  4ISQ A;  5F3G A;  3O1P A;  1I3H A;  1NCR B;  2W92 A;  3S6P A;  1X50 A;  1VRH 1;  2Y33 A;  4GUL A;  1DGR N;  2UY8 A;  4HBN A;  4BYY A;  1MEC 3;  5C8C A;  4H3W A;  1T6B X;  1C57 A;  5C5T A;  4DUV A;  4A42 A;  2VPV A;  3C8X A;  2DU1 A;  1FXZ A;  1R08 1;  2R0H A;  1QNW A;  3VKF C;  4PJY A;  1W2O A;  1DQ0 A;  1ZZC A;  2VGD A;  5FO7 B;  5IT6 A;  5LBE A;  2BFU S;  5CEH A;  4CE8 A;  1AYN 2;  3HNY M;  1DCS A;  4ORF A;  3V0A A;  5A6Q A;  3RJR A;  1FT9 A;  5FZM A;  4L99 A;  2BYV E;  4XC9 A;  2VW2 A;  1CR7 A;  4MET A;  4DXR A;  1REF A;  4HL0 A;  4JDM A;  4LKF A;  2RS1 2;  4ZZ8 A;  1IZ3 A;  5EP9 A;  3SHR A;  1HB3 A;  2WJS A;  2WZR 2;  4QB2 A;  4E4D X;  4PI0 A;  4DY5 A;  1LED A;  2CU5 A;  2GN7 A;  4Y1X A;  2CDO A;  2LW8 A;  3L9J T;  4GH4 B;  2N7G A;  4CCD A;  3JU9 A;  2EXH A;  3ENR A;  1LOE A;  2WL1 A;  5A7W A;  4CZS A;  1LHU A;  2BBA A;  1SQ4 A;  4XQW A;  4YYO A;  2Y6G A;  1YO8 A;  4Y1Z A;  3Q8B A;  2PLV 2;  3ETQ A;  1JHN A;  3VD3 A;  4N9I A;  3M1H A;  1BMV 2;  1H6X A;  1DF0 A;  1Q8S A;  1ND3 A;  3M3C A;  2MHF A;  4RFT 0;  5FRA A;  3VBR B;  3ZFG B;  5FUI A;  4LIU A;  3DYP A;  5C4W C;  1W0P A;  2RMU 2;  1BCX A;  3CBN A;  4BLJ A;  3H7Y A;  2NZ9 A;  4PDW C;  2F4L A;  5KXB A;  1UKR A;  4ATF A;  5HPO A;  3USU A;  5EHD A;  2VZ3 A;  5FP3 A;  4Q4Y 2;  1XSQ A;  2B45 X;  3RZK A;  2DBN A;  3GHN A;  3O14 A;  4DEQ A;  2C4X A;  3ZM8 A;  1MR5 A;  1W8U A;  5L19 A;  4AI2 A;  1UOG A;  4N53 A;  2B4K A;  2ZGU A;  4LA2 A;  1NZC A;  3PHM A;  3RWK X;  1JS9 A;  2GNT A;  3C7E A;  1LHV A;  4IGQ A;  5G05 L;  1GNY A;  2YU2 A;  4AFD A;  2G19 A;  1NA1 A;  4LPL A;  1C5H A;  1ULO A;  3OF1 A;  4M4P A;  2VMH A;  4QDR A;  4YRD A;  2XUE A;  1CON A;  4KU7 A;  5IW0 A;  3B93 A;  3VHN A;  4BIS A;  1XYP A;  1FNZ A;  4LKD A;  3THP A;  5JSR A;  4Y1U A;  4H2A A;  3LEI A;  2VL4 A;  4QQ2 A;  3WDW A;  4XUR A;  4P00 B;  3P6B A;  4LK6 A;  3U75 A;  1KDK A;  4KL1 A;  3S7I A;  3I3B A;  3FFZ A;  3FLR A;  5I0U A;  3W5M A;  3KT1 A;  1VBB 1;  3PME A;  1FMD 3;  1Y7B A;  2XLF A;  2HWC 1;  3WDT A;  1DGW X;  1C5I A;  3GBW A;  2LM3 A;  4W65 A;  3Q9O A;  4XF9 A;  5D2A A;  4DO0 A;  2I45 A;  3G7D A;  2QNK A;  3MIF A;  2FQP A;  1QJU 2;  3FC0 A;  3WEZ A;  1C8N A;  3N36 A;  4UT5 A;  1W8W A;  1RIR A;  3K3O A;  1ND2 A;  2R04 1;  4JKM A;  3HN1 A;  2HYX A;  2RE9 A;  4XUO A;  5FY5 A;  1W2N A;  4D8M A;  3AMP A;  4IEU A;  5FJH A;  1PX4 A;  3ZYJ B;  4IE7 A;  4KWK A;  4HAN A;  1GZC A;  4HG6 B;  1PGL 2;  4QKF A;  1HRI 2;  2XJR A;  5EV7 A;  1IS5 A;  2P5B A;  3OYW A;  3O1R A;  3UYJ A;  4DRV A;  4A2U A;  2R32 A;  5JXH A;  2NYY A;  2VZO A;  5JVV A;  1PO1 1;  2VG9 A;  4CDQ C;  3RQ0 A;  5L7O C;  4CDW A;  1GNZ A;  2FDH A;  2VCC A;  4JKK A;  1CZT A;  3NKT A;  4BM8 A;  4ZU5 A;  1C8M 1;  4AVV A;  4GH4 A;  4IES A;  2GND A;  4MYE A;  4PLN A;  3BTX A;  3WY6 A;  1EP0 A;  4FQ4 A;  3UKV A;  4AI1 A;  1NXM A;  1VP6 A;  1WD3 A;  4GAZ A;  1V6J A;  1H30 A;  2DVB A;  5LZ6 A;  3TAY A;  4CYD A;  4QM8 A;  2P17 A;  2QTW B;  1SDW A;  2OQ6 A;  3ACF A;  3PU3 A;  4HOO A;  2RG4 A;  1RTV A;  3LOI A;  2WS9 3;  3IDA A;  4L92 A;  2DFB A;  4FOY A;  5DG1 A;  5L9R A;  5E89 A;  4N43 B;  5LBF A;  4FTE A;  2P3K A;  2SBA A;  1EY2 A;  1DBN A;  1PO2 2;  2WSU A;  2OXB A;  2VUA A;  3VD7 A;  5FFO C;  1P8J A;  3HN3 A;  3VKL A;  1F15 A;  4RS5 A;  4CEY B;  4FOW A;  3LPF A;  5C9A B;  3O1O A;  1QNY A;  4IER A;  2KA3 A;  4QQH A;  4XEZ A;  1I5P A;  3WLU A;  3MW3 A;  2E7A A;  4NAM A;  2X05 A;  3E97 A;  3OBA A;  5A7Q A;  1L3J A;  1Q43 A;  2WA3 A;  5FZH A;  3KLS A;  1PK6 B;  4L0P A;  1VBB 2;  1RUF 2;  4CP9 A;  4LO7 A;  4MUV A;  1F4A A;  3KT7 A;  3LSE A;  5BUV A;  4NMI A;  4QB1 A;  2VNO A;  4OUM A;  3VDD B;  5F3C A;  1D2S A;  4E2S A;  1W04 A;  1Y9G A;  2DUO A;  4XAB A;  1BBT 2;  3KT4 A;  5EZW A;  1GR3 A;  3W20 A;  4AED A;  1OXC A;  4AE2 A;  1RVF 2;  1GP4 A;  4MXV A;  1APN A;  4QHZ A;  4XFI A;  4BB3 A;  4LEJ A;  1ONA A;  2ZGK A;  2YGL A;  5T3N A;  1F9K A;  4N90 A;  5M0T A;  4W6Y A;  5HV0 A;  3PMS A;  3UT0 A;  1MZF A;  1LNS A;  2ATF A;  1ND2 B;  2C5D A;  4S2H A;  3UJQ A;  1TG7 A;  2BOI A;  1CIW A;  2R07 2;  5GLZ A;  2EIE A;  1GLH A;  3LB9 A;  2QDN A;  1EPZ A;  1NE6 A;  3ZFE A;  5JMC A;  2CSG A;  3O0W A;  1LHN A;  2R06 2;  2F17 A;  2ZZQ A;  2BNM A;  2HWB 3;  1AJO A;  1BVP 1;  3LF7 A;  5JR7 B;  2TNF A;  3H1Y A;  2XLG A;  1CQ9 A;  5EWS A;  2R06 1;  2VOK A;  5FZD A;  4Y33 A;  5A33 A;  5C8C C;  1GWM A;  1RGS A;  4C8D A;  3EBR A;  4OMD A;  3LZZ A;  4XUN A;  5DUV A;  5LA9 A;  1QDC A;  2WQ4 A;  1WW6 A;  4E8C A;  1YIP A;  3NL1 A;  1C8M 3;  4JGZ A;  4ZZ5 A;  3H1W A;  1U12 A;  4XAC A; 
#chains in the Genus database with same CATH homology
 4W8J A;  2WN3 A;  3FHQ A;  1T2X A;  1UXZ A;  1DP0 A;  3OEA A;  4W4Z A;  3I2H A;  2XQX A;  1D7P M;  3UES A;  4XZU G;  3T0D A;  1CZS A;  3GGL A;  1CX1 A;  4CU7 A;  4ARX A;  1NX9 A;  1GQP A;  3WF1 A;  3CDZ B;  1JZ2 A;  4RN5 A;  3VDA A;  2E26 A;  3DYM A;  4BJ0 A;  2WO3 A;  5G04 L;  3I3D A;  4TXW A;  5JMO A;  1UZ0 A;  1W9T A;  3C7F A;  1JZ5 A;  3A21 A;  3A22 A;  1K42 A;  3T2P A;  3UNP A;  1PX3 A;  3WNL A;  2YB7 A;  3JXS A;  4XUQ A;  1SDD B;  3SKV A;  4D0Q A;  4XVH A;  1H6Y A;  1UY3 A;  3LPG A;  4FI9 A;  2WZE A;  2Y6K A;  4BDV B;  3MUY 1;  2EIB A;  2QBX A;  1NUK A;  5HXM A;  1JZ8 A;  1GOH A;  4KMQ A;  4BXS V;  4QDS A;  1XNT A;  2JD9 A;  3THD A;  2VMC A;  3MO4 A;  5DQ0 A;  5JR2 A;  1PMJ X;  2VZU A;  2VQT A;  3PUI A;  1HN1 A;  1UY1 A;  1CIY A;  4BK4 A;  2VMD A;  2VZ1 A;  4DUW A;  5IYY A;  1F4H A;  4OUE A;  4UI9 L;  5CYY A;  3MBW A;  2XOM A;  2LS6 A;  3T2O A;  4CU8 A;  3OB8 A;  3OGS A;  2VCB A;  3NNG A;  1W8O A;  4CU6 A;  3NJX A;  3T09 A;  3OG2 A;  3VDB A;  3NRU A;  3VD4 A;  1JI6 A;  1GOG A;  3WQB A;  3WNP A;  3OGV A;  2VO5 A;  3WF4 A;  2ZEX A;  1XPW A;  1BHG A;  3K77 A;  2W87 A;  3OEB A;  3J7H A;  2QQL A;  3III A;  3LE0 A;  4P08 A;  5IFT A;  2BGP A;  4GWI A;  2EIC A;  5JXJ A;  3WF0 A;  3HNM A;  1UYY A;  3FHA A;  2Y64 A;  2QQM A;  3SEE A;  2J1S A;  1PMH X;  2ZEY A;  2PQS A;  4A3Z A;  1XC6 A;  3VDC A;  2V4V A;  5C71 A;  1DYO A;  4ARY A;  2J1A A;  2ZEZ A;  4QX2 A;  4KI5 M;  5EJ1 B;  2VC9 A;  4YPJ A;  3WNO A;  1US3 A;  2ID4 A;  2QQJ A;  3HJR A;  3LEK A;  1CZV A;  3I3E A;  3MV0 1;  4DUX A;  3BN6 A;  4QDQ A;  5JUV A;  2W1U A;  1JHJ A;  1KEX A;  3CQO A;  1IQD C;  1JYV A;  5IFP A;  5LA0 A;  2JKX A;  1ULP A;  3I2G A;  4CVU A;  4DEV A;  3C7H A;  3T0A A;  2HLE A;  4A41 A;  4QX0 A;  2Y8K A;  3T08 A;  3ACG A;  3GXU A;  4CU9 A;  5C7G A;  1GMM A;  1WKY A;  3NJV A;  2VZQ A;  2VCA A;  3VD9 A;  2W1W A;  3NQH A;  4DXT A;  3I97 A;  3FN9 A;  2W46 A;  2VQU A;  2R7E B;  3SKJ E;  4RYD A;  1YQ2 A;  2J7M A;  4DXS A;  3HOB A;  2WBK A;  5F7U A;  4UOJ A;  3ECQ A;  1R64 A;  5J1X A;  2J22 A;  2W1Q A;  2VR4 A;  2VZS A;  3ZM8 A;  4XUT A;  2BER A;  2J1E A;  4IUG A;  2E32 A;  4XUP A;  1OT5 A;  5EJZ B;  2W95 A;  3I2I A;  2X10 A;  1J84 A;  4MO3 M;  2V72 A;  2VMF A;  4GWJ A;  4OZO A;  3EYP A;  1W9S A;  3WF3 A;  1NAE A;  4CUA A;  2B9V A;  2QQK A;  1UMH A;  3CZJ A;  1SHW B;  3EB7 A;  5LA1 A;  3K75 B;  1JYW A;  1KGY A;  1L7Q A;  2ORZ A;  4GZ9 A;  1WCQ A;  5B4X A;  4W50 A;  5EIY B;  2L9L A;  1W0N A;  5CZK A;  3CZU A;  3P1I A;  2EID A;  4OMC A;  1EUU A;  5I0D A;  5LCW L;  4MOA A;  3OGR A;  3HPN A;  3WF2 A;  3VD5 A;  2ZXQ A;  4BK5 A;  3ABZ A;  3A23 A;  1UYX A;  2E33 A;  3LQC A;  5IJR A;  1SG3 A;  4QAW A;  4A4A A;  2W92 A;  4DUV A;  4A42 A;  3C8X A;  3HEI A;  3A7Q A;  1JYN A;  1OD3 A;  2Z4F A;  2WYS A;  1GUI A;  3UET A;  1K3I A;  3HNY M;  4MGS A;  3D3A A;  3GDB A;  1OF3 A;  2QQO A;  1O8S A;  2DCJ A;  2J1R A;  4A6O A;  4DXR A;  2J1T A;  5JXG A;  2W1S A;  4ZZ8 A;  2JDA A;  1O8P A;  4QB2 A;  5LA2 A;  1J83 A;  2WDB A;  2V5D A;  2CDO A;  2LW8 A;  2Y6L A;  2BBA A;  1W9W A;  1UYZ A;  2Y6G A;  3CMG A;  2VOT A;  1UWW A;  3VD3 A;  1JZ6 A;  2XON A;  1H6X A;  5FUI A;  5A1A A;  3DYP A;  3IB3 A;  3K4Z A;  3LEG A;  3E1F 1;  2VZV A;  2BZD A;  4LKS A;  3MUZ 1;  2W9X A;  5HPO A;  1L7R A;  2DDU A;  4ZXE A;  2VZ3 A;  1UMI A;  2YFU A;  2XHN A;  4P02 B;  4A45 A;  4DEQ A;  2C4X A;  4QX1 A;  2W3J A;  2B4K A;  2WAB A;  2RVA A;  3C7E A;  5G05 L;  1GNY A;  2WZ8 A;  3ETP A;  1EUT A;  1UX7 A;  4LPL A;  4QDR A;  1ULO A;  4M4P A;  1DLC A;  2VM9 A;  3FL7 A;  3LEI A;  3MV1 1;  2VL4 A;  4XUR A;  4QX3 A;  1TVG A;  2WN2 A;  3I2J A;  3P6B A;  4P00 B;  3W5M A;  3ACI A;  3I3B A;  1UXX X;  2W47 A;  4JKL A;  3T2Q A;  3T0B A;  2QQI A;  2VZP A;  3WEZ A;  2Y6J A;  1O59 A;  2RJ2 A;  4JKM A;  4UAP A;  2HYX A;  1JU3 A;  2C26 A;  3C7G A;  4QB6 A;  4XUO A;  3SEP A;  4D8M A;  1PX4 A;  4HG6 B;  1US2 A;  3WNN A;  4OYU A;  5JXH A;  1OH4 A;  1UY2 A;  2VZO A;  4AG4 A;  4JHZ A;  4PF1 A;  2C9K A;  3BGA A;  4M4R A;  2VCC A;  2VZT A;  1JU4 A;  2X09 A;  3ACH A;  4JKK A;  1CZT A;  2VZR A;  2J1V A;  2E31 A;  4ZY9 A;  2RV9 A;  4Z2A A;  2W94 A;  3AC0 A;  4AAX A;  1W99 A;  4CUB A;  3F2Z A;  1K12 A;  4P5Y A;  5DPN A;  2OKX A;  1MPX A;  2J1U A;  2YFZ A;  3ACF A;  1NKG A;  3GM8 A;  3IDA A;  2YC2 A;  2JE8 A;  2WAO A;  1JZ3 A;  2BGO A;  1UY0 A;  2VTF A;  3VD7 A;  1P8J A;  3HN3 A;  1W8N A;  1OF4 A;  4LQR A;  3LPF A;  1JZ7 A;  2YG0 A;  1I5P A;  1RYY A;  3CIH A;  2KD7 A;  3IAP A;  2X05 A;  3C7O A;  4ET7 A;  3OBA A;  5DN2 A;  3THC A;  4CUC A;  4L0P A;  4PQQ A;  2W5F A;  4KWU A;  5B4N A;  2ZEW A;  1F4A A;  4PT6 A;  3K4D A;  4QB1 A;  3U37 A;  3HNB M;  2ORX A;  2WQ8 A;  3K4A A;  3WNK A;  2DCK A;  3WNM A;  2VJX A;  2WO1 A;  5JXI A;  2W91 A;  4TTG A;  2Y6H A;  2WAA A;  4QPW A;  4A44 A;  4E8D A;  3W5N A;  3DYO A;  2YC4 A;  3WSO A;  4LHS A;  1LNS A;  1XNA A;  5IHR A;  1TG7 A;  5DMY A;  1GU3 A;  3I2K A;  2EIE A;  1UY4 A;  2VME A;  3IAQ A;  4MAD A;  3K46 A;  2WUH A;  2QQN A;  3PUH A;  1K45 A;  4JX0 A;  1GOF A;  1JYX A;  2CDP A;  3DEC A;  4OMD A;  4E8C A;  4XUN A;  1JZ4 A;  4MGQ A;  4ZZ5 A;  3CKH A;  3I2F A;  2WO2 A;  5C70 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...