4MGXA

Crystal structure of human filamin c domains 4-5 and gpib alpha cytoplasmic domain complex
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
185
structure length
181
Chain Sequence
QKVRAWGPGLETGQVGKSADFVVEAIGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHILPAPPDCFPDKVKAFGPGLEPTGCIVDKPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVIPNGDGTFRCSYVPTKPIKHTIIISWGGVNVPKSPFRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Filamin-C
publication title A Novel Structural Unit in the N-terminal Region of Filamins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 34
structure length 181
sequence length 185
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mgxA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mgxA01
3PWNB 2Q87A 5FYKL 4L4TD 5GISL 2AV1B 1IGMH 4YGAB 2FX7L 1ZLWK 1BFTA 1PDKA 2H32B 3O3EB 1Y6MR 3IVKA 1V7NH 4PRHA 2AJXH 4RGOH 4WFGD 2PN5A 4AENB 3FFDA 4POZC 3Q5YA 1A2YB 1BM3H 4N0UB 4FFVD 3WV0A 1L4IA 5FK9B 4QLRA 4U1GB 4TVPE 5F7EH 3TFKC 5GRJH 1F42A 3F6IA 3MJ6A 1MIEH 5GGTA 5MEND 3WCYA 4PRHE 1ZLSH 1P53A 2NY0B 3H8NA 4JJHA 1BBDH 4Z78A 1GHFH 2Y5EA 3SKMB 6FABL 5J12B 3DX6B 3WNPA 1JGVH 1OTSD 1OAZL 4MX7B 5TDNA 4Q9QL 3R8QA 3ZT6A 1NCAL 1O5DT 4WO4A 1FG2B 4R4BA 1QA9B 3C2AH 1I1AA 3ISWA 1JI1A 1GAFH 4LKCB 1DQDL 1GPOL 3OSKA 5DMKA 3NMEA 4Y16A 4TNWF 3RPIA 4HKXB 3C6LA 4HH8A 2JK5A 2GI7A 3NIGE 1K5NA 1RU9H 1MCLA 4U1HB 4DCQB 4J1UA 2HKFH 1I8LC 3OR7A 4U7SA 1OARL 2HFTA 4KVCL 4UTAH 1QSEA 3O8XD 2RFXA 1XGTB 1KXTB 5L0QB 1NMBH 5FECB 4HCRH 2O61B 1NC2B 1SBSH 4JDZA 2VXUL 4LRNH 3P77B 4C59B 3NN8A 1E4JA 3LZFL 3QRFM 4CDGC 5EOQL 5F9JB 4APQA 5TE4H 4NQDA 2FJGA 2ADIA 4PJ9C 3Q48A 3ZKMD 1QSEE 4XPHL 5L88H 1YC7A 2VLKE 2VDQL 1GCFA 4XNXH 1XCQB 2UZXB 1RK0B 1FH5L 5GGUA 3RGVD 3CX2A 2NQCA 3SGDI 3U4BH 1WBXB 1I3UA 2WBWB 2P8MA 1FYTD 1T3FB 3D3VA 4KUCD 4DAGH 4R4FH 4GXVH 2H45A 2NY5C 4XI5D 1TTUA 4KUZH 5BS0E 1FYHB 5F7LB 4QXWA 1QD0A 3VJ6A 4JAMA 4I77L 3ZZ1A 1XFPA 2QADB 2NX5D 4GUPA 3R0NA 5J3HD 1N2RA 3L5WA 3T4AA 5CJXA 1X5HA 5T33L 3BJLA 1KLGB 1HK6A 3I75B 3ZYZA 5SWSE 3EFDL 5JO5A 1DN0B 4E5XB 4PRNA 5T1DH 2XXMB 3OAZH 5ADOH 2WBJD 2APVA 5IV2B 1CLOH 1KB5H 1U3JA 1UM5H 3ET9F 5J8OA 2IH3A 1KTLA 2DQFB 2AEQL 2XTJC 3D9AL 3LEXA 1OGTB 1RIVL 1R3IH 4RIRA 5EZOH 3MGAA 2ZNWA 2YBRA 3R1GL 4WO4C 5JPNA 4H25A 3KPQA 2FR4B 4Y1AB 4B0MM 5J0BA 3P0YL 3IGAB 3JV6B 1OSZA 3SJVD 4Q0XL 3LKRA 5I8OH 1WTLA 3IDNA 4NT6B 2V2WB 3TYGL 3LEYL 4X5WB 4OT1H 4ZUTB 1FNHA 5I66A 3QDMB 2DLIA 4TN9A 4Y16C 1I9JH 2AJZA 2YWZA 2IAMB 5D71H 1D7FA 4R8WH 3REVB 3ULVC 1M6OB 3TN0C 1M05B 4FQIL 3MRHA 4CVUA 4GT7A 4D0CA 4ZQKA 3S88L 3QUYB 2Z35B 4Z0XB 4KDTC 1S5HB 4PJGF 3DI2B 4KROB 5C2BL 4D8PA 4YBQD 3K1DA 2J8HA 3QDGD 1RZFL 3MRPB 3JWOH 3P2TA 1ADQL 4PREA 4I5BA 4PGBA 1Q1JL 4APQC 2HKHL 4JO4L 1CXIA 5H37H 4YJZL 1QRNB 2QBWA 3CPLB 4Y89A 4NNYB 4X6DF 3QDJA 5HHNB 1UA6L 5FOBA 4PJ8B 1T89A 5JW4R 5KS9B 3BUYB 1Q72H 4U6HB 1UVQB 2FLBT 1QVOB 5CJBA 1IMHC 2XTLA 1QLFB 4U05A 2NNAB 1ZSDB 5EPMB 5HHOB 1EBPA 2FWOB 4H0HB 4TTGA 4JM2A 1MLBB 3O6LL 3AU1B 4N0UA 5CJXC 3QDJE 4DGYH 5HYIA 2XZQH 1FL3B 2VXQH 1A1OB 5F9AC 3DURB 4UV7L 4HIIB 4CNIB 5T3XL 4U1SB 5B39G 4D9RE 4CADB 4EN3A 1SEQH 3RBGA 2F8OA 4JPVL 1IAIL 2H6PB 4UBDD 1I9IH 3EZ8A 3WFDL 2OCFD 4KTEL 3HNSH 3DSFL 1UM6H 3KPNB 1AD9A 3ARWA 2GJ6A 3NCJH 5EU6D 4L1DA 2A6IB 4OZFA 1F3JB 3D0VA 3CMOH 4LKCA 4OZ4B 3IFLL 5EU5B 1BGXH 1JJUA 5C09D 4RGNE 2EC8A 3X3GH 4U1HA 4DCQA 4XTRD 3UTTA 4BFIB 2R9HD 1TITA 5TDOB 1J8HD 4HUUA 1A3QA 1EGJA 3DETC 1UC6A 5F71A 3NCCB 2GJ6E 3EYSL 3ZDYF 4PB0H 4XB8A 2QHRL 3G5XB 5L2KD 3Q5TA 3I6KB 4MA8H 1NAMB 4L4VE 1CDBA 2A9ML 1XGTA 2QJDA 1UEMA 3MYJA 4Y5YB 4ZO9A 3PWJA 1A6WL 4XNQA 3GSRA 5I16A 3QFJB 4HX1A 4H20L 3RFZC 4PTTA 4HKJB 1A21A 3U36B 1FGNL 3JWDH 2JIXD 2XV6B 5FO8B 1FYTB 1CR9L 2HN7B 4QHNA 2EZ0C 1U8PB 3OKNB 4WFHD 2YR3A 1XCQA 4L3EA 4H26B 1WBXA 1T89C 1NCNA 3FQUA 4L3AA 5HYQA 1TVBB 2J6EL 2BDNH 4TUOB 1AKJD 2CGRH 1CFSA 5C3LD 2B0SL 4YK4B 4EBQH 4AM0A 1ROWA 5BRZA 4L29A 3MRBB 1RJCA 4IM8A 4L3EE 2G5BB 3JUYA 3DX9A 4A6YH 4RAHA 1A7PL 1QBMH 4NO0B 1O7SA 4K9EL 3MV9B 1FNEA 3CFBA 1A6PA 3QBTB 3T3MF 4EN3C 2VLJD 1S8DA 2DYPB 3RL1A 3V52H 5J12C 3QG6B 5BRZE 2ORBL 2F5AL 4YUEL 5F1KC 3T2PA 4OGXH 3AUVA 4GSDL 4P57B 3UJIL 1IL1A 2GITA 3IGAA 3TT3L 3P73B 2VLRB 5I18H 4GRWF 3GSNH 4N9GB 2V2WA 4NPYB 1NAKL 2V9TA 2AI0H 4ZUTA 2DKMA 2W07A 5IOPB 1Z6JT 2FJHA 4KZDL 3UTSD 1U42A 3MLSH 5DMGD 1LK2B 1BAFL 2PYEB 4TSBL 1M05A 1F4HA 4JPWH 1P7KA 1V5JA 3O4LA 4K7FA 4Y5VB 4KK6D 4XCNA 4PB9H 3M07A 2X6MA 1NGQH 4OD1L 5L0QC 2VAJA 3ILQC 3MRLA 3JV0A 1G6RB 1JVKA 1RK1B 4I0PB 3RGHA 4XBPA 3OJDA 3BJ91 4NZTL 3GSUB 1TJHL 4KTYA 2DDQH 4CU6A 3O4LE 5BZWB 3UJTL 5C0RH 4L4TA 3PHQB 1HQRA 1VA9A 4NNYA 5JHDD 2ZCKL 4DZ8B 1RIUH 1DQMH 2ESVD 4KJQC 4ODTL 4QXTA 2IJ0C 4LP4A 5I1KH 4NUGL 4QT5A 3UJJL 3PL6D 1QVOA 1FDLH 1AXSB 1G9ML 4JJ5A 4KMTL 4NKDB 1DQJB 2BC4B 4Z95L 4M02A 4QHUB 5GRZA 3M1BB 5KN5A 4U1KB 4U1MB 1JMZA 2BCKB 3TYFB 3E3QE 2YPLB 3DTXB 2H3NA 3LMJH 5FYJD 3QEGL 2BNUB 2X4PB 5MENA 3CDYA 4WFGE 4K55A 3RKPA 1MCQA 2WQ8A 3DURA 2R1XB 4LLDA 4ETQB 1AP2A 5IIEB 1OGAD 1OP3H 3OPZH 25C8H 3KYKH 2V5RA 4KKAC 5D5MB 4ELMB 2UV3A 4D0DA 2W1NA 5CEZL 2DLFH 1VPOL 3UTPD 3WKMH 3DYMA 4YPJA 5MENE 4FZ8H 1SEBA 3DV6B 3GJFH 1URLA 5SWZD 3VE0B 4WHYG 2R4SL 4QCIB 2X4QB 5FGCE 4F9LC 4KK8C 3VI3E 4IEFB 2C7UB 1F3JA 1XGQB 1NCWL 4DUXA 5D1QD 5KZCD 1J8HB 2D31A 1A5FL 5CINH 1D6EA 3HTLX 2OP4H 1X5XA 3SDAD 3O8XA 4LLWA 5TQ2H 1A1NB 2OL3H 3PDOB 4YHIA 4OZGB 4G7YH 3ULUL 5CEXB 4P2RE 1IJ9A 3VH8G 1NGZB 2UZIH 4CRPA 5GGRA 3TIDB 4KROC 1A6VH 1SJHA 2DD8L 2M2DA 2KPNA 4LCCA 1CLCA 1JWUB 1QSFD 4G80A 4HWBH 1QYGH 2YMXH 1MUJB 4HKJA 1RJZA 3NCBB 2CR6A 5DWUH 4DKAA 4QOKD 4XGZA 3RGVA 3BIAX 3MRJB 4EDWH 3WL9B 2OK0L 4MCYB 3O6ML 1N5AB 1FYTA 1GGIH 2NLJA 2XKNA 5CSGA 3OKNA 2BERA 1AY1L 4JFYB 9CGTA 3OMZA 1UZ8A 1E27B 3Q3GA 5DJZB 4EVNB 3C5JA 2Z8SA 3T8XA 4PJ8C 1NCDH 4U0RB 2NX5A 3MLZH 1IILE 5HDBF 5HVHC 4ZDHA 3PG2A 3D39E 5E8EA 2ZP0T 1S7RA 4FFVC 2YSSA 5EO9B 4CVXB 4LASL 1MJJB 4DEPB 5TE6L 1ETZA 1BQHB 4YDIL 3V2AR 4V1DD 4F33A 4FQQB 5HYSG 3MNVA 1EMTH 4JPIA 5I9QC 2OZ4L 5I1GH 1IM3A 2WBJA 3T04D 2EO9A 5ITBH 4KH2A 1Q94A 3GKWL 5CKAA 3GI8H 3S7GA 2V9QA 4EI5D 5E9DB 3H9HB 3L3HA 4D9LH 2ZUYA 1BPVA 1IGFL 5FCUH 4PS4L 3KJ6H 3SJVA 2VC2H 1AIFA 2WIIA 2YKLH 3NIGF 3JUZA 1CQKA 4QHKI 3QNZA 1T83C 5FKAA 2CUHA 5AYUH 1GGBL 3NPZB 5BV7L 3V79C 2XG5A 4PJ5B 2UYLA 4PLJC 1LWRA 4PGDB 4OQTH 2A1WH 4O9HH 1M7IB 3G5ZB 4HFUH 3O8XC 2VZ1A 5T1LB 4YEEA 3WYRA 1JPSL 2AK4E 3BKJH 3PHSA 5EC2B 2X2YA 3QDGA 1W72H 4TYUA 5LQBL 4F58L 3MBEB 5C0CB 3VGAC 3BISA 3CJJA 2VMFA 4NKMB 4RA3A 3OXSB 4CGTA 4MA1B 3HZKB 1NUGA 5HVFB 5E2VH 4LCCC 4Y5YC 3MACH 5D7IB 1G6RA 5I15H 3SCMB 4I0PA 3UMTA 5DEGA 1FL6B 3PP4L 2MWCA 4GRLB 3AMKA 4XP5L 3QCUH 5KSBA 2CRMA 1J05B 4LEXH 3MOBH 1CN4A 1X5YA 3QDGE 4JVPA 1F58H 1DUZA 1DLHB 4RMVA 2BFVH 3PL6B 4XI5C 1I8MA 3FRUB 5FUZH 3O0RL 2APXA 4BA8A 2YA0A 4IRSD 1LE5A 4WV1B 4EUPB 4F80A 5FB8A 5JHLH 4IRZH 4ACPA 3FO2A 1MJ8H 5J3HC 4F7TB 1NGWB 1AXSA 4F7PA 4GQ9H 2FHBA 2I07A 2XZAL 4BZ2L 4YK4C 1FVEA 4MA7L 3L6FB 3WS3A 4PGJA 3TYFA 4P46B 2JJVA 1X7QB 1NSNL 1OP5H 5DK0A 1WZ1H 2AJYL 4HWUA 3CSYB 4LQFH 4U2YA 4PG2A 43C9A 2R1XA 5IIEA 8FABA 2O5XH 3LPFA 3SDDD 5F96L 1BEYH 5D5MA 2FEEI 3A67L 3SO3B 4NZJA 3STZB 1C5BH 3IJHA 4YQXH 1S7WB 5EU6A 1KCUH 3KNBA 3TBYA 4O58H 3OZ9H 3C87A 12E8H 1U3HB 5C09A 1EFQA 3WD5L 3V6FA 1IQDA 3LSOB 1H5BB 2C7UA 1IC5L 4XCFH 3T65A 1J8HA 3FCTA 2D2OA 3GJEB 1E6JH 1FFQA 3BH9B 1MFBH 1JHTB 5L2KA 3UROR 1SJVA 2DJUA 3NCEB 4YBQC 3FHQA 2DIBA 3VWKB 4GKZA 3V4UL 2FBJH 2A6KA 4Y5VC 1S9KC 1HHHB 4M9OA 4PJFA 5GRVK 1Y0LA 1KENH 4UB0H 3RNKB 3KPMA 3FQRB 3E2HB 4LHUG 2JIXA 4GAYA 1H3GA 1A6AA 1JWUA 4I0PC 4M6AA 3ALWA 4AEIL 2CIIA 3VG9B 1QUNA 2FATH 4M6MH 4KVNL 3WL9A 2HRPH 1N5AA 1VGEL 2H26A 3P3YA 5MERB 1AKJA 5FYKD 4EVNA 1E6OL 5DMIH 3S36X 3PQYB 3HZVA 4RRPA 4ZPVA 3TO4B 4PRPD 4X6CA 2YD3A 4KMLB 4HWZB 4MQSB 5E2TH 2X40A 3W9DA 1A7OH 2EDJA 2XWJA 4K3EL 1GC1H 4CVXA 5ADPH 3HKFA 3HNVL 3BE1L 1FLRL 1YEEH 1FO0B 4NHUB 2NYYD 3O6FD 2J4WH 4MNQB 1OF2B 2VLJA 4PG2C 1FN4B 2AJSH 1RUAH 3EFFB 1Q9KB 5KTEH 3MODH 3WIFA 1ZA3B 4F7CB 4UBDC 3U7YH 5EA0L 4JREB 1G0XA 1KT2B 3UDWA 4ZFGL 1UWEH 3O3UN 1UJTA 4K94H 1CL7H 3JVGA 1C12B 4CJ0A 1P5UA 1KCKA 4YHML 3S35X 5JMRA 4MSWA 3MSPA 5JXAL 5ALBL 4RMTA 2W60A 2VDML 2ZKHH 2DQDH 4XTRC 2QQKL 2J2ZA 3EO1B 1KN2H 3MBXH 3G5ZA 5HGHA 3IJYB 4S1QH 5LAXA 4HJ0D 3NGBB 5IFJA 1FZJB 4NN5B 1N3NB 2VXSH 2V6HA 2UZYB 5C0IA 3UTSE 1S7TA 5EC1A 5EBMA 3QZWG 1LO3L 2Y7QA 3SDCD 1AC6A 5KVEH 3SDXE 4E41D 3LQAL 5T1MB 3FOMB 4UT9L 2KQMA 4NQSB 2D0FA 2R2CA 3MLRL 3SKOB 5D72H 5JHDA 2ESVA 1J05A 4MD0B 4HSQA 4WRLA 1N6QH 5D7LB 2F54B 5DHYB 5I30H 3VRIA 4NQXB 1JWSB 5C0BD 3ZYJA 5IVXA 3PL6A 2DTML 4YE4L 4QF1B 2ID5A 2AERT 2V5YA 3QPXL 5F89A 5GZND 4EUPA 2E9JA 2P42B 5E7FA 3EYVB 1R24B 4U0RC 4QRPB 4OZHA 3SDYL 3PGDB 3MRCA 1A7NH 3TV3H 1NCBH 3G08A 4QO1A 1BWMA 1ZT1A 1MF2H 3DUUB 1CFNB 4DEPC 1OGAA 1AO7D 3D85B 3FQWB 3S8WA 2BSSA 3LN5B 3O2WL 5E24E 3CSYA 3H9SD 4BSWB 2Y72A 4I0KA 4XAKD 3GI9L 4HUWB 1EFXD 3BP5A 4X0KA 1E28A 3L3DB 5FEBA 3RWJA 5HDQL 5SWZA 4XXCA 3S36L 3STZA 3WS6A 3N50A 3UDWC 2KH2B 3FN3A 2V2XB 3X14A 1NFDA 1RD6A 5FCSH 3RWDB 5HHQA 1MHCB 5D1QA 5LCVH 4NN6C 2ZCLL 1C8PA 3UTPE 1RZKC 4W6WB 3RVTD 3SDAA 5F9OL 5DJAB 1CXLA 5DMGC 2VB5A 1N4XH 2AK1L 5IVZB 4X6FA 2HT2D 3GJEA 4J3WA 1QFWH 3BH9A 4FQCL 5C7XH 5EUKA 1K9TA 2ARWA 4RISH 2OMNA 2HFGH 1LO4L 4DWHA 3LKNA 5DLMH 5EORL 3CVHL 1QSFA 1CZ8H 4JKPH 1XH3A 1MI5D 1IKFH 1VFUA 4HGWB 3WKNA 4QOKA 3VFUB 2JLLA 3WIHL 5C1MB 4HH9B 5MEPB 1T04B 2J5LB 4IJ3B 2ZUXA 1A22B 3MLYL 4GRLC 4BH7B 5HXMA 4XNZB 1QBAA 4S1RL 1G7JB 3K7UA 5FUOH 1T5WB 1A6UL 2AP2A 4L8CB 4OUUA 3VWJD 1H9VA 3PL6C 4NGHL 5GS0H 4P99A 3RL2B 1G7PB 7CGTA 4ENEC 1VERA 1SQ2N 3TO4A 4WV1C 1N64H 3ALXA 1G6VK 5E6IB 3F7VA 2QQNH 4Y2OA 4ZUVB 3IYLW 2BY3A 1MWAA 3HAEG 4P46C 4HZAA 4FFZL 3PGCB 4NHUA 1A14H 2VR9A 4YGVA 1BFVH 2R39A 4EI5A 1F4XH 1UB5A 2DS4A 4LEOB 4WY7H 2EE6A 1U58A 3BGAA 1CI5A 2DB8A 3BPNC 5F7KC 4V1DE 5AZ2L 1GGUA 1EVUA 5IF0A 1RMFL 5TF1H 1FZOA 5F8QC 5I71B 2AEPH 5H2BA 3VI3F 3F7PC 5DUBA 4QRSB 2PF6A 1KCRH 5F1SA 4I2XE 4OCRH 3HC4H 5ECJE 4M5ZL 2HFEB 3RY5A 2HH0L 3DX7B 2H2SD 2FHCA 4PRID 3S35H 3I3BA 4LQ1A 2DLTA 1LEGA 1XMWA 2L7JA 3K2UL 3SDAC 4K2UL 1B2WL 5EU7C 3LVEA 1H5BC 4WW2A 1MH5B 3EO1A 5IB4B 3KPOA 1NEUA 1CS6A 4JRWA 4WUUE 3V4PL 4F7EB 2GSIA 4H5SB 3IXTB 3H9YA 4X6BA 5D2LA 2PUQT 4MXQC 4NP4H 5J6HB 4UINH 4QXGH 4MWFB 2YWYA 4JO2L 4PJXF 4BJLA 5FGSA 5IFAH 2GFBA 3LV3B 1BWWA 4PY7B 4NCDA 3FOMA 3DBXB 3VXSE 4H1LA 5I1JH 4J6RL 3RIAK 3SKOA 3MJ9A 3NH7H 3AC0A 3VG9C 3MJ7A 1HHJB 4HIHB 4IRJB 4MD0A 2AVGA 3E1F1 4IRSA 1HKLL 5D2LE 1G1YA 4DVRH 2HLAB 5E2UL 2YA1A 1BM3L 1T1YA 5F1IB 4KGLA 4BFGA 4FQJH 3C8HA 3DV4B 2H9GB 2Q8AL 3LQMA 1QR4A 3TO4C 4DW2H 1C08A 4ONOA 4NZDA 4JFFD 4LPWA 4Q2ZB 5E5MB 1U2CA 3PGDA 1WK0A 4H1LG 5CSBA 3P30L 1WV7T 5B21A 4UT6H 5AD0B 1F97A 1I1FB 3DUUA 1F02I 3EGSB 5C08B 2G60L 5EO0B 1NH6A 4FQ1L 5EH1A 1JNJA 4BSVB 3FQWA 3AVEA 2B4CC 3SDDA 4L8DB 3QO1A 5ID0B 1RZ8B 1GOFA 4EI5C 2V7HA 3WN5B 4NQUA 1X3DA 1I9RH 3BSZH 3RUGB 3HI1A 4JQXA 4HUWA 5J1SC 1XT5A 4BFBD 4Z0BL 3DMMB 1UXSA 2BVPB 2VABA 1Z9MA 4JREC 5D7JD 5E94B 3CFEB 5E2WH 2V2XA 2R8SH 2PETA 2HAZA 3H2WA 3PNWB 4GO6B 3MGTB 4F3FB 4OF8A 1MHCA 3HRZB 4LF3B 1AE6L 4X7TB 4G7VL 3BZ4B 4PGZA 4TULL 2I9LA 1XR9B 1NANI 3E0GA 5EBLB 4WW2C 5IBTL 1M7DB 5IVZA 3KYMB 3O45B 4UT7L 3O6KL 4NJAL 1CD9B 3UBXB 3NGBC 1EERB 4NN5C 3BP7B 3EYQD 4XNXL 4GW4B 4ZOBA 2WANA 4Y7MA 2HVJB 1ACYH 3DXAE 4OB5L 4WI9A 3RTQD 1OLLA 3TA3B 3ZDZF 3LPWA 4HGWA 3VFUA 5JIHA 3BP4B 4O2EB 4R4FL 3PABA 4KUZL 3I50H 5F1NA 5HHVL 1DP0A 4ZSOB 4EI6A 3FN9A 4IRSC 5D7KD 5HI4D 4PRPA 1LE9A 5CSZB 2ED9A 4IMLB 2R1YB 2KZ1B 3RL2A 1G7PA 1HNFA 1S9XB 4UTBL 5CJOL 4PD4J 3ZLQC 1NDMB 1VGKA 3MOQA 5ADOL 2MQ0A 2AW2A 3O6FA 2PKDA 3V95A 5E1AB 4K71C 5DT1H 4LSRL 3QULB 1J0HA 4PJHA 3QHZL 2R4RH 4YDVB 1JWMA 4OGYL 3I9GH 4OCSH 5HTSA 3BH8A 1U8OA 1D5XB 1X5FA 5DHVH 4AY0A 4JQXC 1CFBA 5EOCL 3D5OF 5T5NF 1T1XB 4NDMB 2FD6H 4LLQB 1I7UA 4JN2A 5J13B 3GIVB 3K4DA 4QRSA 1SMOA 3LQZA 3EDJA 1NUNB 4PJHE 4R8WL 3OX8A 5K9KA 2P45B 1RUKH 1NEZB 5D93B 5ICZA 4HT1L 3CZFB 1YPZE 3QPQC 4M7LT 4RFOH 4OI9A 1MCNA 1Q38A 2NPLX 3F7YB 3O2DL 4QHLB 4NQEB 1BVLB 1M1SA 1MREL 1R5IA 1CGSL 1KEGH 4K8RC 4QEGA 1WIPA 2R2BB 3ULUD 2FSEB 4RAVB 1P4IH 1XR8B 4BKLA 3VXNA 3IXTA 3Q0HA 4KZEL 1JYNA 2WSKA 4FMKA 4XP6L 3KWWB 3SGEI 4JDVA 5DC4B 5BJTB 1Q72L 1KN4H 3QQNA 4S1SL 4BQCA 1FCCA 4DTGH 2J5LC 3T77A 4IJ3C 3BZFB 3F5WB 5IQ7L 5C0BA 1B6DA 3HC0B 4XRCB 4DQOH 1HHJA 1CDIA 3I85A 4E41E 5J7CC 4BQ8A 4TOYH 3C5SB 3BRDA 2APTA 1DVFD 5D96B 5KW9H 5F1IA 4ZOAA 3WUWB 4M43L 2XZQL 5J1TC 4X7CC 5F88A 4HG4K 2EEBA 2H9GA 4X4YB 5DK2A 1FBIL 3GBLA 1PQZA 3CU1A 3KPRD 5C0BE 3CDGB 3C9NA 1AO7A 1SEQL 3MLXL 1BJ1J 1LD9B 5DJ6B 1MFDL 2CH8A 2NYYC 3LEVL 4RNRA 5FF6A 3HN3A 3O6FC 4AMKH 5ISZB 3H9SA 1I3RA 4M3KB 5DEFA 4PPTA 5DJ2B 3N85L 5CJ5A 1I1FA 3EGSA 1AGEB 5DQJB 1G7IA 4KI5C 1P1ZA 3CZJA 3MA9H 4ZO7A 1KJMB 1KGCE 2Q76B 4XCCH 4YBLC 4J7RA 3NCJL 3PDGA 3X17A 2PCPB 5D7JB 4AZ8A 2NY4D 3WLWD 2DJ4A 3CSPA 2JB6B 1F3DJ 1I7TA 3GSWA 2BVPA 4JHWH 4KTDL 5SWQA 4PJAB 1CGYA 2W65B 2AJUH 4IOFD 1EEYB 4M3JA 1X5LA 1UGNA 1JGLL 2MCPH 5GGQH 5D8JL 1RJYB 2R0KH 5I1LA 4K3DL 5D2NA 3HRZA 5IEKA 1YMMB 5DC0A 5C9JA 4LPXA 4DN3L 3ZDXE 3FO1B 3NCMA 4AEHH 1CDHA 1NFIA 1YEIL 4ZUSB 3GSQB 4HJ0C 3GMLB 4I0CC 1SJEB 4U3CA 4ELKA 3KPPB 4ISVA 3K4ZA 5CD3B 4DKFH 4N8VA 3I02A 3LH2L 2CK0H 1FP5A 1MI5A 1X5GA 2RBLA 2PTTB 5C07D 3GJFB 1RZJL 3DHMA 3JBG7 4HIXL 3VW3L 4Z6AT 4U6XB 3GNML 5JUEH 1KIRB 1NGYB 5DFTA 3D69B 2C4FT 5I0DA 3MO1B 3T0XA 1TTFA 1FAIL 5JMOC 1U8NB 5I1EH 3KYOA 4JFPA 2L7UA 1MI5E 4KPHH 4RMSA 3PXJA 5FV1L 2YN5A 1N6UA 3MV8B 4IRJC 4N8VG 4K3JH 3DRTB 5GZNC 2CKBL 5GSRA 2B5IB 3LIZL 1S7XB 2Z93B 4IMLA 3S9DB 1KPUA 1D5BB 1X44A 1MQKL 2CLZB 2Y1VA 3QQ4A 1OTTD 1S3KH 1NLBL 2Q3ZA 3T1FB 1Q9OA 2Y06H 4JQIL 1GZPB 2DQTL 1SYVB 4JR9H 1G7HA 4N8PA 3D87B 3B2VL 1OVZA 1D9KD 3IRPX 1B3JA 3CDFA 3UTZA 1OW0A 4TUKH 4NM8H 4LGPB 4M5YL 1HSAB 3BDYH 5FUCE 4U4BA 5GJTL 4WI8A 4YNYA 4NWTH 3DVNB 3EDDA 3VA6A 2F8VA 4WI5A 2EDOA 2VWEE 4JFOB 1JPFA 4LSUL 4PRIA 3RA7L 3FFCB 1ZLWH 5LJYH 4G8EB 4XP9L 1J1XL 3RVTC 4P2QB 2Z92A 4QHMB 2Y23A 4Y4KB 3CZFA 5D2NC 3W9EA 2LAAA 3QSKB 3ZL4H 3F7YA 2R29L 4UUJA 3OL2A 1BVLA 4HPOL 4M7LH 1EBAA 1ORQB 3QJFB 4J3OC 5DURB 3R8BB 3VCLA 1CFVH 1WEJH 1FNLA 3VD4A 4MGXA 3S37X 2YPVL 3VGBA 1AQKL 3LKSB 1YQVL 2F19H 4KHTH 4C58B 4MJID 3T4YB 1AXTH 4FA8A 1T0NA 2XRAH 3L5HA 2GJZA 3MRFB 1O7VA 1UXWB 4YXLH 2A9NH 5DYOB 4PR5A 3KWWA 4HWNA 1VEPA 5F7HA 1CBVL 2P4AB 4O51A 1WIUA 5IHUH 4R3SB 3V0WH 2VH5L 4KDWA 4OD2A 2ITCB 1DVFB 5E2JA 1CICD 4JANA 2X5PA 5KSVA 3HC0A 5AG8A 1BBJB 4M7KH 2NY2D 5DHXB 1NMCC 2XKSA 4YHNA 3WUWA 4JVUA 3QYCA 4JFFA 5CCKH 2BNQD 2JJUA 3ZKXC 1J12A 3VMPA 4ZODA 4Y1AE 1DQLH 1DSFH 5CZVH 4WTXA 2OTPA 2OLDA 3CXHJ 3PWPD 4WNQB 5DJ6A 3Q5OA 2C4FU 2P24A 1OW0C 5DJ2A 3QDME 1KULA 1FC2D 1MCJA 4JFFE 3GRWL 4XPTH 2XWBB 4QNPF 1K3ZA 1HEZB 1KJMA 2EKSA 3GBMH 2BVQA 5D70L 3X11B 3RAJL 2DM3A 5D7JA 4NNPL 4OQ1A 4C56B 1CT8A 4CDHA 2C4XA 2WK2A 4QXUL 4PJIE 3BGFC 5BV7B 5J13C 4PJAA 4MAYB 3QUXD 3WFEH 3W39A 1UEYA 2HMIC 2MQ3A 2ZSWA 1FSKB 3FTGB 1EXUB 3QAZC 4M1GL 4ODVL 3HCVB 1QRNE 4X7SH 4JHZA 2NXYD 4PP1D 1OAUH 4ZUSA 5CGYD 3L3OB 3QEUA 5FV2A 1QYGL 5KS9E 5CD3A 2MJWA 4N90E 3OKDA 3RTQA 4EXKA 5JLZB 2YZ8A 1TQCC 3JZ7A 1WITA 4K7PY 4TSCH 3PJSA 4LLMB 2VZSA 2B2XH 5HHOE 3TBWA 3HNTH 5EOTA 2APBA 3F8UB 1KIRA 1IGTB 3WNNA 1R3LA 3TBTB 4P2YA 1U8NA 5FYLD 5IB1A 2MKLC 4E42B 3NA4A 3HG1D 1HILB 2IQ9L 5ANMB 3FN0L 3SE9L 4P4KB 4HJGA 4GG6B 3S37L 2ARJA 4N0CD 5BO1L 5T1KD 3ARED 2BOCB 4J4PA 4EIGB 3KLDA 4NRYB 3EOYG 1H0DB 4Z8FL 3BGMB 4Q74A 4HPYH 1ZTXH 5D7KE 3O4OB 4DGVL 4G8FB 4Z7WA 4DN4H 2UY7A 3O3AB 3HUJB 4WEUD 5E0QA 2VRAA 3PWLB 3W0WD 3WIIH 4K9EC 3TJHD 4GBXB 5FCUL 2FO4A 2PW1B 5ICYB 5J4MA 3HC3H 3BZDA 5IROA 4KAQL 5AYUL 1TCRA 4KGJA 2W0PA 1R5WA 4P5KB 5JIIA 5D7JC 4LIQE 2YC1A 3QIUB 4PGEA 2A1WL 4U33A 3P9LB 2K7QA 1ZANL 4OLXL 3ZT7A 2HP4A 2OTUA 1F4YL 4O5LH 1TENA 3QFJE 4G8EA 5IJVB 3GUTB 1BX2A 3ARBD 1KJ2B 4KQ4L 4TVPL 1MVUA 3GZKA 1MRDH 4LSTH 4L3CA 5HD8D 4S11A 2A0LD 2W9EL 2BMKB 4W4OA 5K93A 2WQRA 3ZKQD 4U6VH 5F7UA 3X3FH 3BESR 1PW3A 3BP6B 5BMFL 2AKRB 1P69B 1WICA 5CBAA 2IFFL 1J0JA 4G6JH 3V7MA 3RTQC 2VDNH 5I8CB 2X7LB 2DMBA 4JN1H 2ICWA 3EKCA 4GW5A 4AL8H 2EE9A 3GMNB 5DJ0B 4EKXA 7FABH 2G2RB 3CFDB 5HPOA 1KFAL 1HYRC 3L7FB 5K9OA 4Y2DB 15C8H 1DVFA 3MV9E 4JCLA 3MROA 5DA0B 3MV11 4TQEH 5C6TL 3WSQH 3HMWL 1BBJA 3HPLA 2F74B 2VDKH 2EIZB 4LVNB 1J5OL 1NQBA 4ZNCD 2R2EA 1G9MC 2V9RA 3I84A 3KPRA 4X4ZA 4J4PC 4KK9C 3PWPB 3TIEB 3ULVF 1AXIB 2HT3D 1ZEAL 5IBUB 4JZOA 4NM4L 1BEYL 4WGWB 3BEVB 5EUOA 3VXUD 2NY5H 3WLBB 5BZDA 2AXFB 5B38B 5IHLB 3EDFA 4IOIB 3KPRE 2VDLH 2J8UF 3GK8H 4NC0B 4N8CL 2Y36H 3B9DA 4X5XA 1HEZA 5IROC 3MZTA 1FNSH 2ATKB 4PP2A 5JORA 1MJ7L 2PYEE 4NQCB 2OR8A 2BY0A 1YPZF 2HG5B 3QUXB 1P84K 4X7EC 3MYZA 4Y19B 2DQJL 4NC1C 1D6VL 3FMGL 4XPFL 1K8IA 5C92A 5CGTA 2C3GA 1UWGH 4AIZB 2FH8A 4AEEA 5GGTH 3ZSSA 1G9NH 4XAWL 4JY6B 5ABDE 1N0XL 2BRRL 1G0DA 1CDJA 2CLVB 1PLGH 1IGYB 4RCAA 2VDOL 2DMCA 1CGUA 4LSSH 4W4OC 4HKZA 2UWEA 3HS0A 3ULUC 1QLEH 5C07A 4GAJL 5GQBA 4PBVC 1NBZB 2ADGA 3QWOA 3FB6A 2P43B 2IQAA 4Q7DA 3C2SA 1GH7A 1JE6A 1T0MA 4G43A 5CLWA 4X9FA 4V2BA 5BOPA 3ULVH 3ZE2E 1NMAH 1PKQB 4KU1A 5E03A 1L9MA 2XA3A 4KQ3L 1I1YB 1BFOB 4LSPH 3TBTA 1CF8L 1L0XA 2YD2A 3OJ2C 3UPRA 1DVFC 1P7QB 4D94A 1U8MA 4XPAH 3IDMA 1KSRA 4XNUH 4NBYB 1AGDB 4PJDA 1Q9WB 3VDBA 1QR1B 4GG6A 1FVCB 2G9HB 1DE4A 2PO6B 3ZSTA 1EPFA 4WJ5B 4FOMA 1LP9E 4WU5B 3NAAH 2QQLH 3WUZA 1D9KA 5ACLA 4Z18A 5DD1H 3TESA 1FVDB 4IOSD 5KVDL 2WINA 5INCB 3BKYH 2UVEA 2W0FB 3O3AA 2BVEA 2EDKA 3U7YL 3EJZD 3GMMB 1N7ML 4LPYA 1FL5A 1KACB 4ZFFB 3WLWC 1MCOL 4P5TD 4LSDA 4QRUB 2EH7H 1FZKA 5DI8A 2CQVA 3ROLB 2ZKHL 2ENSA 3RWGB 3ZDXF 4IDLA 2JJTA 1V8HA 3RU8H 4I18B 5BV7C 4OLYL 1ZHNA 3BN3B 3FT2A 5T3ZE 3GJFK 1EAPB 1FSKC 4KKCD 3VFTB 5IM7B 3ZHLA 1A0QL 1GGYA 4HZLB 5HPMB 4LARH 3G6DH 4QTHA 4XMPL 2J88L 4JB9H 4AIOA 5JQ6H 5KVEL 4MJIA 1F8TL 1J0KA 3OBAA 1EUUA 3CVHB 1INEH 1R3KB 1DN2A 1VACB 2AKRA 3D2UD 1KTDA 5E4EB 4OIIH 3SPVB 1KNOA 4QYOB 2Y6SD 1KG0B 2YK1H 4PFEA 1N6QL 1I4FA 2CIKA 4YPGA 2HTLD 2C1OB 5I8CA 5GGVH 4K3HA 3Q6GH 3U6RA 2OYPA 2DQGH 4I48A 1AR2A 1CICA 5ACZA 4MJIE 5IB5A 1WWBX 4PTUB 4U1NB 2EYRB 1BQHG 3MFFA 4MD4A 5DRNA 3L7FA 3GEWB 4PJCB 1FE8H 2NTFA 2P5EB 4F57H 5AUMB 3W5NA 4BZYA 3BT2H 3FZUD 3QXWA 2BNQA 5E8DL 1OD9A 2CXGA 1U3YA 3MR9B 3VXMD 2W9DH 1OTTC 1IKNA 3J7HA 1JGUL 3RWCA 3PWPA 1MRFH 4FNLH 3EZJB 1D9KC 1A7QH 3TIEA 5A2FA 4XXDB 5JNYA 3O4OC 2EC9T 1OSPH 3OKKB 3NTCH 4PJ5E 1XGUA 2BNQE 1OHQA 3HFML 1JTOA 1T2QH 2ERJB 4I3RH 4LLVB 1EGJL 2EDFA 2EIDA 3B3IA 2H32H 1EZVY 4JDTL 2JCCB 2BVOB 5IG7B 2GK0A 4CUCA 5CJQL 2ATKA 5F70A 1HE7A 4NQCA 4OLZL 1X4XA 4UIKH 1K2DA 3QUXA 5C0CE 2BHUA 5DQDH 1M7XA 1HHKB 2V2TA 4ZXBD 3QIUC 1LK3L 4XCYB 2A74A 4PRDB 4AIZA 1C16B 1RZIA 4X83A 4NZRH 5D7IE 3RP1A 5CHNB 3MPCA 4FZEH 2FRGP 4RFEB 3DIFA 4RA0C 1IEAA 3SHSA 2R56H 3VGEA 3ECBB 4OTXH 1IGYA 1UACH 3IFPB 3AXLB 1CZ8L 1MY7A 1TVDA 2F5BL 1T1ZB 4EDXA 5J11B 4XMKL 4HGKC 2GW5A 4OZFH 5JOPE 3N1GC 4R90H 5F97E 5I19H 1V7ML 1JGDA 4TSAH 5IB3A 1VFAB 4TNVK 5FUOL 3OGCA 2PYFB 5M95B 4FG6C 3BWAB 1CICC 5KSAD 1A3RL 3HG1A 1KPVB 3QCTH 1I1YA 1BFOA 4JFXB 1ONQB 1REIA 1YEHH 4OZIB 5T1KA 4K23L 4Y2DC 3AREA 3HE6D 4FABL 4N1CA 3OG6B 1F6AA 3VFPA 1YEGL 1Q9WA 2W9LA 2XQBH 2WWMC 3ETBF 1IKNC 4LVNC 3G6JA 2G9HA 5J9PA 4LAQH 2PO6A 1JZ4A 3DYPA 4XBGA 4QTIH 2ITDB 4WU5A 4WY7L 3W0WA 5AZEL 3SQOL 3BN9C 2ZUWA 3BEWA 5INCA 3FQXB 3U0PA 4AK1A 5F9WB 5L9DH 3KLHD 2P5WB 4TPRL 1L7IL 2DIJA 5EO1A 3THML 3IETB 3CFKA 2CLRB 4PBXA 1FJ1A 5GRUH 1OP5K 3N1QC 3W11C 3QDHA 3VXRB 2R69L 1ZHBB 4PJBB 3QXAB 4QRUA 4ZYKB 3QUXC 5E99H 2VZUA 4ONHA 2XFXB 3MNWB 1DBBH 4K7PX 4I3GA 4FS0A 3N9GH 2R23A 2AJ3A 5I76B 1T66D 1X4ZA 2EC9U 3WJLA 3O9WB 4GAGL 3P9WB 5KS9F 3BIKB 4PP1C 4PRAA 3CH8A 4QY8B 5CGYC 4MNGB 4FTVD 1CLZH 3IDJB 5JR1H 2FGWH 2ATPA 4HZLA 1QEWB 5HPMA 4L9LB 3V0VB 1QKZH 2XIDA 3ARFB 4FP8H 4ESKA 1QO3B 1ULVA 3PQYE 4Z7VB 1FQ9C 3AY4A 4GLRH 4LHJB 3PIQB 2QHLA 3GMPB 4FXGB 5C0FA 3LQAC 2FX8L 2LVCA 2Z8RA 4LVOC 3H0TA 4FQJL 4K3GA 3UO1H 4PTUA 3U9UA 1ZLVH 1KJVA 2DWDB 4MNQE 5AWNH 1VFOA 4QRRB 1N26A 4NSKB 3INUL 4XH2B 2BVYA 3RNQA 1FFNA 1P2CB 3KPSE 3GGWB 3QUML 5J1AB 2PO6C 2IH1A 1PZ5B 4BZ1H 4FQ2H 1K4DA 2QSQA 4UAOB 1I9RL 3BSZL 4RMRA 4OM0L 5HGAA 4OI8A 3TJHC 4F8QA 4XXDA 2GUOA 3KYNA 3FHAA 2A38A 5IMKA 4UNUA 2X4TB 4LLVA 2BSRA 3QIBB 4YR6B 1AD0B 4XBEL 5C0AD 4YHZL 4XB7A 1S9WB 4WCYH 2YPKB 1CFTB 5IW1B 5LBSH 2BVOA 5K9QG 4WFFD 5MEOB 3VXUE 4O2FB 4M6NH 4URTB 1HI6A 3VD5A 1RVFH 1IC7H 1QFUL 1HHKA 5C9KA 5DJ8B 1HDMB 35C8L 4XCYA 2XN9D 2Y5TB 1MFEL 1T21B 3S5LB 3CNKA 4I18C 1C16A 4NZUH 4FQXD 1KYOK 3MOAH 2V7NA 1II4E 4KRPD 3VFNB 1KIPA 4RFEA 3TZVB 3ECBA 4KXZH 3DVGB 1J1OH 2F54E 1RUMH 3AXLA 3M45A 5HDOA 1P84J 1HINH 4M8QB 1T1ZA 5I1IH 5ACMA 1JRHH 2ZOKB 3ARGD 1RZ7L 1CDGA 3QEHA 5E8PA 5D7SL 3GHEH 3TPKA 4JRXB 4XVJL 3AY4C 5F6HJ 2XQYK 1AGCB 1YYMH 4W4NA 5ALCH 4K7PL 3PV7A 1U6AL 2PYFA 2EXWC 4OF5A 5TJWK 1BOGA 1WZLA 1TJIL 2C3VA 3RJDA 1TNMA 4HBCL 4LLYB 4S10A 1KIQB 3QEQD 4RX4D 3U1SH 1ONQA 1NAMH 4I4WB 4OZIA 1JN6A 5TE7H 4OV6F 4BK5A 2BNRD 4G6KL 5CUSL 5FDWA 1H3PL 1UH2A 2A73B 2HT3C 3HHRB 2NXZB 4JZJA 3OKOB 4ODHL 2Q8BL 4X5LA 4XMLL 2P8PA 4LBEA 4OCSL 2ZUVA 3FB7B 1N5YL 1EV2E 2NY7L 4X80H 1W0WB 2H8PB 2A6DA 1F4WH 3MLWL 5A40E 5E1HB 3K1KC 4NOBA 4G42A 1JHKL 4U1JA 1KLUB 1AGFB 2F53D 1NUFA 1XGRB 2ERJC 4YWGH 4UDUA 4P5TA 4NO5B 3O41B 1GIGH 1RUKL 1T22B 5D1XB 1BJ1H 1A47A 4NQVA 2IPUK 3DOSA 5SV4A 4PV8A 3ORJA 1HHGB 4PJBA 3SY0B 1Z0NA 3ILPA 3C8KB 1PEZA 5KG9B 4MNHB 4YFLF 4GKNB 3PDDA 3PGFL 2E7LA 1F90L 1MJUL 3F6LA 3WXWH 4F15C 2HWZH 2R0WH 5AG9A 3KR3H 4KY1H 1E4XH 4NRZB 5J6GB 1MCFA 1CD8A 5I76A 4HCRA 2DQCH 1F3DH 4Y88A 3IF1A 3QG7H 5DRZB 4X7DC 4QY8A 1MLCA 4MNGA 4YXKL 1A6ZB 1MAML 3D2UA 3QNXB 4HHAB 3TJEL 2LE9A 1QEWA 4KDVA 3F12B 3NABH 4L9LA 5BQ7B 4GW1A 3ZE2F 3V0VA 1KBGL 5KVFL 5J11C 1F11A 3ARFA 4IS6B 5EWIL 3G9VA 1C5CH 1AI1L 1YEFL 4RZCA 3S96A 5I74B 2JF1A 1D5IL 3WFCH 1I7RA 3S3JA 1ORSB 1QPXA 1TJGH 1T2JA 4JPKH 4HK3J 1ZVSA 1GVIA 2QSTA 3MRRA 1JZ3A 3ARXA 1S7QB 4ELMF 3NVQA 3MTRA 4PG9B 4GG8A 5MI0B 1U8JB 3M17B 1X9QA 2E9IA 1A9BB 2CKBB 2DWDA 1LP9F 2Z4QA 1AHWA 4R96A 2MHAA 1X5KA 4JO1H 2X09A 5ITFA 2WAHA 3MUHL 1G6RH 1RUQH 2AABL 3DVFA 4R7NB 3TPUB 1GL4B 3VXOA 1P4LA 5GSVB 1HH9B 1SY6H 4YO0B 1DQTA 4LSVH 2X4NB 4G9FB 1PZ5A 3VXME 1BD2D 4ZFOB 1PSKH 5B3JE 3Q1SH 4OZGF 3S34L 4GLRI 3HI6L 1FV1A 4R7DB 5F9WC 4RFNB 2X4TA 5KANG 4N0YH 3B5GA 5CJ8A 5HYJD 4OFKA 4P5TC 5BXFB 4KI1A 1S9WA 4GOSA 1CFTA 3CFIC 1E4KC 4LHQB 1KCVH 4ZXBA 3H42L 4FXKB 1WBZA 2BVUA 4F7MA 1DBJH 4AEHL 4OCXH 4X9GA 4AEFA 2E7LC 4YDLB 1CVRA 3MJ8A 1Q0YH 1SM3L 1YC8A 1EJOL 3RIFK 1D5MB 4ZS7H 3DRQA 4NBZB 5LKNA 4KKCC 2QR0B 4PJEB 1C1EH 1ZHKA 3LKPB 4BSJA 4HC1H 1I85A 1OY3B 3O9WC 3IU3A 4MCZA 3RIAF 2YUVA 1CFQB 3JSSA 5A2IH 4L9LC 4OFYD 1FGVL 2Y6SC 3GMOA 1P9MC 4ONGH 1U95B 3ARFC 3NFNB 1NL0H 3AMLA 1YJDL 5KSUB 1U92A 3QJHA 3U48A 5KSAA 5JDSB 4G6AC 1LO0L 1MCBA 3SQBA 3MRKB 1NCTA 3O11A 4LCWB 3IU4L 4M1DH 5ELIA 3EHBC 3B9VA 4M61A 2ICWJ 2GCYB 3MXWH 1L6ZA 2DM4A 4HUVB 1YEKL 4PBWD 3H7LA 5FA3B 3HE6A 4LLYA 3VFSA 4HV8B 5I8KH 5F72S 5HGDB 1HXMB 3FZUC 5H37G 4GRWB 4HIJA 2DN7A 2CR3A 3DUSB 1RIHH 1AHWC 1LMKA 5I75B 4JZNB 4RWYL 3RUGE 3PWVB 3O81A 1RULL 4WTWA 3CUPB 3KPLB 3TCXA 4JY5H 4ZUWB 3RDTB 1I8KB 4TTDC 4F9PA 4KXZI 1DBAH 5DXWA 5L7XH 1A4JB 4JLRA 2JELH 3B83A 1CLYL 4FQLL 2ZJSL 3HMXH 5CZXC 4UAOC 4PJGA 2Q20A 2H8PA 4YHOH 4D0BB 1MAKA 5EIIA 5JA9A 4E9LA 3GM0A 5TFSH 1B88A 1KLUA 1K3IA 5ERWA 3TVMB 5IMOB 1LVEA 2FYYB 1IC4H 2JJSA 4CBPA 3QIBC 2VLKD 4JE4B 4BQ6A 4KRMB 4OF6A 4LK4A 3T0AA 3BAEH 2X4UB 4ONFL 5D1XA 1YY8A 3GHBH 4WWID 5LGHL 3BQUB 5D7IF 2NW2A 4PJGE 5FOJA 3A6CH 4NO2B 1XGPB 2P8LB 4X6DA 1ZT7B 2KBGA 3C8KA 3UBXG 1G1CA 2OR7A 5KG9A 5BS0D 1FORL 5FGBC 1N59B 3LKQB 1NC4B 1J0ZA 3RRQA 5C0ND 1MPAH 5FYJU 1GSMA 1I85C 3WHXA 4JRYB 4ZSOE 5SWSD 1DCLA 2X44D 4LCYB 4X6DE 3TBSA 1UCBL 3LS5H 3QNXA 5C0EB 4P0DA 3BHBB 5ILTH 4JFDB 1WCQA 5E95B 4G9DA 1RZKH 4IS6A 4FTVE 3GFUA 5C71A 2RB8A 2OQJA 1RY7B 4KJWC 5B8CB 4RWHA 4OLVL 1S9YB 2IANB 2C3HA 1WC7B 3DX8A 5KSAC 4M7KL 5C3TA 1EIBA 2OJZL 1CD1A 1WISA 4R26H 4HJJL 3DGGB 2EIBA 1RUPH 4PG9A 3SKNA 1B6UA 1ZVYA 3M17A 3HE6C 1HOCA 3VXQB 1DL7H 4X4ME 4XPBL 3CLEH 2WUBH 3CFCL 1WBYA 5E56A 4F8TA 5A3ID 1FZMA 1E4XI 1H15B 5F8RC 3MUGA 4UQ3A 2VITB 5F7WC 4WEBH 5I8EA 4NCC2 3TBVA 2ZG2A 5JW5A 4F9PC 2BXYA 1HH9A 1RURH 4YDKL 4CU7A 3RWFA 2NXZC 3GBML 3KLHC 4NKOB 1MVFA 4PJ7B 1NEZG 4R2GD 1EHXA 1P6FA 4NQEE 4MVBD 4EUPH 1ED3B 5TDPB 2CJUH 3SKJH 5HSFA 3L5XH 1YDPA 1WAAE 2JJSC 3GSNA 3V6OA 5FYJH 2EDYA 1A9EA 3HZYB 1BIIB 2BSED 1MCRA 2X4OB 5CP7B 2KL6A 5D1XC 2XT1B 5E08L 1FFPB 1BVKB 3O3BB 5DD5L 4X7SL 2JE8A 1QQDB 5C0AE 4WWKD 4W6XB 5F44A 4OFVA 4FQXA 4OKDA 4WFFE 1TDQA 5K9JL 4YX2H 2IALB 2FO1A 2SEBA 3T2NL 3SGKC 3QHTC 1DANT 2J8OA 1NBVL 3LKPA 3IVKB 1RJLA 4PRHB 2XN9E 5FO7A 1CDYA 43CAA 3ARGA 1DBKL 3FFDB 1UFUA 3RVXC 4JG0H 4P2OD 4D9RD 2DQIH 4OAWA 3UZVB 2D4DA 4LMQE 4LOUD 4XHJD 1RZJC 3PP3K 3TH2T 4LCIL 4OCWH 5KSUA 5MP6H 5A43C 1SYSB 3LS4H 3F58H 3LPGA 4Z78B 2HJLA 3AS1A 4RX4A 1T7WA 5IMLB 1V3JA 3MRKA 1UCTA 1PG7X 3RWEA 1YNLL 5TDNB 2NR6D 3IDXH 5GPRA 4JQVA 5MI0C 3CVIH 4XZUA 4R4BB 1CXHA 2BNRA 2KDGA 1I8IA 1I1AB 1B9ZA 4YHLH 3T3ME 3DUSA 4JZNA 4WUKH 4GMSL 3QEQE 2H2PD 3RPIB 3C6LB 2ZPKL 2JK5B 2H41A 1A7RH 3RDTA 3HC3L 4Q9RL 4J1UB 5L2JA 4ERSH 1JNHB 2Q6WA 4L4VD 5L8JB 3KJ4C 2F53A 1FAKT 4P9ML 1QSEB 4YHKL 1AJ7H 1HKFA 1WT5A 4I8DA 1YMME 4OLWH 5I1DA 2P47B 2VL5B 4QRQA 5IMOA 4G3YH 3QRGL 4JDZB 4UOW1 1OAKL 3OXRB 3V6OC 1OPGL 2FJGB 4M62H 5BS0B 4L8BA 1IAOA 2ADIB 2EIEA 4LSTL 2X70B 1DLFH 3HI5H 2B4CH 1FO0H 2JTDA 3CGTA 5GGUB 4FQXC 3MCLL 1TPXB 3MJ9L 2YD7A 1UZ6E 4YDLC 2P8MB 2AQ3A 3D3VB 3P40A 4B7LA 1ZA6A 2AGJL 3VJ6B 3BX7C 4JAMB 2VDNL 4OFIA 2ED8A 3L1OH 1J87A 1EEQA 3ARGC 3FOLB 4GUPB 2OSLB 1N2RB 3L5WB 2LU4A 3T4AB 1UM4H 5L8LB 1OB1B 5DUPH 5IB2A 15C8L 1QSVA 4HWEH 4ZPTA 5EZIH 5JO5B 5LXGH 5ESQA 4PRNB 2BOBA 4POUB 4TQEL 1WC7A 3C5ZB 5HY9A 3IAPA 1E0OB 5DD3L 1INQA 1KTLB 2IH3B 2FB4L 2O5YL 3LEXB 1ZGLB 1UENA 2I5YL 3E6HB 2YXMA 3MRNA 4RIRB 1DANU 1N6VA 4JQVC 4U49A 3F62A 2YBRB 2V17H 5JPNB 4H25B 3VXQA 3KPQB 1JUFA 1CE6A 1IGIH 2OS7A 2OXHA 3LKRB 3IDNB 3MMEA 2YOCA 4YAQA 4M7JL 4Y4HD 1OT2A 2NY6D 3NA9L 5DFVD 1HH6A 3VFGH 2LTQB 5FA4A 3STLA 2DIAA 4XC3L 3WXVH 2AJZB 3FFCE 3RDTC 4S0TD 2HT4D 3UPCA 1WZKA 3MRHB 4D0CB 4ZQKB 4AYFA 4UILL 4NKOA 1WT5C 3ZMRA 1HXYA 5FIEA 5KOMC 5IKCA 3IDGA 1ED3A 1BD2E 3I2CL 1HN1A 5INDB 4PREB 1G9NL 4PGBB 5M7QA 2GTZB 5L8KB 2D7TL 2C26A 2MTPA 5D1ZD 4H88L 5FYKU 2NY3B 3BPOC 5HYJE 4G8IB 2EDTA 3AB0B 4ZTOH 2BX5A 3QDJB 2QSCL 3BVNA 5DUMH 3K8KA 1W72A 2VLMD 5FOBB 2IALA 4Z7UE 5DJYA 1EEZB 5I1CL 4PY8I 4HUMB 5GS1A 2EO1A 1R6VA 4G5ZL 4WI6A 4OFYA 1QP1A 3FRPG 1UKSA 2IPTL 4JM2B 3QXDB 4KKBD 2AJVL 2YXFA 3BPLC 2R0LL 4LSPL 5HDBE 1EO8H 3V5KA 1CGXA 4HS8L 5EN2A 2QEJA 4KI5F 5IGXL 1DFBL 1FC1A 4OCLC 3K8LA 5F3HA 5B8CC 1DBML 1SYSA 4LU5L 4K8RH 4EN3B 3NZHL 3L9RA 1PG7H 5IMLA 1D5ZA 4C4KT 4RGNB 5C70A 2EH8H 4P59L 1YEJL 1KV3A 1U93A 5D9SB 4UQ2A 1AD9B 2GJ6B 1XF3A 5ID1A 2XG4A 4G6MH 1QFWM 4OZFB 5IFHL 1OD7A 3D0VB 4C56E 4L4VB 1LEKA 5B3JF 3TWCH 3CXDH 5M94B 4P2RD 4MB4A 1YNKH 1RHHA 5JQHC 4P3CL 1JNHA 4Z7QF 1X6NA 5FYKH 3UTTB 5FKPA 4HUUB 5BVJB 2FX7H 1QPPA 2MPAL 4LDEB 2VLKA 2O93L 1Z2KA 4ZAKD 4WGVB 3MYJB 5IR1A 2VL5A 3PWJB 2FZ3A 4NKQB 4XNQB 3GSRB 4R9HA 5I16B 4HX1B 3OXRA 4PTTB 1NBYA 2WW8A 3B4NA 5BS0A 4NNXA 2RAMA 1TZGL 2X70A 3ARYA 2I27N 3NFPA 4ODWA 4FN0A 3MJGX 4QHNB 1UKQA 5GRYA 4H8WL 2D9CA 3D39D 3NACL 2AV7A 6FABH 2AQ2A 4L3EB 3MLVL 4B41A 1OAZH 3TNMA 3IFNL 4BYHA 5GHWL 1JF5A 3FQUB 3BW9A 4DVBB 4RMWA 5SWSA 5HYQB 4Q9QH 4P9HL 1NCAH 1T5XA 4UNVA 4JM4H 1CFSB 2GY5A 3RKDD 1B0RA 1VESA 2FEDC 4AM0B 5ANME 4YFEA 2E8YA 3RZCD 3FOLA 5BRZB 4L29B 2OSLA 1DQDH 1GPOH 3RHWK 4YZFF 5JW4Q 3DX9B 3WNKA 2QKIA 4CW1A 2DBLL 1FNGA 1OB1A 1FNEB 1OARH 2BRQA 3CFBB 3K8MA 4KVCH 3P4MA 1U91A 4IDJL 3C5ZA 1S8DB 3RL1B 2IMNA 2NY1B 4M9PA 3QUZD 2I25N 3RUGF 1MQ8A 5MEQA 3LY6A 2IG2L 1ZGLA 4G6FB 4V2CB 4P48A 2ZUUA 3E6HA 2VXUH 3V4VH 3NCYS 3MLUL 3LZFH 1IL1B 2IADA 5EOQH 2GITB 1I1AC 3OJMB 2BXZA 4XPHH 2AK4D 5FHBL 3OKEA 2VDQH 2FJHB 3C6LC 1I3GL 4HS6A 1IGJA 1JPTL 4XVTL 1YMHA 3EYUL 4MQ7B 1G7LA 5GJSL 2QSVA 3F7QA 3VFVA 4XVUD 3GBNL 5FM4A 3E8UL 1P7KB 3MRGA 3O4LB 4UIKL 3ROOA 4K7FB 4XCNB 3CSBA 2EXYD 3MRLB 5K9QI 4LNRB 4LLUA 5T33H 5INDA 1TVHB 4XBPB 3OJDB 4WWKA 1UB6A 2GTZA 3G5YA 4D3CL 3EFDH 3ZYIA 4MQXD 3BDBA 3TF7C 4G8IA 4L4TB 3FT3A 1HQRB 3V5HB 5HHMD 2O5ZL 5C0NC 3LRGA 4AQ1B 1MCPL 2AEQH 1NCCL 3D9AH 1TPXC 5B39A 4QXTB 1RIVH 3QH3A 2OM5A 5HVHB 1EEZA 4QT5B 4R90L 3R1GH 2Q86A 4P2OA 1MIML 5ETUA 1DZBA 4JJ5B 1ND0B 2EDRA 4TUJA 3FQTA 1RFDL 2CKNA 3P0YH 4JGMA 3LHPH 4XCEB 1HWGB 5DVOA 4O2CA 4Q0XH 5KN5B 4HXBL 3T0ED 1P6AB 3TYGH 3LEYH 3WDJA 3WE6A 2H3NB 3QXDA 2PR4L 2XQYG 5I9QB 5MENB 4LVEA 4LLDB 3SKUD 1AP2B 1CU4L 1U8QA 2E27H 4FQIH 5FGCB 2VOTA 4BQ9A 3S88H 4ZUUA 4CMMA 4RGMC 4D0DB 3VG0L 1K6QL 1P5VA 3C5ZC 4EEEA 3R0MA 2C3WA 5IBUG 4ZFZB 3EOTL 3TM6A 4LAQL 3AS0A 1FIGL 1IC1A 2IC2A 5FGRA 1RZFH 1Q8MA 3VH8B 1ADQH 1SEBB 5D9SA 4MD5A 4WW1A 5B38G 4G8GD 1Q1JH 4DUWA 3QUMB 1IBGL 4HUNB 1LO5B 3S4SA 1YN6A 2HKHH 4JO4H 2VO5A 5L9DL 1TETL 4L4VA 3BZEA 4PV9A 2LTQC 4O02L 2D31B 5KVGH 1D6EB 3O8XB 5T5FL 3BKCL 1UA6H 4LLWB 4FQHA 4LHUD 2VISA 1WAAF 3I3EA 1GJIA 4YHIB 4MVBC 5DJDA 4Y5XA 5BVJA 3ULSA 3VGAB 4DFIA 3U0WL 5GGRB 2FIKA 1SJHB 2Y25A 2IPUG 3UAJD 3RBSA 4OKVA 5F7FA 3S4SG 3O6LH 4LCCB 1EHNA 5FHAL 4G80B 5EOCJ 5IVOA 3V7AE 2J3SA 4WWKC 2ED7A 4UV7H 1RJZB 3ABZA 4XGZB 5T3XH 3RGVB 3V7AG 3P4LA 2FGWL 2NLJB 2NY3C 2XKNB 1C5DA 3CX5K 2OTWA 3AB0C 4MJ5A 3DGCR 4KWUA 3C60D 1JP5A 1UZ8B 3Q3GB 4JPVH 3DO7A 3C5JB 1PKQE 4J3XA 1IAIH 3D25A 2CDEA 3T8XB 1QNZL 4DVBA 4ODXA 2NX5B 3RZCB 4ZDHB 3WFDH 5E8EB 4KTEH 1S7RB 4P2OC 3DSFH 2YSSB 2J12B 4LOUC 4XHJC 4Z7NE 5K59F 1ETZB 4F33B 4JM2C 3IFLH 4HS3A 3LOWA 3MNVB 4JPIB 4ODSL 2P7TB 1IM9D 3BXNB 4WU7B 1IM3B 2JKXA 1UYWL 4WFEE 2WBJB 4KKLC 4GRMB 1Q94B 2NR6C 2QHRH 3LKOB 1U41A 4FFYL 3L3HB 2WIMA 2AXGA 3C09B 3SJVB 4RGNC 3RX8A 1AIFB 1A6WH 2WIIB 1OCWL 4PJAF 4Y4HA 4H20H 1YY9C 2A77L 2YA2A 3JTTA 3QNZB 2GIYA 5FKAB 3U9PL 1EHLL 1BZ9A 5CD5C 2DM2A 1VB9A 2UYLB 4YXHL 1CR9H 1W8NA 2VE6A 3IS0X 5E8OA 3RZWA 1QBBA 1OAXL 5LWYL 1MHHA 3TT1L 2I26N 1CGTA 2PXYD 5LBSL 3PV6A 3BKMH 2YRPA 4MQ7A 2J6EH 4Y5XC 3QDGB 2DL2A 5KANI 4WHCA 1B4JH 2B0SH 2Z31D 1WTGT 3IJSA 2GK2A 3DVIA 5D1ZA 4LNRA 1IQWL 3OKLB 1TVHA 5DEGB 1UZ6F 2VXTL 1A7PH 1MHPL 1IRAY 5KSBB 4K9EH 8CGTA 3QIWD 1DUZB 4JHAL 1RUML 1J86A 3V5HA 1HINL 3BI9X 1I8MB 4RMUA 1B0GA 2ORBH 2F5AH 4Y4FD 4YUEH 5ESAA 2VTFA 1LE5B 3PWUB 2EDEA 5FB8B 4GSDH 3SEPA 3FO2B 3UJIH 5L6YL 2VKXA 4MDJB 2C3XA 1YYML 4PJCE 1ND0A 4F7PB 2P5EE 2ZCHL 3TT3H 4XCEA 2VLME 2I07B 2D0GA 2AXHA 1QBLL 1FVEB 3WS3B 1NAKH 1JPST 5DK0B 1AC0A 2MCG1 4KZDH 4LIQL 3VGGA 1MNUL 3HZMB 43C9B 1BAFH 4QHKJ 8FABB 4TSBH 2DLHA 4OGZA 1FFOB 2NY1C 4UNTA 3IJHB 3QCVL 4ZFZA 4OD1H 5GS2H 4AG4L 2RCSH 5EU6B 3IAGC 1TTGA 3KNBB 3TBYB 2E8ZA 3VH8A 2AAVA 2NY6C 4X80L 2JCCE 4Y4HC 5C86A 3U30C 1TJHH 3L3GA 4RDQF 5C09B 3QUMA 4P2RA 4PIRF 3V6FB 1IQDB 1LO5A 3KYAA 4DKEL 1HZHL 3UJTH 2HT4C 3T65B 3FCTB 4ODBD 3UYRL 2ZCKH 4ODTH 4OF7A 5B4MD 1KB9K 2HLFD 4QGTA 5L2KB 1CG9B 4ZAKA 3JV4A 4NUGH 3UJJH 5CWSA 1HHIA 1G9MH 4PGCA 4Z95H 3EO0A 2D03L 4GKZB 5C0DA 2A6KB 4MS8D 4PJFB 1Y0LB 1OAQH 3KPMB 2JIXB 4GAYB 3QEGH 2YD1A 5BVPL 1E4XL 1A6AB 1S7UA 5DD0H 2CIIB 4Z7UF 1CD0A 3D39A 4JKMA 3UBXI 3ZTNL 3HA0A 5HYSA 3T3PE 5I1AA 1MCIA 3VFMB 2H26B 4PJXE 4XPGL 3B8YA 3E3QC 5CEZH 4TNVF 1AKJB 1VPOH 4M1CD 3HZVB 4ZPVB 5DR5L 3WNMA 4X6CB 4OGAD 3RZCA 5FM5M 4UV4H 2DQUL 4I1NB 3W9DB 2D3VA 1GGCH 2R4SH 1KEML 3QUKA 2HFFB 2XWJB 1IM9B 3SN6N 3ME0A 4BM7A 4XNYH 3E6FA 3O3DA 1NCWH 1CDUA 2V5MA 2F9BT 2JB5L 3G5VA 1WFNA 3D18B 1A5FH 5JXED 1JTTA 2P7TA 1TZIA 3BXNA 4WU7A 1JPGA 2VLJB 3RPKA 4GRMA 2KZWA 1MCKA 2X9YA 1OTSC 3WIFB 1HNGA 3LKOA 4ZG1A 3P0VL 1U8HA 1CGWA 3P4OB 4HLZH 4NJ9L 2DD8H 2ZUTA 1OOAA 4LSQL 2VL4A 3ZTJH 3T2OA 2AK4A 3QZWB 4NN6B 4TRPL 1H8SA 1LEIA 4O00A 4MSWB 4UZGA 3UTSB 3OAYH 4WUUD 5HGBA 2OK0H 3DROA 2W60B 1L7TL 4XWGL 3O6MH 3B5HA 2J7LA 3AGVA 1AY1H 3SDXB 5DHVA 3UP1A 3QQ3B 5HGHB 2C1PA 5LAXB 2XY1A 3OF6D 4J23A 5JPMA 5CMAA 5IFJB 4L1HA 3LDBC 1PYWA 2DICA 1BZ7A 5C0IB 4WTZG 2V5SA 1S7TB 4MA3A 5EC1B 5EBMB 1TNNA 1A64A 2C9AA 2N7AA 2LV4A 4NYLA 3VXSD 4LASH 4NWUL 2Y7QB 5TE6H 1IZJA 4UIMA 4YDIH 1BQLH 3ES6A 1WWCA 1N0LA 3ZKMC 2VIRA 3OKLA 2FX9L 2OZ4H 4HC1L 4Z7VE 5JHDB 2ESVB 1JHLL 4XP1L 1JYVA 1MFCL 3ARRA 3RGVC 2O26U 4KRLB 3GKWH 4XP4L 4OBSA 4LPVA 3VRIB 2K7PA 3ZDZE 4ZTPL 5IVXB 5IQ9A 4DGIL 3VXTA 3DLQR 1IGFH 2E9BA 3RKDC 4PS4H 1KELL 5F89B 3PWUA 3KXFE 1WJ3A 3T0EA 5HHME 2ENYA 3RZCC 3GMQA 1EDQA 4OZHB 1DDHA 4MDJA 1GGBH 3MRCB 5BV7H 4NHCH 3G08B 4N0FA 1ZT1B 3JV5A 32C2A 2L4OA 5F9DC 2DWEA 3HUJF 1OGAB 2B1AH 1LO2L 5EU3A 4LMQI 1H3XA 2BSSB 3GO1L 5HVGB 3SO5A 4ZD3L 3NIFF 4N1EA 3T0EE 2X4SA 3HZMA 2WBJC 4HQQL 3BPNB 1JPSH 2G75A 1JCKA 4J3TA 3BP5B 4X0KB 1NCUA 1E28B 5LQBH 4F58H 3VI4E 3RWJB 1J0IA 1Z9LA 4AT6B 4OCNC 1FFOA 5SWZB 4G8GA 4R4ND 4PJ9D 4ALAL 5T3ZL 2Y07L 3X14B 1W0VA 2DQHL 3C09C 4OUOA 3HB3D 1VADB 1NFDB 3U4EA 5L7XL 4OLEA 3CK0L 5HHQB 3JTSA 5D1QB 3HMXL 5KZCB 3ARSA 1MEXL 3PP4H 1YN7A 3HE7D 1L6XA 4XP5H 1ZLVK 2VDPH 1IFHL 3SDAB 5DJCB 3IXAA 2RHEA 4LHUA 3EOBA 5LG1A 3A6BL 3OR6B 4G8GE 3QHFL 3MCKA 3Q6FB 4X6FB 5T5NG 3O0RH 4XVUC 1XCTA 1X5ZA 5EUKB 3FONA 2B1HL 1CG9A 3DXAD 4JY4A 1NKOA 2EXYC 1DEEB 3S5LG 3LKNB 3CDCA 1A4KA 2YUXA 1QSFB 2XZAH 1XH3B 1XIWD 2YEZB 4CMHC 4BZ2H 4L4JA 4MA7H 4QOKB 4YLQT 1KUMA 1NSNH 2ICEA 4HK0A 2QTEA 2AJYH 2R0ZL 3FO9A 4PD4K 2XTJD 1PJ9A 2X4RB 4JRXE 3C60A 3MRQA 4DZBA 5F96H 4OUUB 3VFMA 1EUTA 4OJFL 3A67H 2ZSVB 1FPTL 4UOW0 3KVQA 2XY2A 1B0WA 5DRXA 1PG7W 4U1LA 4Y16D 2E3VA 3J8F7 4NRXA 4HULB 3F7VB 4V1DB 3IDYB 3UCRA 4EJ1C 1BJ8A 2HFFA 1FRGL 3ULVD 3WD5H 1IM9A 3TN0D 3EAKA 1MWAB 1MCWW 4R26L 1IC5H 5DTFA 5IESL 3CX5J 4I2XB 5F3BA 2A83A 1KJ2H 3D18A 4X98A 4YGVB 1LQSR 4EI5B 1UB5B 3QR2A 1F4AA 1U58B 1ZVHA 1XF5B 3BYTA 3D0LA 1CIDA 5IF0B 1FZOB 5H35A 5H2BB 4APQD 5DUBB 3V4UH 1Z9OA 3IT8D 4FQPA 2VUOA 3P4OA 4MJ6B 2BY2A 4KHXL 2QQQA 3OKMA 5DDHA 5E00A 3T0BA 2CMRL 4AEIH 3QZWA 4OSUL 1KTRL 1LEGB 3VFWA 2OR9L 3S3PA 4KVNH 3UTSA 1EO7A 2PXYA 1YA5A 4WW2B 2BP3A 2R9HC 1Q0XL 3QNYB 3SDXA 3NFSL 1OAYH 5GZOD 2ADFL 3QQ3A 3KPOB 4IIQA 1E6OH 2Z31A 2GSIB 5EBWB 2PTVA 3UAJC 4X6BB 5D2LB 2EDLA 3FAWA 3ZKSD 4ZNEA 4K3EH 1T03L 5DS8A 2VKWA 2GJJA 3EYOA 2XOTA 2GFBB 3H3PL 4M48L 1JFQL 3QIWA 4H1LB 4N5ED 1XGYL 5FYLL 3MREA 2GAZA 3MJ7B 4QRTA 4Y4FA 3CH1A 4IRSB 4MZ3A 3V5DA 4ZNEE 1A3LL 1T1YB 4RQQB 1VHPA 4WHDA 5EA0H 2VQ1A 1Z0MA 4Z7NF 4XC1L 4ZFGH 4LKXB 1EO5A 3GSOA 1ZS8A 1BIHA 3MQIA 1C08B 4XNMA 4YH6A 1R0AL 1BFSA 4YHMH 3MV7E 1CDCA 1KGCD 5JXAH 4K71B 4ODUA 3DETD 1YJDC 2VDMH 4HGMA 1I9EA 1K4CA 4GMTL 3BIBX 2MKWA 3SDDB 2QQKH 4JFED 5IK3A 3X12A 3CVIL 3QO1B 5EFIA 3TC9A 2V7HB 1MRCL 4G9FE 3RQ3A 4BH8B 3SE8L 3HI1B 1QLRA 1UXSB 4X99B 2VABB 1PKOA 1VENA 1LO3H 4OCYH 4AT6A 4PUBH 4CVZA 4AH2A 2CRZA 3UC0L 2EZ0D 1OL0A 1KC5H 3LQAH 1VADA 3K81A 4UT9H 5E8NB 3PUCA 5CEYA 4F37K 3JVGC 4DKDC 3MLRH 2I9LB 4YHPA 5DJCA 1TIUA 3FO0L 2PXYC 3BD4A 3OR6A 2ZUSA 3Q6FA 1R3JB 2W0KA 4HF5H 3TO2A 1GZQA 2DTMH 3MV01 3F7RA 1OM3L 3QPXH 4IIQC 3RIFF 1GOGA 4KK6C 2Z31C 4PJEE 5IHZA 5GIRA 4LGRB 4U7KA 1DEEA 1HCFX 5DD6A 1QHOA 1PVHA 5C0GB 1PX3A 3L3IA 2DQEH 2YEZA 1KJ3H 1G7QA 2NY0D 3VFRA 5F7YC 5CIPA 1KB9J 3PABB 3O2WH 5F1NB 5KVMC 3P9MA 4W81A 1LDPL 2X4RA 5HHXH 3HAEA 4LP5A 4EI6B 4Y4FC 3GI9H 3GIZL 3CLFL 4PJCF 1J8KA 4PRPB 1LE9B 5HDQH 4P4RB 2ZSVA 3S36H 5I1HH 2N56A 2GTWA 1U3ZA 4O4YL 3C6SA 1VGKB 2V5TA 3L5IA 4V1DA 4JO3L 2ZCLH 5GGSA 1YNTA 1YECL 2H1PL 3O6FB 5JXEA 5LGJA 4WDIA 4RAUB 5F9OH 3WEXA 1DJSA 1KPRA 1N8ZA 4PJHB 4I2XA 2AK1H 4LVHB 3S6CA 1JWMB 4YBLB 4FQCH 1YPZB 3ILQD 4S2SA 3BH8B 1U8OB 2JCCF 3GMRA 1LO4H 1XF5A 3RY4A 1NC2D 2ZZUT 4ORGA 1OTUD 2VLLB 3GKZA 5EORH 1E4WH 3CVHH 1I7UB 1MOEA 2NCMA 3K46A 1J10A 1JNNL 3MA7A 4JN2B 3LQZB 4B7IA 2A6JA 2GKIA 1BF2A 4XXCC 3WS6C 4QNPE 3OX8B 3X13A 5K9KB 5TH2A 3WIHH 4MJ6A 5ICZB 4WUUA 4MDIA 2OI9C 5D1QC 4CN4A 3MLYH 4M00A 3B9EA 1CIUA 3FB5B 4NUJA 1INDL 2XZCL 4L8SB 1J7VR 1A6UH 1R5IB 3OF6A 3FB8A 1VKXA 3O2VL 1IT9H 3QNYA 1F5WA 4NGHH 3MLPA 2QADD 3AS2A 3ZYOA 4OI7A 3OHXB 3VXSA 5JW3L 3BOVA 4HUXA 5ICXA 4R6UA 4UDTA 4WHTA 5EU4A 4MMXC 3SDCB 5EBWA 1NGXA 4OD3L 4BKLB 3VXNB 1YEDA 4E41B 4I3SL 4JRYE 4HDIA 4MAUL 3T3PF 4JDVB 4KKAD 4JFDE 4FFZH 1IGML 4YC2B 4FHBD 4PRBA 3T77B 5C0BB 1V7NL 5J89A 2AJXL 4RGOL 3ARVA 3ZHDA 5IHBA 3REWA 3CXHK 1A7BA 5AZ2H 2IANE 1CL7I 4OZIF 1RMFH 4U6TA 2COQA 2VR5A 4QGYA 4RQQA 4Y1AD 3DO3A 1H8NA 5F7EL 1WCBB 5CFHA 5GRJL 5F88B 4M5ZH 1U2HA 4LKXA 1MIEL 5DK2B 2HH0H 1PQZB 4I9WE 3QDMD 3C9NB 2EDNA 1AO7B 1ZLSL 2IAMD 3IDYC 1BBDL 5FF6B 4RNRB 1GHFL 4NFCA 3K2UH 5JXEC 4GQPH 4MJ2A 3H9SB 1I3RB 4IHOB 4K2UH 1JGVL 1B2WH 5DEFB 1G7IB 1P1ZB 1PFCA 3QUYD 1EFXB 5DK3A 1I7ZA 4KROD 4MHHG 4WI4A 3V4PH 3OKYA 3C2AL 1RHFA 3JXAA 4PJ9A 1ZE3C 4BH8A 2WNGA 1SVCP 3PXHA 1GAFL 3CD4A 1I7TB 4PJBF 3GSWB 4X99A 5SWQB 5A16A 1EH9A 3TNNA 1RU9L 3HE7A 4E0RA 4JO2H 1XF1A 1QRND 5DZOA 2HKFL 4C4KO 3Q2CA 5DRWA 3N0PB 2XICA 5I1LB 5E8NA 5D2NB 4UTAL 4J6RH 5IEKB 5C9JB 4PJ8D 2GYSA 1HKLH 3T2QA 1NFIB 5E2UH 1NMBL 4HCRL 4N90D 3DXAA 1SBSL 5IWLA 4ELKB 4LRNL 2CDGB 2B20A 1R3JA 4ISVB 4Q9CA 5HHOD 5FAAA 3L3KA 4N8VB 3V0AC 2Q8AH 2VYRE 3I02B 5TE4L 1MI5B 1XIWA 4Z7VF 3UTQA 5L88L 4HMCA 3WFHA 3FT4A 5C0GA 3P30H 1MCCA 3R06A 3U2SA 3U4BL 4XVSH 3VMOA 2VZ3A 2G60H 4FQ1H 4DAGL 3KYOB 4GXVL 4JFPB 1W0YT 4JM4L 1K8DA 3VWJB 1O0VA 4HUKB 5DMYA 1NMCB 3K4AA 4Z0BH 5GSRB 1UH3A 2XTJE 2X1WL 1KPUB 4P4RA 3B6SA 4MXWH 4PLJD 3GSXA 1CTOA 3L5JA 3ZKXB 5MHSE 5TGBA 3QQ4B 3TN0A 1PD6A 1R3HA 3U7WH 1Q9OB 1NGPH 1Z5LB 5T1DL 1AE6H 1QFWI 1G7HB 4G7VH 4KDTA 1WIOA 4TULH 1CLOL 1KB5L 1UM5L 3QT2A 3UTZB 4RAUA 3LAFA 3VI4F 1IAKA 2J8UA 3UPAA 1DUYA 1R3IL 5IBTH 5EZOL 1RZGB 3V4VL 3SDDC 3ULVE 4UT7H 3O6KH 1SMAA 2FECI 1G7MB 4NJAH 2IPKA 4YNYB 3U46B 1YPZA 1BZQK 4R4NC 5I8OL 4X6EA 3QFJD 4HW6A 2VLLA 4OT1L 3HB3C 1JPFB 5I2IB 4PRIB 3BGFB 2W59A 1I9JL 2FL5B 2J8UE 5D71L 4OB5H 3T0WA 2CDFB 3HE7C 2N4IA 1A6TA 2Z92B 5DQ9A 3QAZB 4NQDE 1AGBA 4Z76A 4OFDA 5HHVH 3W9EB 1U8KA 1U36A 2IBGA 2MOVA 4NN7B 3FB5A 4UUJB 4L8SA 2VAAA 3PP3H 2WP3T 4U3XA 2GT9A 3JWOL 3T08A 3VCLB 5IWLC 1Y18B 3I6GA 3D3VE 3OHXA 4UTBH 4P3WA 5CJOH 2J1KA 4HMDA 1JZ5A 1XIWC 3SDCA 1T0NB 1TQCB 2GJZB 4E41A 1G9NC 3MFGB 1TQBB 1GGTA 1RSFA 4NO0D 1VFBA 4X7FC 4PR5B 1XEDA 3MV9D 4LSRH 3L7EA 2MMXA 4O51B 3QHZH 1T4KA 4PLNC 4OD2B 2DYPD 4OGYH 1F00I 3EBAA 3MNZA 4JANB 3DHJA 4BQBA 3LHPL 5KSVB 1UQSA 3IFOA 1HQ4A 4KKNA 2B39A 4M4PA 5EOCH 4JFHE 4YHNB 6CGTA 4DGYL 1WCBA 2VLRD 4JFFB 4AJ0A 2VXQL 4OV5A 1CCZA 2E27L 4HT1H 3ZE1E 4Q58C 4JFEA 1MCSA 1HYSD 3O2DH 2P24B 1OP9A 2PYED 1MREH 4IHOA 4PJIB 4ORZC 2AS5M 3VRJA 1CGSH 1I9IL 4R97B 4LVHC 1EFXA 2ADJA 2EKSB 1S9VB 3HNSL 1UM6L 2BVQB 5C0JA 1MELA 1GRWA 1CT8B 4I0PD 1JK8A 4JFEE 4KZEH 3CMOL 4X8XA 1BGXL 3TLRA 4XP6H 5KVGL 3X3GL 4X8JA 3PWNA 3ZHKA 3W39B 4S1SH 2AV1A 4ZOCA 2ZSWB 4HXAH 2H32A 4PB0L 3O3EA 5IQ7H 1L0QA 3CFJB 4MA8L 1J0YA 5GZOC 4AENA 4MYWB 2DJSA 4L8SC 1A2YA 4N0RA 5FK9A 5H94B 2AEWA 5IT2H 3QEUB 4M43H 2YHGA 2CDGA 2YPLD 1FBIH 3OKDB 3JWDL 3RTQB 3SDCC 1PZUB 1JZ8A 3PJSB 3MLXH 1MFDH 3LEVH 3TBWB 3SKMA 5EOTB 3DX6A 4N0UE 4N5EC 4MX7A 1R3LB 3N85H 1J9CT 2E7CA 4H8WC 5IB1B 2BDNL 4YC2C 1FG2A 1QA9A 2CGRL 3VWJA 4EBQL 3KLAB 4HJGB 4P9HC 2XYCA 2ARJB 4KTDH 4HKXA 4A6YL 1QBML 1JGLH 5D8JH 3WNLA 4K3DH 4Z7WB 1Z5LA 4X4XB 5CILH 4JVWA 5J56B 4DN3H 3V52L 2PNDA 1YEIH 5FECA 2FO4B 2YD6A 1BQSA 3OQ3B 4OGXL 4OZFG 1F45A 2O61A 2CSPA 1NC2A 3KHOA 3IS1X 1RZGA 3P77A 3UTTE 1TCRB 1DQQB 5F9JA 1G7MA 1R5WB 2I60H 1T80A 3U46A 1QHPA 3LH2H 4LDLB 1W2KT 5I18L 3GSNL 2YC1B 1RZJH 4HIXH 2AI0L 4PGEB 3WDHA 3VW3H 5I2IA 1RK0A 3GNMH 5T3ZD 2FL5A 2OTUB 4UMGA 3MLSL 2CDFA 4CJ1A 1BX2B 1FAIH 3BKML 1T3FA 4F2MB 4JPWL 1MVUB 1B4JL 4PJEF 2YRLA 4L3CB 1EHAA 2HT2C 1WSST 3H3BC 4PB9L 1NGQL 2CKBH 3DSNA 1JBJA 3LIZH 4U1GC 1Y18A 1KLGA 3I75A 4HLJA 5CBAB 1MQKH 2FEEL 2KQNA 2DDQL 1NLBH 5A2LH 3WFZA 1UJ3B 1DN0A 4E5XA 1C7TA 1UADC 4JQIH 3V6ZB 2DQTH 5C0RL 3MUJA 1GOHA 2NY0C 3B2VH 1RIUL 1DQML 2ICWB 3B5TA 5IV2A 4GW5B 2DQFA 1OGTA 4M5YH 5I1KL 3RHWF 3KDMB 5E9DD 3ARTA 5K9OB 5GJTH 3RVVD 4TVSa 1FDLL 2FR4A 1GYAA 4Y1AA 3MROB 3HR5B 3JV6A 3B9KD 3VWJC 4F9LA 4ZMAT 2IBBA 4NT6A 4J8RB 4X5WA 3HPLB 3LMJL 4HAFA 1TXKA 4LSUH 1TFHA 1C7SA 2R2EB 3RA7H 3KPRB 3QDMA 2E6JA 3F65A 3DECA 4PJ5D 2IAMA 5FUCC 3REVA 4XP9H 5A2KH 2WZPD 1J1XH 1TCMA 1M6OA 1T7ZA 5LGKA 4JZOB 3OPZL 2VZVA 25C8L 3KYKL 3KG5A 3QUYA 2Z35A 4Z0XA 1S5HA 4FMFA 5EUOB 3MLTB 5T1LD 4ZO8A 2R29H 2VWEC 5BZDB 2DLFL 4HPOH 3WKML 2RCSL 4PJIA 1H3TA 2YUWA 3MRPA 4FZ8L 2NY4B 3MBED 5C0CD 2UUDH 2FGZA 1OTUC 2XACC 2YPVH 4X5XB 1AQKH 4PP2B 1S9VA 1YQVH 1ZKAA 4RMQA 5JORB 4LFHG 4KV5E 3TCLB 1QRNA 5HBBA 3SCMD 3CPLA 1K8IB 4GRLD 2H2SC 5CINL 2OP4L 5HHNA 4C54A 2EKJA 4PJ8A 5TQ2L 2OL3L 3ZT5A 1CBVH 5KS9A 3BUYA 1CXEA 2K1MA 4U6HA 2VH5H 1UVQA 4G7YL 4FRWA 1QLFA 2NNAA 4ENED 4AQOA 3VXPB 1ZSDA 2UZIL 3CFJA 5EPMA 4NN7C 2GSGB 5HHOA 5JOPD 2QADC 1A6VL 1OAQL 4L4TE 2FWOA 3BUTA 4HKZB 3UZQA 2UWEB 4UI2A 1MLBA 1J88A 3AU1A 3HS0B 4GRWH 5EZLB 5H94A 5C07B 1T7YA 5DD0L 4GAFB 4HWBL 1FL3A 2AXJA 2YMXL 2P1YA 1A1OA 5DWUL 2ADGB 3QWOB 4HIIA 4CNIA 1F3RB 2DI7A 4P46D 4U1SA 3ZE0F 4EDWL 3FB6B 2IQAB 4CADA 2HA1A 1GGIL 1T0MB 4G43B 1TQBC 2L0DA 5C6WH 1UWXK 4J2XA 1LP9B 2H6PA 1NCDL 3MLZL 3GRWH 4UV4L 3UPRB 1T83A 1GGCL 3KPNA 5D70H 1U8MB 3RAJH 5C8JB 5IW3A 4NNPH 3IDMB 4XNYL 2A6IA 4PJDB 3KLAA 4OZ4A 1U3HD 1DE4B 4QXUH 1EMTL 5EU5A 5I1GL 2QV2A 2IAMC 4C57C 1D9KB 3NIDF 4HMEA 4BFIA 5ITBL 5TDOA 3BO8B 2WINB