4MGSA

Bixyn10a cbm1 apo
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
141
structure length
141
Chain Sequence
DKVDYEIDYSTAGYSFWNEVNEEVKETTTIGKNDTEGCLEIKTSVAASQNHFIQYHTADNLPIEIGKEYKLKMMVRGSAEGKLNFGVGPWSGRAEGSFSFNTEWKEYEFSFKAVADGGHVMTQSGLFVGTIQIKYVKITHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Xylan utilization in human gut commensal bacteria is orchestrated by unique modular organization of polysaccharide-degrading enzymes.
pubmed doi rcsb
source organism Bacteroides intestinalis
molecule tags Hydrolase
molecule keywords Putative glycosyl hydrolase family 10
total genus 34
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2013-08-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4mgsA00
2WQ8A 3K75B 4A42A 2X09A 2W1UA 1XC6A 1JZ8A 1TG7A 4MO3M 1UY4A 4LHSA 3CKHA 2B9VA 1CX1A 1DP0A 2WO3A 3CZUA 1ULPA 4Z2AA 1O8SA 1UY2A 4A3ZA 4QDQA 4BDVB 2W5FA 5F7UA 5DQ0A 2BZDA 3T2QA 3BGAA 3SEEA 1OF4A 1KEXA 2W87A 4MGSA 1K45A 4XUPA 2VZRA 3VDCA 4XUQA 4E8DA 2QQNA 3MO4A 4M4PA 1GNYA 3A7QA 4XURA 3SKVA 2BGOA 3LEKA 1LNSA 4ZZ5A 3JXSA 2J1EA 2QQJA 1US3A 3WNOA 4OUEA 1UWWA 3WNMA 3GM8A 3WF4A 2V4VA 2WZ8A 5EJ1B 3WNPA 4KI5M 3EYPA 4QB1A 2J1AA 3ACFA 1R64A 3MV11 1W8NA 2E31A 4KWUA 2VZUA 1PX3A 5I0DA 2ORXA 3WF2A 2BBAA 4CVUA 3VD7A 4DEVA 1T2XA 3MBWA 4DUXA 4GWIA 5C7GA 3HNYM 4OYUA 1W9TA 1PMHX 3C7GA 2E32A 2YFUA 4PQQA 2QQKA 4GZ9A 4JKKA 3NRUA 4DXTA 1UY0A 3ACGA 2ZEYA 1UX7A 1WCQA 3DYOA 3P6BA 4QAWA 2LS6A 2JE8A 2W46A 3SKJE 4A41A 5IYYA 3OGVA 3IDAA 4JHZA 4QX0A 2XOMA 1H6YA 2WN2A 5DN2A 2VZOA 3CMGA 4QX3A 1UYXA 1JZ7A 2W92A 2RVAA 4MGQA 1W9WA 3GGLA 2ZEXA 2DCKA 2WO1A 3J7HA 3WQBA 3HPNA 4LKSA 3ETPA 4L0PA 3MUY1 3LEGA 3T0BA 5JXJA 1OT5A 4ET7A 4HG6B 1K12A 2HYXA 3D3AA 2J1SA 1NUKA 3ZM8A 4OMDA 3ACHA 3LQCA 3C7EA 4XVHA 1XPWA 1TVGA 4BK4A 3I2JA 3OBAA 5B4XA 1GOHA 4MOAA 1JU4A 1UZ0A 2W9XA 2VZQA 2EICA 2QQOA 4QB2A 2KD7A 2VQTA 3WNLA 4QX1A 2Z4FA 4W8JA 2VMEA 3A23A 3PUHA 4RYDA 1CZTA 4D0QA 5IFTA 3I3DA 3MUZ1 2W1WA 2VCAA 1EUTA 1BHGA 1W0NA 3HOBA 1DYOA 2EIBA 4W4ZA 2ID4A 2WAOA 2VC9A 2QBXA 3ABZA 5LA2A 5G05L 4AAXA 2WYSA 3OGRA 3C7OA 3HN3A 4P08A 4ZY9A 2VZSA 2DDUA 2WBKA 3THCA 2J1TA 4XZUG 1I5PA 2J1RA 4YPJA 1EUUA 4P02B 2X10A 1XNAA 1L7RA 4BK5A 2WAAA 2Y6GA 1PX4A 4D8MA 4LQRA 3FHAA 1JZ4A 3HNBM 1UY3A 1UMHA 2CDPA 3GXUA 2OKXA 2VL4A 3ECQA 2V72A 2L9LA 2W95A 2VZTA 1OF3A 1CZSA 3GDBA 3UESA 4ZZ8A 1GQPA 5HPOA 3LPGA 3T2PA 5JUVA 1NKGA 1O8PA 2J1VA 2W1QA 5A1AA 3F2ZA 5JXGA 2VO5A 2XONA 4M4RA 2VM9A 2QQIA 1IQDC 2VZVA 4P00B 3VDAA 1JHJA 4ZXEA 2VMFA 3IAQA 1P8JA 4CUBA 4UOJA 2WZEA 2C4XA 2R7EB 3T09A 5JMOA 4TTGA 2WABA 2YC2A 2C26A 4GWJA 3WF1A 5IFPA 2J7MA 2VZ3A 2JDAA 2JD9A 2LW8A 1L7QA 2W3JA 3T0AA 4CUCA 3C7FA 4OZOA 1UY1A 5CYYA 3NJVA 1HN1A 2W94A 5HXMA 4PF1A 2EIDA 1JYWA 3BN6A 4XUTA 1J84A 1JZ2A 5C70A 3K4DA 3VD9A 4OMCA 2E26A 2EIEA 2XQXA 3T0DA 3C8XA 4A4AA 5B4NA 1CZVA 2Y6KA 1NAEA 3OGSA 4RN5A 3VD4A 3HJRA 2VZPA 4JX0A 3I2GA 3VDBA 3ACIA 1GUIA 4UI9L 2WO2A 3AC0A 3K77A 1US2A 1OH4A 2VMCA 4JKLA 4QDRA 2VTFA 2Y6HA 3NJXA 2X05A 1W99A 4QPWA 1RYYA 1UXXX 3P1IA 1JYNA 4E8CA 1SG3A 3U37A 1F4AA 3VD5A 5IHRA 3OEBA 3LPFA 2ZEWA 1H6XA 2RV9A 2B4KA 1OD3A 5DMYA 1UMIA 1ULOA 3I2FA 2QQLA 3K4AA 1XNTA 5DPNA 4MADA 1GU3A 1D7PM 3T08A 3PUIA 3HNMA 2ZEZA 3CQOA 4UAPA 1PMJX 3A22A 1JI6A 3VD3A 3DYPA 3HEIA 4QX2A 1CIYA 2VCCA 5JR2A 3FL7A 3LEIA 2C9KA 2J22A 1K42A 1JZ6A 4CU9A 2Y6JA 4ARXA 3MV01 4A45A 2PQSA 3FHQA 1GOGA 3I97A 5LCWL 3CDZB 1SHWB 5JXHA 2J1UA 4CUAA 5JXIA 3K46A 5LA1A 3WSOA 4DUWA 1WKYA 3C7HA 1JZ5A 5G04L 1KGYA 5EJZB 1GMMA 2ZXQA 2RJ2A 1W9SA 3W5NA 4CU6A 2E33A 3I2KA 4LPLA 3EB7A 3DECA 1JU3A 1W8OA 4BXSV 1F4HA 1K3IA 4DXSA 3OB8A 3FN9A 4FI9A 3I2HA 4KMQA 1NX9A 4BJ0A 5EIYB 4IUGA 2YFZA 3NQHA 4PT6A 2BGPA 4P5YA 5LA0A 3WNNA 2QQMA 2ORZA 3I2IA 4AG4A 2W1SA 2W91A 2DCJA 3WF0A 3IAPA 4DUVA 2V5DA 2W47A 5CZKA 4XUNA 2HLEA 2Y64A 3SEPA 3CZJA 5FUIA 3CIHA 3UNPA 3K4ZA 5IJRA 2VCBA 1JYVA 3WF3A 3NNGA 2YB7A 5J1XA 2VJXA 2VMDA 1DLCA 4QB6A 2VOTA 4JKMA 3IIIA 3DYMA 2VZ1A 2WDBA 3A21A 2WN3A 4DEQA 4CU8A 5C71A 2Y6LA 1O59A 1UXZA 1SDDB 3OG2A 2WUHA 4W50A 3I3BA 1MPXA 3UETA 1JYXA 1JZ3A 3LE0A 4CU7A 2YG0A 3OEAA 2BERA 1GOFA 4ARYA 4A44A 1YQ2A 1J83A 2VR4A 4DXRA 2XHNA 2CDOA 3T2OA 3WEZA 2JKXA 3IB3A 1UYZA 3W5MA 3E1F1 2YC4A 3THDA 4A6OA 4QDSA 2Y8KA 3I3EA 4XUOA 3WNKA 4TXWA 1UYYA 2VQUA
chains in the Genus database with same CATH superfamily
4ZS2A 1CAUB 1XNCA 3ZYRA 1CAUA 5IK7A 1LHVA 4DMIA 3ZYJB 4AFMA 2GALA 3M4FA 4GMP3 4Q4V1 2XG3A 1XYOA 1QJEA 1TG7A 4IE5A 3EMRA 2RDQA 4Y1UA 2CV6A 3RZHA 1AR71 1VBC3 2DU0A 5KXDA 3CJXA 1UY4A 4YZ2A 3B02A 2B9VA 5FDBA 1ULDA 2VOWA 5FP4A 3CZUA 1NLSA 4UW5A 1O8SA 2OZ6A 4JDNA 3POYA 1YQ5A 4LLFA 4QDQA 2FQPA 5F39A 3AZZA 3LD8A 1PO13 1W6MA 1W3VA 1UF2C 1YJKA 1W6PA 2VULA 3E5UA 2BZDA 3A0KA 4EWDA 3O1TA 4COUA 1W6NA 4K6BA 4AHXA 2VNRA 5D8AA 2HWD1 2W87A 4MGSA 5GLZA 1AYN3 1HV0A 3UT0A 4ES9A 3POFA 4P9IA 1MZEA 4MXWA 4WM8C 2P3YA 4OUSA 4E8DA 1Q8SA 3MFAA 2D3RA 2DYCA 5I8TA 3MGUA 3LEKA 2P3JA 3JXSA 5CKNA 1US3A 4D6SA 4K7JA 1H2NA 5CEHA 5DUVA 4OUEA 1UWWA 2V4VA 3WNPA 3ZIXA 1PGW1 3H9AA 4BZ4A 4KI5M 1RUD1 4LHKA 3MV11 4H3WA 4UXAA 1AYM2 3CLPA 4XTPA 5EYXA 1ENQA 4KWUA 5ISLA 2G4IA 2VZUA 4XYXA 2JG8A 4GMP0 3N3HA 3VD7A 5FPAA 5DUWA 1QNWA 4OQ9A 4DUXA 3ZXLA 4Q4X3 2WYFA 5CFCA 1FYUA 1UU4A 3TEXA 2TUNA 1HKDA 2IXIA 4Y20A 3UK9A 2P3KA 2E32A 2R32A 1UIJA 1HXS2 2XLFA 5LK7B 3ZXJA 3JUUA 2JE9A 1JUIA 3TN92 3VBSB 4JKKA 4IV1B 5FO9B 2WNVC 3WG4A 3NRUA 1ZM1A 3AKPA 5JOYA 3ZYBA 2W52A 3POIA 5EFUA 1UY0A 4D7SA 1BBT1 1ASJ1 4AEDC 5FTTC 1CONA 3L9JT 3IN9A 4LLOA 4NN0A 2WWUA 3KB5A 4HVRA 1MEC1 3V0AB 5FOJB 2LTNA 2W46A 4GB33 5BNNB 3IPVA 4YG0A 4QQ2A 4IE4A 3OGVA 2JDKA 1EAH2 1R1A1 2ZA9A 2DVBA 4QX0A 5F32A 3MF9A 4IV3B 3VHRA 4BOWA 4CEWA 1RUI3 1G86A 3ILNA 4XFIA 1AR62 4CXXA 5H9SA 1LENA 4AWDA 5I0SA 3UJOA 1H2KA 1SEFA 3J9SA 3NW4A 4Y3OA 5DAWA 5BNOA 3PIGA 3PJYA 1W9WA 2ZEXA 2YPDA 2EA7A 3NJZA 4GWNA 4JGZC 1HB3A 1RUF2 1MQTC 2ARAA 2DV9A 2XKOA 2ZGOA 3J7HA 2XJTA 4B8EA 1LR5A 2PYTA 2QCSB 1UIKA 3EHKA 1O3QA 2E7TA 4CEYB 5FYVA 2I74A 5KR7A 2JJ6A 3A0NA 1RGSA 1SLIA 2EF6A 3HT1A 2W2IA 3EXUA 1CVNA 2A6XA 1NQDA 1JTZX 3D0JA 1NA1C 4GD4A 1K12A 2X53S 2CNAA 3ZFFB 2J1SA 2JG8C 4NVPA 5A7PA 3H3ZA 1S0IA 3ZM8A 3W21A 3C7EA 5FZOA 1XPWA 1WMXA 1QDOA 1TVGA 1X82A 2VMHA 2D43A 2XJSA 4IEYA 3QH6A 5FZ7A 3WHTA 5A3PA 2RR13 4MG2A 3VKFC 1GOHA 3RWKX 4DY5A 3OPWA 5EZWA 4WM7B 4UFKA 3AKRA 5HCHA 2W9XA 2VZQA 5DAPA 4ZXKA 1UU6A 2OPWA 1DGWX 1H2MA 4XQ4A 5IAXA 4Q4X1 1LOFC 3POJA 5FZ8A 2XVKA 3CF6E 5CA6A 1OUXA 3I59B 3A23A 3PUHA 4NJ4A 1A78A 4RYDA 4D0QA 1QDCA 4RHV3 1OSGA 1OVSA 1HQLA 4M01A 3UGGA 2YGLA 4XFBA 2W68A 3ZN5A 5IVYA 1F15A 1BHGA 1QJU1 2LM3A 3RQ0A 4N43B 3SQOA 1DYOA 2EIBA 1KD7A 1LHOA 1IZ3A 4W4ZA 5KHIA 3VKOA 4O7XA 5GZFA 1D2QA 5FZ1A 1QEXA 2WZPP 3CBNA 3W59A 4D7TA 3OSDA 2V09A 4HKLA 1UU5A 4Q27A 1KDKA 5C3OA 2VZSA 1ND3A 3M2MA 2J1TA 1KDMA 2BGCA 4R9AA 3AMMA 3ZN4A 3WY6A 5JOZA 4Q4Y2 5H9PA 5H9QA 4Z2WA 1Q5OA 1AX0A 3OGJA 1DQ2A 2QDNA 2J1RA 4YPJA 3USSA 5BNQA 4LKEA 2GC0A 2MEV1 2WFPA 2K9ZA 1V6JA 4TZDA 1WD4A 1PX4A 3C3VA 4LHNA 1I5ZA 1FT9A 5GZGA 2A71A 3FHIB 1N1YA 2ETEA 3VDDC 3WZ1A 4FOYA 2A6YA 1W39A 3ZSKA 1BBT2 3ITQA 1GP6A 1U5YA 1XU1A 2XWBB 4S2FA 3KGLA 1AR81 3VBUB 2V72A 3K48A 1NE4A 2WINB 2VZTA 3GDBA 1OF3A 1RHI1 1YO8A 4FOVA 4M3CF 1N3QA 1BK0A 5E1RA 3QH7A 5EV7A 1URXA 4ZU4A 4AEDA 1CPNA 3ZKYA 1JYTA 5A7SA 4ITCA 1O8PA 1GFF2 3LIGA 1HX6A 5K4LA 2D97A 5A1AA 5C5TA 4BU2A 3SC7X 3H3UA 2QTWB 1ST8A 1R093 5DG2A 5FXZA 4JHTA 4AXOA 4P00B 3VB9A 2VVFA 1JHJA 4YVSB 3JQWA 3OYWA 2WFF1 3WX5A 4FPHA 4UFIA 1P8JA 1W3XA 2R042 3PLQA 4UOJA 2WZEA 1RUD2 1GICA 2ZZQA 1UD1A 1Q43A 2E9QA 5LY2A 4GKXA 4N9HA 5JMOA 2R1BA 3ACLA 2JKBA 3NV3A 4Y33A 1UW8A 5FUPA 3WF1A 4AVCA 1ND3B 4ZPIA 5BUVA 3S57A 1E5HA 1QWRA 1RJ7A 3RYRA 4B4RA 2CGNA 1H9PA 1ZA4A 1RUE3 1ZBE2 2LW8A 3OY8B 1DQ0A 4Y1XA 3U75A 3VLBB 4ZKTB 4CUCA 2O14A 4FPCA 1O5UA 2XKPA 1NZCA 1HXS1 3NJVA 1PMIA 4YGEA 5EXOA 4BH9A 2PHFA 1D0GA 1QGLA 5IVEA 4CEYC 3D6EA 3E6DA 4OCTA 3J8F3 4M3CB 5LASA 3WDVA 4D69A 1AYM3 3N35A 5FK7A 1PGL2 4JC1A 4WVMB 3K4DA 3VD9A 5KXBA 4XMAA 4Q0QA 5FLHA 5FY9A 3THTA 1RITA 3ZXAC 4DFSA 2DWRA 2PHWA 1J58A 3PMSA 1R1ZA 1WWYA 1RUI1 2XH6A 4DB5A 5FPUA 1S4CA 2C0ZA 1TMF1 3AP9A 3NNFA 1O5LA 4GB31 4AAPA 1ULGA 5FPXA 5LBEA 1X8EA 2VZPA 5FZ9A 1QOTA 5K0UB 1NT0A 1RXFA 1AX1A 5LEJA 4IEPA 4UI9L 4I0BA 4YM2A 5KHJA 2WO2A 2H6CA 1XB9A 1RUOA 1J1TA 1RUH1 2VMCA 1OH4A 3GZEA 4JKLA 5AC92 1RUJ1 4QDRA 3JBG3 5J3UA 5FP9A 5KHKA 4XDQA 2WJSA 4G3YC 3POBA 1QQP1 4FXKB 4YZ3A 3WG1A 2Z42A 1W99A 1IS5A 1ZBE1 1LCLA 2A70A 1WMFA 1RUG1 4EWAA 1L3JA 5CADA 1FAYA 5FLJA 3N7JA 1SG3A 3B69A 3KF5A 4Q4V2 5ABJC 1UYPA 3VD5A 2WS91 5SV8A 1UQXA 2ZHLA 3RJRA 2EXKA 3UL2A 3LDKA 2VMIA 1AXKA 1CQ9A 3KHBA 4CDWC 1OLRA 2RV9A 2VBBA 4QMAA 4AGGA 5A1LA 2B4KA 1KITA 3GZUC 1LHWA 4CCNA 5FY4A 2NM1A 2FBEA 3INAA 4OHVA 1KJRA 4EQVA 2DCTA 2XJPA 5GZDA 2VPVA 4FPGA 1SLCA 1OHFA 4BMBA 4COVA 3V0BA 2RS51 2ZGUA 4ASKA 2JDYA 2XL7A 3S7IA 1WLCA 1T6GC 2E53A 2VBPA 2PHTA 1TZOA 4E4SA 3ZXEA 3CQOA 4H55A 3E6BA 4UAPA 1LOFA 1PMJX 1LGCA 1ZRFA 1Z78A 2D6PA 3P5BA 2FMYA 1PO11 1EV12 4W6WA 4LORA 4LR4A 2ARCA 3FL7A 4A6SA 5A70A 2BQPA 5CFDB 5FZHA 3OPZA 3WCSA 1DQ5A 1RVF2 4IGQA 2HYKA 2IVIB 4EZ4A 4ARXA 3MV01 2ZMLA 1MZFA 5L9BA 3I97A 1RTVA 4N53C 1BBT3 3AKSA 4XC9A 5LCWL 2DUOA 1OMIA 4RHV2 3ZIWA 3ZFEB 4LO5B 2X5IC 5FBJA 3RMXA 4DUWA 5LA1A 3C7HA 1BZWA 1YIPA 5JR7B 1PVXA 1F8VA 4QGNA 5F3IA 4CZSA 2DBNA 4MZUA 5AVPA 4AFCA 1GMMA 2QVSB 3AYCA 3WT3A 1SLAA 3BU7A 4OHWA 1OKOA 2E33A 2E51A 1CJPA 1W03A 2CGOA 2K2SA 3I2KA 4LPLA 1KRIA 4NWVA 1W0PA 1S0GA 3LZZA 5T5OA 3AP4A 4AZZA 1JU3A 1YWKA 2AGSA 5ACA2 4KNCA 4BXSV 3BI3A 2Y26A 4FPOB 1QJFA 1DIWA 1MS3A 1EY2A 3FN9A 4N7UA 1VBA3 4BJ0A 3H8UA 2YFZA 1WLDA 2B39A 2UWBA 1STMA 1W05A 1UOFA 1RUF3 4MX3A 1OXCA 3HQXA 3TRSB 2BYVE 1VLNA 3BOWA 4UFJA 3WNNA 1IPKA 1N1VA 4NE9A 3OPTA 4XF0A 4ES8A 1W2NA 3A4UA 3AVRA 4NPMA 4KBBA 1DQ4A 3BALA 4RD7A 2OW4A 4KWJA 2V5DA 3PVBB 2YXSA 3MIBA 3VBUA 3AFGA 2YBSA 2YU2A 2HLEA 1RUH2 2WO7A 2Y64A 3NNJA 1SZBA 4DINB 2MNGA 2AUYA 1W8ZA 4XDPA 1LOBA 5A6ZA 2GC2A 4TSVA 1C8M2 1VAVA 3MEPA 2RR12 5E88A 1IGOA 1O4YA 3JD72 5I0TA 3WR0A 5J37A 4HANA 5CG8A 3ME2A 5IUQA 2Y6FA 4AVSA 3S0MA 2XDVA 4FTSA 5C8CC 1A34A 4QU1A 1WLTA 2R30A 3RSJA 3PIJA 4V1PA 4GA9A 4IEWA 3NNGA 4Z92B 2XR4A 3IDCB 4AHWA 5FYYA 4QM8A 4QGLA 1FOD1 5J1XA 4WM7C 3BVCA 3DKQA 1GNZA 3DEMA 3NV2A 3W9AA 1OI6A 4AI9A 3U0ZA 3I2DA 4YW6A 3VL8A 2SLIA 3H1WA 4HN0A 4XBNA 4BYYA 1DGLA 1SCRA 3AP6A 4QB6A 1LU1A 1E5RA 2P37A 4AHYA 2ZX0A 1KQRA 1CAXB 4EE2A 3PVOA 2RS32 5FYCA 1GKBA 1RUE2 4GJYA 2ZABA 4JTNA 4K21A 2BU9A 4CU8A 2JD4A 1FMD2 2RS13 2Y6LA 3TBDA 4IETA 1UXZA 2Y38A 1NA1B 3OG2A 4YZ5A 1FX5A 4U2AA 2D6OX 3ZFGC 3PUSA 4I01A 1SDWA 4OFGA 1Q56A 5FZ0A 1BJQA 4Z07A 3VZNA 2ZGTA 4HBNA 3G6JB 4FOWA 2YG0A 3OEAA 2OYZA 1ASJ2 4YW4A 4NHXA 1D4M3 1W0OA 2C6SA 1TEIA 3CL1A 3OBRA 1JOBA 3OUJA 1YQ2A 1FV2A 1NG0A 1GZCA 1ND2B 3GCWA 3PTYA 5FPVA 4YW2A 3KHCA 2VR4A 1U12A 2YDEA 1VR3A 3BTAA 3KS7A 5F1RA 4DXRA 3URFA 4PBOA 2XJRA 3VBOC 1MS8A 3ELNA 3DPRB 3HQUA 4GWMA 4OI2A 4W65A 5FZ3A 1PZ8A 1QH7A 2GSYA 3H0OA 3Q8CA 4P9XA 4EROA 3BU0A 3I3EA 4RR3C 1EYBA 4HN1A 3WNKA 4Y1YA 1UYYA 1EV11 5EJZB 4FQ4A 4LUKA 2JX9A 2TNFA 1ZRRA 5A33A 3T2TA 2X09A 1XC6A 3PMEA 4YFZA 1WW7A 1CWPA 1Q8VA 3LOIA 3NMBA 5IT6A 3RZKA 1N3PA 4CCDA 5LZ6A 2BVBA 5J48A 4LHSA 1F31A 1O91A 4WZFA 4R9DA 1YRZA 2JDPA 4V2VA 1ULPA 4YGDA 2BJSA 5FZCA 1AR92 2OA2A 5KBFA 1DQ6A 3BGAA 3SEEA 1QXRA 2WQ4A 2RMU3 2UYAA 4XAAA 5IWFA 4QKFA 2P6HA 1JH5A 3OD0A 3NNLA 4LBKA 3R4SA 4P9WA 4IGOA 3ZPOA 1K45A 2UYBA 2JDUA 5CVRA 4XUQA 3LA3A 5DDJ1 4M4PA 1GNYA 3LDRA 4FVVA 3A7QA 3Q8BA 3SLIA 2BGOA 3VBSA 3H8XA 3R4DB 5FLIA 2BTVC 4OHXA 5AFEA 4NOTA 4XOGA 3WNMA 3GM8A 2TEPA 5EJ3A 3WF4A 4HVQA 2VTXJ 4L8QA 3JB4C 1NY72 4HONA 1WCKA 3B01A 4QQPA 2ZACA 1VBE3 3FWEA 5F37A 1W8NA 3E5QA 4MGKE 5BNOC 3MIFA 3VGIA 3GJBA 2XLAA 2JG8B 2HEVF 2AACA 2IXLA 5LW9A 3E6CC 1PX3A 2ORXA 4LO7A 2BBAA 3WF2A 4D7YA 3LAGA 4FPKA 1XYPA 5JIUA 2RM23 2UY9A 3FX3A 1RUNA 2WS92 5JPNB 1MZ6A 3HIFA 1EV13 3J8F1 5C7GA 4WVZA 1AJOA 2ZX1A 3OCPA 1ND2A 5CFCC 1GWMA 4R4ZA 2YFUA 3IPVB 4GAZA 3BODA 1L7LA 4F7ZA 3ZYPA 3POWA 5FWJA 4IEVA 2V5YA 2XVLA 3V65A 2HWB2 2OQ6A 3ORJA 3ACGA 4BPZA 1BMV1 2CYFA 4ZU7A 1POQA 4XDOA 2Q1FA 1RIRA 3ST7A 4CUGA 5A3UA 4IV1A 1LEMA 4HFSA 2JE8A 3DN7A 3RNSA 3MICA 4BLJA 3MI8A 4ISRA 1H2LA 5D8AB 4FFGA 4LBLA 5FZFA 2XOMA 1V9U3 4B4QA 1UKRA 1HQWA 5C4WC 4K8RB 1O3RA 1NCQA 1U5XA 2LALA 4Q4V3 4QX3A 1HRV2 3FC0A 4R52A 2VE1A 1AXZA 4XJ9A 4XIKA 3T3YA 2EAAA 1RMU1 2W92A 4JGYB 2RVAA 4MGQA 4QPIA 4B3NA 3RZZA 1IS4A 3NAPC 2WO1A 1G9CA 1PVC1 4EN6B 2FCTA 3PU3A 4MLOA 4BQ3A 3WQBA 4LKSA 1XSQA 3MW3A 4L99A 4B7EA 1AR83 3DL3A 2WWSA 3U07A 5JXJA 3KT7A 3PUAA 1Z7S2 4QHZA 3BOPA 1YNAA 4LNVA 4MXWB 1J1LA 2JEMA 1CR7A 2ES3A 1GNHA 3KVAA 1W2OA 1NUKA 4H2AA 5D8AC 1GZTA 2GNMA 5FPBA 4OMDA 3TAYA 4CP1A 3AZWA 2HWE3 4CPBD 3MZHA 2UWAA 4BK4A 2CWSA 3OBAA 3USUA 1VBA2 2GP3A 3VBOB 1IPJA 1RUG2 2MPFA 3I7DA 4XQDA 1DYPA 1XSRA 2QQPA 1UZ0A 2WLPA 3HN1A 3VBRB 2D6LX 5A7WB 1LRHA 4QHOA 2WFF2 5GLUA 4IEXA 4M0HA 4QB2A 5FZGA 2KD7A 2VOVA 3U4XA 3WNLA 5FKBA 2Z4FA 4FPLA 5HXVA 1XU2A 4LTAA 1A8MA 4W8JA 3OOXA 1YFUA 2WT0A 3M70A 2GH2A 2RM21 3O1MA 5A32B 1DHKB 5GM0A 5I0RA 2NMOA 3LIHA 1W0NA 3GHMA 3HOBA 3MIHA 3BB6A 4XFAA 3MLJA 2YROA 2Q4SA 3ON7A 4P9GA 5K7PA 1QH6A 4GH4B 5C4WA 3X29B 2LROA 2WAOA 5GZEA 3ABZA 2N7GA 4AAXA 4AEMA 1E5IA 2IXKA 3LA7A 2PAEA 1DGWA 1R091 2VNVA 1AR72 3HBZA 5FZLA 2DDUA 2D3SA 3VZKA 2K0GA 2WBKA 3CJIA 4XQWA 3THCA 3UKVA 4YARA 2ZGNA 5IVBA 4LOTA 2D3PA 2DCYA 3JB8A 2UY8A 2Q0AA 1RUJ3 1I5PA 3O0WA 4GALA 4RS5C 1ZX5A 2A1XA 2YC0A 1RHI3 1EUUA 4P9JA 4P02B 2X10A 2I07B 3VZLA 4AFDA 2WAAA 3ZFFC 1ZYBA 5FZDA 4R4XA 4LQRA 3TYJA 2IXCA 1C3HA 4EN9B 4FFHA 4AR2A 2CDPA 3FMGA 2XLGA 2OKXA 3FFQA 1POV3 2CGPA 1FMD3 2Z79A 3CJIC 3HD8B 1VRH2 4D6QA 4Q4W1 3WQ0A 1GP5A 4LE4A 2Z5WA 4QPGB 2BNMA 2L9LA 2WNUB 4M00A 3K51A 2XJVA 5A7OA 1O3TA 2HKXA 3EJKA 1V6OA 2RDSA 5HPOA 3LPGA 3T2PA 3PTRB 1HJFA 1NKGA 2W1QA 1UPIA 3F2ZA 3M1HA 5JXGA 4ONUA 2VO5A 2G19A 2XONA 5F2SA 5IW0A 4I02A 5L9RA 5JAXA 2QQIA 4CDUC 2VZVA 1VJ2A 2SBAA 3THPA 3O14A 4HOOA 2ADEA 1AXYA 2R061 2WA4A 1DZRA 3BPZA 1OOPB 4HKWA 5I91A 3V56A 2O8QA 2CU5A 1ENRA 1R1A3 3NO8A 5CNAA 5I0UA 4CUBA 4P9YA 1HXS3 5FY0A 1NZIA 3RRDA 2R7EB 1WA4A 4NROA 4BQ5A 3TOJA 1MEC3 2WABA 2YC2A 3M3EA 2C26A 5FZKA 4YFWA 5IFPA 1OKQA 3UKNA 4SBVA 1FNYA 4MGIE 4Q8LA 2JE7A 2JDAA 4YGCA 2JD9A 2PLV3 3DPRA 1A8DA 5L7OC 1OLME 2W3JA 3AMQA 2ERFA 3ILFA 4QQOA 1UY1A 1JUHA 3PVNA 1QQP3 3J7LA 4PDWA 1HLCA 5FCCA 2B7YA 2ZGKA 3DUIA 3F95A 2O1QA 2WKKA 3ZFGB 2C24A 1JYWA 4CTEA 5T50A 1W8TA 4N53B 4XUTA 4ZONA 3TNQA 1JZ2A 2D6NA 4Q4Y1 4TLFA 4UBGA 3H7YA 2VCMA 1CD3G 3ZO0B 3RWNA 3MIEA 1S2KA 3P3NA 3E5XA 2XQXA 2ZZJA 4HXCA 3T0DA 1AR61 1FOD3 1ZVFA 1ULFA 4NO4A 1HN0A 5DABA 2JDNA 1WUVA 2Y6KA 1U5ZA 1NAEA 4RN5A 4WVMA 1HW5A 3ZSEA 4Y1VA 1GQGA 2PFWA 5JPMB 1VE0A 3QBQA 4LK7A 2A75A 4C1WA 5FMBA 1S0JA 3D5OA 1A6CA 3AYAA 2WSUA 2JDMA 1LKNA 3ATGA 3KQ4B 3VDBA 3W58A 4BB3A 1AUYA 1AYN1 2NP0A 1XBFA 4CDUA 5FJKA 4E4ZA 3V64A 5DUUA 4X8NA 1YC61 2RM22 3ZYIB 4HL0A 3NJXA 2XBO1 4RQPC 4CCKA 5FY1A 5A7QA 2R16A 3AZVA 3VBHA 3SISA 1YCIA 3QACA 1RYYA 1I9RA 4QGMA 1JYNA 5J36A 1PHMA 3EO6A 3U37A 1F4AA 2WNEA 3FZ3A 2RMU2 3WXPA 4A2UA 4XE9A 1QJY2 2ZEWA 2DCZA 3O1SA 3WD5A 1DZQA 4FPFA 2WNUC 4QPGC 1VBA1 2OUJA 1Q8QA 4QHBA 4IEQA 3BIWE 4PLOA 1ALYA 4PLNA 2ZGRA 4Y26A 5CIRA 2Y0IA 3G7DA 1IKQA 1UZVA 4IE6A 4I3GA 1N1TA 5DPNA 4AEDB 1YFXA 1QXJA 5J09A 4CDXC 1RUI2 1H4GA 3KCXA 4YLZA 5JI7A 1V9U1 1LOCA 1CAWB 1WCDJ 2VW0A 2WRAA 3I59A 3MW4A 5FYTA 4OI1A 4LBQA 3ZDSA 2ZEZA 4RS5B 2BBVA 1IG0A 3HQRA 2HWF3 4P14A 1RUD3 1RXGA 4Q8KA 3T4HB 2X5IB 3DYPA 2MHFA 4Y5TA 3ZFEC 5F3CA 1CIYA 5JR2A 1OA2A 2CSGA 1C5IA 3LEIA 1WZXA 5JMCA 5F8PA 2C9KA 2J22A 2BFUL 2R073 1PVC2 4L9BA 4XCBA 2VVDA 2B45X 5EP9A 4DZGA 4ASMB 4CU9A 1JZ6A 2Y6JA 1DF0A 1X9TA 4W6YA 5I93A 2CTVA 4QD2A 1Z7S3 1HV1A 5LWBA 4DNYA 1VB2A 4LO4B 2ZGPA 2XXZA 3KZ4C 2GAUA 1VRH3 4CUAA 2OQ7A 2PTMA 4XHXA 1SBFA 3WSOA 2O8OA 5FMOL 2EIGA 4LMFA 5FP8A 3I4IA 1VBD1 2P34A 4DPNA 5LRRA 1V6NA 3FLRA 2QQWA 2Z69A 3HMYA 1AHSA 3AB0A 1W9SA 5LATA 3IMNA 1ND3C 1DLLA 1C4RA 3H3LA 5HCFA 1UZYA 1C5HA 4Q29A 4A7YA 4FAGA 1VRH1 1AR73 2FZ1A 1MVEA 2VUCA 3GZTB 2RS31 1F4HA 1G9AA 1HRV3 4LUMA 4BWOA 1K3IA 2J42A 4DXSA 2R043 3CEWA 4BLIA 2JDZA 3ZXGA 3I2HA 1NX9A 1W6QB 1X50A 2K46A 1ZZ8A 4IUGA 3IM0A 3H50A 5LA0A 1QJX2 4CEWB 5K9YA 1IS6A 1OQ1A 3IKWA 1RUC3 3MPPG 4LEJA 4QPGA 4YWAA 5EWSA 3I2IA 3VV1A 4EYUA 4ISQA 3WV6A 2W1SA 2GNDA 3LEMA 1ODNA 2WT2A 4LHLA 1S0EA 1OVPA 2PELA 2AENA 4E9KA 3IAPA 1GQHA 4M3CE 1RL3A 3L2HA 1LGNA 2JWPA 4QU2A 2IC1A 4CDXA 2VNGA 2VUDA 3WVJA 1BXHA 4CRQA 5IK4A 2NZ9A 3AJYA 4F8AA 3BYWA 4LBMA 5CZKA 5T5JA 4MVTA 3ROUA 3VHPA 4XUNA 1CJDA 3NAPB 1PIV3 4MHUA 3WDXA 5C9AA 3FE5A 4Y22B 1WCUA 4GKYA 1NOVA 2TBVA 3J8F2 4DRVA 4NRPA 4RGGA 2BFUS 4Y1ZA 2ILMA 2E63A 3LSEA 1B09A 2F4LA 4UF0B 4BIFA 5IJRA 1GANA 1RMU2 4XFGA 1CIWA 1JYVA 3I3QA 3WF3A 5T52A 1XJAA 5F5AA 1OPOA 1NY71 2IFRA 1SLBA 1O4TA 3M7AA 4FFFA 1UZWA 4CYDA 4JQRA 1SQ4A 5LBFA 2AYHA 4NAOA 5K0UA 5FQ0A 1HQNA 4C1XA 1ENSA 2BP6A 4JKMA 2GH8A 4YM3A 3ZXDA 1Y7BA 4AVTA 3AP7A 3LB9A 2GP5A 3DYMA 3POSA 1PNFA 4K1YA 4E2QA 4BQ2A 2PLV2 1H8TB 4X6QB 4NIAA 5C71A 2PQQA 3BTYA 1O59A 2ZHKA 2BW8A 1K5MB 3RS6A 3H8OA 1YLLA 4AQ6A 2HWE1 1XE0A 3I3BA 1WD3A 3VZJA 3J26N 2C1FA 1V6IA 2F4PA 3UETA 5KC5A 2JG9C 4B1LA 1JZ3A 4NHYA 1S55A 5FBZA 5JOWA 4M3CA 1GOFA 3GBFA 3KGZA 5CBLA 1QIQA 2RDNA 1J83A 1VPHA 3OD4A 5I8YA 4H7MA 5DZFA 4AI0A 5A6QA 1WBLA 2ATFA 3MLLA 1W8HA 1EPZA 4GMP1 3FBYA 1W8FA 4LOSA 2FMDA 1AR63 1OD5A 2XHNA 5A3WA 2GU9A 4HT1T 3E1F1 4LJHA 4S2HA 2YC4A 4JAAA 4A6OA 4QDSA 4UFHA 4HMZA 4JZRA 5CU1A 5BYNA 3H8RA 4GH4C 2VQUA 1LESA 1HJGA 1W06A 2WQ8A 4YM1A 2VAUA 3ZXKA 4FQZA 2GDFA 1W28A 5LY1A 3ZN6B 4WVVA 4J1XA 1JZ8A 3VHNA 5FR3A 2IXHA 2VVEA 1WMEA 4LKDA 4MO3M 5HCBA 3RDIA 4NIHA 1F9KA 5FKCA 5FFOC 3ZSMA 1D4VB 3CKHA 3N7LA 1CX1A 1DP0A 1VAKA 2WO3A 3HAGA 4IQPA 2F6BA 4Q4W2 4XF3A 3VBUC 4BCUA 4A3ZA 1GR3A 1UKGA 1W6NB 3VKLA 1JYIA 3T2QA 3VBRC 3RGBA 3DF0A 3HT2A 4YNIA 2HWD2 1OF4A 1MEC2 1J3QA 5HV0A 2MEV3 3KWVA 3WP4A 2PAMA 1NLQA 4IV3C 4XUPA 3RI9A 1DBNA 1JYCA 1UZZA 2VZRA 4IGPA 1BVVA 3U1XA 3VDCA 4AW7A 1KXGA 2QQNA 1BLZA 3RYPA 1ZZ7A 2IWGB 2H0BA 4ZZ5A 3SKVA 4CXYA 1LNSA 3AZXA 2J1EA 4KBZA 3PNAA 5F5IA 1F35A 1LTEA 2VTXA 4K40A 5EJ1B 2I2SA 1XQNA 5FY7A 4KH9A 4QB1A 2R49A 1AL21 5CG9A 4COWA 1NQJA 4FO9A 3O1VA 5KHHA 2ZTNA 4JGYA 1AL22 4Q5OA 3WQ1A 4ZS3A 1YUDA 3BIEA 1HB2A 2JICA 4UWDA 2VOKA 4NHLA 3RPQA 4DEVA 5EYYA 1T2XA 4CP9A 2IXJA 4RHV1 1B35A 4XF4A 3KT1A 5A7NA 4FP2A 4GWIA 3ZX7A 1AL0G 1BK1A 1W8UA 2RG4A 4OYUA 1SBDA 1W9TA 4N43A 1W9FA 4AHZA 4L11A 5DUXA 4AI3A 4PQQA 5C8WA 1PK6C 3PJQA 1NCRB 1V00A 4XEZA 1XE8A 1KJLA 5JDBA 1ZRDA 4DXTA 1ZNPA 2XL9A 4V2WA 5FREA 1JODA 5ACA1 2VG9A 2ZEYA 3VKNA 5LRSA 1UX7A 4URTA 3LDBA 1UO9A 1YFYA 1WCQA 5C8CA 2VGDA 3DYOA 1UOGA 1C1FA 1TE1B 1VP6A 2PLV1 1F5FA 3V0BB 1ULCA 4GIQA 5FMDA 5A3TA 1C8M3 1CPMA 3MF6A 2HWF2 4N7IA 4PQ9A 4IESA 2A6ZA 2XUMA 1WMDA 3IDAA 3M3QA 2YBPA 5FZEA 5FO7B 2VXJA 3FUOA 2FHRA 1H6YA 5C3SA 4XHBA 2WZR3 5JSPA 5DN2A 1H4HA 2P17A 3LFIA 3KV5A 2BPA2 2VZOA 3CMGA 1LODA 2UWCA 3MYXA 4CE8A 2YMZA 2R063 4CCOA 2P4EA 1RINA 4Y5SA 4EN8B 1OBNA 1DGRA 2VMGA 5A33B 1REEA 1S2BA 4TN7A 5FP7A 3NWKA 3ETPA 5DAQA 3NAPA 4FOQA 1PK6A 4IE0A 5T54A 2VBDA 1S0CA 1UN1A 4SLIA 2ZAAA 4UW4A 3LEGA 3Q8FA 5FV3A 5T5PA 1M4WA 1VBD2 2VXRA 1KS4A 4HG6B 1H9WA 1LOEA 3GALA 4IL7A 3D3AA 1TNRA 3B9CA 1H8VA 1POV1 1LEDA 2BWCA 1COV1 3JZVA 4K20A 4QX7A 4CP2A 1BMV2 4OZXA 3ACHA 3LQCA 4NPRA 4XVHA 2GN7A 1ZBA2 4JGYC 4CDXB 4J1WA 2XBO2 1PM4A 3IMMA 2A6WA 1ASJ3 4A7KA 1F5JA 2XWJB 4AFAA 5K8SA 3PVEA 4R9CA 3RYKA 4MOAA 1JU4A 1QMJA 4YZ4A 1H0BA 3S6PA 2IZWA 3I8TA 2RMU1 2E6VA 2X5IA 3Q8EA 4IE7A 1NA1A 4CCJA 2OT7A 4ASLA 2NQYA 4PLMA 4YSFA 5KXEA 5FWEA 1TMF2 4JDMA 1QKQA 4HPKA 5FZIA 1COV3 2EALA 1O4ZA 1QJZA 4YG3A 4HSLA 1CZTA 3WW1A 5C3PA 4O65A 2ZHMA 4LBNA 3U11A 4NIIA 3I3DA 1PIV2 4PI0A 2JXAA 1O3SA 4LULA 2FDHA 1QHDA 4BISA 2VCAA 1EUTA 1ULEA 2QDRA 5CKQA 5JCTA 1VBE2 2CAUA 3DKWA 4LITA 5DDJ2 4J6GA 5CFCB 2VC9A 5LA2A 4RSUA 1PGW2 1AYM1 4LBJA 3OGRA 3HN3A 2ZMNA 4P08A 1JHNA 5D21A 3KM5A 1DG6A 3WINE 1VIWB 2ZKNA 4IEZA 3OBZA 4XZUG 5ANNA 4C0BA 2G9GA 1Z7S1 3ZOIA 3VBHB 1SFPA 3PU8A 4XJUA 1XNAA 4F83A 2Y6GA 4KU8A 3VZOA 3RI8A 1LULA 3ZSJA 2XQRA 2XHKA 5IVFA 1OFSA 3FHAA 4O61A 1JZ4A 3ZMOA 5BNPB 2DFBA 4YRDA 1UY3A 2QJVA 2CAVA 1UMHA 1W9YA 1QJX1 2ZKLA 3LSDA 4Q0PA 4XF1A 1ACCA 2D93A 3ECQA 2YU1A 1GZWA 4HK9A 4XMIA 5DG1A 3T1LA 2ZX4A 2D5HA 4L92A 2QE3A 4YVSC 4QQHA 1RJ8A 4G4FA 4DQAA 4EV0A 1AR91 1VBC1 1WCSA 1CZSA 3UESA 5HI0A 4EWEA 2CL2A 3PURA 5JUVA 1W6MB 5JLVA 2J1VA 4AGRA 5ABJB 1OLQA 1FNZA 1QF3A 1LU2A 1SLLA 2R6QA 3BTXA 5FYZA 2VM9A 3RZLA 1IQDC 3MFCA 1PNGA 1Y9GA 2P5BA 3VDAA 1RMU3 1WA6X 2BV4A 3AKTA 1H30A 3L2YA 1CAVB 4D3WA 1XNDA 3WCRA 3WP3A 2H6BA 1HRI1 2DF7A 3ES1A 4ZU5A 3ZN6A 5J7MA 2OUHA 4HVOA 3T09A 2WLQA 4XCAA 4TTGA 3LKJA 4GWJA 5LB6A 2J7MA 1S0FA 5LK5A 2G1MA 3H1MA 2VU9A 1D2SA 5A80A 4AI2A 2FDFA 2HWC2 4CDWA 1I3HA 3KV6A 3T0AA 5FRAA 4CDUB 3DPRC 1C1LA 3C7FA 5CYYA 3HBKA 4YW7A 4AOCA 1EP0A 1JW6A 1UPSA 4MV2A 1HN1A 2WIIB 5SV5A 3VN4A 4ATEA 4CCMA 1AX2A 2OVUA 3B93A 2EIDA 4HETA 4Z82A 1V9U2 4TWTA 5A1FA 3K3NA 1UL9A 4PBPA 3WDTA 1FI2A 2Y34A 3NSTA 2ZAHA 4HZFA 4I3PA 1UAIA 1QJY1 4S2DA 1LB2A 2CY6A 4FXGB 5F5QA 4CCEA 5KXCA 1GBGA 1EPWA 2E26A 1ZRCA 4XPVA 5FPLA 2FZ2A 4XBLA 5L19A 2WNOA 2WZR1 2VW1A 4QWNA 5CB7A 3C8XA 5IVJA 4A4AA 1DZTA 5B4NA 1H8TA 4Q26A 2ARBA 3N9OA 3Q9OA 3VD4A 1VBE1 2ENRA 3C2UA 1C8M1 3WOGA 1A3KA 3E97A 3HJRA 4JX0A 5LBCA 1OFNA 4XJ8A 3ZDVA 1BEV2 3ZFGA 4YGBA 2WT1A 5B2GB 3ACIA 5APAA 3AK0A 1LECA 1TQ5A 3WP6A 2FCVA 4QPYA 5A6XA 1DDLA 1QJU2 1IS3A 3K77A 2AEZA 5FY8A 1YQCA 1OQDA 1R082 1VMJA 2BNOA 2X8KA 1SACA 1JBCA 2RR11 3BPSA 2ZGLA 2Y6HA 4E4HA 1RUH3 5CFDA 1RUJ2 2P6CA 4KU7A 4CEYA 2VOXA 2X05A 2CWMA 4DRRA 3B94A 2GC1A 4B4PA 1UXXX 2CHHA 2JG9B 3JD73 3P1IA 4AVBA 4BQWA 2V73A 4Y22A 4Y4RA 5IHRA 1Q8PA 4X8PA 3LPFA 1OOPA 1TMF3 1S0BA 2ZGQA 5L73A 2A73B 2VH9A 4P9LA 3S5AA 1H6XA 2QQUA 3NJYA 2A6VA 1GWLA 1JS9A 1MVQA 4QXKA 5L7OB 1S1AA 3GBGA 4PJYA 1Q3EA 5F9TA 3O1UA 1S2EA 3MIDA 3LGRA 5E89A 3VBFB 4BQXA 1NXMA 3AXEA 5IATA 3O1RA 2RS52 2XVGA 3D4KA 2QQLA 4Q0SA 1OA4A 4AI8A 5L36A 3V0AA 1VBD3 2HH9A 1XNTA 2Q1MA 4BA6A 1VBB1 5C3RA 1O6UA 3N9NA 1D7PM 4MADA 4UW3A 4Y24A 4PIYA 5GLWA 1U5IA 4KQ7A 2W0XA 3PUIA 4U36A 1OOPC 2D98A 3HNMA 3IT8A 4G9SB 4QX8A 3SMHA 1LOAA 2Q8OA 3ZXFA 4RGAA 1ZBA3 3S30A 4A7ZA 4CP0A 1SFNA 3ZVXA 1IPSA 1FMD1 5J98B 2JG9A 4I0WB 1JI6A 1PZ9A 3NV4A 3VD3A 3HEIA 4QX2A 4YYOA 3SH5A 3UYJA 5JI9A 2P3IA 5DZGA 1UX6A 2ET7A 1PO12 1H1MA 1ZZ6A 4UYBA 4JQTA 3M8LA 4FPEA 1RUF1 1R081 2WSVA 1W8WA 1MR5A 3O12A 3USUB 1IKPA 2HBTA 4BIOA 4AE2A 1K42A 1YEWA 1FPN3 3S5QA 4A45A 1RVF1 4CP9B 2PQSA 5KHGA 1ZBE3 1GOGA 2YPJA 1LGBA 3CJIB 5JXHA 2HWC1 2BNNA 3MDPA 4YM0A 1HRI3 5JXIA 2GNBA 1BKZA 3K46A 5GKAC 1WKYA 4XZPA 1LHUA 3FJSA 4XETA 1OLMA 4HSJA 1KGYA 4CCLA 3B00A 4ORFA 4BHPA 4LKFA 4URAA 2PHRA 1CAVA 5JVVA 2DVGA 2FDKA 2W08A 1OC1A 2RJ2A 3OF1A 4YW5A 5GJ6A 1RUC1 1FV3A 5A3OA 3OYWB 4DXZA 1DYKA 1TME1 4XFHA 4CU6A 5A32A 5CFDC 1SBEA 5IK5A 3AYEA 4GULA 2BEOA 1VMHA 4LO6B 4META 5A7WA 1W8OA 1E57A 3D82A 3H7JA 1OA3A 1CAWA 2HEYF 3OB8A 1R1A2 2EXJA 3VDDA 4FI9A 1N1SA 4KMQA 4E27A 5EIYB 2BUKA 2FCUA 5FYHA 3NQHA 1YIFA 2BGPA 3AM2A 1ZZ9A 4ZHNA 1OURA 3VHOA 1KFXL 3B3QE 4AEJA 4AG4A 1O7FA 2DCJA 3TN93 2C5DA 4IW3A 3WF0A 4BQ4A 4QPIC 2Y60A 1XYNA 1ZRIA 1PO21 2YBKA 4AEKA 5TSWA 4XFCA 4XTMA 4DUVA 1W90A 2VECA 2W47A 2JB4A 5C9AC 1QQP2 3JBG2 4FFIA 4JGZB 3RZMA 2Q8CA 4D6RA 1G9FA 5GALA 3WDWA 3R0RA 1T6BX 4GB32 4PF5A 1JOPA 2WR9A 4OI4A 1F2NA 1G6NA 2JENA 3CIHA 4LE3A 5KC6A 1RB8G 4LT5A 2LUWA 4HKOA 3GCXA 5FZAA 2D7FA 5DXDA 4AF9A 4YVSA 3CHXA 5H9RA 1HIXA 3FLTA 3CU7A 4N8MA 4R9BA 2E7QA 2AEYA 3R4UA 5A3NA 4FAHA 3LOBA 4KG0A 4DS0A 4PIXA 1JN2P 1NCQB 2VJXA 1PGSA 4EJRA 3SH3A 2Y33A 3NKGA 2AC1A 4XXPA 4CDQC 1DLCA 3ES4A 3N9PA 2VOTA 1BEV3 1UOJA 4UFLA 4AK3A 3KMHA 2QUOA 3TEYA 3GF6A 3IIIA 2HWC3 2VZ1A 2Z2SB 2WDBA 4B1MA 4C8DA 4IV1C 2A7AA 5FMCA 3VBSC 4AYUA 1LOGA 2Q30A 1Q8OA 3WDYA 2W39A 1SDDB 2WUHA 5FZ6A 3GJAA 2QFEA 3GZAA 4W50A 4NWWA 4AQTA 4CDQB 4WM7A 4LO8A 4CA9A 1X9PA 2YV8A 3TWIA 1D0HA 1NCQC 4CU7A 2WNVA 3IBMA 1NE6A 2BERA 4UW6A 1MS0A 3J7MA 1QOOA 2R072 4RQPB 4XJZA 4ARYA 4CEWC 4A44A 2IFWA 4NHKA 4COZA 2R041 2KA3A 4XAEA 5FZOB 2DVAA 1HRV1 1QOSA 3NVCA 3LWCA 1VMFA 4RA0A 4F3JA 4EZHA 5BXXA 4YW3A 1Y43B 1PO23 2WA3A 3WEZA 4WVWA 5HCAA 5D1IA 1DU3D 2A3XA 2NN8A 2QKDA 1GV9A 4M0NA 3WG3A 5AVAA 1IG3A 4XUOA 4FTBA 4TXWA 1MS1A 1YFWA 3D0SA 4FSJA 2XMLA 5A6YA 2UU8A 3K75B 4YVWA 5FZ4A 4A42A 5C9AB 2W1UA 4CXWA 4OHZA 2V4AA 4IERA 4JV4A 2FDGA 4W6XA 3D8CA 1QJU3 1V6MA 3RZJA 2NYYA 3OJBA 2VUAA 1W6OA 2DVFA 4C91A 2XUEA 5C6CA 4FP3A 5E8AA 1APNA 2AREA 5L9VA 2XJUA 3QLQA 4Z8BA 1DFQA 1TME3 3N36A 4Z2AA 1UY2A 4YZ1A 5BNOB 3MLKA 4BDVB 2W5FA 2YGMA 5F7UA 4Q4Y3 3I54A 3KV9A 5DQ0A 1JXNA 1RUG3 4YG6A 2HWF1 2OX0A 1PIV1 2ZMKA 4QKNA 3Q8AA 2JECA 1H1IA 2R0HA 3RZGA 4AVVA 1YQ6A 1KEXA 2AR6A 3ALQA 3KVBA 1NXD1 2JIGA 4MHRA 4CDQA 3GNEA 3JBG1 4C90A 3MW2A 3R6SA 3ASIA 4FPJA 3VL9A 1BEV1 5BNNA 3M3CA 1X33A 2GMPA 5ANQA 4JRAA 3AP5A 1W2AX 3MO4A 4OI0A 3DGTA 4XURA 5C8CB 1C8NA 1R083 4MYEA 4Q0UA 2QQJA 4OVEA 2X29A 4QKDA 1JZ7A 3WNOA 1Z0HA 2Q1ZB 1C28A 2WZ8A 3ENRA 3EYPA 2J1AA 3ACFA 5K0UC 1ODMA 1YI7A 2VY0A 1NCRA 5FOBB 1R64A 5M0TA 4A3XA 5EPAA 2E31A 5FO8B 3TEZA 1WW6A 4H7LA 5I0DA 5AC93 4RGKA 4CVUA 5F2WA 1QJY3 4RQPA 3MBWA 5FP3A 3KQRA 1GZ9A 4LXLA 4CPBA 3TB0A 1XOYA 3HNYM 2I45A 1UMZA 1RUC2 2BVVA 1PMHX 3C7GA 2A3YA 3JCIA 1W2TA 1GSLA 2B8MA 2QQKA 4BE3A 4Y5Z0 4N43C 4GZ9A 1RHI2 4J25A 3WG2A 1PGL1 5C5UA 1MS4A 2NPIA 2PN5A 4L97A 5BNNC 2GZWA 2YZ4A 1Y9MA 4XIOA 2DVDA 2XJQA 4OQ8A 2R0FA 1IOAA 1RUE1 2YYOA 4DO0A 3P6BA 3WW2A 5CAZA 4QAWA 2R071 2LS6A 1YQ8A 2FDJA 3CO2A 1WW5A 2YUEA 3OBTA 3SKJE 4QT6A 4A41A 1ND2C 5IYYA 1JMUB 2OZJA 1J3PA 2BRTA 3AXDA 2OPKA 2IUWA 4JHZA 4GJZA 2WN2A 3I3MA 1YI9A 4N90A 1VRBA 1VALA 5KWRA 1PVC3 1WGPA 3LFMA 2RJKA 3R05A 4E4DX 3KV4A 1UYXA 4B7KA 1V6KA 5T3NA 1YHFA 3WHUA 3GGLA 2DCKA 4XABA 3HVDA 1GP4A 5GZCA 3TEWA 2KXLA 3HPNA 4NIGA 4JGZA 1YYNA 4L0PA 4Q2FA 4B29A 3MUY1 4KWKA 3T0BA 1G9BA 1OT5A 4ET7A 3AYDA 1HB4A 3U4SA 1K5MC 1J3RA 2HYXA 1G7YA 3ZFEA 3WLUA 2BOJA 3WW3A 1H8TC 5HBAA 2JIJA 3AFKA 5FK8A 4I30A 1WBFA 3T4VA 5JOXA 2PHXA 1YXWA 1IQAA 4UT5A 4WM8B 4IXLA 4XBQA 5IVVA 2ZJCA 3U14A 4IEUA 3ZYHA 3I2JA 1SPPA 2R1DA 5B4XA 5JSOA 1X8MA 3IWZA 2ZGMA 3VDDB 4FCAA 4PIZA 3WQ7A 2DU1A 2ZHNA 3LA2A 4XILA 2HWD3 2QQVA 3U10A 3K3OA 2JB8A 1ONAA 1K5MA 1SFYA 2DFCA 5F3EA 2EICA 2QQOA 3H1YA 3WUDA 2VQTA 2WL1A 3TN91 4EN7B 4N9IA 2H0VA 4QX1A 5FJHA 4AGVA 4BQ1A 1HB1A 1OH3A 5T55A 4KL1A 2VMEA 4MGYE 3UKTA 2KR2A 5FYSA 1I1EA 4Y4YA 4JRLA 5IFTA 4N53A 5GLVA 3NKTA 4JTOA 5FQ0B 5AC91 3KD4A 2A3WA 2HBUA 3MUZ1 4WBBA 4Q1RA 2W1WA 1XE7A 3VZMA 4DIQA 3BUCA 3SNMA 2RJLA 1LJ7A 2ID4A 2QBXA 3RG0A 2G9ZA 3JD71 3JQXA 4LIUA 5G05L 1E5SA 2WYSA 3C7OA 4ZY9A 1WW4A 4UF0A 3I2OA 4XF9A 3N4MA 2A5ZA 2IVJA 3NV1A 4K3UA 1G8WA 3AVSA 3WDUA 4NMIA 1M06G 5D2AA 1OUSA 1N3OA 1L7RA 2AZ5A 1BCXA 2PA7A 4BK5A 2VW2A 5GLTA 3TNPB 4O9GA 4D8MA 4O9EA 1RVF3 1XNBA 3KCCA 3HWJA 5T5LA 3SCFA 4CSWA 2B42B 4XXAA 1H1AA 3UGHA 2LRPA 3HNBM 1ZREA 3IDEA 4EN0A 2YY1A 4HLTA 2PHUA 2B5HA 3GXUA 5C33A 2VL4A 5CISA 3KLSA 5FYBA 3ILRA 1Y4WA 3GBWA 5FYMA 2GN3A 2PHDA 2BDRA 3DCQA 3O0VA 2W95A 4NPLA 3AMPA 4ZZ8A 4MXVA 2PHLA 4NRMA 5LA9A 3WP5A 4AI1A 1GQPA 1ZBA1 2WWJA 1W6QA 2RS33 3JU9A 4UBHA 3W20A 4JVAA 3B7MA 1NYWA 3FLPA 5BNPC 4AFBA 5BPXA 3VBFA 4COYA 4RL7A 1GYKA 4M4RA 4NAMA 1OPMA 1VBB3 1J59A 5L7OA 3VUOA 1MQTB 2OS2A 3EBRA 1YJLA 4ZXEA 4JDOA 5JIAA 2VMFA 3IAQA 2AH2A 4XJWA 1B35C 5EQUA 2ZBJA 1GLHA 1MS5A 5FXVA 1D4M2 1Y3TA 2EXHA 4ATFA 2F17A 2C4XA 1QU0A 3WNXA 4KG8A 1OQEA 4XJAA 1D4M1 3PDQA 2KM2A 2D44A 4QX5A 1TNFA 1ZA7A 3SHRA 1DCSA 4E2GA 3RVHA 5CKMA 1GWKA 3DV8A 3KCYA 2VZ3A 3OGGA 4NHMA 4YVWC 2GMMA 3FFZA 1N47A 2RHPA 1NCRC 1L7QA 1V6LA 4GH4A 3OY8A 3PHMA 4HK8A 3ZMNA 2DBIA 1ENXA 3MHZA 3OUIA 3N7MA 4OZOA 1PZ7A 4QXHA 4YW1A 2OIIA 2RE9A 4CDWB 2W94A 4QQLA 5F6KA 5HXMA 4PF1A 4LK6A 4OULA 5J96B 3BN6A 1J84A 2HWB1 3APBA 2WNVB 4IDZA 4UFMA 3ZKUA 3N9QA 4QXCA 2EXIA 5C70A 4LBQB 2D6MA 4OMCA 2ZS6B 1WLWA 2ET1A 4MH0E 2GC3A 2EIEA 2MEV2 3BKZA 3FUQA 4RFT0 3N7KA 3UJQA 3ZYFA 3WW4A 1PO22 2EAKA 2Q8EA 4TYSA 3SH4A 1AR93 1CZVA 3RFRA 1W2UA 3AJZA 1MS9A 4GQ7A 4R8HA 3OGSA 3VBRA 3O7OA 3SXWA 1CESA 2HEWF 1CAXA 1REFA 4MGZE 3IIAA 5JSRA 2NMNA 1QJX3 5ERLA 5FPZA 1C57A 1SPPB 4AVAA 5DZEA 2GNTA 5FUNA 4RR3B 2GMEA 1FATA 5FIXA 5LBBA 3AKQA 1QNYA 1AYN2 3I2GA 1GUIA 2D40A 1W04A 5IK8A 2XPJA 4WZCA 4NR1A 4NUBA 2JDHA 4BM8A 4PHZA 3AC0A 2FD8A 2RS12 1US2A 5BY5A 4OUMA 3VBFC 2XBO3 1QXPA 2DTYA 3CNAA 2VTFA 5FMOS 3RJ2X 3B5LB 4KWLA 4OLLA 3MIGA 1TME2 3SCGA 1ZZCA 5JZGA 3O1PA 4LBQD 5A3MA 4RFRB 4BQYA 4QPWA 3ZSLA 2B46X 5E16A 1X36A 1CN1A 4E8CA 4BMEA 3M3OA 3NNMA 4QPIB 4RS5A 2BOIA 3OEBA 4I2OA 1CGPA 5ABJA 1MACA 1VAMA 4PI2A 1COV2 4Q4X2 5FYUA 1OD3A 1U0AA 1BVP1 2DUQA 5DMYA 5FXXA 3J7NA 1QY4A 1POV0 3P3PA 2ZCWA 3BTZA 1UMIA 2ZOEB 1ULOA 2B9UA 3I2FA 2Y0OA 4I09A 4NIDA 4MSVA 3K4AA 2OXBA 4X6RB 2NLRA 5FZMA 4AL9A 2RDRA 3GYDA 3QOPA 2HWB3 5DDJ3 1GU3A 3T08A 4I0AA 4QXBA 4D94A 2WZR2 4MUVA 4OHYA 1GZWB 4HPKB 1UCXA 2VNOA 1VBC2 2P1BA 3IZOA 5BNPA 3GHNA 4K9SA 5FZBA 2R062 5IAVA 1HDKA 3A22A 4DY3A 3KSCA 3LF7A 4TLGA 5DAXA 4P5HA 2VCCA 3AL5A 3SITA 3WUCA 1JOJA 1FPN1 4K1ZA 5EHDA 4FT8A 5FXWA 2FDIA 3U78A 3I49A 2ADDA 4S2GA 1V0AA 2O0OA 3ZR5A 1BYHA 3FHQA 4KGQA 4E2SA 2QZ3A 3CDZB 1SHWB 2PXJA 3IDBB 2XB6C 5LEKA 2ZPXA 2J1UA 2DTWA 4H14A 1KFUL 3DXUA 4RR3A 3K2OA 3PUQA 1JZ5A 1NLRA 3T30A 3OUHA 5G04L 1AR82 4LIVA 1ZZBA 3AL6A 3DXTA 3HR9A 4BXFA 2HJIA 4PCRA 2ZXQA 4AQ2A 1EAH3 3W5NA 1G9DA 4NRQA 5FYIA 3UGFA 3ZYGA 1MQTA 1VBB2 2D5FA 2E7AA 3DECA 3EB7A 1REDA 4AQSA 1RC6A 4K8FA 1FOD2 2ARXA 1I6XA 3J4UH 2WS93 1MZ5A 4PT6A 4Q4W3 1AF9A 1IHMA 4P5YA 4CCCA 5JWPA 1DQ1A 4IV3A 1SMVA 1S0DA 2QQMA 2ORZA 2EVXA 4PDWB 5JZGC 2W91A 1XXNA 2D6KA 3VKMA 2WC2A 4WV8A 2Q5TA 3OTFA 3KT4A 2RS11 3ZPYA 5I8SA 2ZX2A 5A3LA 2ZGSA 1W6OB 3UV9A 3H42B 4QM9A 5FAXA 1X7NA 2G9FA 3LCPA 3ZFFA 1PK6B 5F3GA 2P2KA 3SEPA 4C0HA 5C3QA 4YVWB 3B9IA 4JCKA 1AVBA 2C9AA 4INDA 3AZYA 3CZJA 1VB4A 5F5CA 5FUIA 1SCSA 4FTEA 5DAVA 3FBMA 4DOUA 2QNKA 5FY5A 3UNPA 1PM7A 4PDWC 1XNKA 5JZGB 3EQEA 3RMYA 2VD7A 3MPBA 3K4ZA 4FBFA 4MGTA 1AL23 3BCWA 1B35B 3VBHC 2VCBA 3O0XA 1Y9QA 3POGA 3AMHA 1UOBA 4KGGA 4QKBA 2YB7A 4GXLA 4Q0VA 4Z1VA 4L2NA 2DUPA 5BV6A 1FXZA 1AJKA 2VMDA 3AX4A 3N9MA 2RS53 3PL0A 3O1OA 1EAH1 3M3IA 2WNUA 3ZR6A 1LHNA 3S7EA 2WQZC 4LA3A 3T1MA 1LAJA 1BQPA 2BWAA 4XFFA 5HV4A 2XGXA 3A21A 1DGRN 2WN3A 4FPYA 4XW3A 1V70A 4XACA 4DEQA 2VUJA 5E6HA 3QD6A 4LA2A 2QZ2A 2VQ0A 3AMNA 3O5SA 5F6LB 1MPXA 4IEOA 1JYXA 2HWE2 3LE0A 3N9LA 3ZLIA 3NL1A 3SCHA 1W6PB 2DURA 3KF3A 1CX4A 1R092 1FPN2 3QCWA 4Y20B 1KS5A 4Q1PA 3VBOA 2WFF3 2VQAA 4LBOA 1SLTA 2CDOA 3T2OA 2JKXA 5C4WB 3IB3A 1UNBA 1HRI2 1UYZA 2PAKA 2PMWB 5IVCA 3W5MA 2UURA 5ACA3 4WM8A 3THDA 2Y8KA 5AFBA 2YHJA 1AZDA 2ZX3A 2Q8DA 3ETQA 1K5JA 3POEA 1XRUA
chains in the Genus database with same CATH topology
2WQ8A 3K75B 4A42A 2X09A 2W1UA 1XC6A 1JZ8A 1TG7A 4MO3M 1UY4A 4LHSA 3CKHA 2B9VA 1CX1A 1DP0A 2WO3A 3CZUA 1ULPA 4Z2AA 1O8SA 1UY2A 4A3ZA 4QDQA 4BDVB 2W5FA 5F7UA 5DQ0A 2BZDA 3T2QA 3BGAA 3SEEA 1OF4A 1KEXA 2W87A 4MGSA 1K45A 4XUPA 2VZRA 3VDCA 4XUQA 4E8DA 2QQNA 3MO4A 4M4PA 1GNYA 3A7QA 4XURA 3SKVA 2BGOA 3LEKA 1LNSA 4ZZ5A 3JXSA 2J1EA 2QQJA 1US3A 3WNOA 4OUEA 1UWWA 3WNMA 3GM8A 3WF4A 2V4VA 2WZ8A 5EJ1B 3WNPA 4KI5M 3EYPA 4QB1A 2J1AA 3ACFA 1R64A 3MV11 1W8NA 2E31A 4KWUA 2VZUA 1PX3A 5I0DA 2ORXA 3WF2A 2BBAA 4CVUA 3VD7A 4DEVA 1T2XA 3MBWA 4DUXA 4GWIA 5C7GA 3HNYM 4OYUA 1W9TA 1PMHX 3C7GA 2E32A 2YFUA 4PQQA 2QQKA 4GZ9A 4JKKA 3NRUA 4DXTA 1UY0A 3ACGA 2ZEYA 1UX7A 1WCQA 3DYOA 3P6BA 4QAWA 2LS6A 2JE8A 2W46A 3SKJE 4A41A 5IYYA 3OGVA 3IDAA 4JHZA 4QX0A 2XOMA 1H6YA 2WN2A 5DN2A 2VZOA 3CMGA 4QX3A 1UYXA 1JZ7A 2W92A 2RVAA 4MGQA 1W9WA 3GGLA 2ZEXA 2DCKA 2WO1A 3J7HA 3WQBA 3HPNA 4LKSA 3ETPA 4L0PA 3MUY1 3LEGA 3T0BA 5JXJA 1OT5A 4ET7A 4HG6B 1K12A 2HYXA 3D3AA 2J1SA 1NUKA 3ZM8A 4OMDA 3ACHA 3LQCA 3C7EA 4XVHA 1XPWA 1TVGA 4BK4A 3I2JA 3OBAA 5B4XA 1GOHA 4MOAA 1JU4A 1UZ0A 2W9XA 2VZQA 2EICA 2QQOA 4QB2A 2KD7A 2VQTA 3WNLA 4QX1A 2Z4FA 4W8JA 2VMEA 3A23A 3PUHA 4RYDA 1CZTA 4D0QA 5IFTA 3I3DA 3MUZ1 2W1WA 2VCAA 1EUTA 1BHGA 1W0NA 3HOBA 1DYOA 2EIBA 4W4ZA 2ID4A 2WAOA 2VC9A 2QBXA 3ABZA 5LA2A 5G05L 4AAXA 2WYSA 3OGRA 3C7OA 3HN3A 4P08A 4ZY9A 2VZSA 2DDUA 2WBKA 3THCA 2J1TA 4XZUG 1I5PA 2J1RA 4YPJA 1EUUA 4P02B 2X10A 1XNAA 1L7RA 4BK5A 2WAAA 2Y6GA 1PX4A 4D8MA 4LQRA 3FHAA 1JZ4A 3HNBM 1UY3A 1UMHA 2CDPA 3GXUA 2OKXA 2VL4A 3ECQA 2V72A 2L9LA 2W95A 2VZTA 1OF3A 1CZSA 3GDBA 3UESA 4ZZ8A 1GQPA 5HPOA 3LPGA 3T2PA 5JUVA 1NKGA 1O8PA 2J1VA 2W1QA 5A1AA 3F2ZA 5JXGA 2VO5A 2XONA 4M4RA 2VM9A 2QQIA 1IQDC 2VZVA 4P00B 3VDAA 1JHJA 4ZXEA 2VMFA 3IAQA 1P8JA 4CUBA 4UOJA 2WZEA 2C4XA 2R7EB 3T09A 5JMOA 4TTGA 2WABA 2YC2A 2C26A 4GWJA 3WF1A 5IFPA 2J7MA 2VZ3A 2JDAA 2JD9A 2LW8A 1L7QA 2W3JA 3T0AA 4CUCA 3C7FA 4OZOA 1UY1A 5CYYA 3NJVA 1HN1A 2W94A 5HXMA 4PF1A 2EIDA 1JYWA 3BN6A 4XUTA 1J84A 1JZ2A 5C70A 3K4DA 3VD9A 4OMCA 2E26A 2EIEA 2XQXA 3T0DA 3C8XA 4A4AA 5B4NA 1CZVA 2Y6KA 1NAEA 3OGSA 4RN5A 3VD4A 3HJRA 2VZPA 4JX0A 3I2GA 3VDBA 3ACIA 1GUIA 4UI9L 2WO2A 3AC0A 3K77A 1US2A 1OH4A 2VMCA 4JKLA 4QDRA 2VTFA 2Y6HA 3NJXA 2X05A 1W99A 4QPWA 1RYYA 1UXXX 3P1IA 1JYNA 4E8CA 1SG3A 3U37A 1F4AA 3VD5A 5IHRA 3OEBA 3LPFA 2ZEWA 1H6XA 2RV9A 2B4KA 1OD3A 5DMYA 1UMIA 1ULOA 3I2FA 2QQLA 3K4AA 1XNTA 5DPNA 4MADA 1GU3A 1D7PM 3T08A 3PUIA 3HNMA 2ZEZA 3CQOA 4UAPA 1PMJX 3A22A 1JI6A 3VD3A 3DYPA 3HEIA 4QX2A 1CIYA 2VCCA 5JR2A 3FL7A 3LEIA 2C9KA 2J22A 1K42A 1JZ6A 4CU9A 2Y6JA 4ARXA 3MV01 4A45A 2PQSA 3FHQA 1GOGA 3I97A 5LCWL 3CDZB 1SHWB 5JXHA 2J1UA 4CUAA 5JXIA 3K46A 5LA1A 3WSOA 4DUWA 1WKYA 3C7HA 1JZ5A 5G04L 1KGYA 5EJZB 1GMMA 2ZXQA 2RJ2A 1W9SA 3W5NA 4CU6A 2E33A 3I2KA 4LPLA 3EB7A 3DECA 1JU3A 1W8OA 4BXSV 1F4HA 1K3IA 4DXSA 3OB8A 3FN9A 4FI9A 3I2HA 4KMQA 1NX9A 4BJ0A 5EIYB 4IUGA 2YFZA 3NQHA 4PT6A 2BGPA 4P5YA 5LA0A 3WNNA 2QQMA 2ORZA 3I2IA 4AG4A 2W1SA 2W91A 2DCJA 3WF0A 3IAPA 4DUVA 2V5DA 2W47A 5CZKA 4XUNA 2HLEA 2Y64A 3SEPA 3CZJA 5FUIA 3CIHA 3UNPA 3K4ZA 5IJRA 2VCBA 1JYVA 3WF3A 3NNGA 2YB7A 5J1XA 2VJXA 2VMDA 1DLCA 4QB6A 2VOTA 4JKMA 3IIIA 3DYMA 2VZ1A 2WDBA 3A21A 2WN3A 4DEQA 4CU8A 5C71A 2Y6LA 1O59A 1UXZA 1SDDB 3OG2A 2WUHA 4W50A 3I3BA 1MPXA 3UETA 1JYXA 1JZ3A 3LE0A 4CU7A 2YG0A 3OEAA 2BERA 1GOFA 4ARYA 4A44A 1YQ2A 1J83A 2VR4A 4DXRA 2XHNA 2CDOA 3T2OA 3WEZA 2JKXA 3IB3A 1UYZA 3W5MA 3E1F1 2YC4A 3THDA 4A6OA 4QDSA 2Y8KA 3I3EA 4XUOA 3WNKA 4TXWA 1UYYA 2VQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WQ8 A;  3K75 B;  4A42 A;  2X09 A;  2W1U A;  1XC6 A;  1JZ8 A;  1TG7 A;  4MO3 M;  1UY4 A;  4LHS A;  3CKH A;  2B9V A;  1CX1 A;  1DP0 A;  2WO3 A;  3CZU A;  1ULP A;  4Z2A A;  1O8S A;  1UY2 A;  4A3Z A;  4QDQ A;  4BDV B;  2W5F A;  5F7U A;  5DQ0 A;  2BZD A;  3T2Q A;  3BGA A;  3SEE A;  1OF4 A;  1KEX A;  2W87 A;  4MGS A;  1K45 A;  4XUP A;  2VZR A;  3VDC A;  4XUQ A;  4E8D A;  2QQN A;  3MO4 A;  4M4P A;  1GNY A;  3A7Q A;  4XUR A;  3SKV A;  2BGO A;  3LEK A;  1LNS A;  4ZZ5 A;  3JXS A;  2J1E A;  2QQJ A;  1US3 A;  3WNO A;  4OUE A;  1UWW A;  3WNM A;  3GM8 A;  3WF4 A;  2V4V A;  2WZ8 A;  5EJ1 B;  3WNP A;  4KI5 M;  3EYP A;  4QB1 A;  2J1A A;  3ACF A;  1R64 A;  3MV1 1;  1W8N A;  2E31 A;  4KWU A;  2VZU A;  1PX3 A;  5I0D A;  2ORX A;  3WF2 A;  2BBA A;  4CVU A;  3VD7 A;  4DEV A;  1T2X A;  3MBW A;  4DUX A;  4GWI A;  5C7G A;  3HNY M;  4OYU A;  1W9T A;  1PMH X;  3C7G A;  2E32 A;  2YFU A;  4PQQ A;  2QQK A;  4GZ9 A;  4JKK A;  3NRU A;  4DXT A;  1UY0 A;  3ACG A;  2ZEY A;  1UX7 A;  1WCQ A;  3DYO A;  3P6B A;  4QAW A;  2LS6 A;  2JE8 A;  2W46 A;  3SKJ E;  4A41 A;  5IYY A;  3OGV A;  3IDA A;  4JHZ A;  4QX0 A;  2XOM A;  1H6Y A;  2WN2 A;  5DN2 A;  2VZO A;  3CMG A;  4QX3 A;  1UYX A;  1JZ7 A;  2W92 A;  2RVA A;  4MGQ A;  1W9W A;  3GGL A;  2ZEX A;  2DCK A;  2WO1 A;  3J7H A;  3WQB A;  3HPN A;  4LKS A;  3ETP A;  4L0P A;  3MUY 1;  3LEG A;  3T0B A;  5JXJ A;  1OT5 A;  4ET7 A;  4HG6 B;  1K12 A;  2HYX A;  3D3A A;  2J1S A;  1NUK A;  3ZM8 A;  4OMD A;  3ACH A;  3LQC A;  3C7E A;  4XVH A;  1XPW A;  1TVG A;  4BK4 A;  3I2J A;  3OBA A;  5B4X A;  1GOH A;  4MOA A;  1JU4 A;  1UZ0 A;  2W9X A;  2VZQ A;  2EIC A;  2QQO A;  4QB2 A;  2KD7 A;  2VQT A;  3WNL A;  4QX1 A;  2Z4F A;  4W8J A;  2VME A;  3A23 A;  3PUH A;  4RYD A;  1CZT A;  4D0Q A;  5IFT A;  3I3D A;  3MUZ 1;  2W1W A;  2VCA A;  1EUT A;  1BHG A;  1W0N A;  3HOB A;  1DYO A;  2EIB A;  4W4Z A;  2ID4 A;  2WAO A;  2VC9 A;  2QBX A;  3ABZ A;  5LA2 A;  5G05 L;  4AAX A;  2WYS A;  3OGR A;  3C7O A;  3HN3 A;  4P08 A;  4ZY9 A;  2VZS A;  2DDU A;  2WBK A;  3THC A;  2J1T A;  4XZU G;  1I5P A;  2J1R A;  4YPJ A;  1EUU A;  4P02 B;  2X10 A;  1XNA A;  1L7R A;  4BK5 A;  2WAA A;  2Y6G A;  1PX4 A;  4D8M A;  4LQR A;  3FHA A;  1JZ4 A;  3HNB M;  1UY3 A;  1UMH A;  2CDP A;  3GXU A;  2OKX A;  2VL4 A;  3ECQ A;  2V72 A;  2L9L A;  2W95 A;  2VZT A;  1OF3 A;  1CZS A;  3GDB A;  3UES A;  4ZZ8 A;  1GQP A;  5HPO A;  3LPG A;  3T2P A;  5JUV A;  1NKG A;  1O8P A;  2J1V A;  2W1Q A;  5A1A A;  3F2Z A;  5JXG A;  2VO5 A;  2XON A;  4M4R A;  2VM9 A;  2QQI A;  1IQD C;  2VZV A;  4P00 B;  3VDA A;  1JHJ A;  4ZXE A;  2VMF A;  3IAQ A;  1P8J A;  4CUB A;  4UOJ A;  2WZE A;  2C4X A;  2R7E B;  3T09 A;  5JMO A;  4TTG A;  2WAB A;  2YC2 A;  2C26 A;  4GWJ A;  3WF1 A;  5IFP A;  2J7M A;  2VZ3 A;  2JDA A;  2JD9 A;  2LW8 A;  1L7Q A;  2W3J A;  3T0A A;  4CUC A;  3C7F A;  4OZO A;  1UY1 A;  5CYY A;  3NJV A;  1HN1 A;  2W94 A;  5HXM A;  4PF1 A;  2EID A;  1JYW A;  3BN6 A;  4XUT A;  1J84 A;  1JZ2 A;  5C70 A;  3K4D A;  3VD9 A;  4OMC A;  2E26 A;  2EIE A;  2XQX A;  3T0D A;  3C8X A;  4A4A A;  5B4N A;  1CZV A;  2Y6K A;  1NAE A;  3OGS A;  4RN5 A;  3VD4 A;  3HJR A;  2VZP A;  4JX0 A;  3I2G A;  3VDB A;  3ACI A;  1GUI A;  4UI9 L;  2WO2 A;  3AC0 A;  3K77 A;  1US2 A;  1OH4 A;  2VMC A;  4JKL A;  4QDR A;  2VTF A;  2Y6H A;  3NJX A;  2X05 A;  1W99 A;  4QPW A;  1RYY A;  1UXX X;  3P1I A;  1JYN A;  4E8C A;  1SG3 A;  3U37 A;  1F4A A;  3VD5 A;  5IHR A;  3OEB A;  3LPF A;  2ZEW A;  1H6X A;  2RV9 A;  2B4K A;  1OD3 A;  5DMY A;  1UMI A;  1ULO A;  3I2F A;  2QQL A;  3K4A A;  1XNT A;  5DPN A;  4MAD A;  1GU3 A;  1D7P M;  3T08 A;  3PUI A;  3HNM A;  2ZEZ A;  3CQO A;  4UAP A;  1PMJ X;  3A22 A;  1JI6 A;  3VD3 A;  3DYP A;  3HEI A;  4QX2 A;  1CIY A;  2VCC A;  5JR2 A;  3FL7 A;  3LEI A;  2C9K A;  2J22 A;  1K42 A;  1JZ6 A;  4CU9 A;  2Y6J A;  4ARX A;  3MV0 1;  4A45 A;  2PQS A;  3FHQ A;  1GOG A;  3I97 A;  5LCW L;  3CDZ B;  1SHW B;  5JXH A;  2J1U A;  4CUA A;  5JXI A;  3K46 A;  5LA1 A;  3WSO A;  4DUW A;  1WKY A;  3C7H A;  1JZ5 A;  5G04 L;  1KGY A;  5EJZ B;  1GMM A;  2ZXQ A;  2RJ2 A;  1W9S A;  3W5N A;  4CU6 A;  2E33 A;  3I2K A;  4LPL A;  3EB7 A;  3DEC A;  1JU3 A;  1W8O A;  4BXS V;  1F4H A;  1K3I A;  4DXS A;  3OB8 A;  3FN9 A;  4FI9 A;  3I2H A;  4KMQ A;  1NX9 A;  4BJ0 A;  5EIY B;  4IUG A;  2YFZ A;  3NQH A;  4PT6 A;  2BGP A;  4P5Y A;  5LA0 A;  3WNN A;  2QQM A;  2ORZ A;  3I2I A;  4AG4 A;  2W1S A;  2W91 A;  2DCJ A;  3WF0 A;  3IAP A;  4DUV A;  2V5D A;  2W47 A;  5CZK A;  4XUN A;  2HLE A;  2Y64 A;  3SEP A;  3CZJ A;  5FUI A;  3CIH A;  3UNP A;  3K4Z A;  5IJR A;  2VCB A;  1JYV A;  3WF3 A;  3NNG A;  2YB7 A;  5J1X A;  2VJX A;  2VMD A;  1DLC A;  4QB6 A;  2VOT A;  4JKM A;  3III A;  3DYM A;  2VZ1 A;  2WDB A;  3A21 A;  2WN3 A;  4DEQ A;  4CU8 A;  5C71 A;  2Y6L A;  1O59 A;  1UXZ A;  1SDD B;  3OG2 A;  2WUH A;  4W50 A;  3I3B A;  1MPX A;  3UET A;  1JYX A;  1JZ3 A;  3LE0 A;  4CU7 A;  2YG0 A;  3OEA A;  2BER A;  1GOF A;  4ARY A;  4A44 A;  1YQ2 A;  1J83 A;  2VR4 A;  4DXR A;  2XHN A;  2CDO A;  3T2O A;  3WEZ A;  2JKX A;  3IB3 A;  1UYZ A;  3W5M A;  3E1F 1;  2YC4 A;  3THD A;  4A6O A;  4QDS A;  2Y8K A;  3I3E A;  4XUO A;  3WNK A;  4TXW A;  1UYY A;  2VQU A; 
#chains in the Genus database with same CATH topology
 4ZS2 A;  1CAU B;  1XNC A;  3ZYR A;  1CAU A;  5IK7 A;  1LHV A;  4DMI A;  3ZYJ B;  4AFM A;  2GAL A;  3M4F A;  4GMP 3;  4Q4V 1;  2XG3 A;  1XYO A;  1QJE A;  1TG7 A;  4IE5 A;  3EMR A;  2RDQ A;  4Y1U A;  2CV6 A;  3RZH A;  1AR7 1;  1VBC 3;  2DU0 A;  5KXD A;  3CJX A;  1UY4 A;  4YZ2 A;  3B02 A;  2B9V A;  5FDB A;  1ULD A;  2VOW A;  5FP4 A;  3CZU A;  1NLS A;  4UW5 A;  1O8S A;  2OZ6 A;  4JDN A;  3POY A;  1YQ5 A;  4LLF A;  4QDQ A;  2FQP A;  5F39 A;  3AZZ A;  3LD8 A;  1PO1 3;  1W6M A;  1W3V A;  1UF2 C;  1YJK A;  1W6P A;  2VUL A;  3E5U A;  2BZD A;  3A0K A;  4EWD A;  3O1T A;  4COU A;  1W6N A;  4K6B A;  4AHX A;  2VNR A;  5D8A A;  2HWD 1;  2W87 A;  4MGS A;  5GLZ A;  1AYN 3;  1HV0 A;  3UT0 A;  4ES9 A;  3POF A;  4P9I A;  1MZE A;  4MXW A;  4WM8 C;  2P3Y A;  4OUS A;  4E8D A;  1Q8S A;  3MFA A;  2D3R A;  2DYC A;  5I8T A;  3MGU A;  3LEK A;  2P3J A;  3JXS A;  5CKN A;  1US3 A;  4D6S A;  4K7J A;  1H2N A;  5CEH A;  5DUV A;  4OUE A;  1UWW A;  2V4V A;  3WNP A;  3ZIX A;  1PGW 1;  3H9A A;  4BZ4 A;  4KI5 M;  1RUD 1;  4LHK A;  3MV1 1;  4H3W A;  4UXA A;  1AYM 2;  3CLP A;  4XTP A;  5EYX A;  1ENQ A;  4KWU A;  5ISL A;  2G4I A;  2VZU A;  4XYX A;  2JG8 A;  4GMP 0;  3N3H A;  3VD7 A;  5FPA A;  5DUW A;  1QNW A;  4OQ9 A;  4DUX A;  3ZXL A;  4Q4X 3;  2WYF A;  5CFC A;  1FYU A;  1UU4 A;  3TEX A;  2TUN A;  1HKD A;  2IXI A;  4Y20 A;  3UK9 A;  2P3K A;  2E32 A;  2R32 A;  1UIJ A;  1HXS 2;  2XLF A;  5LK7 B;  3ZXJ A;  3JUU A;  2JE9 A;  1JUI A;  3TN9 2;  3VBS B;  4JKK A;  4IV1 B;  5FO9 B;  2WNV C;  3WG4 A;  3NRU A;  1ZM1 A;  3AKP A;  5JOY A;  3ZYB A;  2W52 A;  3POI A;  5EFU A;  1UY0 A;  4D7S A;  1BBT 1;  1ASJ 1;  4AED C;  5FTT C;  1CON A;  3L9J T;  3IN9 A;  4LLO A;  4NN0 A;  2WWU A;  3KB5 A;  4HVR A;  1MEC 1;  3V0A B;  5FOJ B;  2LTN A;  2W46 A;  4GB3 3;  5BNN B;  3IPV A;  4YG0 A;  4QQ2 A;  4IE4 A;  3OGV A;  2JDK A;  1EAH 2;  1R1A 1;  2ZA9 A;  2DVB A;  4QX0 A;  5F32 A;  3MF9 A;  4IV3 B;  3VHR A;  4BOW A;  4CEW A;  1RUI 3;  1G86 A;  3ILN A;  4XFI A;  1AR6 2;  4CXX A;  5H9S A;  1LEN A;  4AWD A;  5I0S A;  3UJO A;  1H2K A;  1SEF A;  3J9S A;  3NW4 A;  4Y3O A;  5DAW A;  5BNO A;  3PIG A;  3PJY A;  1W9W A;  2ZEX A;  2YPD A;  2EA7 A;  3NJZ A;  4GWN A;  4JGZ C;  1HB3 A;  1RUF 2;  1MQT C;  2ARA A;  2DV9 A;  2XKO A;  2ZGO A;  3J7H A;  2XJT A;  4B8E A;  1LR5 A;  2PYT A;  2QCS B;  1UIK A;  3EHK A;  1O3Q A;  2E7T A;  4CEY B;  5FYV A;  2I74 A;  5KR7 A;  2JJ6 A;  3A0N A;  1RGS A;  1SLI A;  2EF6 A;  3HT1 A;  2W2I A;  3EXU A;  1CVN A;  2A6X A;  1NQD A;  1JTZ X;  3D0J A;  1NA1 C;  4GD4 A;  1K12 A;  2X53 S;  2CNA A;  3ZFF B;  2J1S A;  2JG8 C;  4NVP A;  5A7P A;  3H3Z A;  1S0I A;  3ZM8 A;  3W21 A;  3C7E A;  5FZO A;  1XPW A;  1WMX A;  1QDO A;  1TVG A;  1X82 A;  2VMH A;  2D43 A;  2XJS A;  4IEY A;  3QH6 A;  5FZ7 A;  3WHT A;  5A3P A;  2RR1 3;  4MG2 A;  3VKF C;  1GOH A;  3RWK X;  4DY5 A;  3OPW A;  5EZW A;  4WM7 B;  4UFK A;  3AKR A;  5HCH A;  2W9X A;  2VZQ A;  5DAP A;  4ZXK A;  1UU6 A;  2OPW A;  1DGW X;  1H2M A;  4XQ4 A;  5IAX A;  4Q4X 1;  1LOF C;  3POJ A;  5FZ8 A;  2XVK A;  3CF6 E;  5CA6 A;  1OUX A;  3I59 B;  3A23 A;  3PUH A;  4NJ4 A;  1A78 A;  4RYD A;  4D0Q A;  1QDC A;  4RHV 3;  1OSG A;  1OVS A;  1HQL A;  4M01 A;  3UGG A;  2YGL A;  4XFB A;  2W68 A;  3ZN5 A;  5IVY A;  1F15 A;  1BHG A;  1QJU 1;  2LM3 A;  3RQ0 A;  4N43 B;  3SQO A;  1DYO A;  2EIB A;  1KD7 A;  1LHO A;  1IZ3 A;  4W4Z A;  5KHI A;  3VKO A;  4O7X A;  5GZF A;  1D2Q A;  5FZ1 A;  1QEX A;  2WZP P;  3CBN A;  3W59 A;  4D7T A;  3OSD A;  2V09 A;  4HKL A;  1UU5 A;  4Q27 A;  1KDK A;  5C3O A;  2VZS A;  1ND3 A;  3M2M A;  2J1T A;  1KDM A;  2BGC A;  4R9A A;  3AMM A;  3ZN4 A;  3WY6 A;  5JOZ A;  4Q4Y 2;  5H9P A;  5H9Q A;  4Z2W A;  1Q5O A;  1AX0 A;  3OGJ A;  1DQ2 A;  2QDN A;  2J1R A;  4YPJ A;  3USS A;  5BNQ A;  4LKE A;  2GC0 A;  2MEV 1;  2WFP A;  2K9Z A;  1V6J A;  4TZD A;  1WD4 A;  1PX4 A;  3C3V A;  4LHN A;  1I5Z A;  1FT9 A;  5GZG A;  2A71 A;  3FHI B;  1N1Y A;  2ETE A;  3VDD C;  3WZ1 A;  4FOY A;  2A6Y A;  1W39 A;  3ZSK A;  1BBT 2;  3ITQ A;  1GP6 A;  1U5Y A;  1XU1 A;  2XWB B;  4S2F A;  3KGL A;  1AR8 1;  3VBU B;  2V72 A;  3K48 A;  1NE4 A;  2WIN B;  2VZT A;  3GDB A;  1OF3 A;  1RHI 1;  1YO8 A;  4FOV A;  4M3C F;  1N3Q A;  1BK0 A;  5E1R A;  3QH7 A;  5EV7 A;  1URX A;  4ZU4 A;  4AED A;  1CPN A;  3ZKY A;  1JYT A;  5A7S A;  4ITC A;  1O8P A;  1GFF 2;  3LIG A;  1HX6 A;  5K4L A;  2D97 A;  5A1A A;  5C5T A;  4BU2 A;  3SC7 X;  3H3U A;  2QTW B;  1ST8 A;  1R09 3;  5DG2 A;  5FXZ A;  4JHT A;  4AXO A;  4P00 B;  3VB9 A;  2VVF A;  1JHJ A;  4YVS B;  3JQW A;  3OYW A;  2WFF 1;  3WX5 A;  4FPH A;  4UFI A;  1P8J A;  1W3X A;  2R04 2;  3PLQ A;  4UOJ A;  2WZE A;  1RUD 2;  1GIC A;  2ZZQ A;  1UD1 A;  1Q43 A;  2E9Q A;  5LY2 A;  4GKX A;  4N9H A;  5JMO A;  2R1B A;  3ACL A;  2JKB A;  3NV3 A;  4Y33 A;  1UW8 A;  5FUP A;  3WF1 A;  4AVC A;  1ND3 B;  4ZPI A;  5BUV A;  3S57 A;  1E5H A;  1QWR A;  1RJ7 A;  3RYR A;  4B4R A;  2CGN A;  1H9P A;  1ZA4 A;  1RUE 3;  1ZBE 2;  2LW8 A;  3OY8 B;  1DQ0 A;  4Y1X A;  3U75 A;  3VLB B;  4ZKT B;  4CUC A;  2O14 A;  4FPC A;  1O5U A;  2XKP A;  1NZC A;  1HXS 1;  3NJV A;  1PMI A;  4YGE A;  5EXO A;  4BH9 A;  2PHF A;  1D0G A;  1QGL A;  5IVE A;  4CEY C;  3D6E A;  3E6D A;  4OCT A;  3J8F 3;  4M3C B;  5LAS A;  3WDV A;  4D69 A;  1AYM 3;  3N35 A;  5FK7 A;  1PGL 2;  4JC1 A;  4WVM B;  3K4D A;  3VD9 A;  5KXB A;  4XMA A;  4Q0Q A;  5FLH A;  5FY9 A;  3THT A;  1RIT A;  3ZXA C;  4DFS A;  2DWR A;  2PHW A;  1J58 A;  3PMS A;  1R1Z A;  1WWY A;  1RUI 1;  2XH6 A;  4DB5 A;  5FPU A;  1S4C A;  2C0Z A;  1TMF 1;  3AP9 A;  3NNF A;  1O5L A;  4GB3 1;  4AAP A;  1ULG A;  5FPX A;  5LBE A;  1X8E A;  2VZP A;  5FZ9 A;  1QOT A;  5K0U B;  1NT0 A;  1RXF A;  1AX1 A;  5LEJ A;  4IEP A;  4UI9 L;  4I0B A;  4YM2 A;  5KHJ A;  2WO2 A;  2H6C A;  1XB9 A;  1RUO A;  1J1T A;  1RUH 1;  2VMC A;  1OH4 A;  3GZE A;  4JKL A;  5AC9 2;  1RUJ 1;  4QDR A;  3JBG 3;  5J3U A;  5FP9 A;  5KHK A;  4XDQ A;  2WJS A;  4G3Y C;  3POB A;  1QQP 1;  4FXK B;  4YZ3 A;  3WG1 A;  2Z42 A;  1W99 A;  1IS5 A;  1ZBE 1;  1LCL A;  2A70 A;  1WMF A;  1RUG 1;  4EWA A;  1L3J A;  5CAD A;  1FAY A;  5FLJ A;  3N7J A;  1SG3 A;  3B69 A;  3KF5 A;  4Q4V 2;  5ABJ C;  1UYP A;  3VD5 A;  2WS9 1;  5SV8 A;  1UQX A;  2ZHL A;  3RJR A;  2EXK A;  3UL2 A;  3LDK A;  2VMI A;  1AXK A;  1CQ9 A;  3KHB A;  4CDW C;  1OLR A;  2RV9 A;  2VBB A;  4QMA A;  4AGG A;  5A1L A;  2B4K A;  1KIT A;  3GZU C;  1LHW A;  4CCN A;  5FY4 A;  2NM1 A;  2FBE A;  3INA A;  4OHV A;  1KJR A;  4EQV A;  2DCT A;  2XJP A;  5GZD A;  2VPV A;  4FPG A;  1SLC A;  1OHF A;  4BMB A;  4COV A;  3V0B A;  2RS5 1;  2ZGU A;  4ASK A;  2JDY A;  2XL7 A;  3S7I A;  1WLC A;  1T6G C;  2E53 A;  2VBP A;  2PHT A;  1TZO A;  4E4S A;  3ZXE A;  3CQO A;  4H55 A;  3E6B A;  4UAP A;  1LOF A;  1PMJ X;  1LGC A;  1ZRF A;  1Z78 A;  2D6P A;  3P5B A;  2FMY A;  1PO1 1;  1EV1 2;  4W6W A;  4LOR A;  4LR4 A;  2ARC A;  3FL7 A;  4A6S A;  5A70 A;  2BQP A;  5CFD B;  5FZH A;  3OPZ A;  3WCS A;  1DQ5 A;  1RVF 2;  4IGQ A;  2HYK A;  2IVI B;  4EZ4 A;  4ARX A;  3MV0 1;  2ZML A;  1MZF A;  5L9B A;  3I97 A;  1RTV A;  4N53 C;  1BBT 3;  3AKS A;  4XC9 A;  5LCW L;  2DUO A;  1OMI A;  4RHV 2;  3ZIW A;  3ZFE B;  4LO5 B;  2X5I C;  5FBJ A;  3RMX A;  4DUW A;  5LA1 A;  3C7H A;  1BZW A;  1YIP A;  5JR7 B;  1PVX A;  1F8V A;  4QGN A;  5F3I A;  4CZS A;  2DBN A;  4MZU A;  5AVP A;  4AFC A;  1GMM A;  2QVS B;  3AYC A;  3WT3 A;  1SLA A;  3BU7 A;  4OHW A;  1OKO A;  2E33 A;  2E51 A;  1CJP A;  1W03 A;  2CGO A;  2K2S A;  3I2K A;  4LPL A;  1KRI A;  4NWV A;  1W0P A;  1S0G A;  3LZZ A;  5T5O A;  3AP4 A;  4AZZ A;  1JU3 A;  1YWK A;  2AGS A;  5ACA 2;  4KNC A;  4BXS V;  3BI3 A;  2Y26 A;  4FPO B;  1QJF A;  1DIW A;  1MS3 A;  1EY2 A;  3FN9 A;  4N7U A;  1VBA 3;  4BJ0 A;  3H8U A;  2YFZ A;  1WLD A;  2B39 A;  2UWB A;  1STM A;  1W05 A;  1UOF A;  1RUF 3;  4MX3 A;  1OXC A;  3HQX A;  3TRS B;  2BYV E;  1VLN A;  3BOW A;  4UFJ A;  3WNN A;  1IPK A;  1N1V A;  4NE9 A;  3OPT A;  4XF0 A;  4ES8 A;  1W2N A;  3A4U A;  3AVR A;  4NPM A;  4KBB A;  1DQ4 A;  3BAL A;  4RD7 A;  2OW4 A;  4KWJ A;  2V5D A;  3PVB B;  2YXS A;  3MIB A;  3VBU A;  3AFG A;  2YBS A;  2YU2 A;  2HLE A;  1RUH 2;  2WO7 A;  2Y64 A;  3NNJ A;  1SZB A;  4DIN B;  2MNG A;  2AUY A;  1W8Z A;  4XDP A;  1LOB A;  5A6Z A;  2GC2 A;  4TSV A;  1C8M 2;  1VAV A;  3MEP A;  2RR1 2;  5E88 A;  1IGO A;  1O4Y A;  3JD7 2;  5I0T A;  3WR0 A;  5J37 A;  4HAN A;  5CG8 A;  3ME2 A;  5IUQ A;  2Y6F A;  4AVS A;  3S0M A;  2XDV A;  4FTS A;  5C8C C;  1A34 A;  4QU1 A;  1WLT A;  2R30 A;  3RSJ A;  3PIJ A;  4V1P A;  4GA9 A;  4IEW A;  3NNG A;  4Z92 B;  2XR4 A;  3IDC B;  4AHW A;  5FYY A;  4QM8 A;  4QGL A;  1FOD 1;  5J1X A;  4WM7 C;  3BVC A;  3DKQ A;  1GNZ A;  3DEM A;  3NV2 A;  3W9A A;  1OI6 A;  4AI9 A;  3U0Z A;  3I2D A;  4YW6 A;  3VL8 A;  2SLI A;  3H1W A;  4HN0 A;  4XBN A;  4BYY A;  1DGL A;  1SCR A;  3AP6 A;  4QB6 A;  1LU1 A;  1E5R A;  2P37 A;  4AHY A;  2ZX0 A;  1KQR A;  1CAX B;  4EE2 A;  3PVO A;  2RS3 2;  5FYC A;  1GKB A;  1RUE 2;  4GJY A;  2ZAB A;  4JTN A;  4K21 A;  2BU9 A;  4CU8 A;  2JD4 A;  1FMD 2;  2RS1 3;  2Y6L A;  3TBD A;  4IET A;  1UXZ A;  2Y38 A;  1NA1 B;  3OG2 A;  4YZ5 A;  1FX5 A;  4U2A A;  2D6O X;  3ZFG C;  3PUS A;  4I01 A;  1SDW A;  4OFG A;  1Q56 A;  5FZ0 A;  1BJQ A;  4Z07 A;  3VZN A;  2ZGT A;  4HBN A;  3G6J B;  4FOW A;  2YG0 A;  3OEA A;  2OYZ A;  1ASJ 2;  4YW4 A;  4NHX A;  1D4M 3;  1W0O A;  2C6S A;  1TEI A;  3CL1 A;  3OBR A;  1JOB A;  3OUJ A;  1YQ2 A;  1FV2 A;  1NG0 A;  1GZC A;  1ND2 B;  3GCW A;  3PTY A;  5FPV A;  4YW2 A;  3KHC A;  2VR4 A;  1U12 A;  2YDE A;  1VR3 A;  3BTA A;  3KS7 A;  5F1R A;  4DXR A;  3URF A;  4PBO A;  2XJR A;  3VBO C;  1MS8 A;  3ELN A;  3DPR B;  3HQU A;  4GWM A;  4OI2 A;  4W65 A;  5FZ3 A;  1PZ8 A;  1QH7 A;  2GSY A;  3H0O A;  3Q8C A;  4P9X A;  4ERO A;  3BU0 A;  3I3E A;  4RR3 C;  1EYB A;  4HN1 A;  3WNK A;  4Y1Y A;  1UYY A;  1EV1 1;  5EJZ B;  4FQ4 A;  4LUK A;  2JX9 A;  2TNF A;  1ZRR A;  5A33 A;  3T2T A;  2X09 A;  1XC6 A;  3PME A;  4YFZ A;  1WW7 A;  1CWP A;  1Q8V A;  3LOI A;  3NMB A;  5IT6 A;  3RZK A;  1N3P A;  4CCD A;  5LZ6 A;  2BVB A;  5J48 A;  4LHS A;  1F31 A;  1O91 A;  4WZF A;  4R9D A;  1YRZ A;  2JDP A;  4V2V A;  1ULP A;  4YGD A;  2BJS A;  5FZC A;  1AR9 2;  2OA2 A;  5KBF A;  1DQ6 A;  3BGA A;  3SEE A;  1QXR A;  2WQ4 A;  2RMU 3;  2UYA A;  4XAA A;  5IWF A;  4QKF A;  2P6H A;  1JH5 A;  3OD0 A;  3NNL A;  4LBK A;  3R4S A;  4P9W A;  4IGO A;  3ZPO A;  1K45 A;  2UYB A;  2JDU A;  5CVR A;  4XUQ A;  3LA3 A;  5DDJ 1;  4M4P A;  1GNY A;  3LDR A;  4FVV A;  3A7Q A;  3Q8B A;  3SLI A;  2BGO A;  3VBS A;  3H8X A;  3R4D B;  5FLI A;  2BTV C;  4OHX A;  5AFE A;  4NOT A;  4XOG A;  3WNM A;  3GM8 A;  2TEP A;  5EJ3 A;  3WF4 A;  4HVQ A;  2VTX J;  4L8Q A;  3JB4 C;  1NY7 2;  4HON A;  1WCK A;  3B01 A;  4QQP A;  2ZAC A;  1VBE 3;  3FWE A;  5F37 A;  1W8N A;  3E5Q A;  4MGK E;  5BNO C;  3MIF A;  3VGI A;  3GJB A;  2XLA A;  2JG8 B;  2HEV F;  2AAC A;  2IXL A;  5LW9 A;  3E6C C;  1PX3 A;  2ORX A;  4LO7 A;  2BBA A;  3WF2 A;  4D7Y A;  3LAG A;  4FPK A;  1XYP A;  5JIU A;  2RM2 3;  2UY9 A;  3FX3 A;  1RUN A;  2WS9 2;  5JPN B;  1MZ6 A;  3HIF A;  1EV1 3;  3J8F 1;  5C7G A;  4WVZ A;  1AJO A;  2ZX1 A;  3OCP A;  1ND2 A;  5CFC C;  1GWM A;  4R4Z A;  2YFU A;  3IPV B;  4GAZ A;  3BOD A;  1L7L A;  4F7Z A;  3ZYP A;  3POW A;  5FWJ A;  4IEV A;  2V5Y A;  2XVL A;  3V65 A;  2HWB 2;  2OQ6 A;  3ORJ A;  3ACG A;  4BPZ A;  1BMV 1;  2CYF A;  4ZU7 A;  1POQ A;  4XDO A;  2Q1F A;  1RIR A;  3ST7 A;  4CUG A;  5A3U A;  4IV1 A;  1LEM A;  4HFS A;  2JE8 A;  3DN7 A;  3RNS A;  3MIC A;  4BLJ A;  3MI8 A;  4ISR A;  1H2L A;  5D8A B;  4FFG A;  4LBL A;  5FZF A;  2XOM A;  1V9U 3;  4B4Q A;  1UKR A;  1HQW A;  5C4W C;  4K8R B;  1O3R A;  1NCQ A;  1U5X A;  2LAL A;  4Q4V 3;  4QX3 A;  1HRV 2;  3FC0 A;  4R52 A;  2VE1 A;  1AXZ A;  4XJ9 A;  4XIK A;  3T3Y A;  2EAA A;  1RMU 1;  2W92 A;  4JGY B;  2RVA A;  4MGQ A;  4QPI A;  4B3N A;  3RZZ A;  1IS4 A;  3NAP C;  2WO1 A;  1G9C A;  1PVC 1;  4EN6 B;  2FCT A;  3PU3 A;  4MLO A;  4BQ3 A;  3WQB A;  4LKS A;  1XSQ A;  3MW3 A;  4L99 A;  4B7E A;  1AR8 3;  3DL3 A;  2WWS A;  3U07 A;  5JXJ A;  3KT7 A;  3PUA A;  1Z7S 2;  4QHZ A;  3BOP A;  1YNA A;  4LNV A;  4MXW B;  1J1L A;  2JEM A;  1CR7 A;  2ES3 A;  1GNH A;  3KVA A;  1W2O A;  1NUK A;  4H2A A;  5D8A C;  1GZT A;  2GNM A;  5FPB A;  4OMD A;  3TAY A;  4CP1 A;  3AZW A;  2HWE 3;  4CPB D;  3MZH A;  2UWA A;  4BK4 A;  2CWS A;  3OBA A;  3USU A;  1VBA 2;  2GP3 A;  3VBO B;  1IPJ A;  1RUG 2;  2MPF A;  3I7D A;  4XQD A;  1DYP A;  1XSR A;  2QQP A;  1UZ0 A;  2WLP A;  3HN1 A;  3VBR B;  2D6L X;  5A7W B;  1LRH A;  4QHO A;  2WFF 2;  5GLU A;  4IEX A;  4M0H A;  4QB2 A;  5FZG A;  2KD7 A;  2VOV A;  3U4X A;  3WNL A;  5FKB A;  2Z4F A;  4FPL A;  5HXV A;  1XU2 A;  4LTA A;  1A8M A;  4W8J A;  3OOX A;  1YFU A;  2WT0 A;  3M70 A;  2GH2 A;  2RM2 1;  3O1M A;  5A32 B;  1DHK B;  5GM0 A;  5I0R A;  2NMO A;  3LIH A;  1W0N A;  3GHM A;  3HOB A;  3MIH A;  3BB6 A;  4XFA A;  3MLJ A;  2YRO A;  2Q4S A;  3ON7 A;  4P9G A;  5K7P A;  1QH6 A;  4GH4 B;  5C4W A;  3X29 B;  2LRO A;  2WAO A;  5GZE A;  3ABZ A;  2N7G A;  4AAX A;  4AEM A;  1E5I A;  2IXK A;  3LA7 A;  2PAE A;  1DGW A;  1R09 1;  2VNV A;  1AR7 2;  3HBZ A;  5FZL A;  2DDU A;  2D3S A;  3VZK A;  2K0G A;  2WBK A;  3CJI A;  4XQW A;  3THC A;  3UKV A;  4YAR A;  2ZGN A;  5IVB A;  4LOT A;  2D3P A;  2DCY A;  3JB8 A;  2UY8 A;  2Q0A A;  1RUJ 3;  1I5P A;  3O0W A;  4GAL A;  4RS5 C;  1ZX5 A;  2A1X A;  2YC0 A;  1RHI 3;  1EUU A;  4P9J A;  4P02 B;  2X10 A;  2I07 B;  3VZL A;  4AFD A;  2WAA A;  3ZFF C;  1ZYB A;  5FZD A;  4R4X A;  4LQR A;  3TYJ A;  2IXC A;  1C3H A;  4EN9 B;  4FFH A;  4AR2 A;  2CDP A;  3FMG A;  2XLG A;  2OKX A;  3FFQ A;  1POV 3;  2CGP A;  1FMD 3;  2Z79 A;  3CJI C;  3HD8 B;  1VRH 2;  4D6Q A;  4Q4W 1;  3WQ0 A;  1GP5 A;  4LE4 A;  2Z5W A;  4QPG B;  2BNM A;  2L9L A;  2WNU B;  4M00 A;  3K51 A;  2XJV A;  5A7O A;  1O3T A;  2HKX A;  3EJK A;  1V6O A;  2RDS A;  5HPO A;  3LPG A;  3T2P A;  3PTR B;  1HJF A;  1NKG A;  2W1Q A;  1UPI A;  3F2Z A;  3M1H A;  5JXG A;  4ONU A;  2VO5 A;  2G19 A;  2XON A;  5F2S A;  5IW0 A;  4I02 A;  5L9R A;  5JAX A;  2QQI A;  4CDU C;  2VZV A;  1VJ2 A;  2SBA A;  3THP A;  3O14 A;  4HOO A;  2ADE A;  1AXY A;  2R06 1;  2WA4 A;  1DZR A;  3BPZ A;  1OOP B;  4HKW A;  5I91 A;  3V56 A;  2O8Q A;  2CU5 A;  1ENR A;  1R1A 3;  3NO8 A;  5CNA A;  5I0U A;  4CUB A;  4P9Y A;  1HXS 3;  5FY0 A;  1NZI A;  3RRD A;  2R7E B;  1WA4 A;  4NRO A;  4BQ5 A;  3TOJ A;  1MEC 3;  2WAB A;  2YC2 A;  3M3E A;  2C26 A;  5FZK A;  4YFW A;  5IFP A;  1OKQ A;  3UKN A;  4SBV A;  1FNY A;  4MGI E;  4Q8L A;  2JE7 A;  2JDA A;  4YGC A;  2JD9 A;  2PLV 3;  3DPR A;  1A8D A;  5L7O C;  1OLM E;  2W3J A;  3AMQ A;  2ERF A;  3ILF A;  4QQO A;  1UY1 A;  1JUH A;  3PVN A;  1QQP 3;  3J7L A;  4PDW A;  1HLC A;  5FCC A;  2B7Y A;  2ZGK A;  3DUI A;  3F95 A;  2O1Q A;  2WKK A;  3ZFG B;  2C24 A;  1JYW A;  4CTE A;  5T50 A;  1W8T A;  4N53 B;  4XUT A;  4ZON A;  3TNQ A;  1JZ2 A;  2D6N A;  4Q4Y 1;  4TLF A;  4UBG A;  3H7Y A;  2VCM A;  1CD3 G;  3ZO0 B;  3RWN A;  3MIE A;  1S2K A;  3P3N A;  3E5X A;  2XQX A;  2ZZJ A;  4HXC A;  3T0D A;  1AR6 1;  1FOD 3;  1ZVF A;  1ULF A;  4NO4 A;  1HN0 A;  5DAB A;  2JDN A;  1WUV A;  2Y6K A;  1U5Z A;  1NAE A;  4RN5 A;  4WVM A;  1HW5 A;  3ZSE A;  4Y1V A;  1GQG A;  2PFW A;  5JPM B;  1VE0 A;  3QBQ A;  4LK7 A;  2A75 A;  4C1W A;  5FMB A;  1S0J A;  3D5O A;  1A6C A;  3AYA A;  2WSU A;  2JDM A;  1LKN A;  3ATG A;  3KQ4 B;  3VDB A;  3W58 A;  4BB3 A;  1AUY A;  1AYN 1;  2NP0 A;  1XBF A;  4CDU A;  5FJK A;  4E4Z A;  3V64 A;  5DUU A;  4X8N A;  1YC6 1;  2RM2 2;  3ZYI B;  4HL0 A;  3NJX A;  2XBO 1;  4RQP C;  4CCK A;  5FY1 A;  5A7Q A;  2R16 A;  3AZV A;  3VBH A;  3SIS A;  1YCI A;  3QAC A;  1RYY A;  1I9R A;  4QGM A;  1JYN A;  5J36 A;  1PHM A;  3EO6 A;  3U37 A;  1F4A A;  2WNE A;  3FZ3 A;  2RMU 2;  3WXP A;  4A2U A;  4XE9 A;  1QJY 2;  2ZEW A;  2DCZ A;  3O1S A;  3WD5 A;  1DZQ A;  4FPF A;  2WNU C;  4QPG C;  1VBA 1;  2OUJ A;  1Q8Q A;  4QHB A;  4IEQ A;  3BIW E;  4PLO A;  1ALY A;  4PLN A;  2ZGR A;  4Y26 A;  5CIR A;  2Y0I A;  3G7D A;  1IKQ A;  1UZV A;  4IE6 A;  4I3G A;  1N1T A;  5DPN A;  4AED B;  1YFX A;  1QXJ A;  5J09 A;  4CDX C;  1RUI 2;  1H4G A;  3KCX A;  4YLZ A;  5JI7 A;  1V9U 1;  1LOC A;  1CAW B;  1WCD J;  2VW0 A;  2WRA A;  3I59 A;  3MW4 A;  5FYT A;  4OI1 A;  4LBQ A;  3ZDS A;  2ZEZ A;  4RS5 B;  2BBV A;  1IG0 A;  3HQR A;  2HWF 3;  4P14 A;  1RUD 3;  1RXG A;  4Q8K A;  3T4H B;  2X5I B;  3DYP A;  2MHF A;  4Y5T A;  3ZFE C;  5F3C A;  1CIY A;  5JR2 A;  1OA2 A;  2CSG A;  1C5I A;  3LEI A;  1WZX A;  5JMC A;  5F8P A;  2C9K A;  2J22 A;  2BFU L;  2R07 3;  1PVC 2;  4L9B A;  4XCB A;  2VVD A;  2B45 X;  5EP9 A;  4DZG A;  4ASM B;  4CU9 A;  1JZ6 A;  2Y6J A;  1DF0 A;  1X9T A;  4W6Y A;  5I93 A;  2CTV A;  4QD2 A;  1Z7S 3;  1HV1 A;  5LWB A;  4DNY A;  1VB2 A;  4LO4 B;  2ZGP A;  2XXZ A;  3KZ4 C;  2GAU A;  1VRH 3;  4CUA A;  2OQ7 A;  2PTM A;  4XHX A;  1SBF A;  3WSO A;  2O8O A;  5FMO L;  2EIG A;  4LMF A;  5FP8 A;  3I4I A;  1VBD 1;  2P34 A;  4DPN A;  5LRR A;  1V6N A;  3FLR A;  2QQW A;  2Z69 A;  3HMY A;  1AHS A;  3AB0 A;  1W9S A;  5LAT A;  3IMN A;  1ND3 C;  1DLL A;  1C4R A;  3H3L A;  5HCF A;  1UZY A;  1C5H A;  4Q29 A;  4A7Y A;  4FAG A;  1VRH 1;  1AR7 3;  2FZ1 A;  1MVE A;  2VUC A;  3GZT B;  2RS3 1;  1F4H A;  1G9A A;  1HRV 3;  4LUM A;  4BWO A;  1K3I A;  2J42 A;  4DXS A;  2R04 3;  3CEW A;  4BLI A;  2JDZ A;  3ZXG A;  3I2H A;  1NX9 A;  1W6Q B;  1X50 A;  2K46 A;  1ZZ8 A;  4IUG A;  3IM0 A;  3H50 A;  5LA0 A;  1QJX 2;  4CEW B;  5K9Y A;  1IS6 A;  1OQ1 A;  3IKW A;  1RUC 3;  3MPP G;  4LEJ A;  4QPG A;  4YWA A;  5EWS A;  3I2I A;  3VV1 A;  4EYU A;  4ISQ A;  3WV6 A;  2W1S A;  2GND A;  3LEM A;  1ODN A;  2WT2 A;  4LHL A;  1S0E A;  1OVP A;  2PEL A;  2AEN A;  4E9K A;  3IAP A;  1GQH A;  4M3C E;  1RL3 A;  3L2H A;  1LGN A;  2JWP A;  4QU2 A;  2IC1 A;  4CDX A;  2VNG A;  2VUD A;  3WVJ A;  1BXH A;  4CRQ A;  5IK4 A;  2NZ9 A;  3AJY A;  4F8A A;  3BYW A;  4LBM A;  5CZK A;  5T5J A;  4MVT A;  3ROU A;  3VHP A;  4XUN A;  1CJD A;  3NAP B;  1PIV 3;  4MHU A;  3WDX A;  5C9A A;  3FE5 A;  4Y22 B;  1WCU A;  4GKY A;  1NOV A;  2TBV A;  3J8F 2;  4DRV A;  4NRP A;  4RGG A;  2BFU S;  4Y1Z A;  2ILM A;  2E63 A;  3LSE A;  1B09 A;  2F4L A;  4UF0 B;  4BIF A;  5IJR A;  1GAN A;  1RMU 2;  4XFG A;  1CIW A;  1JYV A;  3I3Q A;  3WF3 A;  5T52 A;  1XJA A;  5F5A A;  1OPO A;  1NY7 1;  2IFR A;  1SLB A;  1O4T A;  3M7A A;  4FFF A;  1UZW A;  4CYD A;  4JQR A;  1SQ4 A;  5LBF A;  2AYH A;  4NAO A;  5K0U A;  5FQ0 A;  1HQN A;  4C1X A;  1ENS A;  2BP6 A;  4JKM A;  2GH8 A;  4YM3 A;  3ZXD A;  1Y7B A;  4AVT A;  3AP7 A;  3LB9 A;  2GP5 A;  3DYM A;  3POS A;  1PNF A;  4K1Y A;  4E2Q A;  4BQ2 A;  2PLV 2;  1H8T B;  4X6Q B;  4NIA A;  5C71 A;  2PQQ A;  3BTY A;  1O59 A;  2ZHK A;  2BW8 A;  1K5M B;  3RS6 A;  3H8O A;  1YLL A;  4AQ6 A;  2HWE 1;  1XE0 A;  3I3B A;  1WD3 A;  3VZJ A;  3J26 N;  2C1F A;  1V6I A;  2F4P A;  3UET A;  5KC5 A;  2JG9 C;  4B1L A;  1JZ3 A;  4NHY A;  1S55 A;  5FBZ A;  5JOW A;  4M3C A;  1GOF A;  3GBF A;  3KGZ A;  5CBL A;  1QIQ A;  2RDN A;  1J83 A;  1VPH A;  3OD4 A;  5I8Y A;  4H7M A;  5DZF A;  4AI0 A;  5A6Q A;  1WBL A;  2ATF A;  3MLL A;  1W8H A;  1EPZ A;  4GMP 1;  3FBY A;  1W8F A;  4LOS A;  2FMD A;  1AR6 3;  1OD5 A;  2XHN A;  5A3W A;  2GU9 A;  4HT1 T;  3E1F 1;  4LJH A;  4S2H A;  2YC4 A;  4JAA A;  4A6O A;  4QDS A;  4UFH A;  4HMZ A;  4JZR A;  5CU1 A;  5BYN A;  3H8R A;  4GH4 C;  2VQU A;  1LES A;  1HJG A;  1W06 A;  2WQ8 A;  4YM1 A;  2VAU A;  3ZXK A;  4FQZ A;  2GDF A;  1W28 A;  5LY1 A;  3ZN6 B;  4WVV A;  4J1X A;  1JZ8 A;  3VHN A;  5FR3 A;  2IXH A;  2VVE A;  1WME A;  4LKD A;  4MO3 M;  5HCB A;  3RDI A;  4NIH A;  1F9K A;  5FKC A;  5FFO C;  3ZSM A;  1D4V B;  3CKH A;  3N7L A;  1CX1 A;  1DP0 A;  1VAK A;  2WO3 A;  3HAG A;  4IQP A;  2F6B A;  4Q4W 2;  4XF3 A;  3VBU C;  4BCU A;  4A3Z A;  1GR3 A;  1UKG A;  1W6N B;  3VKL A;  1JYI A;  3T2Q A;  3VBR C;  3RGB A;  3DF0 A;  3HT2 A;  4YNI A;  2HWD 2;  1OF4 A;  1MEC 2;  1J3Q A;  5HV0 A;  2MEV 3;  3KWV A;  3WP4 A;  2PAM A;  1NLQ A;  4IV3 C;  4XUP A;  3RI9 A;  1DBN A;  1JYC A;  1UZZ A;  2VZR A;  4IGP A;  1BVV A;  3U1X A;  3VDC A;  4AW7 A;  1KXG A;  2QQN A;  1BLZ A;  3RYP A;  1ZZ7 A;  2IWG B;  2H0B A;  4ZZ5 A;  3SKV A;  4CXY A;  1LNS A;  3AZX A;  2J1E A;  4KBZ A;  3PNA A;  5F5I A;  1F35 A;  1LTE A;  2VTX A;  4K40 A;  5EJ1 B;  2I2S A;  1XQN A;  5FY7 A;  4KH9 A;  4QB1 A;  2R49 A;  1AL2 1;  5CG9 A;  4COW A;  1NQJ A;  4FO9 A;  3O1V A;  5KHH A;  2ZTN A;  4JGY A;  1AL2 2;  4Q5O A;  3WQ1 A;  4ZS3 A;  1YUD A;  3BIE A;  1HB2 A;  2JIC A;  4UWD A;  2VOK A;  4NHL A;  3RPQ A;  4DEV A;  5EYY A;  1T2X A;  4CP9 A;  2IXJ A;  4RHV 1;  1B35 A;  4XF4 A;  3KT1 A;  5A7N A;  4FP2 A;  4GWI A;  3ZX7 A;  1AL0 G;  1BK1 A;  1W8U A;  2RG4 A;  4OYU A;  1SBD A;  1W9T A;  4N43 A;  1W9F A;  4AHZ A;  4L11 A;  5DUX A;  4AI3 A;  4PQQ A;  5C8W A;  1PK6 C;  3PJQ A;  1NCR B;  1V00 A;  4XEZ A;  1XE8 A;  1KJL A;  5JDB A;  1ZRD A;  4DXT A;  1ZNP A;  2XL9 A;  4V2W A;  5FRE A;  1JOD A;  5ACA 1;  2VG9 A;  2ZEY A;  3VKN A;  5LRS A;  1UX7 A;  4URT A;  3LDB A;  1UO9 A;  1YFY A;  1WCQ A;  5C8C A;  2VGD A;  3DYO A;  1UOG A;  1C1F A;  1TE1 B;  1VP6 A;  2PLV 1;  1F5F A;  3V0B B;  1ULC A;  4GIQ A;  5FMD A;  5A3T A;  1C8M 3;  1CPM A;  3MF6 A;  2HWF 2;  4N7I A;  4PQ9 A;  4IES A;  2A6Z A;  2XUM A;  1WMD A;  3IDA A;  3M3Q A;  2YBP A;  5FZE A;  5FO7 B;  2VXJ A;  3FUO A;  2FHR A;  1H6Y A;  5C3S A;  4XHB A;  2WZR 3;  5JSP A;  5DN2 A;  1H4H A;  2P17 A;  3LFI A;  3KV5 A;  2BPA 2;  2VZO A;  3CMG A;  1LOD A;  2UWC A;  3MYX A;  4CE8 A;  2YMZ A;  2R06 3;  4CCO A;  2P4E A;  1RIN A;  4Y5S A;  4EN8 B;  1OBN A;  1DGR A;  2VMG A;  5A33 B;  1REE A;  1S2B A;  4TN7 A;  5FP7 A;  3NWK A;  3ETP A;  5DAQ A;  3NAP A;  4FOQ A;  1PK6 A;  4IE0 A;  5T54 A;  2VBD A;  1S0C A;  1UN1 A;  4SLI A;  2ZAA A;  4UW4 A;  3LEG A;  3Q8F A;  5FV3 A;  5T5P A;  1M4W A;  1VBD 2;  2VXR A;  1KS4 A;  4HG6 B;  1H9W A;  1LOE A;  3GAL A;  4IL7 A;  3D3A A;  1TNR A;  3B9C A;  1H8V A;  1POV 1;  1LED A;  2BWC A;  1COV 1;  3JZV A;  4K20 A;  4QX7 A;  4CP2 A;  1BMV 2;  4OZX A;  3ACH A;  3LQC A;  4NPR A;  4XVH A;  2GN7 A;  1ZBA 2;  4JGY C;  4CDX B;  4J1W A;  2XBO 2;  1PM4 A;  3IMM A;  2A6W A;  1ASJ 3;  4A7K A;  1F5J A;  2XWJ B;  4AFA A;  5K8S A;  3PVE A;  4R9C A;  3RYK A;  4MOA A;  1JU4 A;  1QMJ A;  4YZ4 A;  1H0B A;  3S6P A;  2IZW A;  3I8T A;  2RMU 1;  2E6V A;  2X5I A;  3Q8E A;  4IE7 A;  1NA1 A;  4CCJ A;  2OT7 A;  4ASL A;  2NQY A;  4PLM A;  4YSF A;  5KXE A;  5FWE A;  1TMF 2;  4JDM A;  1QKQ A;  4HPK A;  5FZI A;  1COV 3;  2EAL A;  1O4Z A;  1QJZ A;  4YG3 A;  4HSL A;  1CZT A;  3WW1 A;  5C3P A;  4O65 A;  2ZHM A;  4LBN A;  3U11 A;  4NII A;  3I3D A;  1PIV 2;  4PI0 A;  2JXA A;  1O3S A;  4LUL A;  2FDH A;  1QHD A;  4BIS A;  2VCA A;  1EUT A;  1ULE A;  2QDR A;  5CKQ A;  5JCT A;  1VBE 2;  2CAU A;  3DKW A;  4LIT A;  5DDJ 2;  4J6G A;  5CFC B;  2VC9 A;  5LA2 A;  4RSU A;  1PGW 2;  1AYM 1;  4LBJ A;  3OGR A;  3HN3 A;  2ZMN A;  4P08 A;  1JHN A;  5D21 A;  3KM5 A;  1DG6 A;  3WIN E;  1VIW B;  2ZKN A;  4IEZ A;  3OBZ A;  4XZU G;  5ANN A;  4C0B A;  2G9G A;  1Z7S 1;  3ZOI A;  3VBH B;  1SFP A;  3PU8 A;  4XJU A;  1XNA A;  4F83 A;  2Y6G A;  4KU8 A;  3VZO A;  3RI8 A;  1LUL A;  3ZSJ A;  2XQR A;  2XHK A;  5IVF A;  1OFS A;  3FHA A;  4O61 A;  1JZ4 A;  3ZMO A;  5BNP B;  2DFB A;  4YRD A;  1UY3 A;  2QJV A;  2CAV A;  1UMH A;  1W9Y A;  1QJX 1;  2ZKL A;  3LSD A;  4Q0P A;  4XF1 A;  1ACC A;  2D93 A;  3ECQ A;  2YU1 A;  1GZW A;  4HK9 A;  4XMI A;  5DG1 A;  3T1L A;  2ZX4 A;  2D5H A;  4L92 A;  2QE3 A;  4YVS C;  4QQH A;  1RJ8 A;  4G4F A;  4DQA A;  4EV0 A;  1AR9 1;  1VBC 1;  1WCS A;  1CZS A;  3UES A;  5HI0 A;  4EWE A;  2CL2 A;  3PUR A;  5JUV A;  1W6M B;  5JLV A;  2J1V A;  4AGR A;  5ABJ B;  1OLQ A;  1FNZ A;  1QF3 A;  1LU2 A;  1SLL A;  2R6Q A;  3BTX A;  5FYZ A;  2VM9 A;  3RZL A;  1IQD C;  3MFC A;  1PNG A;  1Y9G A;  2P5B A;  3VDA A;  1RMU 3;  1WA6 X;  2BV4 A;  3AKT A;  1H30 A;  3L2Y A;  1CAV B;  4D3W A;  1XND A;  3WCR A;  3WP3 A;  2H6B A;  1HRI 1;  2DF7 A;  3ES1 A;  4ZU5 A;  3ZN6 A;  5J7M A;  2OUH A;  4HVO A;  3T09 A;  2WLQ A;  4XCA A;  4TTG A;  3LKJ A;  4GWJ A;  5LB6 A;  2J7M A;  1S0F A;  5LK5 A;  2G1M A;  3H1M A;  2VU9 A;  1D2S A;  5A80 A;  4AI2 A;  2FDF A;  2HWC 2;  4CDW A;  1I3H A;  3KV6 A;  3T0A A;  5FRA A;  4CDU B;  3DPR C;  1C1L A;  3C7F A;  5CYY A;  3HBK A;  4YW7 A;  4AOC A;  1EP0 A;  1JW6 A;  1UPS A;  4MV2 A;  1HN1 A;  2WII B;  5SV5 A;  3VN4 A;  4ATE A;  4CCM A;  1AX2 A;  2OVU A;  3B93 A;  2EID A;  4HET A;  4Z82 A;  1V9U 2;  4TWT A;  5A1F A;  3K3N A;  1UL9 A;  4PBP A;  3WDT A;  1FI2 A;  2Y34 A;  3NST A;  2ZAH A;  4HZF A;  4I3P A;  1UAI A;  1QJY 1;  4S2D A;  1LB2 A;  2CY6 A;  4FXG B;  5F5Q A;  4CCE A;  5KXC A;  1GBG A;  1EPW A;  2E26 A;  1ZRC A;  4XPV A;  5FPL A;  2FZ2 A;  4XBL A;  5L19 A;  2WNO A;  2WZR 1;  2VW1 A;  4QWN A;  5CB7 A;  3C8X A;  5IVJ A;  4A4A A;  1DZT A;  5B4N A;  1H8T A;  4Q26 A;  2ARB A;  3N9O A;  3Q9O A;  3VD4 A;  1VBE 1;  2ENR A;  3C2U A;  1C8M 1;  3WOG A;  1A3K A;  3E97 A;  3HJR A;  4JX0 A;  5LBC A;  1OFN A;  4XJ8 A;  3ZDV A;  1BEV 2;  3ZFG A;  4YGB A;  2WT1 A;  5B2G B;  3ACI A;  5APA A;  3AK0 A;  1LEC A;  1TQ5 A;  3WP6 A;  2FCV A;  4QPY A;  5A6X A;  1DDL A;  1QJU 2;  1IS3 A;  3K77 A;  2AEZ A;  5FY8 A;  1YQC A;  1OQD A;  1R08 2;  1VMJ A;  2BNO A;  2X8K A;  1SAC A;  1JBC A;  2RR1 1;  3BPS A;  2ZGL A;  2Y6H A;  4E4H A;  1RUH 3;  5CFD A;  1RUJ 2;  2P6C A;  4KU7 A;  4CEY A;  2VOX A;  2X05 A;  2CWM A;  4DRR A;  3B94 A;  2GC1 A;  4B4P A;  1UXX X;  2CHH A;  2JG9 B;  3JD7 3;  3P1I A;  4AVB A;  4BQW A;  2V73 A;  4Y22 A;  4Y4R A;  5IHR A;  1Q8P A;  4X8P A;  3LPF A;  1OOP A;  1TMF 3;  1S0B A;  2ZGQ A;  5L73 A;  2A73 B;  2VH9 A;  4P9L A;  3S5A A;  1H6X A;  2QQU A;  3NJY A;  2A6V A;  1GWL A;  1JS9 A;  1MVQ A;  4QXK A;  5L7O B;  1S1A A;  3GBG A;  4PJY A;  1Q3E A;  5F9T A;  3O1U A;  1S2E A;  3MID A;  3LGR A;  5E89 A;  3VBF B;  4BQX A;  1NXM A;  3AXE A;  5IAT A;  3O1R A;  2RS5 2;  2XVG A;  3D4K A;  2QQL A;  4Q0S A;  1OA4 A;  4AI8 A;  5L36 A;  3V0A A;  1VBD 3;  2HH9 A;  1XNT A;  2Q1M A;  4BA6 A;  1VBB 1;  5C3R A;  1O6U A;  3N9N A;  1D7P M;  4MAD A;  4UW3 A;  4Y24 A;  4PIY A;  5GLW A;  1U5I A;  4KQ7 A;  2W0X A;  3PUI A;  4U36 A;  1OOP C;  2D98 A;  3HNM A;  3IT8 A;  4G9S B;  4QX8 A;  3SMH A;  1LOA A;  2Q8O A;  3ZXF A;  4RGA A;  1ZBA 3;  3S30 A;  4A7Z A;  4CP0 A;  1SFN A;  3ZVX A;  1IPS A;  1FMD 1;  5J98 B;  2JG9 A;  4I0W B;  1JI6 A;  1PZ9 A;  3NV4 A;  3VD3 A;  3HEI A;  4QX2 A;  4YYO A;  3SH5 A;  3UYJ A;  5JI9 A;  2P3I A;  5DZG A;  1UX6 A;  2ET7 A;  1PO1 2;  1H1M A;  1ZZ6 A;  4UYB A;  4JQT A;  3M8L A;  4FPE A;  1RUF 1;  1R08 1;  2WSV A;  1W8W A;  1MR5 A;  3O12 A;  3USU B;  1IKP A;  2HBT A;  4BIO A;  4AE2 A;  1K42 A;  1YEW A;  1FPN 3;  3S5Q A;  4A45 A;  1RVF 1;  4CP9 B;  2PQS A;  5KHG A;  1ZBE 3;  1GOG A;  2YPJ A;  1LGB A;  3CJI B;  5JXH A;  2HWC 1;  2BNN A;  3MDP A;  4YM0 A;  1HRI 3;  5JXI A;  2GNB A;  1BKZ A;  3K46 A;  5GKA C;  1WKY A;  4XZP A;  1LHU A;  3FJS A;  4XET A;  1OLM A;  4HSJ A;  1KGY A;  4CCL A;  3B00 A;  4ORF A;  4BHP A;  4LKF A;  4URA A;  2PHR A;  1CAV A;  5JVV A;  2DVG A;  2FDK A;  2W08 A;  1OC1 A;  2RJ2 A;  3OF1 A;  4YW5 A;  5GJ6 A;  1RUC 1;  1FV3 A;  5A3O A;  3OYW B;  4DXZ A;  1DYK A;  1TME 1;  4XFH A;  4CU6 A;  5A32 A;  5CFD C;  1SBE A;  5IK5 A;  3AYE A;  4GUL A;  2BEO A;  1VMH A;  4LO6 B;  4MET A;  5A7W A;  1W8O A;  1E57 A;  3D82 A;  3H7J A;  1OA3 A;  1CAW A;  2HEY F;  3OB8 A;  1R1A 2;  2EXJ A;  3VDD A;  4FI9 A;  1N1S A;  4KMQ A;  4E27 A;  5EIY B;  2BUK A;  2FCU A;  5FYH A;  3NQH A;  1YIF A;  2BGP A;  3AM2 A;  1ZZ9 A;  4ZHN A;  1OUR A;  3VHO A;  1KFX L;  3B3Q E;  4AEJ A;  4AG4 A;  1O7F A;  2DCJ A;  3TN9 3;  2C5D A;  4IW3 A;  3WF0 A;  4BQ4 A;  4QPI C;  2Y60 A;  1XYN A;  1ZRI A;  1PO2 1;  2YBK A;  4AEK A;  5TSW A;  4XFC A;  4XTM A;  4DUV A;  1W90 A;  2VEC A;  2W47 A;  2JB4 A;  5C9A C;  1QQP 2;  3JBG 2;  4FFI A;  4JGZ B;  3RZM A;  2Q8C A;  4D6R A;  1G9F A;  5GAL A;  3WDW A;  3R0R A;  1T6B X;  4GB3 2;  4PF5 A;  1JOP A;  2WR9 A;  4OI4 A;  1F2N A;  1G6N A;  2JEN A;  3CIH A;  4LE3 A;  5KC6 A;  1RB8 G;  4LT5 A;  2LUW A;  4HKO A;  3GCX A;  5FZA A;  2D7F A;  5DXD A;  4AF9 A;  4YVS A;  3CHX A;  5H9R A;  1HIX A;  3FLT A;  3CU7 A;  4N8M A;  4R9B A;  2E7Q A;  2AEY A;  3R4U A;  5A3N A;  4FAH A;  3LOB A;  4KG0 A;  4DS0 A;  4PIX A;  1JN2 P;  1NCQ B;  2VJX A;  1PGS A;  4EJR A;  3SH3 A;  2Y33 A;  3NKG A;  2AC1 A;  4XXP A;  4CDQ C;  1DLC A;  3ES4 A;  3N9P A;  2VOT A;  1BEV 3;  1UOJ A;  4UFL A;  4AK3 A;  3KMH A;  2QUO A;  3TEY A;  3GF6 A;  3III A;  2HWC 3;  2VZ1 A;  2Z2S B;  2WDB A;  4B1M A;  4C8D A;  4IV1 C;  2A7A A;  5FMC A;  3VBS C;  4AYU A;  1LOG A;  2Q30 A;  1Q8O A;  3WDY A;  2W39 A;  1SDD B;  2WUH A;  5FZ6 A;  3GJA A;  2QFE A;  3GZA A;  4W50 A;  4NWW A;  4AQT A;  4CDQ B;  4WM7 A;  4LO8 A;  4CA9 A;  1X9P A;  2YV8 A;  3TWI A;  1D0H A;  1NCQ C;  4CU7 A;  2WNV A;  3IBM A;  1NE6 A;  2BER A;  4UW6 A;  1MS0 A;  3J7M A;  1QOO A;  2R07 2;  4RQP B;  4XJZ A;  4ARY A;  4CEW C;  4A44 A;  2IFW A;  4NHK A;  4COZ A;  2R04 1;  2KA3 A;  4XAE A;  5FZO B;  2DVA A;  1HRV 1;  1QOS A;  3NVC A;  3LWC A;  1VMF A;  4RA0 A;  4F3J A;  4EZH A;  5BXX A;  4YW3 A;  1Y43 B;  1PO2 3;  2WA3 A;  3WEZ A;  4WVW A;  5HCA A;  5D1I A;  1DU3 D;  2A3X A;  2NN8 A;  2QKD A;  1GV9 A;  4M0N A;  3WG3 A;  5AVA A;  1IG3 A;  4XUO A;  4FTB A;  4TXW A;  1MS1 A;  1YFW A;  3D0S A;  4FSJ A;  2XML A;  5A6Y A;  2UU8 A;  3K75 B;  4YVW A;  5FZ4 A;  4A42 A;  5C9A B;  2W1U A;  4CXW A;  4OHZ A;  2V4A A;  4IER A;  4JV4 A;  2FDG A;  4W6X A;  3D8C A;  1QJU 3;  1V6M A;  3RZJ A;  2NYY A;  3OJB A;  2VUA A;  1W6O A;  2DVF A;  4C91 A;  2XUE A;  5C6C A;  4FP3 A;  5E8A A;  1APN A;  2ARE A;  5L9V A;  2XJU A;  3QLQ A;  4Z8B A;  1DFQ A;  1TME 3;  3N36 A;  4Z2A A;  1UY2 A;  4YZ1 A;  5BNO B;  3MLK A;  4BDV B;  2W5F A;  2YGM A;  5F7U A;  4Q4Y 3;  3I54 A;  3KV9 A;  5DQ0 A;  1JXN A;  1RUG 3;  4YG6 A;  2HWF 1;  2OX0 A;  1PIV 1;  2ZMK A;  4QKN A;  3Q8A A;  2JEC A;  1H1I A;  2R0H A;  3RZG A;  4AVV A;  1YQ6 A;  1KEX A;  2AR6 A;  3ALQ A;  3KVB A;  1NXD 1;  2JIG A;  4MHR A;  4CDQ A;  3GNE A;  3JBG 1;  4C90 A;  3MW2 A;  3R6S A;  3ASI A;  4FPJ A;  3VL9 A;  1BEV 1;  5BNN A;  3M3C A;  1X33 A;  2GMP A;  5ANQ A;  4JRA A;  3AP5 A;  1W2A X;  3MO4 A;  4OI0 A;  3DGT A;  4XUR A;  5C8C B;  1C8N A;  1R08 3;  4MYE A;  4Q0U A;  2QQJ A;  4OVE A;  2X29 A;  4QKD A;  1JZ7 A;  3WNO A;  1Z0H A;  2Q1Z B;  1C28 A;  2WZ8 A;  3ENR A;  3EYP A;  2J1A A;  3ACF A;  5K0U C;  1ODM A;  1YI7 A;  2VY0 A;  1NCR A;  5FOB B;  1R64 A;  5M0T A;  4A3X A;  5EPA A;  2E31 A;  5FO8 B;  3TEZ A;  1WW6 A;  4H7L A;  5I0D A;  5AC9 3;  4RGK A;  4CVU A;  5F2W A;  1QJY 3;  4RQP A;  3MBW A;  5FP3 A;  3KQR A;  1GZ9 A;  4LXL A;  4CPB A;  3TB0 A;  1XOY A;  3HNY M;  2I45 A;  1UMZ A;  1RUC 2;  2BVV A;  1PMH X;  3C7G A;  2A3Y A;  3JCI A;  1W2T A;  1GSL A;  2B8M A;  2QQK A;  4BE3 A;  4Y5Z 0;  4N43 C;  4GZ9 A;  1RHI 2;  4J25 A;  3WG2 A;  1PGL 1;  5C5U A;  1MS4 A;  2NPI A;  2PN5 A;  4L97 A;  5BNN C;  2GZW A;  2YZ4 A;  1Y9M A;  4XIO A;  2DVD A;  2XJQ A;  4OQ8 A;  2R0F A;  1IOA A;  1RUE 1;  2YYO A;  4DO0 A;  3P6B A;  3WW2 A;  5CAZ A;  4QAW A;  2R07 1;  2LS6 A;  1YQ8 A;  2FDJ A;  3CO2 A;  1WW5 A;  2YUE A;  3OBT A;  3SKJ E;  4QT6 A;  4A41 A;  1ND2 C;  5IYY A;  1JMU B;  2OZJ A;  1J3P A;  2BRT A;  3AXD A;  2OPK A;  2IUW A;  4JHZ A;  4GJZ A;  2WN2 A;  3I3M A;  1YI9 A;  4N90 A;  1VRB A;  1VAL A;  5KWR A;  1PVC 3;  1WGP A;  3LFM A;  2RJK A;  3R05 A;  4E4D X;  3KV4 A;  1UYX A;  4B7K A;  1V6K A;  5T3N A;  1YHF A;  3WHU A;  3GGL A;  2DCK A;  4XAB A;  3HVD A;  1GP4 A;  5GZC A;  3TEW A;  2KXL A;  3HPN A;  4NIG A;  4JGZ A;  1YYN A;  4L0P A;  4Q2F A;  4B29 A;  3MUY 1;  4KWK A;  3T0B A;  1G9B A;  1OT5 A;  4ET7 A;  3AYD A;  1HB4 A;  3U4S A;  1K5M C;  1J3R A;  2HYX A;  1G7Y A;  3ZFE A;  3WLU A;  2BOJ A;  3WW3 A;  1H8T C;  5HBA A;  2JIJ A;  3AFK A;  5FK8 A;  4I30 A;  1WBF A;  3T4V A;  5JOX A;  2PHX A;  1YXW A;  1IQA A;  4UT5 A;  4WM8 B;  4IXL A;  4XBQ A;  5IVV A;  2ZJC A;  3U14 A;  4IEU A;  3ZYH A;  3I2J A;  1SPP A;  2R1D A;  5B4X A;  5JSO A;  1X8M A;  3IWZ A;  2ZGM A;  3VDD B;  4FCA A;  4PIZ A;  3WQ7 A;  2DU1 A;  2ZHN A;  3LA2 A;  4XIL A;  2HWD 3;  2QQV A;  3U10 A;  3K3O A;  2JB8 A;  1ONA A;  1K5M A;  1SFY A;  2DFC A;  5F3E A;  2EIC A;  2QQO A;  3H1Y A;  3WUD A;  2VQT A;  2WL1 A;  3TN9 1;  4EN7 B;  4N9I A;  2H0V A;  4QX1 A;  5FJH A;  4AGV A;  4BQ1 A;  1HB1 A;  1OH3 A;  5T55 A;  4KL1 A;  2VME A;  4MGY E;  3UKT A;  2KR2 A;  5FYS A;  1I1E A;  4Y4Y A;  4JRL A;  5IFT A;  4N53 A;  5GLV A;  3NKT A;  4JTO A;  5FQ0 B;  5AC9 1;  3KD4 A;  2A3W A;  2HBU A;  3MUZ 1;  4WBB A;  4Q1R A;  2W1W A;  1XE7 A;  3VZM A;  4DIQ A;  3BUC A;  3SNM A;  2RJL A;  1LJ7 A;  2ID4 A;  2QBX A;  3RG0 A;  2G9Z A;  3JD7 1;  3JQX A;  4LIU A;  5G05 L;  1E5S A;  2WYS A;  3C7O A;  4ZY9 A;  1WW4 A;  4UF0 A;  3I2O A;  4XF9 A;  3N4M A;  2A5Z A;  2IVJ A;  3NV1 A;  4K3U A;  1G8W A;  3AVS A;  3WDU A;  4NMI A;  1M06 G;  5D2A A;  1OUS A;  1N3O A;  1L7R A;  2AZ5 A;  1BCX A;  2PA7 A;  4BK5 A;  2VW2 A;  5GLT A;  3TNP B;  4O9G A;  4D8M A;  4O9E A;  1RVF 3;  1XNB A;  3KCC A;  3HWJ A;  5T5L A;  3SCF A;  4CSW A;  2B42 B;  4XXA A;  1H1A A;  3UGH A;  2LRP A;  3HNB M;  1ZRE A;  3IDE A;  4EN0 A;  2YY1 A;  4HLT A;  2PHU A;  2B5H A;  3GXU A;  5C33 A;  2VL4 A;  5CIS A;  3KLS A;  5FYB A;  3ILR A;  1Y4W A;  3GBW A;  5FYM A;  2GN3 A;  2PHD A;  2BDR A;  3DCQ A;  3O0V A;  2W95 A;  4NPL A;  3AMP A;  4ZZ8 A;  4MXV A;  2PHL A;  4NRM A;  5LA9 A;  3WP5 A;  4AI1 A;  1GQP A;  1ZBA 1;  2WWJ A;  1W6Q A;  2RS3 3;  3JU9 A;  4UBH A;  3W20 A;  4JVA A;  3B7M A;  1NYW A;  3FLP A;  5BNP C;  4AFB A;  5BPX A;  3VBF A;  4COY A;  4RL7 A;  1GYK A;  4M4R A;  4NAM A;  1OPM A;  1VBB 3;  1J59 A;  5L7O A;  3VUO A;  1MQT B;  2OS2 A;  3EBR A;  1YJL A;  4ZXE A;  4JDO A;  5JIA A;  2VMF A;  3IAQ A;  2AH2 A;  4XJW A;  1B35 C;  5EQU A;  2ZBJ A;  1GLH A;  1MS5 A;  5FXV A;  1D4M 2;  1Y3T A;  2EXH A;  4ATF A;  2F17 A;  2C4X A;  1QU0 A;  3WNX A;  4KG8 A;  1OQE A;  4XJA A;  1D4M 1;  3PDQ A;  2KM2 A;  2D44 A;  4QX5 A;  1TNF A;  1ZA7 A;  3SHR A;  1DCS A;  4E2G A;  3RVH A;  5CKM A;  1GWK A;  3DV8 A;  3KCY A;  2VZ3 A;  3OGG A;  4NHM A;  4YVW C;  2GMM A;  3FFZ A;  1N47 A;  2RHP A;  1NCR C;  1L7Q A;  1V6L A;  4GH4 A;  3OY8 A;  3PHM A;  4HK8 A;  3ZMN A;  2DBI A;  1ENX A;  3MHZ A;  3OUI A;  3N7M A;  4OZO A;  1PZ7 A;  4QXH A;  4YW1 A;  2OII A;  2RE9 A;  4CDW B;  2W94 A;  4QQL A;  5F6K A;  5HXM A;  4PF1 A;  4LK6 A;  4OUL A;  5J96 B;  3BN6 A;  1J84 A;  2HWB 1;  3APB A;  2WNV B;  4IDZ A;  4UFM A;  3ZKU A;  3N9Q A;  4QXC A;  2EXI A;  5C70 A;  4LBQ B;  2D6M A;  4OMC A;  2ZS6 B;  1WLW A;  2ET1 A;  4MH0 E;  2GC3 A;  2EIE A;  2MEV 2;  3BKZ A;  3FUQ A;  4RFT 0;  3N7K A;  3UJQ A;  3ZYF A;  3WW4 A;  1PO2 2;  2EAK A;  2Q8E A;  4TYS A;  3SH4 A;  1AR9 3;  1CZV A;  3RFR A;  1W2U A;  3AJZ A;  1MS9 A;  4GQ7 A;  4R8H A;  3OGS A;  3VBR A;  3O7O A;  3SXW A;  1CES A;  2HEW F;  1CAX A;  1REF A;  4MGZ E;  3IIA A;  5JSR A;  2NMN A;  1QJX 3;  5ERL A;  5FPZ A;  1C57 A;  1SPP B;  4AVA A;  5DZE A;  2GNT A;  5FUN A;  4RR3 B;  2GME A;  1FAT A;  5FIX A;  5LBB A;  3AKQ A;  1QNY A;  1AYN 2;  3I2G A;  1GUI A;  2D40 A;  1W04 A;  5IK8 A;  2XPJ A;  4WZC A;  4NR1 A;  4NUB A;  2JDH A;  4BM8 A;  4PHZ A;  3AC0 A;  2FD8 A;  2RS1 2;  1US2 A;  5BY5 A;  4OUM A;  3VBF C;  2XBO 3;  1QXP A;  2DTY A;  3CNA A;  2VTF A;  5FMO S;  3RJ2 X;  3B5L B;  4KWL A;  4OLL A;  3MIG A;  1TME 2;  3SCG A;  1ZZC A;  5JZG A;  3O1P A;  4LBQ D;  5A3M A;  4RFR B;  4BQY A;  4QPW A;  3ZSL A;  2B46 X;  5E16 A;  1X36 A;  1CN1 A;  4E8C A;  4BME A;  3M3O A;  3NNM A;  4QPI B;  4RS5 A;  2BOI A;  3OEB A;  4I2O A;  1CGP A;  5ABJ A;  1MAC A;  1VAM A;  4PI2 A;  1COV 2;  4Q4X 2;  5FYU A;  1OD3 A;  1U0A A;  1BVP 1;  2DUQ A;  5DMY A;  5FXX A;  3J7N A;  1QY4 A;  1POV 0;  3P3P A;  2ZCW A;  3BTZ A;  1UMI A;  2ZOE B;  1ULO A;  2B9U A;  3I2F A;  2Y0O A;  4I09 A;  4NID A;  4MSV A;  3K4A A;  2OXB A;  4X6R B;  2NLR A;  5FZM A;  4AL9 A;  2RDR A;  3GYD A;  3QOP A;  2HWB 3;  5DDJ 3;  1GU3 A;  3T08 A;  4I0A A;  4QXB A;  4D94 A;  2WZR 2;  4MUV A;  4OHY A;  1GZW B;  4HPK B;  1UCX A;  2VNO A;  1VBC 2;  2P1B A;  3IZO A;  5BNP A;  3GHN A;  4K9S A;  5FZB A;  2R06 2;  5IAV A;  1HDK A;  3A22 A;  4DY3 A;  3KSC A;  3LF7 A;  4TLG A;  5DAX A;  4P5H A;  2VCC A;  3AL5 A;  3SIT A;  3WUC A;  1JOJ A;  1FPN 1;  4K1Z A;  5EHD A;  4FT8 A;  5FXW A;  2FDI A;  3U78 A;  3I49 A;  2ADD A;  4S2G A;  1V0A A;  2O0O A;  3ZR5 A;  1BYH A;  3FHQ A;  4KGQ A;  4E2S A;  2QZ3 A;  3CDZ B;  1SHW B;  2PXJ A;  3IDB B;  2XB6 C;  5LEK A;  2ZPX A;  2J1U A;  2DTW A;  4H14 A;  1KFU L;  3DXU A;  4RR3 A;  3K2O A;  3PUQ A;  1JZ5 A;  1NLR A;  3T30 A;  3OUH A;  5G04 L;  1AR8 2;  4LIV A;  1ZZB A;  3AL6 A;  3DXT A;  3HR9 A;  4BXF A;  2HJI A;  4PCR A;  2ZXQ A;  4AQ2 A;  1EAH 3;  3W5N A;  1G9D A;  4NRQ A;  5FYI A;  3UGF A;  3ZYG A;  1MQT A;  1VBB 2;  2D5F A;  2E7A A;  3DEC A;  3EB7 A;  1RED A;  4AQS A;  1RC6 A;  4K8F A;  1FOD 2;  2ARX A;  1I6X A;  3J4U H;  2WS9 3;  1MZ5 A;  4PT6 A;  4Q4W 3;  1AF9 A;  1IHM A;  4P5Y A;  4CCC A;  5JWP A;  1DQ1 A;  4IV3 A;  1SMV A;  1S0D A;  2QQM A;  2ORZ A;  2EVX A;  4PDW B;  5JZG C;  2W91 A;  1XXN A;  2D6K A;  3VKM A;  2WC2 A;  4WV8 A;  2Q5T A;  3OTF A;  3KT4 A;  2RS1 1;  3ZPY A;  5I8S A;  2ZX2 A;  5A3L A;  2ZGS A;  1W6O B;  3UV9 A;  3H42 B;  4QM9 A;  5FAX A;  1X7N A;  2G9F A;  3LCP A;  3ZFF A;  1PK6 B;  5F3G A;  2P2K A;  3SEP A;  4C0H A;  5C3Q A;  4YVW B;  3B9I A;  4JCK A;  1AVB A;  2C9A A;  4IND A;  3AZY A;  3CZJ A;  1VB4 A;  5F5C A;  5FUI A;  1SCS A;  4FTE A;  5DAV A;  3FBM A;  4DOU A;  2QNK A;  5FY5 A;  3UNP A;  1PM7 A;  4PDW C;  1XNK A;  5JZG B;  3EQE A;  3RMY A;  2VD7 A;  3MPB A;  3K4Z A;  4FBF A;  4MGT A;  1AL2 3;  3BCW A;  1B35 B;  3VBH C;  2VCB A;  3O0X A;  1Y9Q A;  3POG A;  3AMH A;  1UOB A;  4KGG A;  4QKB A;  2YB7 A;  4GXL A;  4Q0V A;  4Z1V A;  4L2N A;  2DUP A;  5BV6 A;  1FXZ A;  1AJK A;  2VMD A;  3AX4 A;  3N9M A;  2RS5 3;  3PL0 A;  3O1O A;  1EAH 1;  3M3I A;  2WNU A;  3ZR6 A;  1LHN A;  3S7E A;  2WQZ C;  4LA3 A;  3T1M A;  1LAJ A;  1BQP A;  2BWA A;  4XFF A;  5HV4 A;  2XGX A;  3A21 A;  1DGR N;  2WN3 A;  4FPY A;  4XW3 A;  1V70 A;  4XAC A;  4DEQ A;  2VUJ A;  5E6H A;  3QD6 A;  4LA2 A;  2QZ2 A;  2VQ0 A;  3AMN A;  3O5S A;  5F6L B;  1MPX A;  4IEO A;  1JYX A;  2HWE 2;  3LE0 A;  3N9L A;  3ZLI A;  3NL1 A;  3SCH A;  1W6P B;  2DUR A;  3KF3 A;  1CX4 A;  1R09 2;  1FPN 2;  3QCW A;  4Y20 B;  1KS5 A;  4Q1P A;  3VBO A;  2WFF 3;  2VQA A;  4LBO A;  1SLT A;  2CDO A;  3T2O A;  2JKX A;  5C4W B;  3IB3 A;  1UNB A;  1HRI 2;  1UYZ A;  2PAK A;  2PMW B;  5IVC A;  3W5M A;  2UUR A;  5ACA 3;  4WM8 A;  3THD A;  2Y8K A;  5AFB A;  2YHJ A;  1AZD A;  2ZX3 A;  2Q8D A;  3ETQ A;  1K5J A;  3POE A;  1XRU A; 
#chains in the Genus database with same CATH homology
 2WQ8 A;  3K75 B;  4A42 A;  2X09 A;  2W1U A;  1XC6 A;  1JZ8 A;  1TG7 A;  4MO3 M;  1UY4 A;  4LHS A;  3CKH A;  2B9V A;  1CX1 A;  1DP0 A;  2WO3 A;  3CZU A;  1ULP A;  4Z2A A;  1O8S A;  1UY2 A;  4A3Z A;  4QDQ A;  4BDV B;  2W5F A;  5F7U A;  5DQ0 A;  2BZD A;  3T2Q A;  3BGA A;  3SEE A;  1OF4 A;  1KEX A;  2W87 A;  4MGS A;  1K45 A;  4XUP A;  2VZR A;  3VDC A;  4XUQ A;  4E8D A;  2QQN A;  3MO4 A;  4M4P A;  1GNY A;  3A7Q A;  4XUR A;  3SKV A;  2BGO A;  3LEK A;  1LNS A;  4ZZ5 A;  3JXS A;  2J1E A;  2QQJ A;  1US3 A;  3WNO A;  4OUE A;  1UWW A;  3WNM A;  3GM8 A;  3WF4 A;  2V4V A;  2WZ8 A;  5EJ1 B;  3WNP A;  4KI5 M;  3EYP A;  4QB1 A;  2J1A A;  3ACF A;  1R64 A;  3MV1 1;  1W8N A;  2E31 A;  4KWU A;  2VZU A;  1PX3 A;  5I0D A;  2ORX A;  3WF2 A;  2BBA A;  4CVU A;  3VD7 A;  4DEV A;  1T2X A;  3MBW A;  4DUX A;  4GWI A;  5C7G A;  3HNY M;  4OYU A;  1W9T A;  1PMH X;  3C7G A;  2E32 A;  2YFU A;  4PQQ A;  2QQK A;  4GZ9 A;  4JKK A;  3NRU A;  4DXT A;  1UY0 A;  3ACG A;  2ZEY A;  1UX7 A;  1WCQ A;  3DYO A;  3P6B A;  4QAW A;  2LS6 A;  2JE8 A;  2W46 A;  3SKJ E;  4A41 A;  5IYY A;  3OGV A;  3IDA A;  4JHZ A;  4QX0 A;  2XOM A;  1H6Y A;  2WN2 A;  5DN2 A;  2VZO A;  3CMG A;  4QX3 A;  1UYX A;  1JZ7 A;  2W92 A;  2RVA A;  4MGQ A;  1W9W A;  3GGL A;  2ZEX A;  2DCK A;  2WO1 A;  3J7H A;  3WQB A;  3HPN A;  4LKS A;  3ETP A;  4L0P A;  3MUY 1;  3LEG A;  3T0B A;  5JXJ A;  1OT5 A;  4ET7 A;  4HG6 B;  1K12 A;  2HYX A;  3D3A A;  2J1S A;  1NUK A;  3ZM8 A;  4OMD A;  3ACH A;  3LQC A;  3C7E A;  4XVH A;  1XPW A;  1TVG A;  4BK4 A;  3I2J A;  3OBA A;  5B4X A;  1GOH A;  4MOA A;  1JU4 A;  1UZ0 A;  2W9X A;  2VZQ A;  2EIC A;  2QQO A;  4QB2 A;  2KD7 A;  2VQT A;  3WNL A;  4QX1 A;  2Z4F A;  4W8J A;  2VME A;  3A23 A;  3PUH A;  4RYD A;  1CZT A;  4D0Q A;  5IFT A;  3I3D A;  3MUZ 1;  2W1W A;  2VCA A;  1EUT A;  1BHG A;  1W0N A;  3HOB A;  1DYO A;  2EIB A;  4W4Z A;  2ID4 A;  2WAO A;  2VC9 A;  2QBX A;  3ABZ A;  5LA2 A;  5G05 L;  4AAX A;  2WYS A;  3OGR A;  3C7O A;  3HN3 A;  4P08 A;  4ZY9 A;  2VZS A;  2DDU A;  2WBK A;  3THC A;  2J1T A;  4XZU G;  1I5P A;  2J1R A;  4YPJ A;  1EUU A;  4P02 B;  2X10 A;  1XNA A;  1L7R A;  4BK5 A;  2WAA A;  2Y6G A;  1PX4 A;  4D8M A;  4LQR A;  3FHA A;  1JZ4 A;  3HNB M;  1UY3 A;  1UMH A;  2CDP A;  3GXU A;  2OKX A;  2VL4 A;  3ECQ A;  2V72 A;  2L9L A;  2W95 A;  2VZT A;  1OF3 A;  1CZS A;  3GDB A;  3UES A;  4ZZ8 A;  1GQP A;  5HPO A;  3LPG A;  3T2P A;  5JUV A;  1NKG A;  1O8P A;  2J1V A;  2W1Q A;  5A1A A;  3F2Z A;  5JXG A;  2VO5 A;  2XON A;  4M4R A;  2VM9 A;  2QQI A;  1IQD C;  2VZV A;  4P00 B;  3VDA A;  1JHJ A;  4ZXE A;  2VMF A;  3IAQ A;  1P8J A;  4CUB A;  4UOJ A;  2WZE A;  2C4X A;  2R7E B;  3T09 A;  5JMO A;  4TTG A;  2WAB A;  2YC2 A;  2C26 A;  4GWJ A;  3WF1 A;  5IFP A;  2J7M A;  2VZ3 A;  2JDA A;  2JD9 A;  2LW8 A;  1L7Q A;  2W3J A;  3T0A A;  4CUC A;  3C7F A;  4OZO A;  1UY1 A;  5CYY A;  3NJV A;  1HN1 A;  2W94 A;  5HXM A;  4PF1 A;  2EID A;  1JYW A;  3BN6 A;  4XUT A;  1J84 A;  1JZ2 A;  5C70 A;  3K4D A;  3VD9 A;  4OMC A;  2E26 A;  2EIE A;  2XQX A;  3T0D A;  3C8X A;  4A4A A;  5B4N A;  1CZV A;  2Y6K A;  1NAE A;  3OGS A;  4RN5 A;  3VD4 A;  3HJR A;  2VZP A;  4JX0 A;  3I2G A;  3VDB A;  3ACI A;  1GUI A;  4UI9 L;  2WO2 A;  3AC0 A;  3K77 A;  1US2 A;  1OH4 A;  2VMC A;  4JKL A;  4QDR A;  2VTF A;  2Y6H A;  3NJX A;  2X05 A;  1W99 A;  4QPW A;  1RYY A;  1UXX X;  3P1I A;  1JYN A;  4E8C A;  1SG3 A;  3U37 A;  1F4A A;  3VD5 A;  5IHR A;  3OEB A;  3LPF A;  2ZEW A;  1H6X A;  2RV9 A;  2B4K A;  1OD3 A;  5DMY A;  1UMI A;  1ULO A;  3I2F A;  2QQL A;  3K4A A;  1XNT A;  5DPN A;  4MAD A;  1GU3 A;  1D7P M;  3T08 A;  3PUI A;  3HNM A;  2ZEZ A;  3CQO A;  4UAP A;  1PMJ X;  3A22 A;  1JI6 A;  3VD3 A;  3DYP A;  3HEI A;  4QX2 A;  1CIY A;  2VCC A;  5JR2 A;  3FL7 A;  3LEI A;  2C9K A;  2J22 A;  1K42 A;  1JZ6 A;  4CU9 A;  2Y6J A;  4ARX A;  3MV0 1;  4A45 A;  2PQS A;  3FHQ A;  1GOG A;  3I97 A;  5LCW L;  3CDZ B;  1SHW B;  5JXH A;  2J1U A;  4CUA A;  5JXI A;  3K46 A;  5LA1 A;  3WSO A;  4DUW A;  1WKY A;  3C7H A;  1JZ5 A;  5G04 L;  1KGY A;  5EJZ B;  1GMM A;  2ZXQ A;  2RJ2 A;  1W9S A;  3W5N A;  4CU6 A;  2E33 A;  3I2K A;  4LPL A;  3EB7 A;  3DEC A;  1JU3 A;  1W8O A;  4BXS V;  1F4H A;  1K3I A;  4DXS A;  3OB8 A;  3FN9 A;  4FI9 A;  3I2H A;  4KMQ A;  1NX9 A;  4BJ0 A;  5EIY B;  4IUG A;  2YFZ A;  3NQH A;  4PT6 A;  2BGP A;  4P5Y A;  5LA0 A;  3WNN A;  2QQM A;  2ORZ A;  3I2I A;  4AG4 A;  2W1S A;  2W91 A;  2DCJ A;  3WF0 A;  3IAP A;  4DUV A;  2V5D A;  2W47 A;  5CZK A;  4XUN A;  2HLE A;  2Y64 A;  3SEP A;  3CZJ A;  5FUI A;  3CIH A;  3UNP A;  3K4Z A;  5IJR A;  2VCB A;  1JYV A;  3WF3 A;  3NNG A;  2YB7 A;  5J1X A;  2VJX A;  2VMD A;  1DLC A;  4QB6 A;  2VOT A;  4JKM A;  3III A;  3DYM A;  2VZ1 A;  2WDB A;  3A21 A;  2WN3 A;  4DEQ A;  4CU8 A;  5C71 A;  2Y6L A;  1O59 A;  1UXZ A;  1SDD B;  3OG2 A;  2WUH A;  4W50 A;  3I3B A;  1MPX A;  3UET A;  1JYX A;  1JZ3 A;  3LE0 A;  4CU7 A;  2YG0 A;  3OEA A;  2BER A;  1GOF A;  4ARY A;  4A44 A;  1YQ2 A;  1J83 A;  2VR4 A;  4DXR A;  2XHN A;  2CDO A;  3T2O A;  3WEZ A;  2JKX A;  3IB3 A;  1UYZ A;  3W5M A;  3E1F 1;  2YC4 A;  3THD A;  4A6O A;  4QDS A;  2Y8K A;  3I3E A;  4XUO A;  3WNK A;  4TXW A;  1UYY A;  2VQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...