4MGSA

Bixyn10a cbm1 apo
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
b'DKVDYEIDYSTAGYSFWNEVNEEVKETTTIGKNDTEGCLEIKTSVAASQNHFIQYHTADNLPIEIGKEYKLKMMVRGSAEGKLNFGVGPWSGRAEGSFSFNTEWKEYEFSFKAVADGGHVMTQSGLFVGTIQIKYVKITHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative glycosyl hydrolase family 10
molecule tags Hydrolase
source organism Bacteroides intestinalis
publication title Xylan utilization in human gut commensal bacteria is orchestrated by unique modular organization of polysaccharide-degrading enzymes.
pubmed doi rcsb
total genus 34
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2013-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4mgsA00
2W87A 4XUNA 5DQ0A 2YB7A 2VCAA 2YC2A 3JXSA 4CU8A 3IDAA 3HPNA 4RYDA 3VDBA 4A44A 1W9SA 5B4NA 5EJZB 4BK4A 1EUTA 3BGAA 4QDRA 2B4KA 4QDQA 4ZY9A 5JXIA 1K45A 3CZUA 1OD3A 2W3JA 1I5PA 4CU7A 3T2OA 1TVGA 4W4ZA 1O59A 3K46A 2CDPA 2VO5A 2VZTA 2J1AA 2BERA 4KWUA 1JZ6A 1JZ4A 4DXSA 1UY3A 2Y6KA 4E8CA 4GWIA 3F2ZA 2XHNA 1PX4A 3T0AA 1GQPA 3T2QA 5J1XA 2Y64A 1XNTA 3GGLA 3MBWA 2J1VA 4XZUG 2WO2A 2QQJA 2HYXA 2RVAA 2W9XA 3T08A 5DN2A 4CUAA 4DUWA 4QB6A 4ZZ8A 1XNAA 3HNYM 3HEIA 5A1AA 2JKXA 3GXUA 1W9TA 1UXZA 1UY4A 4XURA 1JZ3A 5LCWL 2WQ8A 2J22A 4LHSA 3GM8A 5JR2A 2J1UA 3OGRA 5C71A 2VMDA 2R7EB 3A23A 2VMEA 3ACHA 2E26A 3THCA 3LQCA 4LPLA 1EUUA 2VOTA 3C7OA 2VJXA 1GOFA 2ZEZA 3LPFA 4DXRA 4OMDA 4LKSA 4A3ZA 1UWWA 3K4ZA 4JKKA 2V5DA 1CIYA 2W5FA 2LS6A 4UAPA 1UXXX 1NX9A 1ULPA 4YPJA 1GMMA 3WEZA 2WN2A 2Y6LA 3I2FA 3P6BA 5JXHA 3SKJE 1US2A 4QX0A 4E8DA 3HNMA 4P02B 3LPGA 3C8XA 2BBAA 2JDAA 2WZ8A 2BGOA 4QX3A 1WCQA 1GU3A 4Z2AA 2ID4A 3OGVA 2QBXA 3NNGA 2JD9A 2BZDA 2LW8A 1W8OA 4D8MA 3SKVA 4PF1A 1F4AA 1T2XA 4ET7A 3WNPA 3LEKA 1W8NA 3C7GA 4LQRA 5CZKA 2W95A 3K75B 3OBAA 5CYYA 3WQBA 4CU9A 4HG6B 3VDCA 1OF3A 2C26A 2YC4A 1UMHA 2VZRA 4OZOA 2VZ3A 3P1IA 3WF4A 2WUHA 3VD3A 1XC6A 5IHRA 3T09A 1US3A 3NJXA 5C7GA 4XUTA 1P8JA 3ACIA 1JZ7A 3ABZA 4XUPA 1UYYA 4JKMA 5JMOA 4MOAA 3EB7A 4KMQA 3I2GA 2QQLA 4M4PA 3IAPA 4DEVA 3NRUA 5HXMA 1UMIA 4BXSV 1CZTA 5LA2A 2W1SA 4TXWA 2VQTA 1J84A 2VZVA 4A4AA 3LEGA 3UNPA 2E33A 3WNKA 1W99A 3W5MA 3T0BA 1GOHA 2V72A 2VZPA 3DECA 2C4XA 2W1WA 2WAAA 2ORXA 1JYNA 1JZ8A 1O8SA 4A6OA 2VCCA 2V4VA 4PQQA 3MV01 1TG7A 5LA0A 5B4XA 2QQKA 2YG0A 2C9KA 2WO3A 1W0NA 1D7PM 4JHZA 5G04L 1KEXA 4OMCA 4AG4A 4TTGA 3I3EA 3T2PA 3HN3A 3SEEA 1UX7A 1YQ2A 4OUEA 1DLCA 4QB1A 3D3AA 4ARYA 3A21A 1R64A 1J83A 2VR4A 4KI5M 3MV11 2VZOA 5EIYB 3A7QA 1HN1A 3ZM8A 3WSOA 2VZ1A 2YFZA 1NUKA 3CIHA 1JU4A 5G05L 5IJRA 4IUGA 2VZSA 4OYUA 1L7RA 4UI9L 2BGPA 3VD7A 1BHGA 2E32A 3FHQA 3J7HA 4UOJA 1PMJX 2W1UA 3CDZB 1NAEA 3WF2A 2W1QA 3CKHA 3MO4A 3PUHA 2DCKA 4CU6A 4QAWA 3WF0A 5EJ1B 3HJRA 2VZUA 2WAOA 3T0DA 2W47A 4QB2A 1H6YA 3ETPA 3I2JA 1GUIA 4ARXA 3C7FA 3I2IA 3ACFA 2ZEXA 4D0QA 2VMCA 1WKYA 3FL7A 3C7EA 4MO3M 3PUIA 3OEAA 1K12A 4BK5A 3NJVA 2VQUA 1RYYA 4GWJA 2HLEA 2W91A 4A45A 4DXTA 4XVHA 1JZ5A 1H6XA 2ZEYA 3CZJA 4JX0A 5IFPA 4BJ0A 2VMFA 2QQMA 2X10A 3I97A 3MUZ1 3WNLA 4CVUA 2VM9A 4GZ9A 2RJ2A 2XONA 3THDA 3HNBM 4QDSA 1JU3A 4PT6A 1K42A 2JE8A 5C70A 2W46A 3WNOA 3OB8A 4W50A 2J1EA 2Y6HA 3K4AA 4MGSA 3WNMA 3IAQA 2J1TA 3MUY1 1JZ2A 4W8JA 3K77A 2WABA 4XUOA 1UZ0A 1DP0A 3LE0A 3E1F1 2J1RA 3WF1A 2PQSA 3W5NA 2Y8KA 4MGQA 2VZQA 4L0PA 3CMGA 5DPNA 4DUXA 2DCJA 4M4RA 1SDDB 2YFUA 5IYYA 4JKLA 1JYWA 4QX1A 2ZXQA 1MPXA 2ORZA 2CDOA 3IB3A 3UESA 4ZXEA 5JUVA 4P5YA 3SEPA 1O8PA 4MADA 1UYZA 2XQXA 1NKGA 4DEQA 4P08A 4QX2A 4ZZ5A 1CZVA 1LNSA 3UETA 3A22A 2QQNA 3C7HA 3WNNA 4BDVB 1DYOA 2VC9A 1UY1A 3FN9A 2W94A 1W9WA 2VTFA 3OEBA 3I2HA 2WYSA 3U37A 1K3IA 3WF3A 3OGSA 2KD7A 1L7QA 4CUBA 2Z4FA 2WBKA 3NQHA 4RN5A 3FHAA 1SG3A 3BN6A 1OF4A 1UY2A 3DYPA 2EIBA 1GNYA 3CQOA 2VL4A 2WN3A 5IFTA 3DYMA 1JHJA 2L9LA 1IQDC 2XOMA 2EIDA 4P00B 3VDAA 5FUIA 5JXJA 3EYPA 2DDUA 3IIIA 2OKXA 1XPWA 3I3DA 1OH4A 2EIEA 3LEIA 3AC0A 1SHWB 1GOGA 5I0DA 3DYOA 2QQIA 5DMYA 1OT5A 3ACGA 2Y6GA 3OG2A 3VD5A 1UYXA 2WZEA 5HPOA 4XUQA 2J1SA 2WO1A 2ZEWA 4QPWA 1JYXA 3I2KA 1JI6A 2W92A 1ULOA 2X09A 4FI9A 2E31A 2RV9A 2WDBA 4A42A 5JXGA 2QQOA 2VCBA 1F4HA 3GDBA 1JYVA 3K4DA 1UY0A 3HOBA 4CUCA 5F7UA 3I3BA 5LA1A 3VD4A 1CZSA 2X05A 4DUVA 2EICA 2J7MA 2B9VA 3VD9A 1PMHX 4A41A 1PX3A 1CX1A 4AAXA 3ECQA 1KGYA 2Y6JA
chains in the Genus database with same CATH superfamily
3ZOIA 2R30A 4CDUB 4NIHA 4H7LA 1HRI2 2VCAA 3KF3A 5FZMA 2JDKA 3S7EA 3UYJA 4YGCA 3RJ2X 1RUG1 1VBD3 2B45X 1LOBA 2PYTA 1W9SA 4B4RA 4LMFA 5EJZB 1BK1A 3POGA 5A32B 5GZFA 2BWAA 4XFIA 1NCQA 1SCRA 2XVLA 2ZGTA 4QDQA 2IXCA 2UY8A 3I2DA 2HWD3 1W2NA 1OD3A 2CU5A 2XB6C 3CZUA 3JQXA 3KHBA 5FUPA 4CU7A 3AKPA 1SLTA 5FMOS 3VB9A 2LALA 2DCZA 3TNPB 1I5ZA 4MYEA 4J6GA 2VZTA 1PGW1 2SLIA 3F95A 2FMYA 3KVBA 4LEJA 2HWE3 1JZ4A 1IKPA 4O7XA 1WWYA 4PF5A 4N7UA 4DRVA 3TEXA 4E8CA 3N9PA 1AR82 4GKYA 3E6DA 3F2ZA 1PX4A 3AFGA 1NCQB 1GQPA 3NMBA 3BYWA 1AL0G 3JUUA 2IWGB 4DQAA 1PGL1 1H8TB 1W8TA 2J1VA 2ZGRA 5J37A 2D44A 1GKBA 5JSOA 2JG8C 1LECA 4LIUA 4O61A 2YXSA 4YZ3A 2BW8A 3T08A 1X36A 5DN2A 1VBA2 4CUAA 4Q2FA 4QB6A 4EZ4A 1T6GC 2OUHA 4AEKA 5HI0A 5H9RA 1G9BA 2Y6FA 1DLLA 1XNAA 3D0SA 3HEIA 4B1MA 2JKXA 3NJZA 4Y1UA 2W2IA 5JMCA 3VN4A 1RXGA 3EO6A 3WOGA 2ARBA 1PMIA 2JDPA 4K40A 5JZGC 1H1AA 2ZGKA 4OI4A 4ORFA 1DCSA 4XURA 2BOIA 4OHWA 1F35A 2EALA 2XHKA 1C8M3 1Q8OA 5C71A 3L2HA 3OGRA 4ZXKA 4UW4A 4NHXA 3A23A 5EFUA 2E26A 1W04A 3MIGA 4URAA 4BIFA 1EUUA 4QKDA 2RG4A 2VOTA 1Z7S2 3MW4A 2VMIA 2HWE2 4NRPA 5M0TA 1JTZX 1IS5A 3DV8A 2BUKA 1OURA 1ZRRA 4FT8A 4LKSA 3LSEA 1PK6B 3K4ZA 4ISQA 4XPVA 1KJLA 2V5DA 4NPMA 1CIYA 5FTTC 4C90A 3BIWE 4CDXB 3JD71 2Z69A 3UKVA 4QM8A 3MI8A 2LS6A 1QJZA 3MF6A 1ODMA 2JX9A 1R1A1 5BYNA 4WM7C 4X8NA 4YWAA 1NX9A 2WS92 2HYKA 2VOXA 1DGRN 4G9SB 1AR92 4D3WA 3AYDA 5I8YA 2CGOA 1K5JA 4P9YA 2Y6LA 4AI2A 3I2FA 4KG8A 2XLGA 4E8DA 1HRV1 2R063 4LO6B 4BA6A 2WNUC 3HNMA 3CJIB 5K8SA 4AZZA 3QH7A 4AFAA 5EHDA 4CDWA 3OGVA 2QBXA 3PMEA 4RFRB 1HQNA 1PVC3 2WZR2 3VBRB 4YVSB 1LOCA 1ZRIA 2BZDA 2Q1ZB 3SKVA 4X6QB 3TN93 1VRH3 4D6RA 4RHV2 4Z1VA 1W8NA 2E9QA 1OC1A 2WNUB 4AAPA 1BJQA 3GJAA 3OBAA 4GH4B 3FJSA 5BPXA 3RZLA 1UAIA 3TEWA 1RUH2 3TEYA 1EV11 2LTNA 4XQ4A 2DVBA 4HFSA 4OZOA 1Q5OA 3HQRA 2BQPA 2ES3A 4B7EA 3OGGA 3BKZA 2X5IA 4HSLA 1AX2A 2JDHA 2VECA 2R49A 4HLTA 3TN91 4CDXC 1LHOA 2VVEA 1US3A 2D6LX 3AXDA 5FXWA 4E9KA 2VBBA 1P8JA 5CU1A 4YW2A 2W08A 3H7JA 3TNQA 1L3JA 3ABZA 1UYYA 1JZ7A 4JKMA 5JMOA 4MOAA 1FMD1 1RVF3 2XPJA 4IE6A 4HXCA 3H3UA 4A7KA 1IPSA 1CPNA 1S0DA 3N36A 3U10A 5BNOA 5C9AA 4NIDA 5LA2A 4CCMA 2W1SA 1H1MA 2E7QA 4LK6A 2K46A 1SPPA 5FZGA 5FPVA 3LA3A 3ZMNA 4EN7B 5I93A 3PHMA 3ZYRA 5JLVA 1AR83 5APAA 3VHPA 4FP2A 2PFWA 1W99A 1KD7A 4B4QA 2YU2A 1FXZA 3INAA 4P14A 2Q1MA 3RFRA 3ZYJB 1J58A 3DECA 2WAAA 1JYNA 1SCSA 4C0HA 1RUF3 3AMNA 1S0CA 1ZZBA 5CB7A 2XJPA 5IVFA 5DUWA 5T55A 5KHGA 4XAEA 4C1XA 2ZS6B 1QHDA 4AL9A 5CFCB 1MS8A 3EQEA 2WQ4A 5ACA2 2QQKA 2VW1A 2WO3A 1VBE1 3WDXA 1C57A 3ZIWA 1PM7A 1OPMA 1W0NA 4Q8LA 1OMIA 4BXFA 2I2SA 4IETA 4QU1A 1SLAA 1OOPB 4AG4A 4TTGA 4OQ8A 5C8CA 3T2PA 1UQXA 4IGQA 3SEEA 4CDUA 3TEZA 3AZYA 1FV3A 1M06G 2WFF1 3D4KA 2PMWB 3O7OA 1DF0A 1E57A 2ZGUA 1ND3B 3UV9A 1MZEA 1AHSA 3PUSA 5HCHA 3WW4A 3J9SA 4PIXA 1QJU2 2QE3A 1W3XA 2WKKA 2GNDA 5LA9A 2VR4A 3CLPA 1W39A 3KGLA 4YYOA 2D97A 2PA7A 2LUWA 3A7QA 3ZM8A 1OVPA 2ZGMA 3WG2A 2YFZA 1EAH3 3EXUA 2CGPA 3AMHA 2HWD2 4PLMA 1L7RA 5FPLA 2D7FA 4UI9L 4IE5A 4I30A 3KV5A 1UX6A 3EJKA 4NOTA 2XR4A 5BNNC 2I74A 4K9SA 1PMJX 1UCXA 1SEFA 1VMJA 2XUMA 3U0ZA 3CDZB 4HKLA 1PZ9A 1XYPA 2X8KA 3NNFA 5FYBA 2Q8EA 5C9AB 2JWPA 4IEYA 2OA2A 4L2NA 4Q4V2 3LB9A 4QPGB 1RUI1 5KXDA 1GZCA 4JQRA 2DCKA 4G3YC 1Y43B 4N9IA 2YBPA 4QAWA 4WV8A 4XHXA 4Q5OA 3MIDA 1NZCA 2YC0A 3T0DA 1J1LA 1LHUA 2WA3A 2AUYA 2WLPA 1BVP1 4UFJA 3H8UA 4RQPC 1IZ3A 1GLHA 2EAAA 2UWAA 4E4DX 1SFPA 4KBBA 3BU0A 1ENQA 1H6YA 1RUC3 4XDQA 2B46X 4HANA 4CXXA 1KXGA 3I2IA 2X5IB 3ACFA 2GC0A 3I4IA 2RR13 5F3CA 3ZN6A 5EYXA 1OUXA 2WZR1 2CGNA 4HOOA 3WW1A 1ZZ7A 3KD4A 3GCXA 2F6BA 2VMCA 3LDKA 1WKYA 3M1HA 4NPRA 3C7EA 5K9YA 3EBRA 2WL1A 2PHLA 3OEAA 3I8TA 4RL7A 2QFEA 3RNSA 4BK5A 2VQUA 1L7LA 3TBDA 1V9U3 1VAMA 2WNUA 3WLUA 1OXCA 4LHNA 1Z0HA 2YMZA 4FPLA 4GWJA 1ZBE2 2DFBA 3NAPA 4A45A 2DVFA 1F31A 3KMHA 4LLFA 3SH3A 3W21A 5BNPA 4JX0A 1W6PA 5IFPA 3E5QA 1X33A 1K5MC 4BJ0A 3WQ1A 1YJKA 3ZXGA 2IUWA 2J42A 4MVTA 1VBB2 3IMMA 3E6CC 1VAKA 1TQ5A 4I09A 4M3CE 3I97A 4YLZA 4XAAA 1W90A 2QVSB 4L97A 4CVUA 4K3UA 2VM9A 3V64A 4ZS2A 2FDFA 4JGYA 3VKOA 4XJZA 5FYYA 5GLTA 5A7NA 1Z7S3 4DIQA 2RJ2A 1RTVA 1ZRDA 4OI1A 5DDJ2 1UZYA 2JDYA 2OXBA 5LBFA 3T1LA 3AP5A 2PN5A 5LASA 2RM23 3RDIA 4YGBA 2G1MA 5ACA3 1CAUA 2WNVB 1BBT1 2PAKA 3J26N 4CCNA 4HETA 2BWCA 3KV6A 5C3PA 4KU7A 1K42A 1XNDA 5SV8A 2BVBA 2VBDA 1COV3 4W50A 2J1EA 1RUF2 2BNMA 1AR81 4YZ5A 2WT0A 3SITA 3MZHA 1NA1B 1WUVA 1Y9MA 3OYWB 3IKWA 3IAQA 2J1TA 2EAKA 2A5ZA 2ZHKA 1JZ2A 1RJ8A 3FUQA 4W8JA 3UJQA 3K77A 3ZXLA 1Q8PA 1VBA3 3NAPC 1CAWA 1UZ0A 4XACA 1ENRA 2HWC1 5DDJ1 5FFOC 2E63A 3D82A 3P5BA 4LKEA 2WWUA 2PQSA 4XF4A 5C4WA 1ZBA2 1ND3A 2FDKA 4ZU4A 4KBZA 5A7SA 3WDVA 3BCWA 2ZX3A 1OI6A 4YM0A 3HIFA 1DG6A 1R081 5FPBA 2P3JA 2DCJA 3POEA 3O12A 3SXWA 4GMP3 2RDRA 4JKLA 3KT4A 4AF9A 4CDWC 3KHCA 5SV5A 4SBVA 1GICA 3J4UH 1HXS2 4N53B 3S5QA 3ZYBA 4AR2A 4AFCA 5DDJ3 1JOBA 1G6NA 4XFAA 5T52A 1S0BA 1OSGA 2G19A 4RSUA 2D6KA 2AC1A 3NV3A 2ZHLA 1R092 1RUD2 3M4FA 4P5YA 4PIZA 1OUSA 1RUE1 3IDCB 2YHJA 1D2SA 4XMIA 2DVAA 3SQOA 1V9U2 1VALA 2XQXA 3OJBA 5GLUA 1Y3TA 3PUQA 1MEC3 4YZ2A 4NWWA 2ZHMA 4P5HA 1IHMA 1EAH1 1LNSA 4LO7A 2WSVA 3C7HA 5L19A 4BDVB 3ZXDA 2VC9A 1H30A 4QPYA 1UOJA 3BPZA 4XF1A 4LLOA 2RS11 5CIRA 1TNRA 4Y1XA 1W9WA 1SPPB 1UYPA 5D8AA 5DAVA 2VVDA 2RJLA 3K51A 1UD1A 1ZM1A 2H6BA 4XOGA 1L7QA 2RS51 5FMCA 3ON7A 4Y1ZA 3SC7X 3WCSA 3SHRA 2WINB 1RUI2 2ZZJA 1S0EA 2HWB1 1LULA 1S55A 1ZVFA 1U12A 1OF4A 2XGXA 3DYPA 1OKOA 1YC61 1HN0A 2Q0AA 3ZYPA 4CP9A 2EF6A 5EZWA 5FZ3A 1AF9A 3E5XA 4A7ZA 3GALA 5F2SA 2EIDA 4QXCA 3KM5A 2AEYA 3ZLIA 5JXJA 1QQP3 3AYEA 2JE9A 1XQNA 1N1YA 3QBQA 4CUGA 3W20A 5KC5A 1XPWA 3MW3A 4Y20B 1VBC1 4HZFA 4AGVA 4XXAA 1JYTA 3ZYFA 4N53C 2D6NA 2JIGA 4JGZB 4YVSC 2VUDA 2WZR3 5F2WA 3AC0A 5ABJB 3KF5A 1FOD1 3IWZA 1J3RA 1WLWA 3DYOA 4AK3A 4OI2A 5I0TA 2EIGA 4AEDB 4LHKA 1GZWB 5A3MA 2NLRA 3MLJA 2Y6GA 1RUC2 3AKSA 3GBGA 3OG2A 1UYXA 3VD5A 4AHZA 3A0KA 1GR3A 4RD7A 4CPBD 1AL22 2J1SA 4R52A 3UL2A 5JZGA 4QPWA 1QJU1 2W92A 3GHMA 3S30A 4FI9A 3ZSEA 2QZ3A 4AHXA 4M01A 4A42A 5IAXA 2DBIA 4HVOA 2VCBA 1C8M2 4LA3A 2QNKA 3TYJA 2IVIB 3NNMA 3GYDA 2A3WA 1H2MA 1KRIA 3GDBA 1XE8A 2FCVA 4IE0A 2DU1A 4Q4V1 5L9VA 3K4DA 1UY0A 4NHYA 4Q4W1 1FAYA 3I3BA 3PTRB 1IGOA 4QHZA 4LBMA 4CUCA 5C8WA 1W28A 3VBOC 1XNKA 1CZSA 4E2GA 2E7AA 1YYNA 1VB4A 5FR3A 1QJU3 2B9VA 2PELA 1F5JA 4A41A 4AVAA 1QNWA 2Q8OA 3SEPA 3ZKUA 4Q0PA 5FWEA 5HCAA 4KWKA 2GH2A 1IQAA 4I0AA 2XJUA 1ULCA 3E5UA 4AGRA 4HKOA 1RUNA 1GWMA 3JBG1 2W87A 1UZVA 4XUNA 5DQ0A 2YB7A 5KXBA 1IPKA 1BBT3 2R0HA 3L9JT 3CEWA 1EPWA 4I3GA 3JXSA 3PLQA 4N9HA 4GQ7A 3BOPA 5LEJA 1HW5A 1F5FA 3I3QA 3RYKA 1IS3A 1H2KA 2UY9A 2R32A 4BK4A 1EUTA 5LK7B 2X29A 2RM22 3AKRA 2B4KA 5FRAA 4S2HA 3PU8A 5J36A 1UZWA 4QD2A 5I8SA 5I8TA 3W58A 4QX7A 1I5PA 2FBEA 4UF0A 1MQTB 4K8RB 4N8MA 5DAQA 1MQTC 1TVGA 1UO9A 5BNPB 4Q4Y1 4GB33 1O59A 3K46A 5DG2A 1DGRA 2BERA 2PHFA 5J48A 1D4M1 1JZ6A 4DXSA 1UY3A 4K8FA 3NNJA 2JD4A 4NO4A 1RB8G 1UKGA 1OH3A 1UOGA 1R083 4AFMA 4LORA 4XFFA 5FZ6A 3Q8CA 3UGFA 5J1XA 3LD8A 5A7OA 1PIV1 3ENRA 3UKNA 4XZUG 2BP6A 3H50A 3SMHA 3ZN6B 5FOJB 2BNOA 3B9IA 4QXHA 2VD7A 5GZDA 3N7LA 4RHV1 3J7MA 2HYXA 3O1PA 5ANQA 1LOFC 1YIFA 2RVAA 2W9XA 1U0AA 2Z42A 4HMZA 2VGDA 4KWJA 2GAUA 4Q0UA 4FPYA 4BQXA 4YG6A 4F3JA 5IUQA 3V0AA 2VXRA 4BHPA 4AW7A 1V0AA 4Y5SA 3GXUA 3PVOA 5FYMA 5FKBA 1S1AA 1GP6A 2RDNA 3JB8A 1WGPA 5EPAA 2JDMA 5EXOA 2AEZA 4DB5A 1W6NA 1CR7A 4YM2A 1JZ3A 1D2QA 4Z2WA 2J22A 5FYSA 4PLOA 1TEIA 2ARAA 3GM8A 4LHSA 4Q26A 4Y5Z0 5FLJA 5CISA 5JR2A 2RS52 1LTEA 2J1UA 4RS5B 5BUVA 4V2VA 5F6LB 5JIUA 2ZGSA 2R7EB 2PAMA 4ZONA 1AL23 5JVVA 5A32A 3LQCA 2E7TA 1DQ2A 4LPLA 2D3PA 3OOXA 3MPBA 1AR93 5FZKA 1N1VA 3GZUC 3ST7A 3ZDSA 3LPFA 1CD3G 4KU8A 3ZFEA 1XNBA 4OMDA 4A3ZA 3H8XA 4Y22A 2BYVE 3K3NA 3WHUA 4JKKA 3WQ0A 3WNXA 4HONA 4MLOA 5F5CA 2W5FA 4ZU5A 2A3YA 5F8PA 3AL5A 4WVMB 2WA4A 4XF3A 2OX0A 4MGYE 1UU5A 2BJSA 4KG0A 4Y24A 1XSRA 3LIGA 1W9FA 1HRV2 1UXXX 2AR6A 1E5IA 3DEMA 1VPHA 2VG9A 4OUMA 1FX5A 3SH5A 4XJUA 4AQSA 1ZZ8A 1VRH1 3LFMA 3R6SA 3FWEA 3O1SA 1BMV1 4YPJA 2WN2A 2ARCA 4P9JA 2HEYF 2YDEA 3N9QA 1KFXL 5JXHA 3SKJE 2TEPA 4BH9A 2VTXJ 2ZX2A 3EHKA 2BBAA 1QKQA 1WMDA 3ZFEB 2UYAA 3POBA 5FZ7A 1STMA 4Q29A 2WZ8A 4YW1A 5AVAA 4O9EA 1WCQA 3RGBA 5FXXA 2ID4A 1RINA 3LSDA 2B7YA 1DZRA 1KS5A 1ND3C 2FDJA 2DV9A 5CKQA 5FK7A 4CEWC 3RZHA 4D8MA 4XIOA 1VRBA 3MIFA 4XABA 1U5XA 1T2XA 2P4EA 4ET7A 4DO0A 3LEKA 3LDRA 5CZKA 3K75B 1LAJA 3H0OA 2A75A 3VDCA 4JGYC 5F5AA 1N1TA 1DBNA 1OF3A 1LGNA 2YC4A 3JD72 1EP0A 2VZRA 1ZZ6A 3THPA 3NNLA 3A4UA 1AR72 4PJYA 2WSUA 5C8CC 1W6OB 2QJVA 2A73B 1G8WA 3USSA 4BOWA 5BNOB 1G9FA 2P2KA 1QXPA 3NJXA 5FZBA 3U07A 3ACIA 3PVNA 4LBQA 3S7IA 1CAXB 4XUPA 5FLIA 4L92A 3CF6E 3UK9A 3VHNA 3GZEA 4YRDA 4KMQA 1QJY3 1G7YA 4GD4A 4HPKA 4M4PA 3UGGA 3WR0A 3IAPA 2R6QA 3NRUA 1UMIA 1QIQA 4BQYA 1DYPA 1NE6A 1O91A 3U1XA 3AFKA 2Z79A 1G9CA 3UJOA 1YCIA 5L7OA 4XF0A 3DPRA 4I01A 2VZVA 3ZYIB 4A4AA 4COWA 5FQ0A 1AUYA 3LEGA 1B35C 4NE9A 3KV9A 3UNPA 4Q4Y3 3ZDVA 4B8EA 1M4WA 1U5YA 4JHTA 1S4CA 2A6ZA 1CVNA 1SACA 1YIPA 1WZXA 4Z8BA 1B09A 2W1WA 3ZMOA 1JZ8A 1NA1C 1O5UA 3N9OA 4BQ3A 4IV3B 5GLWA 4E2QA 4WBBA 1HRV3 2R061 1GBGA 5GZEA 4PQQA 1YFXA 1ULGA 4I0BA 5LA0A 5B4XA 2YG0A 1LOEA 2BVVA 2JDNA 4ZKTB 3RZGA 4QPIC 3G7DA 3RYRA 2OPWA 2BDRA 2QQWA 2XJTA 1K5MB 3ZPOA 2DFCA 1XSQA 1X9PA 3J7NA 2ZKNA 3POSA 5FMBA 5FYIA 5A7WA 3SCFA 1GZ9A 3ZXAC 4CTEA 4CE8A 2ETEA 3SNMA 3VDDB 5JIAA 3KZ4C 2G9GA 2HBUA 4AWDA 4CYDA 4ARYA 3AYAA 1EV13 1ASJ1 1R64A 5FAXA 1QU0A 5FJHA 3IT8A 2XXZA 4KI5M 1UOBA 1BXHA 5C5UA 4YFZA 1BQPA 2FHRA 2VZOA 3WVJA 5EIYB 4J1WA 4ATEA 1PO11 2ET7A 2VZ1A 4LKDA 4PBOA 4F83A 5C3QA 3CIHA 3I59B 5B2GB 3AB0A 5FO8B 1DQ0A 1YFWA 1LU1A 5FP7A 2RJKA 4OYUA 4AQ2A 4NHLA 2HWD1 1UZZA 4XMAA 2DYCA 1GP5A 5AFBA 2WRAA 3SLIA 2BGPA 3VD7A 2AREA 4MXWA 2OPKA 4EYUA 2E32A 4D94A 3V0BA 2D5FA 1X7NA 3J7HA 4AXOA 1E5RA 1UKRA 4PHZA 5ERLA 2XBO1 5ABJA 1FOD2 2W1QA 3ORJA 4LBOA 1QOSA 1ASJ2 2MNGA 1ZA4A 2ZGQA 4JGZA 5FQ0B 1EY2A 2VW0A 5L7OB 3I3MA 3CKHA 1C28A 3PUHA 2R062 1XRUA 5FPAA 1OHFA 5EJ1B 3HJRA 4YW3A 5FYVA 2KA3A 4XW3A 5C6CA 3O1UA 2VZUA 2D3SA 1HB4A 2TUNA 4RQPB 2CNAA 4JTNA 3ETPA 4XQWA 2PTMA 4XEZA 5IWFA 4ARXA 1I1EA 1APNA 2ZKLA 1ND2C 3RWKX 4HBNA 4XZPA 4IL7A 1U5ZA 2ZEXA 2DCYA 4AEJA 1PO22 1H8TA 1ONAA 1QF3A 5GKAC 2FDHA 2MPFA 4Y1YA 1W05A 4JRLA 5JR7B 4CCEA 1W6OA 1IKQA 5C9AC 2OT7A 3ILFA 1HB3A 4KWLA 2CL2A 3OPZA 1POV1 5DXDA 5KXCA 5GM0A 5AC93 1FPN2 3RZZA 2IFRA 4EN6B 1E5HA 1A8MA 4IV3C 2TBVA 5IVJA 5FZ1A 3OTFA 3J8F2 3WY6A 1YQ5A 4COZA 1YXWA 4QQHA 1H8TC 2Y6JA 3GHNA 1NLQA 4OHVA 3OPTA 2WWJA 5IAVA 4WM8B 2NYYA 4K1ZA 2XLAA 2YU1A 1JMUB 2C6SA 2FD8A 3VGIA 4AGGA 1J3QA 5A6QA 2YGMA 1XBFA 2X10A 3KV4A 1ZBA1 1Y7BA 3MUZ1 1POV3 2RS33 2D5HA 3WG3A 1VBB1 1W3VA 2I07B 3HN1A 4PI0A 3WDWA 3IPVA 4IESA 4GZ9A 3T3YA 2Y34A 3BUCA 2NN8A 3ZKYA 3HNBM 5GJ6A 4LA2A 1REFA 1JU3A 2VQ0A 2ZX1A 4A3XA 4FFFA 1W0PA 2WNEA 1SFYA 3GBWA 2JE8A 2ZX4A 3FUOA 4QQPA 4OVEA 3NO8A 5C70A 3WNOA 5J3UA 4XYXA 1ZRCA 2JG9A 1TMF1 2Y6HA 5A33A 4ITCA 2EXIA 4QQ2A 2A6VA 4FPCA 1HRI3 5DAPA 4GIQA 3VBHC 1YHFA 3LFIA 5FP3A 4GMP1 1RUJ3 4R8HA 4YVWA 3VBSC 2WABA 4QHBA 4XUOA 1W06A 2DVGA 3C3VA 1JUIA 4N90A 2VOWA 3OSDA 4Y33A 5FZAA 3RMYA 2NP0A 5KHKA 3WW3A 3W5NA 5DG1A 3B5LB 3VLBB 4PDWB 3ZSLA 1TME2 2VZQA 4EN0A 4FTSA 2GN3A 1V6NA 5KWRA 4YW7A 5JSRA 1JBCA 3FLRA 5LBEA 2NM1A 5J98B 1CGPA 4M4RA 1MR5A 1NCRB 1SDDB 4YZ4A 5FZOB 3VDDC 3MHZA 4E27A 5CG8A 4URTA 5IYYA 3BTYA 2H0VA 2GC1A 4XJ8A 3LOBA 2PXJA 4H2AA 1REEA 1DZTA 1H8VA 1OBNA 1SDWA 1JYWA 1WBLA 2ORZA 4GXLA 3KQRA 2CDOA 3GZAA 3IB3A 2HEVF 1QEXA 4IEUA 1RMU2 2A1XA 4XDPA 5FPZA 3KT7A 1FMD3 4PIYA 4QXBA 4XTMA 4BYYA 1O3SA 1UYZA 2WR9A 2VPVA 3SISA 1PO12 5BNQA 4FPOB 4P08A 2JDZA 4QX2A 1WMXA 3ACLA 1CZVA 3UETA 4QU2A 3A22A 1KFUL 2QQNA 2VNGA 4BZ4A 4OULA 1LESA 1W2OA 3LA7A 4QMAA 4LOSA 1VRH2 4AYUA 1SBFA 2VNRA 3PVBB 4ATFA 2HWF3 2B9UA 5TSWA 3RYPA 4GH4C 1H9WA 4LBKA 5FY4A 4FPJA 5J09A 2WYSA 2GNTA 1DDLA 4KGGA 3OGSA 3WF3A 5A7PA 1RIRA 3BB6A 2ZPXA 3MIEA 2XLFA 2WBKA 3NQHA 5HCBA 4D7YA 3FHAA 3EMRA 4WM7B 2QDRA 1W9YA 2EIBA 1RUI3 1CONA 3CQOA 2Q8DA 1F8VA 5A80A 2A71A 1LJ7A 4CCJA 1IOAA 2YPDA 3OUHA 2WN3A 4F7ZA 4QQOA 5IFTA 2YBKA 1D0HA 2NZ9A 1JHJA 4UW3A 1COV1 5E16A 4FAHA 1IQDC 3D6EA 3ZYGA 4BMEA 2XOMA 1GYKA 4ISRA 4OQ9A 2CV6A 3EYPA 4UXAA 1AR63 3D5OA 1GQHA 5K0UA 3I3DA 2OKXA 3TAYA 1PZ8A 4DMIA 3VBSB 1YI7A 4EN9B 1YFYA 2PLV3 2XWJB 3CL1A 2R1DA 3HWJA 1BEV1 2ZGLA 2YYOA 3APBA 4FQZA 4XF9A 2WNOA 3IM0A 1GOGA 1VR3A 5L9BA 5I0DA 1JH5A 2RS32 4M00A 2QQIA 3ZR6A 5C33A 5C4WC 5I0UA 4YG3A 3WINE 4EWDA 5A1FA 4CDQA 4FP3A 1PK6C 1PHMA 3B69A 4NROA 1I6XA 4Q4X1 3LIHA 2PHWA 4YVWB 1GWLA 4YGDA 3ZSKA 3FFQA 5FZ4A 1ULOA 3LGRA 1QDOA 1W6QA 1W6MA 3HQUA 3RVHA 4H14A 3BPSA 4CXYA 2R0FA 2Y0IA 3OY8B 1NQJA 4FXGB 2QQOA 4MZUA 3RPQA 2ZMLA 1F4HA 2JG9B 4IDZA 4UFHA 2EXKA 5BY5A 2C0ZA 3HVDA 5AC92 3R05A 4E4HA 5F3IA 4BIOA 1LKNA 1RUG2 4P9XA 1UU4A 3KSCA 3VD4A 2ENRA 1C8M1 2X05A 1O6UA 3QOPA 1VE0A 3PMSA 1AZDA 5D2AA 2R1BA 4HKWA 3VD9A 3A0NA 5JSPA 1CX1A 4IV1C 1AYM1 1GZWA 4AAXA 4W6YA 3POFA 5FBZA 3KVAA 1WA6X 1GSLA 2D6OX 2OW4A 5HXVA 4AHYA 3N4MA 2R072 5ACA1 3FMGA 1RUC1 4ZS3A 3WX5A 3UKTA 4Y20A 1WLTA 3ZXKA 2YY1A 4EN8B 1LHVA 1NY72 1RJ7A 5FO7B 4CU8A 4XJAA 3IDAA 1D4M3 1FATA 2UURA 4LUKA 2WFPA 3WP5A 1TMF3 3IN9A 4BLIA 4DY3A 2Q8CA 1SQ4A 3RSJA 3RI9A 4BB3A 1BK0A 5JOXA 1O3QA 1BVVA 5B4NA 5EV7A 2FDGA 5T50A 4QDRA 1AYM3 1WW6A 2YV8A 3ALQA 3C2UA 4RR3A 1MVQA 1OPOA 4ZY9A 3I7DA 1ULFA 5FZCA 1ND2B 4CP9B 5JXIA 2W3JA 4Y1VA 1ZA7A 5IT6A 3T4VA 4XCAA 4OHYA 5C3SA 5J7MA 3LOIA 5DABA 3T1MA 5FKCA 4JAAA 1A6CA 2CDPA 2VO5A 2J1AA 3VDBA 2ZTNA 4AI8A 5D8AB 4EWEA 2CTVA 5L7OC 1W8FA 1ND2A 4GWIA 5IW0A 3VZMA 3AVRA 3AYCA 3T0AA 3T2QA 3PDQA 3HD8B 2Y64A 2VQAA 4RQPA 3MBWA 3GGLA 3H1YA 5FYUA 5K4LA 4CZSA 2MHFA 2FQPA 5LWBA 1GNZA 2QQJA 4TSVA 3RG0A 3HBKA 4IW3A 4ZHNA 5LK5A 2XVGA 5H9QA 2BTVC 1Z7S1 4V2WA 5FREA 3WZ1A 1AL21 5KC6A 3S5AA 4XFHA 2AACA 4FPFA 1PNFA 2YBSA 3HNYM 4UFKA 5BNNA 4D7SA 1MEC1 4N53A 1LRHA 2HBTA 1FI2A 2WT1A 3Q8EA 4META 3SH4A 1I3HA 1LHWA 2GC2A 1MS0A 4LBQD 1UXZA 4PI2A 4YW5A 4IQPA 3UT0A 5F37A 1MZ5A 1MS5A 3U78A 1V9U1 3OGJA 1S2BA 3RI8A 1X50A 2VMDA 2G4IA 4LTAA 4OLLA 4OI0A 5DZEA 2K2SA 5CBLA 3ACHA 4ZU7A 2RS53 4CEYB 5JWPA 2F4PA 4YVSA 4LULA 2WS93 2IXLA 4HVQA 2YROA 1VBA1 1HXS1 3RWNA 3O1VA 1URXA 2OYZA 3JBG3 4FAGA 4GALA 4QPIB 2VJXA 4RFT0 1GOFA 2ZEZA 3P3NA 4ASKA 3AM2A 2KR2A 3QACA 1TME3 2OZJA 1PIV2 2V09A 3ZFGB 1S2EA 3B02A 2HWC2 4LO8A 5FIXA 4M0NA 4CDQB 2JG8B 1OQEA 4UAPA 4AOCA 1NOVA 1AR61 5IK8A 3U11A 3AMPA 4MHRA 3T4HB 1ULPA 1AX1A 2WNVA 5CG9A 4R9BA 3MFAA 3DXTA 5F3EA 1HXS3 1GMMA 3OCPA 4NIIA 3ITQA 1C5IA 1TMF2 4AFBA 5LY1A 1JW6A 1VP6A 4GWNA 4K21A 5FBJA 2ZOEB 3URFA 3MF9A 3FE5A 4YVWC 3VBSA 4P02B 3LPGA 3C8XA 3POWA 5K0UB 1VJ2A 1O5LA 2BGOA 4COVA 2D98A 1A8DA 1GU3A 2WLQA 1GFF2 5IVYA 4Z2AA 3U4SA 5FP8A 2WZPP 3M7AA 2R16A 2OVUA 3AP7A 2JD9A 1C1FA 3NNGA 4GB32 4YNIA 2LW8A 2Y38A 1W8OA 4GJZA 2F4LA 4PF1A 4B4PA 1ULDA 4LITA 3WNPA 1LENA 5LZ6A 1PO23 3C7GA 4LQRA 4BM8A 1JYCA 2PQQA 3JBG2 4CU9A 3K3OA 4BQ5A 1C4RA 1FNYA 1W2TA 1XJAA 2UWBA 4IEOA 2C26A 5FYCA 5CFDB 1UMHA 3NAPB 3IMNA 2B5HA 2ZABA 4QXKA 4YARA 3P1IA 2WUHA 3BOWA 3VD3A 4CDUC 4YW4A 5FZ8A 1V6LA 1SLLA 5IHRA 4QHOA 1OVSA 3J8F3 4E2SA 1YUDA 3T09A 2PHRA 2LM3A 1NYWA 1VMFA 2IXJA 4GJYA 4RA0A 4Y4YA 2JIJA 3SCHA 1OFSA 5C5TA 1BZWA 4XUTA 4Q0SA 1YRZA 2E6VA 1LB2A 2XJSA 5BNOC 4TN7A 1W03A 4PQ9A 4FOQA 4K1YA 4W65A 4OZXA 3EB7A 2A3XA 1E5SA 1AXZA 1S0GA 3I2GA 2XJVA 4H7MA 2QQLA 4QKNA 3LF7A 4BMBA 3KQ4B 2YUEA 4IE7A 4AEDC 3OF1A 5HXMA 2Y60A 4BXSV 1CZTA 3POYA 4LIVA 3D0JA 1PVC2 1UIKA 5CA6A 1QH6A 3ZFGC 1QH7A 2PAEA 3DGTA 4DINB 1YQ6A 1J84A 3KCCA 1RXFA 2RS13 1WMFA 2P6HA 1YI9A 1LOFA 4NRQA 4F8AA 1HDKA 2CSGA 4S2GA 3WNKA 5A6YA 3MEPA 3PVEA 3WP3A 4CXWA 5FY5A 3W5MA 2OQ7A 2ARXA 3R4UA 1GOHA 3AMQA 4XDOA 2V72A 2VZPA 4CEWB 2O0OA 4NAOA 1GV9A 1Q8SA 2ZACA 4A6SA 1YFUA 1O8SA 4AHWA 4BQ4A 4NN0A 2GSYA 2WT2A 4SLIA 4RR3B 2FCUA 3NWKA 1N47A 3BODA 3K2OA 1Y4WA 3WCRA 1UIJA 5A33B 2XBO2 2R041 4H3WA 1O3RA 1EYBA 4CP0A 4NPLA 1QXJA 2XL7A 3OBZA 4IERA 4JHZA 2OUJA 5HBAA 1QQP2 1KEXA 4FTEA 4O9GA 4V1PA 5FY8A 4COYA 4OMCA 1REDA 2X5IC 3THTA 1J59A 5FZHA 2WQZC 1QOOA 1UX7A 1WA4A 1QJX2 2I45A 4MGIE 4WVMA 1DLCA 4ASLA 4IGPA 5A6XA 2EXJA 1RHI1 4PCRA 3D3AA 1UL9A 4DRRA 1PGSA 3FC0A 4IEWA 5E1RA 3WXPA 3JU9A 1D4M2 5FLHA 1CN1A 3IZOA 4M3CF 1EPZA 3HT1A 2XJQA 1DQ1A 3KLSA 4G4FA 3ZYHA 2VMGA 3WSOA 2EA7A 4JV4A 3S0MA 1NUKA 2K0GA 1JU4A 4HL0A 1CAVB 5G05L 4PBPA 3VZLA 4IUGA 4YFWA 3IDBB 3KB5A 1UPIA 3N7KA 1N3OA 1T6BX 5FY1A 2BFUS 2RM21 1BHGA 3AVSA 3QD6A 1W6MB 3GBFA 3ZXFA 4BQ2A 2VVFA 3FHQA 3LAGA 4QT6A 2KM2A 2VCMA 2ZHNA 1WMEA 3VBOA 3OD0A 5GLVA 3GCWA 3B7MA 4UWDA 2GMMA 2IXHA 4Q4W3 3N3HA 4BE3A 3I54A 4C1WA 2B42B 1R082 1PVXA 1IG3A 1NXD1 2W52A 3AL6A 3E97A 5LATA 4JZRA 3ZX7A 1Y9GA 3CNAA 2R071 4AVBA 2XJRA 3TB0A 5KBFA 1R091 1RUD1 2WAOA 1WCKA 1BEV2 2Y33A 2O14A 4AVSA 5LY2A 2DVDA 2FDIA 4S2DA 3I2JA 1GUIA 2ZZQA 2DCTA 1N3QA 2JG9C 4BPZA 2CY6A 3C7FA 3ZO0B 2RDQA 5T5PA 4LBNA 4B3NA 2ERFA 4CA9A 4E4ZA 1CJDA 1OOPC 1RUG3 1VBD1 1SZBA 1IS6A 1YEWA 4D0QA 1S0IA 1JHNA 3M3OA 1XU1A 1QJY2 2WFF2 3FL7A 5L73A 4MO3M 5LEKA 1AR71 2DBNA 1ST8A 3NV1A 1W8HA 1G86A 3NJVA 4WM7A 4W6WA 5CFCC 3NW4A 1RYYA 4XBLA 2CAUA 5K7PA 4DXTA 1CJPA 4UFLA 1H6XA 2Y0OA 5FPXA 1KITA 5C3RA 4E4SA 2ZEYA 3VBFB 5FZDA 4FOWA 4GH4A 4HK9A 2WJSA 3DKQA 5KHIA 3VL8A 2QUOA 1PM4A 4FCAA 1WW7A 2OIIA 1ZZ9A 2A7AA 1F9KA 1HJFA 2IZWA 5FJKA 5FCCA 4DY5A 3FBMA 4DPNA 3AK0A 3O0WA 2VMFA 3I59A 2QQMA 1DGLA 1O4TA 3AP6A 3VBRA 3WNLA 1QOTA 1PIV3 1S0JA 1VBC2 3GNEA 1Z78A 2GZWA 3B94A 1FPN3 2D43A 4LE4A 2F17A 3N35A 4NRMA 5FY9A 1PO13 4A7YA 4XTPA 3T2TA 3VBUC 5FK8A 1RUJ1 1C5HA 3THDA 3CJXA 5FZEA 3WG1A 5E6HA 3O1MA 1W8WA 3TWIA 4ES9A 1GQGA 1ENSA 3AZWA 3VBOB 1WCSA 4BISA 1N1SA 1NCRA 3MPPG 1KS4A 5D8AC 3UGHA 4AQ6A 1QJEA 3Q9OA 2ZCWA 1VAVA 4QX8A 2W46A 5FZLA 4BQWA 4QPIA 4KQ7A 2ZGNA 1JN2P 2VH9A 2VOKA 3K4AA 4LBJA 5H9SA 1EV12 3RS6A 4CDXA 3PU3A 1CAVA 1ZZCA 3K48A 3VZNA 2GDFA 3MUY1 1LGBA 2GH8A 1PK6A 4FBFA 3WHTA 1R1A2 1G9DA 2HWF2 4UBHA 4IV3A 5F32A 4Q8KA 3RZKA 4AI0A 1DZQA 4UT5A 1AR91 3H3ZA 3LE0A 1FOD3 2AZ5A 3AJYA 3E1F1 2J1RA 3HT2A 4O65A 4EWAA 2P3KA 3JZVA 2Y8KA 3H8RA 2DWRA 3P3PA 5FO9B 5LBCA 4L0PA 1MEC2 4S2FA 3CMGA 3O5SA 2DTYA 3POIA 4P9LA 3D8CA 5D21A 5BNNB 4DUXA 2OZ6A 2YFUA 1R1A3 1HV0A 4LK7A 2W0XA 4JQTA 1RITA 4P9GA 4AVCA 3E6BA 4XETA 1A3KA 2HWF1 2V4AA 3FBYA 4QX1A 2ZXQA 3TRSB 4B7KA 1DQ6A 1RHI3 5KR7A 3UESA 4H55A 3NV2A 2GALA 2ATFA 3IPVB 5HCFA 4Q4V3 2E51A 5A1LA 1NQDA 1TE1B 4M3CB 3M8LA 5A3NA 5JDBA 5LW9A 5FYHA 2BBVA 1H2NA 3LKJA 1AYM2 1FV2A 4LJHA 1NKGA 1NCRC 4R4XA 4TLGA 2C1FA 4CEWA 4ZZ5A 4GULA 2XWBB 1H4HA 3WNNA 4BQ1A 4UW5A 5F5QA 1HB2A 3WP4A 1H2LA 3ZN5A 4Q27A 1HLCA 3FN9A 3N9MA 4N43C 2W94A 3ATGA 4PDWC 1V6MA 1MACA 2JXAA 2VTFA 2P6CA 3AP9A 3AZZA 1RGSA 1CPMA 2X53S 3U37A 3ILNA 3ZPYA 2KD7A 1ALYA 4U2AA 3FX3A 5IVBA 3ZXEA 4UBGA 4UW6A 3ZIXA 1BEV3 4RN5A 5T3NA 4FPKA 1WW4A 5EP9A 2XVKA 5FMOL 4DS0A 3OUIA 4NIGA 4CRQA 2R073 2XKPA 5L9RA 5LRRA 4DXZA 1AXKA 4AI1A 3GZTB 2L9LA 4LBLA 1GWKA 1SLCA 1IG0A 4RGAA 2WO7A 5FP9A 1MS3A 5FY0A 3SCGA 3VDAA 2XL9A 4UFIA 2PHTA 2VNOA 4M3CA 2DDUA 3IIIA 4ES8A 3BI3A 4P9IA 1RVF2 5CNAA 3WQ7A 1XNCA 1OH4A 3R4DB 2EIEA 1FYUA 3LEIA 5A3WA 2GMEA 2VMHA 5LB6A 4ONUA 1AXYA 2P34A 5JI9A 2HWC3 4LO4B 5CFDA 1HIXA 1AX0A 2FZ1A 5DMYA 2P3IA 5F6KA 3G6JB 1OT5A 4FPGA 4J25A 1VBD2 5EQUA 3IDEA 5HPOA 4XUQA 1F15A 2WNVC 3X29B 2WO1A 5EWSA 2NMNA 2VUCA 4RGKA 3Q8BA 3AX4A 4L9BA 1JI6A 4WM8C 3N7JA 4N43A 3ZXJA 1OKQA 1W6QB 1OLRA 2X09A 4Y22B 2E31A 1OD5A 1OLMA 1PZ7A 3VZKA 4AEMA 2KXLA 2RV9A 5JXGA 3M3QA 5T5OA 5HV0A 1JS9A 3HMYA 2R042 3USUA 1KDKA 1HV1A 5A3LA 1MS1A 1KQRA 2CWMA 3TN92 3HOBA 1CAUB 1J3PA 2XBO3 1LHNA 4TYSA 2DUOA 1PGW2 4HSJA 2AGSA 1H9PA 2C9AA 2J7MA 2AH2A 4OHXA 2G9ZA 3VBHA 1JYIA 1PMHX 3AMMA 1PX3A 3I49A 4DOUA 1FMD2 3ECQA 1JODA 2QZ2A 1B35A 3B93A 3O14A 4CEYC 3VDDA 1QJX3 1RMU1 4Q1PA 4Q0QA 4INDA 5E89A 3ZFGA 3VBRC 1POV0 5ANNA 4A2UA 3NJYA 3V0AB 1VLNA 5FPUA 2YC2A 4WVVA 1BYHA 1ASJ3 2H0BA 3J7LA 1DGWX 3HPNA 1NXMA 3QLQA 1AYN1 4RYDA 2EVXA 1HB1A 5GLZA 4FOVA 4A44A 3VBUA 2VAUA 1SBDA 4QGMA 4QGLA 1HRI1 4GMP0 1W6PB 1Y9QA 4LHLA 2JENA 2ZJCA 2ZA9A 3FFZA 3BGAA 4DFSA 4HT1T 4JDNA 1RUE2 1PNGA 4FSJA 1K45A 1RMU3 4IEVA 3HQXA 3T2OA 3QH6A 1U5IA 4R9CA 2JECA 4I3PA 4NR1A 2D6PA 3VBFA 4W4ZA 1QQP1 5CKMA 1G9AA 2Z5WA 3VL9A 4IEXA 5FZ9A 4KWUA 2IVJA 2XKOA 3KCXA 3NKTA 1MQTA 2RS12 2Y6KA 5DUVA 4HVRA 3U75A 3ZFFA 2ZAHA 4BCUA 2H6CA 3NKGA 1PVC1 3AJZA 2W39A 2EXHA 2UWCA 2XHNA 1C8NA 2P37A 3FLPA 3RMXA 1XNTA 4QGNA 1HJGA 2HWB2 3LCPA 1WCUA 2ZX0A 2WO2A 4LNVA 3O1OA 1CIWA 3OUJA 1Q56A 4L99A 1UF2C 4Z07A 3U4XA 2IFWA 1CAXA 4DUWA 2JB4A 1LGCA 2WS91 4QPGA 4MV2A 1QY4A 2JEMA 4ZZ8A 5CADA 3VZOA 5A1AA 2WFF3 4TWTA 1W9TA 1F2NA 4EZHA 4EE2A 1TME1 3PUAA 2VU9A 1UY4A 3PURA 2N7GA 4UYBA 2QQUA 4LR4A 5BXXA 3H9AA 3ZSMA 4YSFA 5LCWL 2AENA 2WQ8A 4RGGA 2VXJA 5J96B 3HBZA 5IK5A 2P5BA 3ES4A 3KGZA 1MS9A 2XDVA 3FHIB 3KT1A 5JCTA 2VMEA 2JKBA 1QDCA 3THCA 2Q5TA 5DAWA 5DUUA 4CP1A 1OLME 1NCQC 4JVAA 5JPNB 2DUQA 1C1LA 1OQDA 3C7OA 4X6RB 5FZ0A 5A3UA 1UW8A 4DXRA 1UWWA 3ZR5A 2JDUA 1POQA 1XYNA 2CYFA 3ZFFC 1AR62 1PGL2 1ZBA3 2BU9A 4BWOA 2P3YA 1OA4A 4LXLA 4DZGA 2CAVA 2QDNA 3MFCA 3VZJA 4L11A 5E88A 5C8CB 2P17A 3B9CA 1BBT2 5E8AA 3WD5A 1GZTA 1NLRA 4QWNA 2A6YA 4AEDA 3M3IA 2XH6A 3M3EA 4HN1A 2BEOA 3WEZA 1VB2A 3P6BA 1CQ9A 3DUIA 1RUF1 2HKXA 4PLNA 4YGEA 3VKLA 4C8DA 5JPMB 2IXKA 4JC1A 1US2A 4QX0A 4GB31 2QTWB 5CFCA 2LROA 4XCBA 4BLJA 4NMIA 3IBMA 2JDAA 3H8OA 5FMDA 3WG4A 2RR11 4QX3A 4YM3A 3JD73 3DN7A 4FFIA 2PHDA 2O8OA 3OY8A 1ZYBA 1BLZA 4LKFA 4LE3A 5A7QA 5IK4A 1QNYA 3LZZA 5JOYA 2YPJA 1NG0A 1AYN2 3W59A 3L2YA 3NVCA 1F4AA 3RJRA 4EQVA 2ZAAA 1V00A 2K9ZA 2BV4A 5JI7A 3O1RA 1GNHA 1H1IA 2W95A 2YGLA 2ILMA 4RHV3 5CYYA 2CHHA 5F5IA 2QCSB 2ZMKA 3KCYA 1W8ZA 4HG6B 5A3OA 3WQBA 2HEWF 4COUA 4D69A 3MICA 3B3QE 1ULEA 2MEV2 4GWMA 2WYFA 2VZ3A 4I02A 1W6NB 2UU8A 4NVPA 3WF4A 3MGUA 3ZVXA 5CAZA 1XC6A 4HK8A 4KNCA 2AYHA 4JRAA 2XG3A 3ZFEC 4Q1RA 3POJA 5H9PA 1XU2A 2GNBA 4FXKB 1DU3D 4I0WB 2ADEA 5C7GA 2VW2A 1KJRA 3RZJA 3QCWA 1O7FA 2GU9A 4Z92B 4FQ4A 1QMJA 1SBEA 1RUE3 1WLDA 4EJRA 3NSTA 4NUBA 4AVVA 1DQ4A 3B00A 4DEVA 1WW5A 2B39A 1O4ZA 3MYXA 3I2OA 1JUHA 5GALA 2YZ4A 4CP2A 3M3CA 3NL1A 4TXWA 2XUEA 2RHPA 2VQTA 1X82A 1A78A 4WZFA 4MGTA 5I0SA 3CJIC 5FWJA 2D6MA 4Q4X3 4AI9A 4AVTA 3V0BB 1S2KA 2ET1A 2VULA 1ENXA 2Q4SA 1N3PA 2GN7A 4MHUA 2ZGOA 2E33A 3ELNA 3O0XA 4IEQA 3O1TA 3OBTA 4NIAA 1ZREA 3CHXA 3AZXA 4IXLA 3GJBA 3OPWA 1QWRA 4YG0A 1XE0A 1QGLA 3T0BA 1RVF1 2C4XA 4CDWB 1ACCA 3VBUB 3VHRA 2ORXA 3LEMA 3OBRA 5IK7A 3R4SA 2UYBA 1X9TA 4A6OA 1MVEA 3W9AA 4CCKA 2VCCA 2V4VA 3MV01 5A3PA 4Z82A 1TG7A 3WUCA 5A3TA 1NA1A 1X8MA 4WZCA 5T54A 5AC91 1ZNPA 4LT5A 2C9KA 5FZIA 1D7PM 1HQWA 5G04L 2IXIA 4NWVA 1B35B 2TNFA 4OFGA 2FCTA 1V6IA 4OCTA 1DFQA 3BALA 5FXVA 4IEZA 4D6QA 3BIEA 4QQLA 2RMU1 1LU2A 1VBC3 2DTWA 2PHXA 2B8MA 2GP5A 2PLV1 3I3EA 3ME2A 4Y4RA 3HN3A 3VBFC 3VBHB 3N7MA 1YQ2A 4OUEA 4DNYA 1SLBA 4MH0E 4QB1A 1OLQA 4QKFA 3A21A 4YW6A 3FLTA 4K20A 1NLSA 2JG8A 3N9LA 1J83A 2RS31 3B01A 4XC9A 4JGYB 3BTXA 1VBE3 4CCCA 1X8EA 3MV11 1DIWA 5GZCA 1UOFA 1A34A 1OFNA 1HN1A 5LRSA 1O4YA 4QM9A 5FY7A 4N43B 1RC6A 2NQYA 4QKBA 5IJRA 1GANA 5FYTA 2RMU3 4XFGA 2VZSA 1SMVA 3JCIA 3PL0A 4B29A 2OQ6A 1LEDA 2PLV2 5L36A 1BCXA 2RMU2 4CCDA 1UPSA 1MZFA 3DPRB 4BU2A 1UNBA 4FFGA 4XIKA 4CEYA 5FYZA 3WUDA 3AXEA 4UOJA 4D6SA 5JOWA 2W1UA 3Q8FA 2XQRA 4JTOA 5JZGB 5DUXA 1VBE2 2BRTA 1NAEA 3WF2A 4NHMA 3FZ3A 2RDSA 4NAMA 4YM1A 4C0BA 4CCOA 1NZIA 1IPJA 3PIGA 2WIIB 3MO4A 5F3GA 4CU6A 3WF0A 5IVVA 4R9AA 5CVRA 4LBQB 3AKQA 1AVBA 4FPEA 2DUPA 2CWSA 3ZSJA 2W47A 4N7IA 1QJFA 1COV2 4QB2A 1Q8QA 5HV4A 2Y26A 1JOPA 1YQ8A 1ZBE3 2BOJA 1FT9A 1YQCA 2O1QA 1ZRFA 2HJIA 1TNFA 4IEPA 4WM8A 3MDPA 4KGQA 4Q4W2 1HX6A 2JICA 4MG2A 1WBFA 2VY0A 1R1ZA 1J1TA 3IIAA 5EJ3A 1GP4A 4FPHA 5EYYA 4AFDA 3R0RA 1Q3EA 3PUIA 4L8QA 5AVPA 2QKDA 3HAGA 1RUH1 1K12A 1YLLA 2XMLA 1LCLA 1ODNA 4D7TA 2HLEA 2RE9A 2W91A 4P9WA 4RS5C 4XVHA 3WDTA 4CSWA 5I91A 3CBNA 1JZ5A 2JJ6A 1V70A 1OA2A 3CU7A 3TOJA 3CZJA 2O8QA 3KS7A 2GC3A 1KDMA 2V5YA 3VHOA 4X8PA 3S57A 4K6BA 2PHUA 3LDBA 4JCKA 5CEHA 1XE7A 4QPGC 2QQPA 5FUNA 5FOBB 4R9DA 2GP3A 3WT3A 4FFHA 1RUH3 3WDYA 1DYKA 3MLKA 5A6ZA 3S6PA 2Q30A 1LR5A 4RR3C 4LO5B 2DF7A 3VKMA 3LWCA 1W2UA 2BGCA 2ZMNA 1YNAA 3BVCA 1UMZA 1VIWB 3HR9A 4NHKA 3VKFC 4EV0A 5ABJC 1BMV2 3M2MA 4CPBA 1MS4A 5LBBA 4JGZC 2XONA 1UU6A 5D1IA 5CKNA 4MSVA 5F39A 3M70A 4QDSA 3RRDA 2RR12 4XHBA 4GKXA 1LODA 2VNVA 4IV1B 4JDOA 4PT6A 4XFCA 1V6JA 3JQWA 1OOPA 5I0RA 3ZN4A 2GMPA 3BTZA 3Q8AA 2VE1A 1WD3A 1XB9A 1QXRA 4MXWB 3OB8A 5FZFA 4ASMB 3ROUA 3RZMA 1HKDA 4MGSA 2FZ2A 4JDMA 3DXUA 4XILA 1MZ6A 3BTAA 3WNMA 5C4WB 5BV6A 4CCLA 2A6XA 2OS2A 1YO8A 4K7JA 4C91A 2WWSA 4RS5A 1DP0A 1CAWB 1DGWA 2D93A 4Y3OA 5GZGA 1R093 3U14A 3WF1A 3GF6A 1FNZA 4IGOA 3OYWA 4MXVA 4MGQA 4W6XA 1Q8VA 2BPA2 3ETQA 3DKWA 1AJKA 4XJ9A 3O0VA 1XYOA 4FVVA 4MGZE 5T5LA 2HWE1 3MLLA 2ZBJA 2R043 4OHZA 5C3OA 5FDBA 5A7WB 3WV6A 5FP4A 5BNPC 5DPNA 5A70A 2WC2A 3DPRC 1K5MA 4R4ZA 3RQ0A 3V65A 1RUJ2 2V73A 4WVZA 1ZX5A 4XE9A 1AR73 3VUOA 4MGKE 3J8F1 1NT0A 1DQ5A 5IVEA 1V6OA 2A70A 1NY71 3ES1A 3WP6A 5CFDC 3MIBA 2BNNA 2ZGPA 1TZOA 4LOTA 4Q4Y2 4J1XA 4Y26A 1MPXA 3PNAA 5DAXA 5IATA 2VTXA 5DZFA 4WVWA 4ZXEA 3VKNA 3VV1A 5JUVA 1JXNA 3ASIA 3LA2A 1O8PA 3MW2A 4MADA 2BFUL 2VOVA 1QJY1 4KH9A 5F9TA 4XQDA 1RL3A 1LOAA 1RUOA 4GA9A 2SBAA 1W8UA 4DEQA 1BKZA 2NPIA 4NJ4A 2DU0A 1WD4A 3DL3A 3AZVA 3PJYA 5DZGA 4Y5TA 2VUAA 2E53A 4M0HA 4TZDA 1DYOA 3JB4C 4GAZA 3PIJA 1UY1A 1JOJA 2Q1FA 3WDUA 1PO21 2HH9A 4UF0B 1FPN1 1WLCA 3OEBA 4FOYA 3ZFFB 3I2HA 1VBB3 5IVCA 1OQ1A 5KHHA 1AJOA 1K3IA 1NE4A 3ILRA 1DHKB 1XXNA 5FV3A 4CUBA 4MX3A 3H42B 2QQVA 4AE2A 2C5DA 2Z4FA 3NV4A 4HPKB 1SG3A 4MUVA 3AP4A 3BN6A 4U36A 1UY2A 4UFMA 4I2OA 2P1BA 3H7YA 1GNYA 5AFEA 4YZ1A 4Q4X2 1SFNA 2JB8A 2GNMA 1SLIA 1YWKA 1LEMA 2IC1A 2W68A 2VL4A 2Z2SB 3DYMA 5K0UC 2D3RA 3CO2A 4OUSA 2JE7A 1HQLA 2FMDA 3H3LA 1CX4A 2DURA 1H0BA 3OD4A 4P00B 5FUIA 5F1RA 4XXPA 1W2AX 2D40A 5JAXA 1XOYA 2ADDA 5FXZA 1ZBE1 4XJWA 4FTBA 2LRPA 3CJIA 5JOZA 4Q0VA 2A6WA 3PJQA 4AI3A 4B1LA 5KXEA 3T30A 2HWB3 3BU7A 1SHWB 4CDQC 4ZPIA 5KHJA 2C24A 1C3HA 3MIHA 5FZOA 3ACGA 2WZEA 4FO9A 1D4VB 1RHI2 1I9RA 1V6KA 4LUMA 2ZEWA 1D0GA 4HN0A 3I2KA 4QX5A 1JYXA 3PTYA 4PDWA 2VBPA 3WW2A 1O3TA 4XBNA 2MEV3 4KL1A 3KWVA 1IS4A 1WCDJ 2WDBA 1QJX1 1VMHA 1Q43A 1YJLA 3H1WA 5T5JA 2VUJA 3N9NA 4TLFA 3USUB 5ISLA 4IE4A 1H4GA 3DF0A 4XBQA 1LOGA 1W0OA 3V56A 1UN1A 1JYVA 4EROA 4IV1A 5F7UA 5LA1A 1AYN3 3H1MA 1EAH2 4XFBA 4DUVA 2G9FA 2EICA 1S0FA 3AKTA 2NMOA 2MEV1 4AQTA 1KGYA 1RUD3 1CESA 3DCQA 1CWPA 1OA3A
chains in the Genus database with same CATH topology
2W87A 4XUNA 5DQ0A 2YB7A 2VCAA 2YC2A 3JXSA 4CU8A 3IDAA 3HPNA 4RYDA 3VDBA 4A44A 1W9SA 5B4NA 5EJZB 4BK4A 1EUTA 3BGAA 4QDRA 2B4KA 4QDQA 4ZY9A 5JXIA 1K45A 3CZUA 1OD3A 2W3JA 1I5PA 4CU7A 3T2OA 1TVGA 4W4ZA 1O59A 3K46A 2CDPA 2VO5A 2VZTA 2J1AA 2BERA 4KWUA 1JZ6A 1JZ4A 4DXSA 1UY3A 2Y6KA 4E8CA 4GWIA 3F2ZA 2XHNA 1PX4A 3T0AA 1GQPA 3T2QA 5J1XA 2Y64A 1XNTA 3GGLA 3MBWA 2J1VA 4XZUG 2WO2A 2QQJA 2HYXA 2RVAA 2W9XA 3T08A 5DN2A 4CUAA 4DUWA 4QB6A 4ZZ8A 1XNAA 3HNYM 3HEIA 5A1AA 2JKXA 3GXUA 1W9TA 1UXZA 1UY4A 4XURA 1JZ3A 5LCWL 2WQ8A 2J22A 4LHSA 3GM8A 5JR2A 2J1UA 3OGRA 5C71A 2VMDA 2R7EB 3A23A 2VMEA 3ACHA 2E26A 3THCA 3LQCA 4LPLA 1EUUA 2VOTA 3C7OA 2VJXA 1GOFA 2ZEZA 3LPFA 4DXRA 4OMDA 4LKSA 4A3ZA 1UWWA 3K4ZA 4JKKA 2V5DA 1CIYA 2W5FA 2LS6A 4UAPA 1UXXX 1NX9A 1ULPA 4YPJA 1GMMA 3WEZA 2WN2A 2Y6LA 3I2FA 3P6BA 5JXHA 3SKJE 1US2A 4QX0A 4E8DA 3HNMA 4P02B 3LPGA 3C8XA 2BBAA 2JDAA 2WZ8A 2BGOA 4QX3A 1WCQA 1GU3A 4Z2AA 2ID4A 3OGVA 2QBXA 3NNGA 2JD9A 2BZDA 2LW8A 1W8OA 4D8MA 3SKVA 4PF1A 1F4AA 1T2XA 4ET7A 3WNPA 3LEKA 1W8NA 3C7GA 4LQRA 5CZKA 2W95A 3K75B 3OBAA 5CYYA 3WQBA 4CU9A 4HG6B 3VDCA 1OF3A 2C26A 2YC4A 1UMHA 2VZRA 4OZOA 2VZ3A 3P1IA 3WF4A 2WUHA 3VD3A 1XC6A 5IHRA 3T09A 1US3A 3NJXA 5C7GA 4XUTA 1P8JA 3ACIA 1JZ7A 3ABZA 4XUPA 1UYYA 4JKMA 5JMOA 4MOAA 3EB7A 4KMQA 3I2GA 2QQLA 4M4PA 3IAPA 4DEVA 3NRUA 5HXMA 1UMIA 4BXSV 1CZTA 5LA2A 2W1SA 4TXWA 2VQTA 1J84A 2VZVA 4A4AA 3LEGA 3UNPA 2E33A 3WNKA 1W99A 3W5MA 3T0BA 1GOHA 2V72A 2VZPA 3DECA 2C4XA 2W1WA 2WAAA 2ORXA 1JYNA 1JZ8A 1O8SA 4A6OA 2VCCA 2V4VA 4PQQA 3MV01 1TG7A 5LA0A 5B4XA 2QQKA 2YG0A 2C9KA 2WO3A 1W0NA 1D7PM 4JHZA 5G04L 1KEXA 4OMCA 4AG4A 4TTGA 3I3EA 3T2PA 3HN3A 3SEEA 1UX7A 1YQ2A 4OUEA 1DLCA 4QB1A 3D3AA 4ARYA 3A21A 1R64A 1J83A 2VR4A 4KI5M 3MV11 2VZOA 5EIYB 3A7QA 1HN1A 3ZM8A 3WSOA 2VZ1A 2YFZA 1NUKA 3CIHA 1JU4A 5G05L 5IJRA 4IUGA 2VZSA 4OYUA 1L7RA 4UI9L 2BGPA 3VD7A 1BHGA 2E32A 3FHQA 3J7HA 4UOJA 1PMJX 2W1UA 3CDZB 1NAEA 3WF2A 2W1QA 3CKHA 3MO4A 3PUHA 2DCKA 4CU6A 4QAWA 3WF0A 5EJ1B 3HJRA 2VZUA 2WAOA 3T0DA 2W47A 4QB2A 1H6YA 3ETPA 3I2JA 1GUIA 4ARXA 3C7FA 3I2IA 3ACFA 2ZEXA 4D0QA 2VMCA 1WKYA 3FL7A 3C7EA 4MO3M 3PUIA 3OEAA 1K12A 4BK5A 3NJVA 2VQUA 1RYYA 4GWJA 2HLEA 2W91A 4A45A 4DXTA 4XVHA 1JZ5A 1H6XA 2ZEYA 3CZJA 4JX0A 5IFPA 4BJ0A 2VMFA 2QQMA 2X10A 3I97A 3MUZ1 3WNLA 4CVUA 2VM9A 4GZ9A 2RJ2A 2XONA 3THDA 3HNBM 4QDSA 1JU3A 4PT6A 1K42A 2JE8A 5C70A 2W46A 3WNOA 3OB8A 4W50A 2J1EA 2Y6HA 3K4AA 4MGSA 3WNMA 3IAQA 2J1TA 3MUY1 1JZ2A 4W8JA 3K77A 2WABA 4XUOA 1UZ0A 1DP0A 3LE0A 3E1F1 2J1RA 3WF1A 2PQSA 3W5NA 2Y8KA 4MGQA 2VZQA 4L0PA 3CMGA 5DPNA 4DUXA 2DCJA 4M4RA 1SDDB 2YFUA 5IYYA 4JKLA 1JYWA 4QX1A 2ZXQA 1MPXA 2ORZA 2CDOA 3IB3A 3UESA 4ZXEA 5JUVA 4P5YA 3SEPA 1O8PA 4MADA 1UYZA 2XQXA 1NKGA 4DEQA 4P08A 4QX2A 4ZZ5A 1CZVA 1LNSA 3UETA 3A22A 2QQNA 3C7HA 3WNNA 4BDVB 1DYOA 2VC9A 1UY1A 3FN9A 2W94A 1W9WA 2VTFA 3OEBA 3I2HA 2WYSA 3U37A 1K3IA 3WF3A 3OGSA 2KD7A 1L7QA 4CUBA 2Z4FA 2WBKA 3NQHA 4RN5A 3FHAA 1SG3A 3BN6A 1OF4A 1UY2A 3DYPA 2EIBA 1GNYA 3CQOA 2VL4A 2WN3A 5IFTA 3DYMA 1JHJA 2L9LA 1IQDC 2XOMA 2EIDA 4P00B 3VDAA 5FUIA 5JXJA 3EYPA 2DDUA 3IIIA 2OKXA 1XPWA 3I3DA 1OH4A 2EIEA 3LEIA 3AC0A 1SHWB 1GOGA 5I0DA 3DYOA 2QQIA 5DMYA 1OT5A 3ACGA 2Y6GA 3OG2A 3VD5A 1UYXA 2WZEA 5HPOA 4XUQA 2J1SA 2WO1A 2ZEWA 4QPWA 1JYXA 3I2KA 1JI6A 2W92A 1ULOA 2X09A 4FI9A 2E31A 2RV9A 2WDBA 4A42A 5JXGA 2QQOA 2VCBA 1F4HA 3GDBA 1JYVA 3K4DA 1UY0A 3HOBA 4CUCA 5F7UA 3I3BA 5LA1A 3VD4A 1CZSA 2X05A 4DUVA 2EICA 2J7MA 2B9VA 3VD9A 1PMHX 4A41A 1PX3A 1CX1A 4AAXA 3ECQA 1KGYA 2Y6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W87 A;  4XUN A;  5DQ0 A;  2YB7 A;  2VCA A;  2YC2 A;  3JXS A;  4CU8 A;  3IDA A;  3HPN A;  4RYD A;  3VDB A;  4A44 A;  1W9S A;  5B4N A;  5EJZ B;  4BK4 A;  1EUT A;  3BGA A;  4QDR A;  2B4K A;  4QDQ A;  4ZY9 A;  5JXI A;  1K45 A;  3CZU A;  1OD3 A;  2W3J A;  1I5P A;  4CU7 A;  3T2O A;  1TVG A;  4W4Z A;  1O59 A;  3K46 A;  2CDP A;  2VO5 A;  2VZT A;  2J1A A;  2BER A;  4KWU A;  1JZ6 A;  1JZ4 A;  4DXS A;  1UY3 A;  2Y6K A;  4E8C A;  4GWI A;  3F2Z A;  2XHN A;  1PX4 A;  3T0A A;  1GQP A;  3T2Q A;  5J1X A;  2Y64 A;  1XNT A;  3GGL A;  3MBW A;  2J1V A;  4XZU G;  2WO2 A;  2QQJ A;  2HYX A;  2RVA A;  2W9X A;  3T08 A;  5DN2 A;  4CUA A;  4DUW A;  4QB6 A;  4ZZ8 A;  1XNA A;  3HNY M;  3HEI A;  5A1A A;  2JKX A;  3GXU A;  1W9T A;  1UXZ A;  1UY4 A;  4XUR A;  1JZ3 A;  5LCW L;  2WQ8 A;  2J22 A;  4LHS A;  3GM8 A;  5JR2 A;  2J1U A;  3OGR A;  5C71 A;  2VMD A;  2R7E B;  3A23 A;  2VME A;  3ACH A;  2E26 A;  3THC A;  3LQC A;  4LPL A;  1EUU A;  2VOT A;  3C7O A;  2VJX A;  1GOF A;  2ZEZ A;  3LPF A;  4DXR A;  4OMD A;  4LKS A;  4A3Z A;  1UWW A;  3K4Z A;  4JKK A;  2V5D A;  1CIY A;  2W5F A;  2LS6 A;  4UAP A;  1UXX X;  1NX9 A;  1ULP A;  4YPJ A;  1GMM A;  3WEZ A;  2WN2 A;  2Y6L A;  3I2F A;  3P6B A;  5JXH A;  3SKJ E;  1US2 A;  4QX0 A;  4E8D A;  3HNM A;  4P02 B;  3LPG A;  3C8X A;  2BBA A;  2JDA A;  2WZ8 A;  2BGO A;  4QX3 A;  1WCQ A;  1GU3 A;  4Z2A A;  2ID4 A;  3OGV A;  2QBX A;  3NNG A;  2JD9 A;  2BZD A;  2LW8 A;  1W8O A;  4D8M A;  3SKV A;  4PF1 A;  1F4A A;  1T2X A;  4ET7 A;  3WNP A;  3LEK A;  1W8N A;  3C7G A;  4LQR A;  5CZK A;  2W95 A;  3K75 B;  3OBA A;  5CYY A;  3WQB A;  4CU9 A;  4HG6 B;  3VDC A;  1OF3 A;  2C26 A;  2YC4 A;  1UMH A;  2VZR A;  4OZO A;  2VZ3 A;  3P1I A;  3WF4 A;  2WUH A;  3VD3 A;  1XC6 A;  5IHR A;  3T09 A;  1US3 A;  3NJX A;  5C7G A;  4XUT A;  1P8J A;  3ACI A;  1JZ7 A;  3ABZ A;  4XUP A;  1UYY A;  4JKM A;  5JMO A;  4MOA A;  3EB7 A;  4KMQ A;  3I2G A;  2QQL A;  4M4P A;  3IAP A;  4DEV A;  3NRU A;  5HXM A;  1UMI A;  4BXS V;  1CZT A;  5LA2 A;  2W1S A;  4TXW A;  2VQT A;  1J84 A;  2VZV A;  4A4A A;  3LEG A;  3UNP A;  2E33 A;  3WNK A;  1W99 A;  3W5M A;  3T0B A;  1GOH A;  2V72 A;  2VZP A;  3DEC A;  2C4X A;  2W1W A;  2WAA A;  2ORX A;  1JYN A;  1JZ8 A;  1O8S A;  4A6O A;  2VCC A;  2V4V A;  4PQQ A;  3MV0 1;  1TG7 A;  5LA0 A;  5B4X A;  2QQK A;  2YG0 A;  2C9K A;  2WO3 A;  1W0N A;  1D7P M;  4JHZ A;  5G04 L;  1KEX A;  4OMC A;  4AG4 A;  4TTG A;  3I3E A;  3T2P A;  3HN3 A;  3SEE A;  1UX7 A;  1YQ2 A;  4OUE A;  1DLC A;  4QB1 A;  3D3A A;  4ARY A;  3A21 A;  1R64 A;  1J83 A;  2VR4 A;  4KI5 M;  3MV1 1;  2VZO A;  5EIY B;  3A7Q A;  1HN1 A;  3ZM8 A;  3WSO A;  2VZ1 A;  2YFZ A;  1NUK A;  3CIH A;  1JU4 A;  5G05 L;  5IJR A;  4IUG A;  2VZS A;  4OYU A;  1L7R A;  4UI9 L;  2BGP A;  3VD7 A;  1BHG A;  2E32 A;  3FHQ A;  3J7H A;  4UOJ A;  1PMJ X;  2W1U A;  3CDZ B;  1NAE A;  3WF2 A;  2W1Q A;  3CKH A;  3MO4 A;  3PUH A;  2DCK A;  4CU6 A;  4QAW A;  3WF0 A;  5EJ1 B;  3HJR A;  2VZU A;  2WAO A;  3T0D A;  2W47 A;  4QB2 A;  1H6Y A;  3ETP A;  3I2J A;  1GUI A;  4ARX A;  3C7F A;  3I2I A;  3ACF A;  2ZEX A;  4D0Q A;  2VMC A;  1WKY A;  3FL7 A;  3C7E A;  4MO3 M;  3PUI A;  3OEA A;  1K12 A;  4BK5 A;  3NJV A;  2VQU A;  1RYY A;  4GWJ A;  2HLE A;  2W91 A;  4A45 A;  4DXT A;  4XVH A;  1JZ5 A;  1H6X A;  2ZEY A;  3CZJ A;  4JX0 A;  5IFP A;  4BJ0 A;  2VMF A;  2QQM A;  2X10 A;  3I97 A;  3MUZ 1;  3WNL A;  4CVU A;  2VM9 A;  4GZ9 A;  2RJ2 A;  2XON A;  3THD A;  3HNB M;  4QDS A;  1JU3 A;  4PT6 A;  1K42 A;  2JE8 A;  5C70 A;  2W46 A;  3WNO A;  3OB8 A;  4W50 A;  2J1E A;  2Y6H A;  3K4A A;  4MGS A;  3WNM A;  3IAQ A;  2J1T A;  3MUY 1;  1JZ2 A;  4W8J A;  3K77 A;  2WAB A;  4XUO A;  1UZ0 A;  1DP0 A;  3LE0 A;  3E1F 1;  2J1R A;  3WF1 A;  2PQS A;  3W5N A;  2Y8K A;  4MGQ A;  2VZQ A;  4L0P A;  3CMG A;  5DPN A;  4DUX A;  2DCJ A;  4M4R A;  1SDD B;  2YFU A;  5IYY A;  4JKL A;  1JYW A;  4QX1 A;  2ZXQ A;  1MPX A;  2ORZ A;  2CDO A;  3IB3 A;  3UES A;  4ZXE A;  5JUV A;  4P5Y A;  3SEP A;  1O8P A;  4MAD A;  1UYZ A;  2XQX A;  1NKG A;  4DEQ A;  4P08 A;  4QX2 A;  4ZZ5 A;  1CZV A;  1LNS A;  3UET A;  3A22 A;  2QQN A;  3C7H A;  3WNN A;  4BDV B;  1DYO A;  2VC9 A;  1UY1 A;  3FN9 A;  2W94 A;  1W9W A;  2VTF A;  3OEB A;  3I2H A;  2WYS A;  3U37 A;  1K3I A;  3WF3 A;  3OGS A;  2KD7 A;  1L7Q A;  4CUB A;  2Z4F A;  2WBK A;  3NQH A;  4RN5 A;  3FHA A;  1SG3 A;  3BN6 A;  1OF4 A;  1UY2 A;  3DYP A;  2EIB A;  1GNY A;  3CQO A;  2VL4 A;  2WN3 A;  5IFT A;  3DYM A;  1JHJ A;  2L9L A;  1IQD C;  2XOM A;  2EID A;  4P00 B;  3VDA A;  5FUI A;  5JXJ A;  3EYP A;  2DDU A;  3III A;  2OKX A;  1XPW A;  3I3D A;  1OH4 A;  2EIE A;  3LEI A;  3AC0 A;  1SHW B;  1GOG A;  5I0D A;  3DYO A;  2QQI A;  5DMY A;  1OT5 A;  3ACG A;  2Y6G A;  3OG2 A;  3VD5 A;  1UYX A;  2WZE A;  5HPO A;  4XUQ A;  2J1S A;  2WO1 A;  2ZEW A;  4QPW A;  1JYX A;  3I2K A;  1JI6 A;  2W92 A;  1ULO A;  2X09 A;  4FI9 A;  2E31 A;  2RV9 A;  2WDB A;  4A42 A;  5JXG A;  2QQO A;  2VCB A;  1F4H A;  3GDB A;  1JYV A;  3K4D A;  1UY0 A;  3HOB A;  4CUC A;  5F7U A;  3I3B A;  5LA1 A;  3VD4 A;  1CZS A;  2X05 A;  4DUV A;  2EIC A;  2J7M A;  2B9V A;  3VD9 A;  1PMH X;  4A41 A;  1PX3 A;  1CX1 A;  4AAX A;  3ECQ A;  1KGY A;  2Y6J A; 
#chains in the Genus database with same CATH topology
 3ZOI A;  2R30 A;  4CDU B;  4NIH A;  4H7L A;  1HRI 2;  2VCA A;  3KF3 A;  5FZM A;  2JDK A;  3S7E A;  3UYJ A;  4YGC A;  3RJ2 X;  1RUG 1;  1VBD 3;  2B45 X;  1LOB A;  2PYT A;  1W9S A;  4B4R A;  4LMF A;  5EJZ B;  1BK1 A;  3POG A;  5A32 B;  5GZF A;  2BWA A;  4XFI A;  1NCQ A;  1SCR A;  2XVL A;  2ZGT A;  4QDQ A;  2IXC A;  2UY8 A;  3I2D A;  2HWD 3;  1W2N A;  1OD3 A;  2CU5 A;  2XB6 C;  3CZU A;  3JQX A;  3KHB A;  5FUP A;  4CU7 A;  3AKP A;  1SLT A;  5FMO S;  3VB9 A;  2LAL A;  2DCZ A;  3TNP B;  1I5Z A;  4MYE A;  4J6G A;  2VZT A;  1PGW 1;  2SLI A;  3F95 A;  2FMY A;  3KVB A;  4LEJ A;  2HWE 3;  1JZ4 A;  1IKP A;  4O7X A;  1WWY A;  4PF5 A;  4N7U A;  4DRV A;  3TEX A;  4E8C A;  3N9P A;  1AR8 2;  4GKY A;  3E6D A;  3F2Z A;  1PX4 A;  3AFG A;  1NCQ B;  1GQP A;  3NMB A;  3BYW A;  1AL0 G;  3JUU A;  2IWG B;  4DQA A;  1PGL 1;  1H8T B;  1W8T A;  2J1V A;  2ZGR A;  5J37 A;  2D44 A;  1GKB A;  5JSO A;  2JG8 C;  1LEC A;  4LIU A;  4O61 A;  2YXS A;  4YZ3 A;  2BW8 A;  3T08 A;  1X36 A;  5DN2 A;  1VBA 2;  4CUA A;  4Q2F A;  4QB6 A;  4EZ4 A;  1T6G C;  2OUH A;  4AEK A;  5HI0 A;  5H9R A;  1G9B A;  2Y6F A;  1DLL A;  1XNA A;  3D0S A;  3HEI A;  4B1M A;  2JKX A;  3NJZ A;  4Y1U A;  2W2I A;  5JMC A;  3VN4 A;  1RXG A;  3EO6 A;  3WOG A;  2ARB A;  1PMI A;  2JDP A;  4K40 A;  5JZG C;  1H1A A;  2ZGK A;  4OI4 A;  4ORF A;  1DCS A;  4XUR A;  2BOI A;  4OHW A;  1F35 A;  2EAL A;  2XHK A;  1C8M 3;  1Q8O A;  5C71 A;  3L2H A;  3OGR A;  4ZXK A;  4UW4 A;  4NHX A;  3A23 A;  5EFU A;  2E26 A;  1W04 A;  3MIG A;  4URA A;  4BIF A;  1EUU A;  4QKD A;  2RG4 A;  2VOT A;  1Z7S 2;  3MW4 A;  2VMI A;  2HWE 2;  4NRP A;  5M0T A;  1JTZ X;  1IS5 A;  3DV8 A;  2BUK A;  1OUR A;  1ZRR A;  4FT8 A;  4LKS A;  3LSE A;  1PK6 B;  3K4Z A;  4ISQ A;  4XPV A;  1KJL A;  2V5D A;  4NPM A;  1CIY A;  5FTT C;  4C90 A;  3BIW E;  4CDX B;  3JD7 1;  2Z69 A;  3UKV A;  4QM8 A;  3MI8 A;  2LS6 A;  1QJZ A;  3MF6 A;  1ODM A;  2JX9 A;  1R1A 1;  5BYN A;  4WM7 C;  4X8N A;  4YWA A;  1NX9 A;  2WS9 2;  2HYK A;  2VOX A;  1DGR N;  4G9S B;  1AR9 2;  4D3W A;  3AYD A;  5I8Y A;  2CGO A;  1K5J A;  4P9Y A;  2Y6L A;  4AI2 A;  3I2F A;  4KG8 A;  2XLG A;  4E8D A;  1HRV 1;  2R06 3;  4LO6 B;  4BA6 A;  2WNU C;  3HNM A;  3CJI B;  5K8S A;  4AZZ A;  3QH7 A;  4AFA A;  5EHD A;  4CDW A;  3OGV A;  2QBX A;  3PME A;  4RFR B;  1HQN A;  1PVC 3;  2WZR 2;  3VBR B;  4YVS B;  1LOC A;  1ZRI A;  2BZD A;  2Q1Z B;  3SKV A;  4X6Q B;  3TN9 3;  1VRH 3;  4D6R A;  4RHV 2;  4Z1V A;  1W8N A;  2E9Q A;  1OC1 A;  2WNU B;  4AAP A;  1BJQ A;  3GJA A;  3OBA A;  4GH4 B;  3FJS A;  5BPX A;  3RZL A;  1UAI A;  3TEW A;  1RUH 2;  3TEY A;  1EV1 1;  2LTN A;  4XQ4 A;  2DVB A;  4HFS A;  4OZO A;  1Q5O A;  3HQR A;  2BQP A;  2ES3 A;  4B7E A;  3OGG A;  3BKZ A;  2X5I A;  4HSL A;  1AX2 A;  2JDH A;  2VEC A;  2R49 A;  4HLT A;  3TN9 1;  4CDX C;  1LHO A;  2VVE A;  1US3 A;  2D6L X;  3AXD A;  5FXW A;  4E9K A;  2VBB A;  1P8J A;  5CU1 A;  4YW2 A;  2W08 A;  3H7J A;  3TNQ A;  1L3J A;  3ABZ A;  1UYY A;  1JZ7 A;  4JKM A;  5JMO A;  4MOA A;  1FMD 1;  1RVF 3;  2XPJ A;  4IE6 A;  4HXC A;  3H3U A;  4A7K A;  1IPS A;  1CPN A;  1S0D A;  3N36 A;  3U10 A;  5BNO A;  5C9A A;  4NID A;  5LA2 A;  4CCM A;  2W1S A;  1H1M A;  2E7Q A;  4LK6 A;  2K46 A;  1SPP A;  5FZG A;  5FPV A;  3LA3 A;  3ZMN A;  4EN7 B;  5I93 A;  3PHM A;  3ZYR A;  5JLV A;  1AR8 3;  5APA A;  3VHP A;  4FP2 A;  2PFW A;  1W99 A;  1KD7 A;  4B4Q A;  2YU2 A;  1FXZ A;  3INA A;  4P14 A;  2Q1M A;  3RFR A;  3ZYJ B;  1J58 A;  3DEC A;  2WAA A;  1JYN A;  1SCS A;  4C0H A;  1RUF 3;  3AMN A;  1S0C A;  1ZZB A;  5CB7 A;  2XJP A;  5IVF A;  5DUW A;  5T55 A;  5KHG A;  4XAE A;  4C1X A;  2ZS6 B;  1QHD A;  4AL9 A;  5CFC B;  1MS8 A;  3EQE A;  2WQ4 A;  5ACA 2;  2QQK A;  2VW1 A;  2WO3 A;  1VBE 1;  3WDX A;  1C57 A;  3ZIW A;  1PM7 A;  1OPM A;  1W0N A;  4Q8L A;  1OMI A;  4BXF A;  2I2S A;  4IET A;  4QU1 A;  1SLA A;  1OOP B;  4AG4 A;  4TTG A;  4OQ8 A;  5C8C A;  3T2P A;  1UQX A;  4IGQ A;  3SEE A;  4CDU A;  3TEZ A;  3AZY A;  1FV3 A;  1M06 G;  2WFF 1;  3D4K A;  2PMW B;  3O7O A;  1DF0 A;  1E57 A;  2ZGU A;  1ND3 B;  3UV9 A;  1MZE A;  1AHS A;  3PUS A;  5HCH A;  3WW4 A;  3J9S A;  4PIX A;  1QJU 2;  2QE3 A;  1W3X A;  2WKK A;  2GND A;  5LA9 A;  2VR4 A;  3CLP A;  1W39 A;  3KGL A;  4YYO A;  2D97 A;  2PA7 A;  2LUW A;  3A7Q A;  3ZM8 A;  1OVP A;  2ZGM A;  3WG2 A;  2YFZ A;  1EAH 3;  3EXU A;  2CGP A;  3AMH A;  2HWD 2;  4PLM A;  1L7R A;  5FPL A;  2D7F A;  4UI9 L;  4IE5 A;  4I30 A;  3KV5 A;  1UX6 A;  3EJK A;  4NOT A;  2XR4 A;  5BNN C;  2I74 A;  4K9S A;  1PMJ X;  1UCX A;  1SEF A;  1VMJ A;  2XUM A;  3U0Z A;  3CDZ B;  4HKL A;  1PZ9 A;  1XYP A;  2X8K A;  3NNF A;  5FYB A;  2Q8E A;  5C9A B;  2JWP A;  4IEY A;  2OA2 A;  4L2N A;  4Q4V 2;  3LB9 A;  4QPG B;  1RUI 1;  5KXD A;  1GZC A;  4JQR A;  2DCK A;  4G3Y C;  1Y43 B;  4N9I A;  2YBP A;  4QAW A;  4WV8 A;  4XHX A;  4Q5O A;  3MID A;  1NZC A;  2YC0 A;  3T0D A;  1J1L A;  1LHU A;  2WA3 A;  2AUY A;  2WLP A;  1BVP 1;  4UFJ A;  3H8U A;  4RQP C;  1IZ3 A;  1GLH A;  2EAA A;  2UWA A;  4E4D X;  1SFP A;  4KBB A;  3BU0 A;  1ENQ A;  1H6Y A;  1RUC 3;  4XDQ A;  2B46 X;  4HAN A;  4CXX A;  1KXG A;  3I2I A;  2X5I B;  3ACF A;  2GC0 A;  3I4I A;  2RR1 3;  5F3C A;  3ZN6 A;  5EYX A;  1OUX A;  2WZR 1;  2CGN A;  4HOO A;  3WW1 A;  1ZZ7 A;  3KD4 A;  3GCX A;  2F6B A;  2VMC A;  3LDK A;  1WKY A;  3M1H A;  4NPR A;  3C7E A;  5K9Y A;  3EBR A;  2WL1 A;  2PHL A;  3OEA A;  3I8T A;  4RL7 A;  2QFE A;  3RNS A;  4BK5 A;  2VQU A;  1L7L A;  3TBD A;  1V9U 3;  1VAM A;  2WNU A;  3WLU A;  1OXC A;  4LHN A;  1Z0H A;  2YMZ A;  4FPL A;  4GWJ A;  1ZBE 2;  2DFB A;  3NAP A;  4A45 A;  2DVF A;  1F31 A;  3KMH A;  4LLF A;  3SH3 A;  3W21 A;  5BNP A;  4JX0 A;  1W6P A;  5IFP A;  3E5Q A;  1X33 A;  1K5M C;  4BJ0 A;  3WQ1 A;  1YJK A;  3ZXG A;  2IUW A;  2J42 A;  4MVT A;  1VBB 2;  3IMM A;  3E6C C;  1VAK A;  1TQ5 A;  4I09 A;  4M3C E;  3I97 A;  4YLZ A;  4XAA A;  1W90 A;  2QVS B;  4L97 A;  4CVU A;  4K3U A;  2VM9 A;  3V64 A;  4ZS2 A;  2FDF A;  4JGY A;  3VKO A;  4XJZ A;  5FYY A;  5GLT A;  5A7N A;  1Z7S 3;  4DIQ A;  2RJ2 A;  1RTV A;  1ZRD A;  4OI1 A;  5DDJ 2;  1UZY A;  2JDY A;  2OXB A;  5LBF A;  3T1L A;  3AP5 A;  2PN5 A;  5LAS A;  2RM2 3;  3RDI A;  4YGB A;  2G1M A;  5ACA 3;  1CAU A;  2WNV B;  1BBT 1;  2PAK A;  3J26 N;  4CCN A;  4HET A;  2BWC A;  3KV6 A;  5C3P A;  4KU7 A;  1K42 A;  1XND A;  5SV8 A;  2BVB A;  2VBD A;  1COV 3;  4W50 A;  2J1E A;  1RUF 2;  2BNM A;  1AR8 1;  4YZ5 A;  2WT0 A;  3SIT A;  3MZH A;  1NA1 B;  1WUV A;  1Y9M A;  3OYW B;  3IKW A;  3IAQ A;  2J1T A;  2EAK A;  2A5Z A;  2ZHK A;  1JZ2 A;  1RJ8 A;  3FUQ A;  4W8J A;  3UJQ A;  3K77 A;  3ZXL A;  1Q8P A;  1VBA 3;  3NAP C;  1CAW A;  1UZ0 A;  4XAC A;  1ENR A;  2HWC 1;  5DDJ 1;  5FFO C;  2E63 A;  3D82 A;  3P5B A;  4LKE A;  2WWU A;  2PQS A;  4XF4 A;  5C4W A;  1ZBA 2;  1ND3 A;  2FDK A;  4ZU4 A;  4KBZ A;  5A7S A;  3WDV A;  3BCW A;  2ZX3 A;  1OI6 A;  4YM0 A;  3HIF A;  1DG6 A;  1R08 1;  5FPB A;  2P3J A;  2DCJ A;  3POE A;  3O12 A;  3SXW A;  4GMP 3;  2RDR A;  4JKL A;  3KT4 A;  4AF9 A;  4CDW C;  3KHC A;  5SV5 A;  4SBV A;  1GIC A;  3J4U H;  1HXS 2;  4N53 B;  3S5Q A;  3ZYB A;  4AR2 A;  4AFC A;  5DDJ 3;  1JOB A;  1G6N A;  4XFA A;  5T52 A;  1S0B A;  1OSG A;  2G19 A;  4RSU A;  2D6K A;  2AC1 A;  3NV3 A;  2ZHL A;  1R09 2;  1RUD 2;  3M4F A;  4P5Y A;  4PIZ A;  1OUS A;  1RUE 1;  3IDC B;  2YHJ A;  1D2S A;  4XMI A;  2DVA A;  3SQO A;  1V9U 2;  1VAL A;  2XQX A;  3OJB A;  5GLU A;  1Y3T A;  3PUQ A;  1MEC 3;  4YZ2 A;  4NWW A;  2ZHM A;  4P5H A;  1IHM A;  1EAH 1;  1LNS A;  4LO7 A;  2WSV A;  3C7H A;  5L19 A;  4BDV B;  3ZXD A;  2VC9 A;  1H30 A;  4QPY A;  1UOJ A;  3BPZ A;  4XF1 A;  4LLO A;  2RS1 1;  5CIR A;  1TNR A;  4Y1X A;  1W9W A;  1SPP B;  1UYP A;  5D8A A;  5DAV A;  2VVD A;  2RJL A;  3K51 A;  1UD1 A;  1ZM1 A;  2H6B A;  4XOG A;  1L7Q A;  2RS5 1;  5FMC A;  3ON7 A;  4Y1Z A;  3SC7 X;  3WCS A;  3SHR A;  2WIN B;  1RUI 2;  2ZZJ A;  1S0E A;  2HWB 1;  1LUL A;  1S55 A;  1ZVF A;  1U12 A;  1OF4 A;  2XGX A;  3DYP A;  1OKO A;  1YC6 1;  1HN0 A;  2Q0A A;  3ZYP A;  4CP9 A;  2EF6 A;  5EZW A;  5FZ3 A;  1AF9 A;  3E5X A;  4A7Z A;  3GAL A;  5F2S A;  2EID A;  4QXC A;  3KM5 A;  2AEY A;  3ZLI A;  5JXJ A;  1QQP 3;  3AYE A;  2JE9 A;  1XQN A;  1N1Y A;  3QBQ A;  4CUG A;  3W20 A;  5KC5 A;  1XPW A;  3MW3 A;  4Y20 B;  1VBC 1;  4HZF A;  4AGV A;  4XXA A;  1JYT A;  3ZYF A;  4N53 C;  2D6N A;  2JIG A;  4JGZ B;  4YVS C;  2VUD A;  2WZR 3;  5F2W A;  3AC0 A;  5ABJ B;  3KF5 A;  1FOD 1;  3IWZ A;  1J3R A;  1WLW A;  3DYO A;  4AK3 A;  4OI2 A;  5I0T A;  2EIG A;  4AED B;  4LHK A;  1GZW B;  5A3M A;  2NLR A;  3MLJ A;  2Y6G A;  1RUC 2;  3AKS A;  3GBG A;  3OG2 A;  1UYX A;  3VD5 A;  4AHZ A;  3A0K A;  1GR3 A;  4RD7 A;  4CPB D;  1AL2 2;  2J1S A;  4R52 A;  3UL2 A;  5JZG A;  4QPW A;  1QJU 1;  2W92 A;  3GHM A;  3S30 A;  4FI9 A;  3ZSE A;  2QZ3 A;  4AHX A;  4M01 A;  4A42 A;  5IAX A;  2DBI A;  4HVO A;  2VCB A;  1C8M 2;  4LA3 A;  2QNK A;  3TYJ A;  2IVI B;  3NNM A;  3GYD A;  2A3W A;  1H2M A;  1KRI A;  3GDB A;  1XE8 A;  2FCV A;  4IE0 A;  2DU1 A;  4Q4V 1;  5L9V A;  3K4D A;  1UY0 A;  4NHY A;  4Q4W 1;  1FAY A;  3I3B A;  3PTR B;  1IGO A;  4QHZ A;  4LBM A;  4CUC A;  5C8W A;  1W28 A;  3VBO C;  1XNK A;  1CZS A;  4E2G A;  2E7A A;  1YYN A;  1VB4 A;  5FR3 A;  1QJU 3;  2B9V A;  2PEL A;  1F5J A;  4A41 A;  4AVA A;  1QNW A;  2Q8O A;  3SEP A;  3ZKU A;  4Q0P A;  5FWE A;  5HCA A;  4KWK A;  2GH2 A;  1IQA A;  4I0A A;  2XJU A;  1ULC A;  3E5U A;  4AGR A;  4HKO A;  1RUN A;  1GWM A;  3JBG 1;  2W87 A;  1UZV A;  4XUN A;  5DQ0 A;  2YB7 A;  5KXB A;  1IPK A;  1BBT 3;  2R0H A;  3L9J T;  3CEW A;  1EPW A;  4I3G A;  3JXS A;  3PLQ A;  4N9H A;  4GQ7 A;  3BOP A;  5LEJ A;  1HW5 A;  1F5F A;  3I3Q A;  3RYK A;  1IS3 A;  1H2K A;  2UY9 A;  2R32 A;  4BK4 A;  1EUT A;  5LK7 B;  2X29 A;  2RM2 2;  3AKR A;  2B4K A;  5FRA A;  4S2H A;  3PU8 A;  5J36 A;  1UZW A;  4QD2 A;  5I8S A;  5I8T A;  3W58 A;  4QX7 A;  1I5P A;  2FBE A;  4UF0 A;  1MQT B;  4K8R B;  4N8M A;  5DAQ A;  1MQT C;  1TVG A;  1UO9 A;  5BNP B;  4Q4Y 1;  4GB3 3;  1O59 A;  3K46 A;  5DG2 A;  1DGR A;  2BER A;  2PHF A;  5J48 A;  1D4M 1;  1JZ6 A;  4DXS A;  1UY3 A;  4K8F A;  3NNJ A;  2JD4 A;  4NO4 A;  1RB8 G;  1UKG A;  1OH3 A;  1UOG A;  1R08 3;  4AFM A;  4LOR A;  4XFF A;  5FZ6 A;  3Q8C A;  3UGF A;  5J1X A;  3LD8 A;  5A7O A;  1PIV 1;  3ENR A;  3UKN A;  4XZU G;  2BP6 A;  3H50 A;  3SMH A;  3ZN6 B;  5FOJ B;  2BNO A;  3B9I A;  4QXH A;  2VD7 A;  5GZD A;  3N7L A;  4RHV 1;  3J7M A;  2HYX A;  3O1P A;  5ANQ A;  1LOF C;  1YIF A;  2RVA A;  2W9X A;  1U0A A;  2Z42 A;  4HMZ A;  2VGD A;  4KWJ A;  2GAU A;  4Q0U A;  4FPY A;  4BQX A;  4YG6 A;  4F3J A;  5IUQ A;  3V0A A;  2VXR A;  4BHP A;  4AW7 A;  1V0A A;  4Y5S A;  3GXU A;  3PVO A;  5FYM A;  5FKB A;  1S1A A;  1GP6 A;  2RDN A;  3JB8 A;  1WGP A;  5EPA A;  2JDM A;  5EXO A;  2AEZ A;  4DB5 A;  1W6N A;  1CR7 A;  4YM2 A;  1JZ3 A;  1D2Q A;  4Z2W A;  2J22 A;  5FYS A;  4PLO A;  1TEI A;  2ARA A;  3GM8 A;  4LHS A;  4Q26 A;  4Y5Z 0;  5FLJ A;  5CIS A;  5JR2 A;  2RS5 2;  1LTE A;  2J1U A;  4RS5 B;  5BUV A;  4V2V A;  5F6L B;  5JIU A;  2ZGS A;  2R7E B;  2PAM A;  4ZON A;  1AL2 3;  5JVV A;  5A32 A;  3LQC A;  2E7T A;  1DQ2 A;  4LPL A;  2D3P A;  3OOX A;  3MPB A;  1AR9 3;  5FZK A;  1N1V A;  3GZU C;  3ST7 A;  3ZDS A;  3LPF A;  1CD3 G;  4KU8 A;  3ZFE A;  1XNB A;  4OMD A;  4A3Z A;  3H8X A;  4Y22 A;  2BYV E;  3K3N A;  3WHU A;  4JKK A;  3WQ0 A;  3WNX A;  4HON A;  4MLO A;  5F5C A;  2W5F A;  4ZU5 A;  2A3Y A;  5F8P A;  3AL5 A;  4WVM B;  2WA4 A;  4XF3 A;  2OX0 A;  4MGY E;  1UU5 A;  2BJS A;  4KG0 A;  4Y24 A;  1XSR A;  3LIG A;  1W9F A;  1HRV 2;  1UXX X;  2AR6 A;  1E5I A;  3DEM A;  1VPH A;  2VG9 A;  4OUM A;  1FX5 A;  3SH5 A;  4XJU A;  4AQS A;  1ZZ8 A;  1VRH 1;  3LFM A;  3R6S A;  3FWE A;  3O1S A;  1BMV 1;  4YPJ A;  2WN2 A;  2ARC A;  4P9J A;  2HEY F;  2YDE A;  3N9Q A;  1KFX L;  5JXH A;  3SKJ E;  2TEP A;  4BH9 A;  2VTX J;  2ZX2 A;  3EHK A;  2BBA A;  1QKQ A;  1WMD A;  3ZFE B;  2UYA A;  3POB A;  5FZ7 A;  1STM A;  4Q29 A;  2WZ8 A;  4YW1 A;  5AVA A;  4O9E A;  1WCQ A;  3RGB A;  5FXX A;  2ID4 A;  1RIN A;  3LSD A;  2B7Y A;  1DZR A;  1KS5 A;  1ND3 C;  2FDJ A;  2DV9 A;  5CKQ A;  5FK7 A;  4CEW C;  3RZH A;  4D8M A;  4XIO A;  1VRB A;  3MIF A;  4XAB A;  1U5X A;  1T2X A;  2P4E A;  4ET7 A;  4DO0 A;  3LEK A;  3LDR A;  5CZK A;  3K75 B;  1LAJ A;  3H0O A;  2A75 A;  3VDC A;  4JGY C;  5F5A A;  1N1T A;  1DBN A;  1OF3 A;  1LGN A;  2YC4 A;  3JD7 2;  1EP0 A;  2VZR A;  1ZZ6 A;  3THP A;  3NNL A;  3A4U A;  1AR7 2;  4PJY A;  2WSU A;  5C8C C;  1W6O B;  2QJV A;  2A73 B;  1G8W A;  3USS A;  4BOW A;  5BNO B;  1G9F A;  2P2K A;  1QXP A;  3NJX A;  5FZB A;  3U07 A;  3ACI A;  3PVN A;  4LBQ A;  3S7I A;  1CAX B;  4XUP A;  5FLI A;  4L92 A;  3CF6 E;  3UK9 A;  3VHN A;  3GZE A;  4YRD A;  4KMQ A;  1QJY 3;  1G7Y A;  4GD4 A;  4HPK A;  4M4P A;  3UGG A;  3WR0 A;  3IAP A;  2R6Q A;  3NRU A;  1UMI A;  1QIQ A;  4BQY A;  1DYP A;  1NE6 A;  1O91 A;  3U1X A;  3AFK A;  2Z79 A;  1G9C A;  3UJO A;  1YCI A;  5L7O A;  4XF0 A;  3DPR A;  4I01 A;  2VZV A;  3ZYI B;  4A4A A;  4COW A;  5FQ0 A;  1AUY A;  3LEG A;  1B35 C;  4NE9 A;  3KV9 A;  3UNP A;  4Q4Y 3;  3ZDV A;  4B8E A;  1M4W A;  1U5Y A;  4JHT A;  1S4C A;  2A6Z A;  1CVN A;  1SAC A;  1YIP A;  1WZX A;  4Z8B A;  1B09 A;  2W1W A;  3ZMO A;  1JZ8 A;  1NA1 C;  1O5U A;  3N9O A;  4BQ3 A;  4IV3 B;  5GLW A;  4E2Q A;  4WBB A;  1HRV 3;  2R06 1;  1GBG A;  5GZE A;  4PQQ A;  1YFX A;  1ULG A;  4I0B A;  5LA0 A;  5B4X A;  2YG0 A;  1LOE A;  2BVV A;  2JDN A;  4ZKT B;  3RZG A;  4QPI C;  3G7D A;  3RYR A;  2OPW A;  2BDR A;  2QQW A;  2XJT A;  1K5M B;  3ZPO A;  2DFC A;  1XSQ A;  1X9P A;  3J7N A;  2ZKN A;  3POS A;  5FMB A;  5FYI A;  5A7W A;  3SCF A;  1GZ9 A;  3ZXA C;  4CTE A;  4CE8 A;  2ETE A;  3SNM A;  3VDD B;  5JIA A;  3KZ4 C;  2G9G A;  2HBU A;  4AWD A;  4CYD A;  4ARY A;  3AYA A;  1EV1 3;  1ASJ 1;  1R64 A;  5FAX A;  1QU0 A;  5FJH A;  3IT8 A;  2XXZ A;  4KI5 M;  1UOB A;  1BXH A;  5C5U A;  4YFZ A;  1BQP A;  2FHR A;  2VZO A;  3WVJ A;  5EIY B;  4J1W A;  4ATE A;  1PO1 1;  2ET7 A;  2VZ1 A;  4LKD A;  4PBO A;  4F83 A;  5C3Q A;  3CIH A;  3I59 B;  5B2G B;  3AB0 A;  5FO8 B;  1DQ0 A;  1YFW A;  1LU1 A;  5FP7 A;  2RJK A;  4OYU A;  4AQ2 A;  4NHL A;  2HWD 1;  1UZZ A;  4XMA A;  2DYC A;  1GP5 A;  5AFB A;  2WRA A;  3SLI A;  2BGP A;  3VD7 A;  2ARE A;  4MXW A;  2OPK A;  4EYU A;  2E32 A;  4D94 A;  3V0B A;  2D5F A;  1X7N A;  3J7H A;  4AXO A;  1E5R A;  1UKR A;  4PHZ A;  5ERL A;  2XBO 1;  5ABJ A;  1FOD 2;  2W1Q A;  3ORJ A;  4LBO A;  1QOS A;  1ASJ 2;  2MNG A;  1ZA4 A;  2ZGQ A;  4JGZ A;  5FQ0 B;  1EY2 A;  2VW0 A;  5L7O B;  3I3M A;  3CKH A;  1C28 A;  3PUH A;  2R06 2;  1XRU A;  5FPA A;  1OHF A;  5EJ1 B;  3HJR A;  4YW3 A;  5FYV A;  2KA3 A;  4XW3 A;  5C6C A;  3O1U A;  2VZU A;  2D3S A;  1HB4 A;  2TUN A;  4RQP B;  2CNA A;  4JTN A;  3ETP A;  4XQW A;  2PTM A;  4XEZ A;  5IWF A;  4ARX A;  1I1E A;  1APN A;  2ZKL A;  1ND2 C;  3RWK X;  4HBN A;  4XZP A;  4IL7 A;  1U5Z A;  2ZEX A;  2DCY A;  4AEJ A;  1PO2 2;  1H8T A;  1ONA A;  1QF3 A;  5GKA C;  2FDH A;  2MPF A;  4Y1Y A;  1W05 A;  4JRL A;  5JR7 B;  4CCE A;  1W6O A;  1IKQ A;  5C9A C;  2OT7 A;  3ILF A;  1HB3 A;  4KWL A;  2CL2 A;  3OPZ A;  1POV 1;  5DXD A;  5KXC A;  5GM0 A;  5AC9 3;  1FPN 2;  3RZZ A;  2IFR A;  4EN6 B;  1E5H A;  1A8M A;  4IV3 C;  2TBV A;  5IVJ A;  5FZ1 A;  3OTF A;  3J8F 2;  3WY6 A;  1YQ5 A;  4COZ A;  1YXW A;  4QQH A;  1H8T C;  2Y6J A;  3GHN A;  1NLQ A;  4OHV A;  3OPT A;  2WWJ A;  5IAV A;  4WM8 B;  2NYY A;  4K1Z A;  2XLA A;  2YU1 A;  1JMU B;  2C6S A;  2FD8 A;  3VGI A;  4AGG A;  1J3Q A;  5A6Q A;  2YGM A;  1XBF A;  2X10 A;  3KV4 A;  1ZBA 1;  1Y7B A;  3MUZ 1;  1POV 3;  2RS3 3;  2D5H A;  3WG3 A;  1VBB 1;  1W3V A;  2I07 B;  3HN1 A;  4PI0 A;  3WDW A;  3IPV A;  4IES A;  4GZ9 A;  3T3Y A;  2Y34 A;  3BUC A;  2NN8 A;  3ZKY A;  3HNB M;  5GJ6 A;  4LA2 A;  1REF A;  1JU3 A;  2VQ0 A;  2ZX1 A;  4A3X A;  4FFF A;  1W0P A;  2WNE A;  1SFY A;  3GBW A;  2JE8 A;  2ZX4 A;  3FUO A;  4QQP A;  4OVE A;  3NO8 A;  5C70 A;  3WNO A;  5J3U A;  4XYX A;  1ZRC A;  2JG9 A;  1TMF 1;  2Y6H A;  5A33 A;  4ITC A;  2EXI A;  4QQ2 A;  2A6V A;  4FPC A;  1HRI 3;  5DAP A;  4GIQ A;  3VBH C;  1YHF A;  3LFI A;  5FP3 A;  4GMP 1;  1RUJ 3;  4R8H A;  4YVW A;  3VBS C;  2WAB A;  4QHB A;  4XUO A;  1W06 A;  2DVG A;  3C3V A;  1JUI A;  4N90 A;  2VOW A;  3OSD A;  4Y33 A;  5FZA A;  3RMY A;  2NP0 A;  5KHK A;  3WW3 A;  3W5N A;  5DG1 A;  3B5L B;  3VLB B;  4PDW B;  3ZSL A;  1TME 2;  2VZQ A;  4EN0 A;  4FTS A;  2GN3 A;  1V6N A;  5KWR A;  4YW7 A;  5JSR A;  1JBC A;  3FLR A;  5LBE A;  2NM1 A;  5J98 B;  1CGP A;  4M4R A;  1MR5 A;  1NCR B;  1SDD B;  4YZ4 A;  5FZO B;  3VDD C;  3MHZ A;  4E27 A;  5CG8 A;  4URT A;  5IYY A;  3BTY A;  2H0V A;  2GC1 A;  4XJ8 A;  3LOB A;  2PXJ A;  4H2A A;  1REE A;  1DZT A;  1H8V A;  1OBN A;  1SDW A;  1JYW A;  1WBL A;  2ORZ A;  4GXL A;  3KQR A;  2CDO A;  3GZA A;  3IB3 A;  2HEV F;  1QEX A;  4IEU A;  1RMU 2;  2A1X A;  4XDP A;  5FPZ A;  3KT7 A;  1FMD 3;  4PIY A;  4QXB A;  4XTM A;  4BYY A;  1O3S A;  1UYZ A;  2WR9 A;  2VPV A;  3SIS A;  1PO1 2;  5BNQ A;  4FPO B;  4P08 A;  2JDZ A;  4QX2 A;  1WMX A;  3ACL A;  1CZV A;  3UET A;  4QU2 A;  3A22 A;  1KFU L;  2QQN A;  2VNG A;  4BZ4 A;  4OUL A;  1LES A;  1W2O A;  3LA7 A;  4QMA A;  4LOS A;  1VRH 2;  4AYU A;  1SBF A;  2VNR A;  3PVB B;  4ATF A;  2HWF 3;  2B9U A;  5TSW A;  3RYP A;  4GH4 C;  1H9W A;  4LBK A;  5FY4 A;  4FPJ A;  5J09 A;  2WYS A;  2GNT A;  1DDL A;  4KGG A;  3OGS A;  3WF3 A;  5A7P A;  1RIR A;  3BB6 A;  2ZPX A;  3MIE A;  2XLF A;  2WBK A;  3NQH A;  5HCB A;  4D7Y A;  3FHA A;  3EMR A;  4WM7 B;  2QDR A;  1W9Y A;  2EIB A;  1RUI 3;  1CON A;  3CQO A;  2Q8D A;  1F8V A;  5A80 A;  2A71 A;  1LJ7 A;  4CCJ A;  1IOA A;  2YPD A;  3OUH A;  2WN3 A;  4F7Z A;  4QQO A;  5IFT A;  2YBK A;  1D0H A;  2NZ9 A;  1JHJ A;  4UW3 A;  1COV 1;  5E16 A;  4FAH A;  1IQD C;  3D6E A;  3ZYG A;  4BME A;  2XOM A;  1GYK A;  4ISR A;  4OQ9 A;  2CV6 A;  3EYP A;  4UXA A;  1AR6 3;  3D5O A;  1GQH A;  5K0U A;  3I3D A;  2OKX A;  3TAY A;  1PZ8 A;  4DMI A;  3VBS B;  1YI7 A;  4EN9 B;  1YFY A;  2PLV 3;  2XWJ B;  3CL1 A;  2R1D A;  3HWJ A;  1BEV 1;  2ZGL A;  2YYO A;  3APB A;  4FQZ A;  4XF9 A;  2WNO A;  3IM0 A;  1GOG A;  1VR3 A;  5L9B A;  5I0D A;  1JH5 A;  2RS3 2;  4M00 A;  2QQI A;  3ZR6 A;  5C33 A;  5C4W C;  5I0U A;  4YG3 A;  3WIN E;  4EWD A;  5A1F A;  4CDQ A;  4FP3 A;  1PK6 C;  1PHM A;  3B69 A;  4NRO A;  1I6X A;  4Q4X 1;  3LIH A;  2PHW A;  4YVW B;  1GWL A;  4YGD A;  3ZSK A;  3FFQ A;  5FZ4 A;  1ULO A;  3LGR A;  1QDO A;  1W6Q A;  1W6M A;  3HQU A;  3RVH A;  4H14 A;  3BPS A;  4CXY A;  2R0F A;  2Y0I A;  3OY8 B;  1NQJ A;  4FXG B;  2QQO A;  4MZU A;  3RPQ A;  2ZML A;  1F4H A;  2JG9 B;  4IDZ A;  4UFH A;  2EXK A;  5BY5 A;  2C0Z A;  3HVD A;  5AC9 2;  3R05 A;  4E4H A;  5F3I A;  4BIO A;  1LKN A;  1RUG 2;  4P9X A;  1UU4 A;  3KSC A;  3VD4 A;  2ENR A;  1C8M 1;  2X05 A;  1O6U A;  3QOP A;  1VE0 A;  3PMS A;  1AZD A;  5D2A A;  2R1B A;  4HKW A;  3VD9 A;  3A0N A;  5JSP A;  1CX1 A;  4IV1 C;  1AYM 1;  1GZW A;  4AAX A;  4W6Y A;  3POF A;  5FBZ A;  3KVA A;  1WA6 X;  1GSL A;  2D6O X;  2OW4 A;  5HXV A;  4AHY A;  3N4M A;  2R07 2;  5ACA 1;  3FMG A;  1RUC 1;  4ZS3 A;  3WX5 A;  3UKT A;  4Y20 A;  1WLT A;  3ZXK A;  2YY1 A;  4EN8 B;  1LHV A;  1NY7 2;  1RJ7 A;  5FO7 B;  4CU8 A;  4XJA A;  3IDA A;  1D4M 3;  1FAT A;  2UUR A;  4LUK A;  2WFP A;  3WP5 A;  1TMF 3;  3IN9 A;  4BLI A;  4DY3 A;  2Q8C A;  1SQ4 A;  3RSJ A;  3RI9 A;  4BB3 A;  1BK0 A;  5JOX A;  1O3Q A;  1BVV A;  5B4N A;  5EV7 A;  2FDG A;  5T50 A;  4QDR A;  1AYM 3;  1WW6 A;  2YV8 A;  3ALQ A;  3C2U A;  4RR3 A;  1MVQ A;  1OPO A;  4ZY9 A;  3I7D A;  1ULF A;  5FZC A;  1ND2 B;  4CP9 B;  5JXI A;  2W3J A;  4Y1V A;  1ZA7 A;  5IT6 A;  3T4V A;  4XCA A;  4OHY A;  5C3S A;  5J7M A;  3LOI A;  5DAB A;  3T1M A;  5FKC A;  4JAA A;  1A6C A;  2CDP A;  2VO5 A;  2J1A A;  3VDB A;  2ZTN A;  4AI8 A;  5D8A B;  4EWE A;  2CTV A;  5L7O C;  1W8F A;  1ND2 A;  4GWI A;  5IW0 A;  3VZM A;  3AVR A;  3AYC A;  3T0A A;  3T2Q A;  3PDQ A;  3HD8 B;  2Y64 A;  2VQA A;  4RQP A;  3MBW A;  3GGL A;  3H1Y A;  5FYU A;  5K4L A;  4CZS A;  2MHF A;  2FQP A;  5LWB A;  1GNZ A;  2QQJ A;  4TSV A;  3RG0 A;  3HBK A;  4IW3 A;  4ZHN A;  5LK5 A;  2XVG A;  5H9Q A;  2BTV C;  1Z7S 1;  4V2W A;  5FRE A;  3WZ1 A;  1AL2 1;  5KC6 A;  3S5A A;  4XFH A;  2AAC A;  4FPF A;  1PNF A;  2YBS A;  3HNY M;  4UFK A;  5BNN A;  4D7S A;  1MEC 1;  4N53 A;  1LRH A;  2HBT A;  1FI2 A;  2WT1 A;  3Q8E A;  4MET A;  3SH4 A;  1I3H A;  1LHW A;  2GC2 A;  1MS0 A;  4LBQ D;  1UXZ A;  4PI2 A;  4YW5 A;  4IQP A;  3UT0 A;  5F37 A;  1MZ5 A;  1MS5 A;  3U78 A;  1V9U 1;  3OGJ A;  1S2B A;  3RI8 A;  1X50 A;  2VMD A;  2G4I A;  4LTA A;  4OLL A;  4OI0 A;  5DZE A;  2K2S A;  5CBL A;  3ACH A;  4ZU7 A;  2RS5 3;  4CEY B;  5JWP A;  2F4P A;  4YVS A;  4LUL A;  2WS9 3;  2IXL A;  4HVQ A;  2YRO A;  1VBA 1;  1HXS 1;  3RWN A;  3O1V A;  1URX A;  2OYZ A;  3JBG 3;  4FAG A;  4GAL A;  4QPI B;  2VJX A;  4RFT 0;  1GOF A;  2ZEZ A;  3P3N A;  4ASK A;  3AM2 A;  2KR2 A;  3QAC A;  1TME 3;  2OZJ A;  1PIV 2;  2V09 A;  3ZFG B;  1S2E A;  3B02 A;  2HWC 2;  4LO8 A;  5FIX A;  4M0N A;  4CDQ B;  2JG8 B;  1OQE A;  4UAP A;  4AOC A;  1NOV A;  1AR6 1;  5IK8 A;  3U11 A;  3AMP A;  4MHR A;  3T4H B;  1ULP A;  1AX1 A;  2WNV A;  5CG9 A;  4R9B A;  3MFA A;  3DXT A;  5F3E A;  1HXS 3;  1GMM A;  3OCP A;  4NII A;  3ITQ A;  1C5I A;  1TMF 2;  4AFB A;  5LY1 A;  1JW6 A;  1VP6 A;  4GWN A;  4K21 A;  5FBJ A;  2ZOE B;  3URF A;  3MF9 A;  3FE5 A;  4YVW C;  3VBS A;  4P02 B;  3LPG A;  3C8X A;  3POW A;  5K0U B;  1VJ2 A;  1O5L A;  2BGO A;  4COV A;  2D98 A;  1A8D A;  1GU3 A;  2WLQ A;  1GFF 2;  5IVY A;  4Z2A A;  3U4S A;  5FP8 A;  2WZP P;  3M7A A;  2R16 A;  2OVU A;  3AP7 A;  2JD9 A;  1C1F A;  3NNG A;  4GB3 2;  4YNI A;  2LW8 A;  2Y38 A;  1W8O A;  4GJZ A;  2F4L A;  4PF1 A;  4B4P A;  1ULD A;  4LIT A;  3WNP A;  1LEN A;  5LZ6 A;  1PO2 3;  3C7G A;  4LQR A;  4BM8 A;  1JYC A;  2PQQ A;  3JBG 2;  4CU9 A;  3K3O A;  4BQ5 A;  1C4R A;  1FNY A;  1W2T A;  1XJA A;  2UWB A;  4IEO A;  2C26 A;  5FYC A;  5CFD B;  1UMH A;  3NAP B;  3IMN A;  2B5H A;  2ZAB A;  4QXK A;  4YAR A;  3P1I A;  2WUH A;  3BOW A;  3VD3 A;  4CDU C;  4YW4 A;  5FZ8 A;  1V6L A;  1SLL A;  5IHR A;  4QHO A;  1OVS A;  3J8F 3;  4E2S A;  1YUD A;  3T09 A;  2PHR A;  2LM3 A;  1NYW A;  1VMF A;  2IXJ A;  4GJY A;  4RA0 A;  4Y4Y A;  2JIJ A;  3SCH A;  1OFS A;  5C5T A;  1BZW A;  4XUT A;  4Q0S A;  1YRZ A;  2E6V A;  1LB2 A;  2XJS A;  5BNO C;  4TN7 A;  1W03 A;  4PQ9 A;  4FOQ A;  4K1Y A;  4W65 A;  4OZX A;  3EB7 A;  2A3X A;  1E5S A;  1AXZ A;  1S0G A;  3I2G A;  2XJV A;  4H7M A;  2QQL A;  4QKN A;  3LF7 A;  4BMB A;  3KQ4 B;  2YUE A;  4IE7 A;  4AED C;  3OF1 A;  5HXM A;  2Y60 A;  4BXS V;  1CZT A;  3POY A;  4LIV A;  3D0J A;  1PVC 2;  1UIK A;  5CA6 A;  1QH6 A;  3ZFG C;  1QH7 A;  2PAE A;  3DGT A;  4DIN B;  1YQ6 A;  1J84 A;  3KCC A;  1RXF A;  2RS1 3;  1WMF A;  2P6H A;  1YI9 A;  1LOF A;  4NRQ A;  4F8A A;  1HDK A;  2CSG A;  4S2G A;  3WNK A;  5A6Y A;  3MEP A;  3PVE A;  3WP3 A;  4CXW A;  5FY5 A;  3W5M A;  2OQ7 A;  2ARX A;  3R4U A;  1GOH A;  3AMQ A;  4XDO A;  2V72 A;  2VZP A;  4CEW B;  2O0O A;  4NAO A;  1GV9 A;  1Q8S A;  2ZAC A;  4A6S A;  1YFU A;  1O8S A;  4AHW A;  4BQ4 A;  4NN0 A;  2GSY A;  2WT2 A;  4SLI A;  4RR3 B;  2FCU A;  3NWK A;  1N47 A;  3BOD A;  3K2O A;  1Y4W A;  3WCR A;  1UIJ A;  5A33 B;  2XBO 2;  2R04 1;  4H3W A;  1O3R A;  1EYB A;  4CP0 A;  4NPL A;  1QXJ A;  2XL7 A;  3OBZ A;  4IER A;  4JHZ A;  2OUJ A;  5HBA A;  1QQP 2;  1KEX A;  4FTE A;  4O9G A;  4V1P A;  5FY8 A;  4COY A;  4OMC A;  1RED A;  2X5I C;  3THT A;  1J59 A;  5FZH A;  2WQZ C;  1QOO A;  1UX7 A;  1WA4 A;  1QJX 2;  2I45 A;  4MGI E;  4WVM A;  1DLC A;  4ASL A;  4IGP A;  5A6X A;  2EXJ A;  1RHI 1;  4PCR A;  3D3A A;  1UL9 A;  4DRR A;  1PGS A;  3FC0 A;  4IEW A;  5E1R A;  3WXP A;  3JU9 A;  1D4M 2;  5FLH A;  1CN1 A;  3IZO A;  4M3C F;  1EPZ A;  3HT1 A;  2XJQ A;  1DQ1 A;  3KLS A;  4G4F A;  3ZYH A;  2VMG A;  3WSO A;  2EA7 A;  4JV4 A;  3S0M A;  1NUK A;  2K0G A;  1JU4 A;  4HL0 A;  1CAV B;  5G05 L;  4PBP A;  3VZL A;  4IUG A;  4YFW A;  3IDB B;  3KB5 A;  1UPI A;  3N7K A;  1N3O A;  1T6B X;  5FY1 A;  2BFU S;  2RM2 1;  1BHG A;  3AVS A;  3QD6 A;  1W6M B;  3GBF A;  3ZXF A;  4BQ2 A;  2VVF A;  3FHQ A;  3LAG A;  4QT6 A;  2KM2 A;  2VCM A;  2ZHN A;  1WME A;  3VBO A;  3OD0 A;  5GLV A;  3GCW A;  3B7M A;  4UWD A;  2GMM A;  2IXH A;  4Q4W 3;  3N3H A;  4BE3 A;  3I54 A;  4C1W A;  2B42 B;  1R08 2;  1PVX A;  1IG3 A;  1NXD 1;  2W52 A;  3AL6 A;  3E97 A;  5LAT A;  4JZR A;  3ZX7 A;  1Y9G A;  3CNA A;  2R07 1;  4AVB A;  2XJR A;  3TB0 A;  5KBF A;  1R09 1;  1RUD 1;  2WAO A;  1WCK A;  1BEV 2;  2Y33 A;  2O14 A;  4AVS A;  5LY2 A;  2DVD A;  2FDI A;  4S2D A;  3I2J A;  1GUI A;  2ZZQ A;  2DCT A;  1N3Q A;  2JG9 C;  4BPZ A;  2CY6 A;  3C7F A;  3ZO0 B;  2RDQ A;  5T5P A;  4LBN A;  4B3N A;  2ERF A;  4CA9 A;  4E4Z A;  1CJD A;  1OOP C;  1RUG 3;  1VBD 1;  1SZB A;  1IS6 A;  1YEW A;  4D0Q A;  1S0I A;  1JHN A;  3M3O A;  1XU1 A;  1QJY 2;  2WFF 2;  3FL7 A;  5L73 A;  4MO3 M;  5LEK A;  1AR7 1;  2DBN A;  1ST8 A;  3NV1 A;  1W8H A;  1G86 A;  3NJV A;  4WM7 A;  4W6W A;  5CFC C;  3NW4 A;  1RYY A;  4XBL A;  2CAU A;  5K7P A;  4DXT A;  1CJP A;  4UFL A;  1H6X A;  2Y0O A;  5FPX A;  1KIT A;  5C3R A;  4E4S A;  2ZEY A;  3VBF B;  5FZD A;  4FOW A;  4GH4 A;  4HK9 A;  2WJS A;  3DKQ A;  5KHI A;  3VL8 A;  2QUO A;  1PM4 A;  4FCA A;  1WW7 A;  2OII A;  1ZZ9 A;  2A7A A;  1F9K A;  1HJF A;  2IZW A;  5FJK A;  5FCC A;  4DY5 A;  3FBM A;  4DPN A;  3AK0 A;  3O0W A;  2VMF A;  3I59 A;  2QQM A;  1DGL A;  1O4T A;  3AP6 A;  3VBR A;  3WNL A;  1QOT A;  1PIV 3;  1S0J A;  1VBC 2;  3GNE A;  1Z78 A;  2GZW A;  3B94 A;  1FPN 3;  2D43 A;  4LE4 A;  2F17 A;  3N35 A;  4NRM A;  5FY9 A;  1PO1 3;  4A7Y A;  4XTP A;  3T2T A;  3VBU C;  5FK8 A;  1RUJ 1;  1C5H A;  3THD A;  3CJX A;  5FZE A;  3WG1 A;  5E6H A;  3O1M A;  1W8W A;  3TWI A;  4ES9 A;  1GQG A;  1ENS A;  3AZW A;  3VBO B;  1WCS A;  4BIS A;  1N1S A;  1NCR A;  3MPP G;  1KS4 A;  5D8A C;  3UGH A;  4AQ6 A;  1QJE A;  3Q9O A;  2ZCW A;  1VAV A;  4QX8 A;  2W46 A;  5FZL A;  4BQW A;  4QPI A;  4KQ7 A;  2ZGN A;  1JN2 P;  2VH9 A;  2VOK A;  3K4A A;  4LBJ A;  5H9S A;  1EV1 2;  3RS6 A;  4CDX A;  3PU3 A;  1CAV A;  1ZZC A;  3K48 A;  3VZN A;  2GDF A;  3MUY 1;  1LGB A;  2GH8 A;  1PK6 A;  4FBF A;  3WHT A;  1R1A 2;  1G9D A;  2HWF 2;  4UBH A;  4IV3 A;  5F32 A;  4Q8K A;  3RZK A;  4AI0 A;  1DZQ A;  4UT5 A;  1AR9 1;  3H3Z A;  3LE0 A;  1FOD 3;  2AZ5 A;  3AJY A;  3E1F 1;  2J1R A;  3HT2 A;  4O65 A;  4EWA A;  2P3K A;  3JZV A;  2Y8K A;  3H8R A;  2DWR A;  3P3P A;  5FO9 B;  5LBC A;  4L0P A;  1MEC 2;  4S2F A;  3CMG A;  3O5S A;  2DTY A;  3POI A;  4P9L A;  3D8C A;  5D21 A;  5BNN B;  4DUX A;  2OZ6 A;  2YFU A;  1R1A 3;  1HV0 A;  4LK7 A;  2W0X A;  4JQT A;  1RIT A;  4P9G A;  4AVC A;  3E6B A;  4XET A;  1A3K A;  2HWF 1;  2V4A A;  3FBY A;  4QX1 A;  2ZXQ A;  3TRS B;  4B7K A;  1DQ6 A;  1RHI 3;  5KR7 A;  3UES A;  4H55 A;  3NV2 A;  2GAL A;  2ATF A;  3IPV B;  5HCF A;  4Q4V 3;  2E51 A;  5A1L A;  1NQD A;  1TE1 B;  4M3C B;  3M8L A;  5A3N A;  5JDB A;  5LW9 A;  5FYH A;  2BBV A;  1H2N A;  3LKJ A;  1AYM 2;  1FV2 A;  4LJH A;  1NKG A;  1NCR C;  4R4X A;  4TLG A;  2C1F A;  4CEW A;  4ZZ5 A;  4GUL A;  2XWB B;  1H4H A;  3WNN A;  4BQ1 A;  4UW5 A;  5F5Q A;  1HB2 A;  3WP4 A;  1H2L A;  3ZN5 A;  4Q27 A;  1HLC A;  3FN9 A;  3N9M A;  4N43 C;  2W94 A;  3ATG A;  4PDW C;  1V6M A;  1MAC A;  2JXA A;  2VTF A;  2P6C A;  3AP9 A;  3AZZ A;  1RGS A;  1CPM A;  2X53 S;  3U37 A;  3ILN A;  3ZPY A;  2KD7 A;  1ALY A;  4U2A A;  3FX3 A;  5IVB A;  3ZXE A;  4UBG A;  4UW6 A;  3ZIX A;  1BEV 3;  4RN5 A;  5T3N A;  4FPK A;  1WW4 A;  5EP9 A;  2XVK A;  5FMO L;  4DS0 A;  3OUI A;  4NIG A;  4CRQ A;  2R07 3;  2XKP A;  5L9R A;  5LRR A;  4DXZ A;  1AXK A;  4AI1 A;  3GZT B;  2L9L A;  4LBL A;  1GWK A;  1SLC A;  1IG0 A;  4RGA A;  2WO7 A;  5FP9 A;  1MS3 A;  5FY0 A;  3SCG A;  3VDA A;  2XL9 A;  4UFI A;  2PHT A;  2VNO A;  4M3C A;  2DDU A;  3III A;  4ES8 A;  3BI3 A;  4P9I A;  1RVF 2;  5CNA A;  3WQ7 A;  1XNC A;  1OH4 A;  3R4D B;  2EIE A;  1FYU A;  3LEI A;  5A3W A;  2GME A;  2VMH A;  5LB6 A;  4ONU A;  1AXY A;  2P34 A;  5JI9 A;  2HWC 3;  4LO4 B;  5CFD A;  1HIX A;  1AX0 A;  2FZ1 A;  5DMY A;  2P3I A;  5F6K A;  3G6J B;  1OT5 A;  4FPG A;  4J25 A;  1VBD 2;  5EQU A;  3IDE A;  5HPO A;  4XUQ A;  1F15 A;  2WNV C;  3X29 B;  2WO1 A;  5EWS A;  2NMN A;  2VUC A;  4RGK A;  3Q8B A;  3AX4 A;  4L9B A;  1JI6 A;  4WM8 C;  3N7J A;  4N43 A;  3ZXJ A;  1OKQ A;  1W6Q B;  1OLR A;  2X09 A;  4Y22 B;  2E31 A;  1OD5 A;  1OLM A;  1PZ7 A;  3VZK A;  4AEM A;  2KXL A;  2RV9 A;  5JXG A;  3M3Q A;  5T5O A;  5HV0 A;  1JS9 A;  3HMY A;  2R04 2;  3USU A;  1KDK A;  1HV1 A;  5A3L A;  1MS1 A;  1KQR A;  2CWM A;  3TN9 2;  3HOB A;  1CAU B;  1J3P A;  2XBO 3;  1LHN A;  4TYS A;  2DUO A;  1PGW 2;  4HSJ A;  2AGS A;  1H9P A;  2C9A A;  2J7M A;  2AH2 A;  4OHX A;  2G9Z A;  3VBH A;  1JYI A;  1PMH X;  3AMM A;  1PX3 A;  3I49 A;  4DOU A;  1FMD 2;  3ECQ A;  1JOD A;  2QZ2 A;  1B35 A;  3B93 A;  3O14 A;  4CEY C;  3VDD A;  1QJX 3;  1RMU 1;  4Q1P A;  4Q0Q A;  4IND A;  5E89 A;  3ZFG A;  3VBR C;  1POV 0;  5ANN A;  4A2U A;  3NJY A;  3V0A B;  1VLN A;  5FPU A;  2YC2 A;  4WVV A;  1BYH A;  1ASJ 3;  2H0B A;  3J7L A;  1DGW X;  3HPN A;  1NXM A;  3QLQ A;  1AYN 1;  4RYD A;  2EVX A;  1HB1 A;  5GLZ A;  4FOV A;  4A44 A;  3VBU A;  2VAU A;  1SBD A;  4QGM A;  4QGL A;  1HRI 1;  4GMP 0;  1W6P B;  1Y9Q A;  4LHL A;  2JEN A;  2ZJC A;  2ZA9 A;  3FFZ A;  3BGA A;  4DFS A;  4HT1 T;  4JDN A;  1RUE 2;  1PNG A;  4FSJ A;  1K45 A;  1RMU 3;  4IEV A;  3HQX A;  3T2O A;  3QH6 A;  1U5I A;  4R9C A;  2JEC A;  4I3P A;  4NR1 A;  2D6P A;  3VBF A;  4W4Z A;  1QQP 1;  5CKM A;  1G9A A;  2Z5W A;  3VL9 A;  4IEX A;  5FZ9 A;  4KWU A;  2IVJ A;  2XKO A;  3KCX A;  3NKT A;  1MQT A;  2RS1 2;  2Y6K A;  5DUV A;  4HVR A;  3U75 A;  3ZFF A;  2ZAH A;  4BCU A;  2H6C A;  3NKG A;  1PVC 1;  3AJZ A;  2W39 A;  2EXH A;  2UWC A;  2XHN A;  1C8N A;  2P37 A;  3FLP A;  3RMX A;  1XNT A;  4QGN A;  1HJG A;  2HWB 2;  3LCP A;  1WCU A;  2ZX0 A;  2WO2 A;  4LNV A;  3O1O A;  1CIW A;  3OUJ A;  1Q56 A;  4L99 A;  1UF2 C;  4Z07 A;  3U4X A;  2IFW A;  1CAX A;  4DUW A;  2JB4 A;  1LGC A;  2WS9 1;  4QPG A;  4MV2 A;  1QY4 A;  2JEM A;  4ZZ8 A;  5CAD A;  3VZO A;  5A1A A;  2WFF 3;  4TWT A;  1W9T A;  1F2N A;  4EZH A;  4EE2 A;  1TME 1;  3PUA A;  2VU9 A;  1UY4 A;  3PUR A;  2N7G A;  4UYB A;  2QQU A;  4LR4 A;  5BXX A;  3H9A A;  3ZSM A;  4YSF A;  5LCW L;  2AEN A;  2WQ8 A;  4RGG A;  2VXJ A;  5J96 B;  3HBZ A;  5IK5 A;  2P5B A;  3ES4 A;  3KGZ A;  1MS9 A;  2XDV A;  3FHI B;  3KT1 A;  5JCT A;  2VME A;  2JKB A;  1QDC A;  3THC A;  2Q5T A;  5DAW A;  5DUU A;  4CP1 A;  1OLM E;  1NCQ C;  4JVA A;  5JPN B;  2DUQ A;  1C1L A;  1OQD A;  3C7O A;  4X6R B;  5FZ0 A;  5A3U A;  1UW8 A;  4DXR A;  1UWW A;  3ZR5 A;  2JDU A;  1POQ A;  1XYN A;  2CYF A;  3ZFF C;  1AR6 2;  1PGL 2;  1ZBA 3;  2BU9 A;  4BWO A;  2P3Y A;  1OA4 A;  4LXL A;  4DZG A;  2CAV A;  2QDN A;  3MFC A;  3VZJ A;  4L11 A;  5E88 A;  5C8C B;  2P17 A;  3B9C A;  1BBT 2;  5E8A A;  3WD5 A;  1GZT A;  1NLR A;  4QWN A;  2A6Y A;  4AED A;  3M3I A;  2XH6 A;  3M3E A;  4HN1 A;  2BEO A;  3WEZ A;  1VB2 A;  3P6B A;  1CQ9 A;  3DUI A;  1RUF 1;  2HKX A;  4PLN A;  4YGE A;  3VKL A;  4C8D A;  5JPM B;  2IXK A;  4JC1 A;  1US2 A;  4QX0 A;  4GB3 1;  2QTW B;  5CFC A;  2LRO A;  4XCB A;  4BLJ A;  4NMI A;  3IBM A;  2JDA A;  3H8O A;  5FMD A;  3WG4 A;  2RR1 1;  4QX3 A;  4YM3 A;  3JD7 3;  3DN7 A;  4FFI A;  2PHD A;  2O8O A;  3OY8 A;  1ZYB A;  1BLZ A;  4LKF A;  4LE3 A;  5A7Q A;  5IK4 A;  1QNY A;  3LZZ A;  5JOY A;  2YPJ A;  1NG0 A;  1AYN 2;  3W59 A;  3L2Y A;  3NVC A;  1F4A A;  3RJR A;  4EQV A;  2ZAA A;  1V00 A;  2K9Z A;  2BV4 A;  5JI7 A;  3O1R A;  1GNH A;  1H1I A;  2W95 A;  2YGL A;  2ILM A;  4RHV 3;  5CYY A;  2CHH A;  5F5I A;  2QCS B;  2ZMK A;  3KCY A;  1W8Z A;  4HG6 B;  5A3O A;  3WQB A;  2HEW F;  4COU A;  4D69 A;  3MIC A;  3B3Q E;  1ULE A;  2MEV 2;  4GWM A;  2WYF A;  2VZ3 A;  4I02 A;  1W6N B;  2UU8 A;  4NVP A;  3WF4 A;  3MGU A;  3ZVX A;  5CAZ A;  1XC6 A;  4HK8 A;  4KNC A;  2AYH A;  4JRA A;  2XG3 A;  3ZFE C;  4Q1R A;  3POJ A;  5H9P A;  1XU2 A;  2GNB A;  4FXK B;  1DU3 D;  4I0W B;  2ADE A;  5C7G A;  2VW2 A;  1KJR A;  3RZJ A;  3QCW A;  1O7F A;  2GU9 A;  4Z92 B;  4FQ4 A;  1QMJ A;  1SBE A;  1RUE 3;  1WLD A;  4EJR A;  3NST A;  4NUB A;  4AVV A;  1DQ4 A;  3B00 A;  4DEV A;  1WW5 A;  2B39 A;  1O4Z A;  3MYX A;  3I2O A;  1JUH A;  5GAL A;  2YZ4 A;  4CP2 A;  3M3C A;  3NL1 A;  4TXW A;  2XUE A;  2RHP A;  2VQT A;  1X82 A;  1A78 A;  4WZF A;  4MGT A;  5I0S A;  3CJI C;  5FWJ A;  2D6M A;  4Q4X 3;  4AI9 A;  4AVT A;  3V0B B;  1S2K A;  2ET1 A;  2VUL A;  1ENX A;  2Q4S A;  1N3P A;  2GN7 A;  4MHU A;  2ZGO A;  2E33 A;  3ELN A;  3O0X A;  4IEQ A;  3O1T A;  3OBT A;  4NIA A;  1ZRE A;  3CHX A;  3AZX A;  4IXL A;  3GJB A;  3OPW A;  1QWR A;  4YG0 A;  1XE0 A;  1QGL A;  3T0B A;  1RVF 1;  2C4X A;  4CDW B;  1ACC A;  3VBU B;  3VHR A;  2ORX A;  3LEM A;  3OBR A;  5IK7 A;  3R4S A;  2UYB A;  1X9T A;  4A6O A;  1MVE A;  3W9A A;  4CCK A;  2VCC A;  2V4V A;  3MV0 1;  5A3P A;  4Z82 A;  1TG7 A;  3WUC A;  5A3T A;  1NA1 A;  1X8M A;  4WZC A;  5T54 A;  5AC9 1;  1ZNP A;  4LT5 A;  2C9K A;  5FZI A;  1D7P M;  1HQW A;  5G04 L;  2IXI A;  4NWV A;  1B35 B;  2TNF A;  4OFG A;  2FCT A;  1V6I A;  4OCT A;  1DFQ A;  3BAL A;  5FXV A;  4IEZ A;  4D6Q A;  3BIE A;  4QQL A;  2RMU 1;  1LU2 A;  1VBC 3;  2DTW A;  2PHX A;  2B8M A;  2GP5 A;  2PLV 1;  3I3E A;  3ME2 A;  4Y4R A;  3HN3 A;  3VBF C;  3VBH B;  3N7M A;  1YQ2 A;  4OUE A;  4DNY A;  1SLB A;  4MH0 E;  4QB1 A;  1OLQ A;  4QKF A;  3A21 A;  4YW6 A;  3FLT A;  4K20 A;  1NLS A;  2JG8 A;  3N9L A;  1J83 A;  2RS3 1;  3B01 A;  4XC9 A;  4JGY B;  3BTX A;  1VBE 3;  4CCC A;  1X8E A;  3MV1 1;  1DIW A;  5GZC A;  1UOF A;  1A34 A;  1OFN A;  1HN1 A;  5LRS A;  1O4Y A;  4QM9 A;  5FY7 A;  4N43 B;  1RC6 A;  2NQY A;  4QKB A;  5IJR A;  1GAN A;  5FYT A;  2RMU 3;  4XFG A;  2VZS A;  1SMV A;  3JCI A;  3PL0 A;  4B29 A;  2OQ6 A;  1LED A;  2PLV 2;  5L36 A;  1BCX A;  2RMU 2;  4CCD A;  1UPS A;  1MZF A;  3DPR B;  4BU2 A;  1UNB A;  4FFG A;  4XIK A;  4CEY A;  5FYZ A;  3WUD A;  3AXE A;  4UOJ A;  4D6S A;  5JOW A;  2W1U A;  3Q8F A;  2XQR A;  4JTO A;  5JZG B;  5DUX A;  1VBE 2;  2BRT A;  1NAE A;  3WF2 A;  4NHM A;  3FZ3 A;  2RDS A;  4NAM A;  4YM1 A;  4C0B A;  4CCO A;  1NZI A;  1IPJ A;  3PIG A;  2WII B;  3MO4 A;  5F3G A;  4CU6 A;  3WF0 A;  5IVV A;  4R9A A;  5CVR A;  4LBQ B;  3AKQ A;  1AVB A;  4FPE A;  2DUP A;  2CWS A;  3ZSJ A;  2W47 A;  4N7I A;  1QJF A;  1COV 2;  4QB2 A;  1Q8Q A;  5HV4 A;  2Y26 A;  1JOP A;  1YQ8 A;  1ZBE 3;  2BOJ A;  1FT9 A;  1YQC A;  2O1Q A;  1ZRF A;  2HJI A;  1TNF A;  4IEP A;  4WM8 A;  3MDP A;  4KGQ A;  4Q4W 2;  1HX6 A;  2JIC A;  4MG2 A;  1WBF A;  2VY0 A;  1R1Z A;  1J1T A;  3IIA A;  5EJ3 A;  1GP4 A;  4FPH A;  5EYY A;  4AFD A;  3R0R A;  1Q3E A;  3PUI A;  4L8Q A;  5AVP A;  2QKD A;  3HAG A;  1RUH 1;  1K12 A;  1YLL A;  2XML A;  1LCL A;  1ODN A;  4D7T A;  2HLE A;  2RE9 A;  2W91 A;  4P9W A;  4RS5 C;  4XVH A;  3WDT A;  4CSW A;  5I91 A;  3CBN A;  1JZ5 A;  2JJ6 A;  1V70 A;  1OA2 A;  3CU7 A;  3TOJ A;  3CZJ A;  2O8Q A;  3KS7 A;  2GC3 A;  1KDM A;  2V5Y A;  3VHO A;  4X8P A;  3S57 A;  4K6B A;  2PHU A;  3LDB A;  4JCK A;  5CEH A;  1XE7 A;  4QPG C;  2QQP A;  5FUN A;  5FOB B;  4R9D A;  2GP3 A;  3WT3 A;  4FFH A;  1RUH 3;  3WDY A;  1DYK A;  3MLK A;  5A6Z A;  3S6P A;  2Q30 A;  1LR5 A;  4RR3 C;  4LO5 B;  2DF7 A;  3VKM A;  3LWC A;  1W2U A;  2BGC A;  2ZMN A;  1YNA A;  3BVC A;  1UMZ A;  1VIW B;  3HR9 A;  4NHK A;  3VKF C;  4EV0 A;  5ABJ C;  1BMV 2;  3M2M A;  4CPB A;  1MS4 A;  5LBB A;  4JGZ C;  2XON A;  1UU6 A;  5D1I A;  5CKN A;  4MSV A;  5F39 A;  3M70 A;  4QDS A;  3RRD A;  2RR1 2;  4XHB A;  4GKX A;  1LOD A;  2VNV A;  4IV1 B;  4JDO A;  4PT6 A;  4XFC A;  1V6J A;  3JQW A;  1OOP A;  5I0R A;  3ZN4 A;  2GMP A;  3BTZ A;  3Q8A A;  2VE1 A;  1WD3 A;  1XB9 A;  1QXR A;  4MXW B;  3OB8 A;  5FZF A;  4ASM B;  3ROU A;  3RZM A;  1HKD A;  4MGS A;  2FZ2 A;  4JDM A;  3DXU A;  4XIL A;  1MZ6 A;  3BTA A;  3WNM A;  5C4W B;  5BV6 A;  4CCL A;  2A6X A;  2OS2 A;  1YO8 A;  4K7J A;  4C91 A;  2WWS A;  4RS5 A;  1DP0 A;  1CAW B;  1DGW A;  2D93 A;  4Y3O A;  5GZG A;  1R09 3;  3U14 A;  3WF1 A;  3GF6 A;  1FNZ A;  4IGO A;  3OYW A;  4MXV A;  4MGQ A;  4W6X A;  1Q8V A;  2BPA 2;  3ETQ A;  3DKW A;  1AJK A;  4XJ9 A;  3O0V A;  1XYO A;  4FVV A;  4MGZ E;  5T5L A;  2HWE 1;  3MLL A;  2ZBJ A;  2R04 3;  4OHZ A;  5C3O A;  5FDB A;  5A7W B;  3WV6 A;  5FP4 A;  5BNP C;  5DPN A;  5A70 A;  2WC2 A;  3DPR C;  1K5M A;  4R4Z A;  3RQ0 A;  3V65 A;  1RUJ 2;  2V73 A;  4WVZ A;  1ZX5 A;  4XE9 A;  1AR7 3;  3VUO A;  4MGK E;  3J8F 1;  1NT0 A;  1DQ5 A;  5IVE A;  1V6O A;  2A70 A;  1NY7 1;  3ES1 A;  3WP6 A;  5CFD C;  3MIB A;  2BNN A;  2ZGP A;  1TZO A;  4LOT A;  4Q4Y 2;  4J1X A;  4Y26 A;  1MPX A;  3PNA A;  5DAX A;  5IAT A;  2VTX A;  5DZF A;  4WVW A;  4ZXE A;  3VKN A;  3VV1 A;  5JUV A;  1JXN A;  3ASI A;  3LA2 A;  1O8P A;  3MW2 A;  4MAD A;  2BFU L;  2VOV A;  1QJY 1;  4KH9 A;  5F9T A;  4XQD A;  1RL3 A;  1LOA A;  1RUO A;  4GA9 A;  2SBA A;  1W8U A;  4DEQ A;  1BKZ A;  2NPI A;  4NJ4 A;  2DU0 A;  1WD4 A;  3DL3 A;  3AZV A;  3PJY A;  5DZG A;  4Y5T A;  2VUA A;  2E53 A;  4M0H A;  4TZD A;  1DYO A;  3JB4 C;  4GAZ A;  3PIJ A;  1UY1 A;  1JOJ A;  2Q1F A;  3WDU A;  1PO2 1;  2HH9 A;  4UF0 B;  1FPN 1;  1WLC A;  3OEB A;  4FOY A;  3ZFF B;  3I2H A;  1VBB 3;  5IVC A;  1OQ1 A;  5KHH A;  1AJO A;  1K3I A;  1NE4 A;  3ILR A;  1DHK B;  1XXN A;  5FV3 A;  4CUB A;  4MX3 A;  3H42 B;  2QQV A;  4AE2 A;  2C5D A;  2Z4F A;  3NV4 A;  4HPK B;  1SG3 A;  4MUV A;  3AP4 A;  3BN6 A;  4U36 A;  1UY2 A;  4UFM A;  4I2O A;  2P1B A;  3H7Y A;  1GNY A;  5AFE A;  4YZ1 A;  4Q4X 2;  1SFN A;  2JB8 A;  2GNM A;  1SLI A;  1YWK A;  1LEM A;  2IC1 A;  2W68 A;  2VL4 A;  2Z2S B;  3DYM A;  5K0U C;  2D3R A;  3CO2 A;  4OUS A;  2JE7 A;  1HQL A;  2FMD A;  3H3L A;  1CX4 A;  2DUR A;  1H0B A;  3OD4 A;  4P00 B;  5FUI A;  5F1R A;  4XXP A;  1W2A X;  2D40 A;  5JAX A;  1XOY A;  2ADD A;  5FXZ A;  1ZBE 1;  4XJW A;  4FTB A;  2LRP A;  3CJI A;  5JOZ A;  4Q0V A;  2A6W A;  3PJQ A;  4AI3 A;  4B1L A;  5KXE A;  3T30 A;  2HWB 3;  3BU7 A;  1SHW B;  4CDQ C;  4ZPI A;  5KHJ A;  2C24 A;  1C3H A;  3MIH A;  5FZO A;  3ACG A;  2WZE A;  4FO9 A;  1D4V B;  1RHI 2;  1I9R A;  1V6K A;  4LUM A;  2ZEW A;  1D0G A;  4HN0 A;  3I2K A;  4QX5 A;  1JYX A;  3PTY A;  4PDW A;  2VBP A;  3WW2 A;  1O3T A;  4XBN A;  2MEV 3;  4KL1 A;  3KWV A;  1IS4 A;  1WCD J;  2WDB A;  1QJX 1;  1VMH A;  1Q43 A;  1YJL A;  3H1W A;  5T5J A;  2VUJ A;  3N9N A;  4TLF A;  3USU B;  5ISL A;  4IE4 A;  1H4G A;  3DF0 A;  4XBQ A;  1LOG A;  1W0O A;  3V56 A;  1UN1 A;  1JYV A;  4ERO A;  4IV1 A;  5F7U A;  5LA1 A;  1AYN 3;  3H1M A;  1EAH 2;  4XFB A;  4DUV A;  2G9F A;  2EIC A;  1S0F A;  3AKT A;  2NMO A;  2MEV 1;  4AQT A;  1KGY A;  1RUD 3;  1CES A;  3DCQ A;  1CWP A;  1OA3 A; 
#chains in the Genus database with same CATH homology
 2W87 A;  4XUN A;  5DQ0 A;  2YB7 A;  2VCA A;  2YC2 A;  3JXS A;  4CU8 A;  3IDA A;  3HPN A;  4RYD A;  3VDB A;  4A44 A;  1W9S A;  5B4N A;  5EJZ B;  4BK4 A;  1EUT A;  3BGA A;  4QDR A;  2B4K A;  4QDQ A;  4ZY9 A;  5JXI A;  1K45 A;  3CZU A;  1OD3 A;  2W3J A;  1I5P A;  4CU7 A;  3T2O A;  1TVG A;  4W4Z A;  1O59 A;  3K46 A;  2CDP A;  2VO5 A;  2VZT A;  2J1A A;  2BER A;  4KWU A;  1JZ6 A;  1JZ4 A;  4DXS A;  1UY3 A;  2Y6K A;  4E8C A;  4GWI A;  3F2Z A;  2XHN A;  1PX4 A;  3T0A A;  1GQP A;  3T2Q A;  5J1X A;  2Y64 A;  1XNT A;  3GGL A;  3MBW A;  2J1V A;  4XZU G;  2WO2 A;  2QQJ A;  2HYX A;  2RVA A;  2W9X A;  3T08 A;  5DN2 A;  4CUA A;  4DUW A;  4QB6 A;  4ZZ8 A;  1XNA A;  3HNY M;  3HEI A;  5A1A A;  2JKX A;  3GXU A;  1W9T A;  1UXZ A;  1UY4 A;  4XUR A;  1JZ3 A;  5LCW L;  2WQ8 A;  2J22 A;  4LHS A;  3GM8 A;  5JR2 A;  2J1U A;  3OGR A;  5C71 A;  2VMD A;  2R7E B;  3A23 A;  2VME A;  3ACH A;  2E26 A;  3THC A;  3LQC A;  4LPL A;  1EUU A;  2VOT A;  3C7O A;  2VJX A;  1GOF A;  2ZEZ A;  3LPF A;  4DXR A;  4OMD A;  4LKS A;  4A3Z A;  1UWW A;  3K4Z A;  4JKK A;  2V5D A;  1CIY A;  2W5F A;  2LS6 A;  4UAP A;  1UXX X;  1NX9 A;  1ULP A;  4YPJ A;  1GMM A;  3WEZ A;  2WN2 A;  2Y6L A;  3I2F A;  3P6B A;  5JXH A;  3SKJ E;  1US2 A;  4QX0 A;  4E8D A;  3HNM A;  4P02 B;  3LPG A;  3C8X A;  2BBA A;  2JDA A;  2WZ8 A;  2BGO A;  4QX3 A;  1WCQ A;  1GU3 A;  4Z2A A;  2ID4 A;  3OGV A;  2QBX A;  3NNG A;  2JD9 A;  2BZD A;  2LW8 A;  1W8O A;  4D8M A;  3SKV A;  4PF1 A;  1F4A A;  1T2X A;  4ET7 A;  3WNP A;  3LEK A;  1W8N A;  3C7G A;  4LQR A;  5CZK A;  2W95 A;  3K75 B;  3OBA A;  5CYY A;  3WQB A;  4CU9 A;  4HG6 B;  3VDC A;  1OF3 A;  2C26 A;  2YC4 A;  1UMH A;  2VZR A;  4OZO A;  2VZ3 A;  3P1I A;  3WF4 A;  2WUH A;  3VD3 A;  1XC6 A;  5IHR A;  3T09 A;  1US3 A;  3NJX A;  5C7G A;  4XUT A;  1P8J A;  3ACI A;  1JZ7 A;  3ABZ A;  4XUP A;  1UYY A;  4JKM A;  5JMO A;  4MOA A;  3EB7 A;  4KMQ A;  3I2G A;  2QQL A;  4M4P A;  3IAP A;  4DEV A;  3NRU A;  5HXM A;  1UMI A;  4BXS V;  1CZT A;  5LA2 A;  2W1S A;  4TXW A;  2VQT A;  1J84 A;  2VZV A;  4A4A A;  3LEG A;  3UNP A;  2E33 A;  3WNK A;  1W99 A;  3W5M A;  3T0B A;  1GOH A;  2V72 A;  2VZP A;  3DEC A;  2C4X A;  2W1W A;  2WAA A;  2ORX A;  1JYN A;  1JZ8 A;  1O8S A;  4A6O A;  2VCC A;  2V4V A;  4PQQ A;  3MV0 1;  1TG7 A;  5LA0 A;  5B4X A;  2QQK A;  2YG0 A;  2C9K A;  2WO3 A;  1W0N A;  1D7P M;  4JHZ A;  5G04 L;  1KEX A;  4OMC A;  4AG4 A;  4TTG A;  3I3E A;  3T2P A;  3HN3 A;  3SEE A;  1UX7 A;  1YQ2 A;  4OUE A;  1DLC A;  4QB1 A;  3D3A A;  4ARY A;  3A21 A;  1R64 A;  1J83 A;  2VR4 A;  4KI5 M;  3MV1 1;  2VZO A;  5EIY B;  3A7Q A;  1HN1 A;  3ZM8 A;  3WSO A;  2VZ1 A;  2YFZ A;  1NUK A;  3CIH A;  1JU4 A;  5G05 L;  5IJR A;  4IUG A;  2VZS A;  4OYU A;  1L7R A;  4UI9 L;  2BGP A;  3VD7 A;  1BHG A;  2E32 A;  3FHQ A;  3J7H A;  4UOJ A;  1PMJ X;  2W1U A;  3CDZ B;  1NAE A;  3WF2 A;  2W1Q A;  3CKH A;  3MO4 A;  3PUH A;  2DCK A;  4CU6 A;  4QAW A;  3WF0 A;  5EJ1 B;  3HJR A;  2VZU A;  2WAO A;  3T0D A;  2W47 A;  4QB2 A;  1H6Y A;  3ETP A;  3I2J A;  1GUI A;  4ARX A;  3C7F A;  3I2I A;  3ACF A;  2ZEX A;  4D0Q A;  2VMC A;  1WKY A;  3FL7 A;  3C7E A;  4MO3 M;  3PUI A;  3OEA A;  1K12 A;  4BK5 A;  3NJV A;  2VQU A;  1RYY A;  4GWJ A;  2HLE A;  2W91 A;  4A45 A;  4DXT A;  4XVH A;  1JZ5 A;  1H6X A;  2ZEY A;  3CZJ A;  4JX0 A;  5IFP A;  4BJ0 A;  2VMF A;  2QQM A;  2X10 A;  3I97 A;  3MUZ 1;  3WNL A;  4CVU A;  2VM9 A;  4GZ9 A;  2RJ2 A;  2XON A;  3THD A;  3HNB M;  4QDS A;  1JU3 A;  4PT6 A;  1K42 A;  2JE8 A;  5C70 A;  2W46 A;  3WNO A;  3OB8 A;  4W50 A;  2J1E A;  2Y6H A;  3K4A A;  4MGS A;  3WNM A;  3IAQ A;  2J1T A;  3MUY 1;  1JZ2 A;  4W8J A;  3K77 A;  2WAB A;  4XUO A;  1UZ0 A;  1DP0 A;  3LE0 A;  3E1F 1;  2J1R A;  3WF1 A;  2PQS A;  3W5N A;  2Y8K A;  4MGQ A;  2VZQ A;  4L0P A;  3CMG A;  5DPN A;  4DUX A;  2DCJ A;  4M4R A;  1SDD B;  2YFU A;  5IYY A;  4JKL A;  1JYW A;  4QX1 A;  2ZXQ A;  1MPX A;  2ORZ A;  2CDO A;  3IB3 A;  3UES A;  4ZXE A;  5JUV A;  4P5Y A;  3SEP A;  1O8P A;  4MAD A;  1UYZ A;  2XQX A;  1NKG A;  4DEQ A;  4P08 A;  4QX2 A;  4ZZ5 A;  1CZV A;  1LNS A;  3UET A;  3A22 A;  2QQN A;  3C7H A;  3WNN A;  4BDV B;  1DYO A;  2VC9 A;  1UY1 A;  3FN9 A;  2W94 A;  1W9W A;  2VTF A;  3OEB A;  3I2H A;  2WYS A;  3U37 A;  1K3I A;  3WF3 A;  3OGS A;  2KD7 A;  1L7Q A;  4CUB A;  2Z4F A;  2WBK A;  3NQH A;  4RN5 A;  3FHA A;  1SG3 A;  3BN6 A;  1OF4 A;  1UY2 A;  3DYP A;  2EIB A;  1GNY A;  3CQO A;  2VL4 A;  2WN3 A;  5IFT A;  3DYM A;  1JHJ A;  2L9L A;  1IQD C;  2XOM A;  2EID A;  4P00 B;  3VDA A;  5FUI A;  5JXJ A;  3EYP A;  2DDU A;  3III A;  2OKX A;  1XPW A;  3I3D A;  1OH4 A;  2EIE A;  3LEI A;  3AC0 A;  1SHW B;  1GOG A;  5I0D A;  3DYO A;  2QQI A;  5DMY A;  1OT5 A;  3ACG A;  2Y6G A;  3OG2 A;  3VD5 A;  1UYX A;  2WZE A;  5HPO A;  4XUQ A;  2J1S A;  2WO1 A;  2ZEW A;  4QPW A;  1JYX A;  3I2K A;  1JI6 A;  2W92 A;  1ULO A;  2X09 A;  4FI9 A;  2E31 A;  2RV9 A;  2WDB A;  4A42 A;  5JXG A;  2QQO A;  2VCB A;  1F4H A;  3GDB A;  1JYV A;  3K4D A;  1UY0 A;  3HOB A;  4CUC A;  5F7U A;  3I3B A;  5LA1 A;  3VD4 A;  1CZS A;  2X05 A;  4DUV A;  2EIC A;  2J7M A;  2B9V A;  3VD9 A;  1PMH X;  4A41 A;  1PX3 A;  1CX1 A;  4AAX A;  3ECQ A;  1KGY A;  2Y6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...