4MHDA

Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermidine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
170
structure length
170
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine n1-acetyltransferase
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
total genus 51
structure length 170
sequence length 170
chains with identical sequence B, C
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mhdA00
2GE3A 1ON0A 2JLMA 4NEXA 4YGOA 4KOTA 1KUYA 3LD2A 3DSBA 4FD7A 3I3GA 1TIQA 1IICA 4KVXA 5C82A 2R98A 1J4JA 3R9FA 4KVME 4E0AA 4ZBGA 5GCNA 4UA3A 2KCWA 1RO5A 1K4JA 2BL1A 2ZW5A 2FIAA 4YRHA 1XE4A 1QSNA 3VWDA 1S5KA 1B6BA 4PSXA 5F47A 2JEVA 4U9YA 1QSOA 3SXOA 4IUSA 1I12A 4HNWB 4NCZA 4X5KA 4QBJA 1Z9UA 5FVJA 2VI7A 5C88A 3WR7A 4KVOE 3SHPA 2B58A 4NSQA 3R9EA 3F8KA 4KZTA 2Q0YA 4PK2A 4KUAA 2FS5A 3RYOA 3R95A 4UWJA 3D2PA 1MK4A 1XIXA 5IX3A 4H6ZA 1NSLA 4QUSA 1QSTA 3FXTA 2B4DB 2JDCA 3GYAA 5F46A 1M4DA 2R8VA 1WK4A 4H6UA 2QIRA 3S6FA 2CY2A 4KLVA 1PU9A 2QECA 2ARHA 3W6SA 3EXNA 3TCVA 3ZZIA 1XF8A 1KUVA 4L8AA 2CNMA 1BOBA 2FCKA 4OADA 4XPKA 3PP9A 2ZW4A 1I1DA 2X7BA 4HKFA 2G3AA 2CNTA 4J3GA 3JVNA 3PZJA 3ZJ0A 4AB7A 3W91A 1M4GA 1N71A 4NXYA 2I00A 2NMTA 3CXQA 4KOXA 1GHEA 3EC4A 3GY9A 1YREA 3TT2A 4QVTA 4CRZB 5J8CA 3JUWA 2OH1A 1PUAA 3R1KA 1R57A 2PR8A 4JD6A 3R96A 2Q4VA 4B5PB 4BMHA 3MGDA 1IIDA 1MJBA 4CAVA 2B3VA 1XEBA 2PSWA 4UBRA 4CS0B 2PQ8A 1LRZA 2GANA 1S7NA 2OZGA 4U5YA 4MY0A 5HMNA 4RI1A 4CAXA 4EVYA 3T9YA 3EFAA 4F0YA 3GKRA 4KOWA 3CXSA 1IYKA 1UFHA 3P2FA 1CM0A 3VWEA 3FBUA 1NMTA 2JDDA 2FL4A 2VXKA 4R3KA 3TO7A 4ONUA 1YLEA 1BO4A 2FT0A 4U9ZA 2OB0A 1NE9A 2DXQA 3S6GA 3B8GA 1Z4RA 3TO9A 5IB0A 3F0AA 5F49A 1IYLA 4RS2A 5H84A 4R9MA 4K30A 1SQHA 3EY5A 3S6KA 1S7FA 3BJ8A 1WWZA 4JXQA 1QSMA 4OLLA 3G8WA 3G3SA 4HNXB 4H89A 4UWIA 1P0HA 2EUIA 3K9UA 2J8MA 4R87A 3FIXA 5J8FA 3FRMA 3H4QA 4XPDC 1YX0A 4F6AA 4IF5A 2BSWA 4R57A 1Y9WA 4AVCA 2R1IA 5EBVA 3DR6A 4JLYA 2REEA 2PRBA 4CAWA 1QSRA 2K5TA 2ZW6A 5I0CA 5HH1A 3UY5A 3SXNA 4M3SA 2B5GB 2OZHA 1FY7A 1RXTA 3FNCA 1YVKA 3D3SA 4CRYB 4JJXA 5DWMA 3TO6A 4FD6A 2CNSA 3C26A 4GS4A 2ZPAA 5CNPA 3V8IA 2AJ6A 3BLNA 4B5OA 2HV2A 1U6MA 4QC6A 2PC1A 5JPHA 3DR8A 4KORA 1MJ9A 3BJ7A 4AG9A 2AE6A 2Q4YA 2G0BA 5H86A 1I21A 3IGRA 2P6EA 5F48A 1S7KA 4R3LA 4KOUA 4QB9A 3R9GA 2Z11A 2H5MA 2PDOA 2OZUA 4AVAA 1Z4EA 2QMLA 4ORFA 4OAEA 3TOAA 3IWGA 2B4DA 2Q04A 4MI4A 1M44A 2VZYA 1CJWA 4KOVA 2VZZA 1XMTA 3E0KA 1Y9KA 3TFYA 1KZFA 1YR0A 3F5BA 4KOYA 4XNHC 4AVBA 5KTDA 5JQ4A 4FD5A 4L89A 2GIVA 2BUEA 4MHDA 2J8NA 2B5GA 1KUXA 4M85A 2F5IA 5EC4A 3PGPA 2R7HA 1Q2CA 2Y0MA 3OWCA 1YGHA 2VEZA 2C27A 1B87A 4DNCA 5E96A 2OU2A 3D2MA 1L0CA 4AG7A 2BEIA 2FIWA 1M1DA 2B4BA 2FE7A 1YVOA 4E8OA 4B5PA 4PK3A 3I9SA 4MBUA 4MJ8A 2P6GA 2RC4A 2I79A 2REFA 2D4OA 1V0CA 2Z0ZA 1M4IA 3KKWA 3QAHA 4PV6A 4XNHB 4XPLA 4KOSA 4LX9A 3TTHA 4HNYB 4Y49C 2HUZA 5IV0A 3FYNA 3QB8A 3FB3A 1S3ZA 2EVNA 2IL4A 2A4NA 4JWPA 2D4PA 1S7LA 2PR1A 4KUBA 2ATRA 3TOBA 2FSRA 2VBQA 1YK3A 3DDDA 3CXPA 3D8PA 3DNSA 4II9A 1VKCA 2FXFA 4JXRA 1Y7RA 2Z10A 3T90A 4NF1A 3TE4A 1OZPA 2J8RA 2Q7BA 3S6HA 5KTAA 2G3TA 2Q44A 4YFJA 2ZW7A 5DWNA 1Q2DA 2O28A 4MY3A 4KLWA 3W6XA 5ISVA 3N7ZA 4XPDB 2P0WA 3P2HA 4I49A 1P4NA 4LUAA 4PSWA 4Y49B 4FD4A 3LODA 1MJAA 1S60A 2HQYA 2VQYA 1Q2YA 3NE7A 3EO4A 5KTCA 2WPXA 2WPWA 1IB1E 4E2AA 2B3UA 2ZXVA 1VHSA 2P6FA
chains in the Genus database with same CATH superfamily
1YMEA 2GE3A 1ON0A 2JLMA 4NEXA 4IHMA 4YGOA 3NFZA 4KOTA 1KUYA 3LD2A 3DSBA 2ZEHA 2ZENA 3K9TA 3I3GA 1TIQA 1IICA 4FD7A 4KVXA 5AGEA 3RO0A 5C82A 2R98A 1J4JA 2C1CA 3R9FA 5BWAB 4KVME 4UEEA 4E0AA 4ZBGA 2DPSA 3D66A 2V8DA 1NSAA 5GCNA 4UA3A 2KCWA 1RO5A 1K4JA 2BL1A 2ZW5A 4OC1A 5AG7A 2FIAA 4YRHA 2Z3PA 1IOFA 1XE4A 1QSNA 4M6IA 3VWDA 1ZG8A 4NGTA 4BINA 1S5KA 2EBJA 1B6BA 4PSXA 5F47A 2JEVA 4U9YA 1QSOA 3SXOA 4A33A 4IUSA 4P10A 3RBUA 3SI1A 5JM6A 1FT7A 1ELLP 1I12A 4HNWB 4NCZA 3I1UA 3IIBA 4X5KA 4QBJA 1AMPA 1TKHA 1Z9UA 3B7IA 5FVJA 1R3NA 2ZEGA 3IU1A 2PE3A 2VI7A 1BAVA 3WR7A 3KHXA 5AG5A 5C88A 4KVOE 3SHPA 4ZY2A 1KWMA 2B58A 2BOAA 2F7VA 4NSQA 2IJZA 2Z3OA 3WC5A 3R9EA 5HVHA 3MRUA 1TKJA 4ONWA 4GXHA 5K8MA 3F8KA 1BPNA 4KZTA 3MN8A 3BI0A 2Q0YA 1LOKA 2YNCA 3IJ3A 4PK2A 3DGVA 4NJQA 4KUAA 3VATA 4A32A 1HDUA 2FS5A 3KL9A 4ZX8A 3SJXA 3RYOA 3QNVA 2ZEPA 6CPAA 2YNEA 2Z3KA 4OKOA 4UWJA 3R95A 3SJEA 2PJBA 1XOVA 3D2PA 1MK4A 4H2KA 4A2ZA 4CYPA 1XIXA 4MCSA 4PQAA 4OC5A 4UEFA 5IX3A 4H6ZA 1NSLA 4QUSA 1QSTA 3D7GA 3FXTA 2B4DB 1Z8WA 2JDCA 3H5ZA 4C2YA 3RNZA 3GYAA 3FMCA 4CGOA 5F46A 1M4DA 3S9NA 2R8VA 3TC8A 4NGRA 1WK4A 2BCOA 4H6UA 2QIRA 4X8IA 3S6FA 2CY2A 1XJOA 4KLVA 4R6TA 1PU9A 2QECA 4IAVA 2ARHA 2CIJA 3W6SA 3EXNA 3TCVA 3ZZIA 4F9VA 1XF8A 5J1QA 1XBUA 1KUVA 2EK8A 5LRGA 4L8AA 2CNMA 4B12A 1BOBA 1XRYA 2FCKA 4OADA 4XPKA 3PP9A 2ZW4A 1I1DA 2NSMA 2X7BA 4HKFA 2G3AA 1ZG7A 2CNTA 4A95A 4J3GA 3JVNA 3PZJA 3ZJ0A 4ZGYB 4AB7A 4C2ZA 3W91A 2NYQA 4FWUA 1M4GA 3H8GA 4PXBA 4KSAA 1N71A 4NXYA 4CAFA 2I00A 2JEWA 4CGPA 2NMTA 3CXQA 4KOXA 5HVGA 1GHEA 3EC4A 2GLFA 3GB0A 4OC3A 3GY9A 2AFUA 1YREA 3BHXA 3TT2A 4QVTA 4CRZB 2WYRA 5J8CA 4K3NA 1BLLE 2V8HA 3CPXA 4PXCA 3JUWA 4Q38A 2OH1A 1PUAA 4UIBA 3R1KA 1R57A 4BD9A 2OR4A 2PR8A 1UWYA 4JD6A 5D8NA 4EWTA 3R96A 2GU2A 2AFOA 2Q4VA 1HDQA 4ZY1A 4B5PB 4MFJA 4UCNA 1LCPA 4BMHA 2WSAA 3KGQA 1IIDA 1MJBA 2ODFA 3MGDA 4CAVA 2B3VA 1TXRA 1XEBA 1JQGA 3ISZA 3JTKA 2CTBA 3KI9A 5AG4A 2PJCA 2PSWA 4UBRA 1IOIA 3SI2A 2DF5A 4YU9A 3CDXA 5LYFA 4CS0B 2PQ8A 1LRZA 1LAMA 1S7NA 2GANA 2OZGA 4U5YA 4MY0A 4X2TA 5HMNA 4RI1A 4CAXA 4G1PA 4UEZA 4EVYA 2ZEFA 2PJ4A 4R7MA 3T9YA 3EFAA 4F0YA 3D7FA 4KS9A 2EWBA 1LANA 3GKRA 4DJLA 3B2YA 3CXSA 4KOWA 1IYKA 1CP6A 4X3RA 1IGBA 3NH5A 2YGWA 4KSFA 1UFHA 3P2FA 2QVPA 1CM0A 3VWEA 4UIAA 5G22A 5LRKA 3FBUA 1NMTA 3KASA 2JDDA 2FL4A 4MCQA 2VXKA 3N5FA 4R3KA 3TO7A 1XFOA 3DLJA 1Z2LA 1CG2A 4C2XA 4ONUA 2Z3LA 2PJ2A 1YLEA 3IFEA 5K8PA 1BO4A 2FT0A 4MRIA 4U9ZA 4OIDA 2Q4ZA 3SJFA 3TX8A 2OB0A 3B3TA 1NE9A 2DXQA 3S6GA 3B8GA 3PB7X 1Z4RA 4Q7AA 3TO9A 5IB0A 3F0AA 4P4EA 5F49A 4MFLA 4F8ZA 1IYLA 3D7HA 4LQ6A 4RS2A 2HB6A 3PRTA 4YWYA 2Q43A 5H84A 1F2OA 4P4IA 4MCRA 4R9MA 4K30A 1SQHA 3EY5A 3S6KA 1S7FA 4EMEA 2C6GA 3BJ8A 2XEFA 4RUHA 1WWZA 5IB9A 2DPTA 4NGPA 1AUGA 2CXAA 1VGYA 2GFQA 2G9DA 4NFRA 4JXQA 4M6GA 5G1ZA 4B6ZA 1QSMA 1TKFA 3KZWA 3NH4A 4OC0A 4OLLA 3G8WA 1LFWA 3G3SA 1IY7A 4HNXB 4H89A 4UWIA 1P0HA 2RFHA 2XEIA 5G21A 2EUIA 2PRQA 1EE3P 2J9AA 5F09A 3K9UA 4Q36A 2J8MA 3PB6X 4R87A 3FIXA 3KR5A 3PB4X 5J8FA 3FRMA 3H4QA 4UF4A 1PCAA 4XPDC 1YX0A 3KR4A 4OC2A 4ZY0A 4F6AA 3WC6A 1GYTA 4IF5A 2BSWA 4P44A 3H8FA 2CTCA 1Y9WA 4R57A 5THWA 2POKA 2PCUA 2R1IA 2PIZA 5EBVA 4PXEA 3DR6A 4A30A 3LMSA 4JLYA 2PJ9A 7CPAA 4C68A 2PJ6A 2REEA 3FF3A 2PRBA 1CPXA 4CAWA 5HXDA 1CBXA 2PVWA 2AFXA 5AG6A 1QSRA 3KQXA 5HVFA 4CGMA 2K5TA 3HLPA 2YNCC 2ZW6A 1QQ9A 5I0CA 3FEDA 5HH1A 3NA6A 3IEHA 3UY5A 1Z8LA 3SXNA 4WJBA 4M3SA 2B5GB 2OZHA 2O4HA 1FY7A 1RXTA 1Y0YA 3FNCA 4C7IA 4ZI6A 1YVKA 3A9LA 3D3SA 3IWWA 4DUKA 4CRYB 2PJ3A 4JJXA 5DWMA 3PBEA 3TO6A 4FD6A 2CNSA 4Z65A 3C26A 4GS4A 4CGLA 5CBMA 2ZPAA 5CNPA 1YW4A 3V8IA 2AJ6A 3BLNA 2ZOFA 3PBBA 4B5OA 2HV2A 4GM5A 1U6MA 4QC6A 2PC1A 4OMEA 5JPHA 3DR8A 1QMUA 4KORA 5JH9A 1MJ9A 4A38A 2PVVA 3RAMA 3BJ7A 3FEEA 4AG9A 1ZG9A 4A39A 2AE6A 2CF4A 3CT9A 2Q4YA 4P4BA 2G0BA 1H8LA 3D68A 5H86A 1OBRA 4B14A 1I21A 4MFQA 3WT4A 2BO9A 2EK9A 3IU2A 3IGRA 2AFSA 2P6EA 1XMBA 5F48A 1S7KA 3L2NA 4KOUA 4R3LA 4QB9A 3R9GA 3BI1A 2Z11A 2H5MA 2C6CA 2PDOA 4C7HA 4CYQA 1Q7LA 2OZUA 4AVAA 1Z4EA 2QMLA 4ORFA 4OAEA 3TOAA 2ZEEA 2WZNA 3IWGA 2B4DA 3WABA 3GIUA 2Q04A 3FJUA 5LYIA 2PIYA 4MI4A 5LRJA 1M44A 2VZYA 1CJWA 1ARMA 3KQZA 4RN7A 4KOVA 2VZZA 1XMTA 3E0KA 3GLJA 1VHEA 3IWEA 1R43A 1DTDA 2ZELA 2V77A 3GUXA 3FVLA 2ZEDA 1Y9KA 3VH9A 2PJ7A 3TFYA 1KZFA 4UFWA 5G20A 1YR0A 3F5BA 4KOYA 4UCMA 4MFPA 4XNHC 4AVBA 5KTDA 4NGQA 4FUUA 2IQ6A 2OOTA 4FBEA 5K8NA 5JQ4A 4FD5A 1TF9A 2GLJA 4L89A 4OP4A 2GIVA 5A27A 1Z8XA 3LACA 3ISXA 2BUEA 2YNDA 4MHDA 4CGNA 1A2ZA 2J8NA 5I4MA 4FAIA 2AFWA 2B5GA 3H8EA 1BPMA 1KUXA 3SI0A 1YW6A 8CPAA 4M85A 4F9UA 3PEIA 3VARA 2F5IA 2QJ8A 3FX6A 5EC4A 3PGPA 3K2KA 2R7HA 1Q2CA 2Y0MA 4ZX9A 1Y7EA 1YGHA 3OWCA 2GREA 2VEZA 2C27A 1B87A 3D4UA 4DNCA 5E96A 5ELYA 2OU2A 3D2MA 5LYLA 2JBKA 1L0CA 4UFXA 4AG7A 1PYTB 2BEIA 2V8GA 4W9YA 2FIWA 1M1DA 3B3WA 2B4BA 4UCPA 4AVCA 2I3CA 2FE7A 4MHYA 1YVOA 4NGNA 3FH4A 4B5PA 2ABZA 4E8OA 4O23A 4PK3A 3I9SA 4CPAA 2EO8A 1M4LA 4KSIA 4P6YA 4MBUA 4MJ8A 2Z3MA 5A28A 2PJ8A 4CAEA 3S9LA 2P6GA 2RC4A 4IK2A 2I79A 3NE8A 3FECA 2REFA 4MMOA 4TWEA 2D4OA 4B13A 1V0CA 2Z0ZA 3PB8X 4LQGA 4DYOA 2JBJA 1M4IA 1Z8TA 4MHNA 3CZXA 4P4FA 2AFMA 3KKWA 3QAHA 3WC7A 2HC9A 4PV6A 4PPZA 4XNHB 4CYOA 5EMIA 2C6PA 1CPSA 1HEEA 2PJAA 2XEJA 1YQEA 3PFEA 4KOSA 4XPLA 2ZEMA 4LX9A 3PB9X 2QYVA 4OIWA 4HNYB 3TTHA 3T8WA 4Y49C 2HUZA 2PJ0A 4F0XA 1RTQA 1Z5RA 1CP7A 5IV0A 3FYNA 1ZLHA 1YSJA 3HUVA 3B35A 3FB3A 1S3ZA 2EVNA 3QB8A 1Y0RA 2IL4A 2IMOA 4MHPA 2A4NA 4JWPA 4P4DA 1YLOA 2D4PA 1S7LA 4OC4A 3B3CA 2PR1A 3CPAA 2ATRA 4KUBA 5JGFA 3TOBA 2FSRA 4NGSA 2Z3NA 4MXUA 2XEGA 2VBQA 4MCPA 1YK3A 1ELMP 4R76A 3DDDA 3CXPA 3D8PA 3D67A 3DNSA 4II9A 1ARLA 1FNOA 2O53A 1VKCA 3BXMA 2FXFA 4CYNA 3KHZA 4JXRA 1Y7RA 2Z10A 3JRUA 3IO1A 2V8VA 3T90A 4M6HA 4R8FA 4NF1A 5LYDA 3TE4A 1OZPA 2J8RA 2Q7BA 4WWVA 3PFOA 4A37A 3S6HA 5KTAA 2G3TA 3D7DA 4A94A 1VIXA 2Q51A 2Q44A 3V7ZA 4YFJA 4BBHA 1LAPA 2ZW7A 4UFVA 4JYWA 5DWNA 4MHZA 2AFZA 1Q2DA 3NH8A 4B11A 5D29A 4TNUA 2PJ1A 2ZEOA 4AXVA 5K8OA 2O28A 1F2PA 2ZOGA 4MY3A 4KLWA 3W6XA 5ISVA 4EFDA 5DS0A 4HPSA 2Q7SA 5CPAA 3N7ZA 4XPDB 2FVGA 3IC1A 4P45A 4A31A 2P0WA 1X10A 1DE4C 2PJ5A 3P2HA 2VL1A 3QAYA 4I49A 1P4NA 4LUAA 4P4JA 1AYEA 1JWQA 4FD4A 4MFKA 4PSWA 4JZ0A 1VHOA 4Y49B 3V38A 3LODA 4MFZA 1MJAA 1S60A 3B3SA 1TF8A 2WUUA 1ZO0A 2HQYA 4ZYQA 2VQYA 1Q2YA 3NE7A 3EO4A 3RZAA 2DEAA 4NGMA 4PXDA 2F8HA 1CX8A 1F57A 3SJGA 5KTCA 1ZLIA 2WPXA 2WPWA 1IB1E 4E2AA 3S9MA 1IU8A 2B3UA 1X12A 2ZXVA 3LWUA 4NJRA 1VHSA 2RB7A 3B3VA 2ANPA 4B10A 2P6FA
chains in the Genus database with same CATH topology
2GE3A 1ON0A 2JLMA 4NEXA 4YGOA 4KOTA 1KUYA 3LD2A 3DSBA 4FD7A 3I3GA 1TIQA 1IICA 4KVXA 5AGEA 5C82A 2R98A 1J4JA 3R9FA 5BWAB 4KVME 4E0AA 4ZBGA 2DPSA 5GCNA 4UA3A 2KCWA 1RO5A 1K4JA 2BL1A 2ZW5A 5AG7A 2FIAA 4YRHA 2Z3PA 1XE4A 1QSNA 3VWDA 1S5KA 1B6BA 4PSXA 5F47A 2JEVA 4U9YA 1QSOA 3SXOA 4A33A 4IUSA 1I12A 4HNWB 4NCZA 4X5KA 4QBJA 1Z9UA 5FVJA 3IU1A 2VI7A 5C88A 3WR7A 5AG5A 4KVOE 3SHPA 2B58A 4NSQA 2Z3OA 3R9EA 3F8KA 4KZTA 2Q0YA 2YNCA 4PK2A 4KUAA 4A32A 2FS5A 3RYOA 2YNEA 2Z3KA 4UWJA 3R95A 3D2PA 1MK4A 4A2ZA 4CYPA 1XIXA 5IX3A 4H6ZA 1NSLA 4QUSA 1QSTA 3FXTA 2B4DB 2JDCA 3H5ZA 4C2YA 3GYAA 4CGOA 5F46A 1M4DA 2R8VA 1WK4A 4H6UA 2QIRA 3S6FA 2CY2A 4KLVA 1PU9A 2QECA 2ARHA 3W6SA 3EXNA 3TCVA 3ZZIA 1XF8A 1KUVA 4L8AA 2CNMA 4B12A 1BOBA 2FCKA 4OADA 4XPKA 3PP9A 2ZW4A 1I1DA 2X7BA 4HKFA 2G3AA 4A95A 2CNTA 4J3GA 3JVNA 3PZJA 3ZJ0A 4ZGYB 4AB7A 4C2ZA 3W91A 1M4GA 4KSAA 1N71A 4NXYA 4CAFA 2I00A 4CGPA 2NMTA 3CXQA 4KOXA 1GHEA 3EC4A 3GY9A 1YREA 3TT2A 4QVTA 4CRZB 5J8CA 3JUWA 4Q38A 2OH1A 1PUAA 3R1KA 1R57A 2PR8A 4JD6A 3R96A 2Q4VA 4B5PB 4MFJA 4UCNA 4BMHA 2WSAA 3MGDA 1IIDA 1MJBA 4CAVA 2B3VA 1XEBA 3JTKA 5AG4A 2PSWA 4UBRA 4CS0B 2PQ8A 1LRZA 2GANA 1S7NA 2OZGA 4U5YA 4MY0A 5HMNA 4RI1A 4CAXA 4EVYA 3T9YA 3EFAA 4F0YA 4KS9A 3GKRA 4KOWA 3CXSA 1IYKA 2YGWA 4KSFA 1UFHA 3P2FA 1CM0A 3VWEA 5G22A 3FBUA 1NMTA 2JDDA 2FL4A 2VXKA 4R3KA 3TO7A 4C2XA 4ONUA 2Z3LA 1YLEA 1BO4A 2FT0A 4U9ZA 2OB0A 1NE9A 2DXQA 3S6GA 3B8GA 1Z4RA 3TO9A 5IB0A 3F0AA 5F49A 4MFLA 1IYLA 4RS2A 5H84A 4R9MA 4K30A 1SQHA 3EY5A 3S6KA 1S7FA 3BJ8A 1WWZA 2DPTA 2CXAA 4JXQA 5G1ZA 1QSMA 4OLLA 3G8WA 3G3SA 4HNXB 4H89A 4UWIA 1P0HA 5G21A 2EUIA 3K9UA 4Q36A 2J8MA 4R87A 3FIXA 5J8FA 3FRMA 3H4QA 4XPDC 1YX0A 4F6AA 4IF5A 2BSWA 4R57A 1Y9WA 4A30A 4AVCA 2R1IA 5EBVA 3DR6A 4JLYA 4C68A 2REEA 2PRBA 4CAWA 5AG6A 1QSRA 4CGMA 2K5TA 2YNCC 2ZW6A 5I0CA 5HH1A 3UY5A 3SXNA 4M3SA 2B5GB 2OZHA 1FY7A 1RXTA 3FNCA 4C7IA 1YVKA 3A9LA 3D3SA 4CRYB 4JJXA 5DWMA 3TO6A 4FD6A 2CNSA 3C26A 4GS4A 4CGLA 2ZPAA 5CNPA 3V8IA 2AJ6A 3BLNA 4B5OA 2HV2A 1U6MA 4QC6A 2PC1A 5JPHA 3DR8A 4KORA 1MJ9A 3BJ7A 4AG9A 2AE6A 2Q4YA 2G0BA 5H86A 4B14A 1I21A 4MFQA 3IU2A 3IGRA 2P6EA 5F48A 1S7KA 4R3LA 4KOUA 4QB9A 3R9GA 4CYQA 2Z11A 2H5MA 2PDOA 4C7HA 2OZUA 4AVAA 1Z4EA 2QMLA 4ORFA 4OAEA 3TOAA 3IWGA 2B4DA 2Q04A 4MI4A 1M44A 2VZYA 1CJWA 4KOVA 2VZZA 1XMTA 3E0KA 3IWEA 1Y9KA 3TFYA 1KZFA 4UFWA 5G20A 1YR0A 3F5BA 4KOYA 4UCMA 4MFPA 4XNHC 4AVBA 5KTDA 5JQ4A 4FD5A 4L89A 2GIVA 5A27A 2BUEA 2YNDA 4MHDA 4CGNA 2J8NA 2B5GA 1KUXA 4M85A 2F5IA 5EC4A 3PGPA 2R7HA 1Q2CA 2Y0MA 3OWCA 1YGHA 2VEZA 2C27A 1B87A 4DNCA 5E96A 2OU2A 3D2MA 1L0CA 4UFXA 4AG7A 2BEIA 2FIWA 1M1DA 2B4BA 4UCPA 2FE7A 1YVOA 4E8OA 4B5PA 4PK3A 3I9SA 4MBUA 4MJ8A 2Z3MA 5A28A 4CAEA 2P6GA 2RC4A 2I79A 2REFA 2D4OA 4B13A 1V0CA 2Z0ZA 1M4IA 3KKWA 3QAHA 4PV6A 4XNHB 4CYOA 4XPLA 4KOSA 4LX9A 3TTHA 4HNYB 4Y49C 2HUZA 4F0XA 5IV0A 3FYNA 3QB8A 3FB3A 1S3ZA 2EVNA 2IL4A 2A4NA 4JWPA 2D4PA 1S7LA 2PR1A 4KUBA 2ATRA 3TOBA 2FSRA 2Z3NA 2VBQA 1YK3A 3DDDA 3CXPA 3D8PA 3DNSA 4II9A 4CYNA 1VKCA 2FXFA 4JXRA 1Y7RA 2Z10A 3T90A 4NF1A 3TE4A 1OZPA 2J8RA 2Q7BA 3S6HA 5KTAA 2G3TA 2Q44A 4YFJA 4BBHA 2ZW7A 4UFVA 5DWNA 1Q2DA 4B11A 2O28A 4MY3A 4KLWA 3W6XA 5ISVA 3N7ZA 4XPDB 4A31A 2P0WA 3P2HA 4I49A 1P4NA 4LUAA 4PSWA 4Y49B 4FD4A 4MFKA 3LODA 4MFZA 1MJAA 1S60A 2WUUA 1ZO0A 2HQYA 2VQYA 1Q2YA 3NE7A 3EO4A 5KTCA 2WPXA 2WPWA 1IB1E 4E2AA 2B3UA 2ZXVA 1VHSA 4B10A 2P6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GE3 A;  1ON0 A;  2JLM A;  4NEX A;  4YGO A;  4KOT A;  1KUY A;  3LD2 A;  3DSB A;  4FD7 A;  3I3G A;  1TIQ A;  1IIC A;  4KVX A;  5C82 A;  2R98 A;  1J4J A;  3R9F A;  4KVM E;  4E0A A;  4ZBG A;  5GCN A;  4UA3 A;  2KCW A;  1RO5 A;  1K4J A;  2BL1 A;  2ZW5 A;  2FIA A;  4YRH A;  1XE4 A;  1QSN A;  3VWD A;  1S5K A;  1B6B A;  4PSX A;  5F47 A;  2JEV A;  4U9Y A;  1QSO A;  3SXO A;  4IUS A;  1I12 A;  4HNW B;  4NCZ A;  4X5K A;  4QBJ A;  1Z9U A;  5FVJ A;  2VI7 A;  5C88 A;  3WR7 A;  4KVO E;  3SHP A;  2B58 A;  4NSQ A;  3R9E A;  3F8K A;  4KZT A;  2Q0Y A;  4PK2 A;  4KUA A;  2FS5 A;  3RYO A;  3R95 A;  4UWJ A;  3D2P A;  1MK4 A;  1XIX A;  5IX3 A;  4H6Z A;  1NSL A;  4QUS A;  1QST A;  3FXT A;  2B4D B;  2JDC A;  3GYA A;  5F46 A;  1M4D A;  2R8V A;  1WK4 A;  4H6U A;  2QIR A;  3S6F A;  2CY2 A;  4KLV A;  1PU9 A;  2QEC A;  2ARH A;  3W6S A;  3EXN A;  3TCV A;  3ZZI A;  1XF8 A;  1KUV A;  4L8A A;  2CNM A;  1BOB A;  2FCK A;  4OAD A;  4XPK A;  3PP9 A;  2ZW4 A;  1I1D A;  2X7B A;  4HKF A;  2G3A A;  2CNT A;  4J3G A;  3JVN A;  3PZJ A;  3ZJ0 A;  4AB7 A;  3W91 A;  1M4G A;  1N71 A;  4NXY A;  2I00 A;  2NMT A;  3CXQ A;  4KOX A;  1GHE A;  3EC4 A;  3GY9 A;  1YRE A;  3TT2 A;  4QVT A;  4CRZ B;  5J8C A;  3JUW A;  2OH1 A;  1PUA A;  3R1K A;  1R57 A;  2PR8 A;  4JD6 A;  3R96 A;  2Q4V A;  4B5P B;  4BMH A;  3MGD A;  1IID A;  1MJB A;  4CAV A;  2B3V A;  1XEB A;  2PSW A;  4UBR A;  4CS0 B;  2PQ8 A;  1LRZ A;  2GAN A;  1S7N A;  2OZG A;  4U5Y A;  4MY0 A;  5HMN A;  4RI1 A;  4CAX A;  4EVY A;  3T9Y A;  3EFA A;  4F0Y A;  3GKR A;  4KOW A;  3CXS A;  1IYK A;  1UFH A;  3P2F A;  1CM0 A;  3VWE A;  3FBU A;  1NMT A;  2JDD A;  2FL4 A;  2VXK A;  4R3K A;  3TO7 A;  4ONU A;  1YLE A;  1BO4 A;  2FT0 A;  4U9Z A;  2OB0 A;  1NE9 A;  2DXQ A;  3S6G A;  3B8G A;  1Z4R A;  3TO9 A;  5IB0 A;  3F0A A;  5F49 A;  1IYL A;  4RS2 A;  5H84 A;  4R9M A;  4K30 A;  1SQH A;  3EY5 A;  3S6K A;  1S7F A;  3BJ8 A;  1WWZ A;  4JXQ A;  1QSM A;  4OLL A;  3G8W A;  3G3S A;  4HNX B;  4H89 A;  4UWI A;  1P0H A;  2EUI A;  3K9U A;  2J8M A;  4R87 A;  3FIX A;  5J8F A;  3FRM A;  3H4Q A;  4XPD C;  1YX0 A;  4F6A A;  4IF5 A;  2BSW A;  4R57 A;  1Y9W A;  4AVC A;  2R1I A;  5EBV A;  3DR6 A;  4JLY A;  2REE A;  2PRB A;  4CAW A;  1QSR A;  2K5T A;  2ZW6 A;  5I0C A;  5HH1 A;  3UY5 A;  3SXN A;  4M3S A;  2B5G B;  2OZH A;  1FY7 A;  1RXT A;  3FNC A;  1YVK A;  3D3S A;  4CRY B;  4JJX A;  5DWM A;  3TO6 A;  4FD6 A;  2CNS A;  3C26 A;  4GS4 A;  2ZPA A;  5CNP A;  3V8I A;  2AJ6 A;  3BLN A;  4B5O A;  2HV2 A;  1U6M A;  4QC6 A;  2PC1 A;  5JPH A;  3DR8 A;  4KOR A;  1MJ9 A;  3BJ7 A;  4AG9 A;  2AE6 A;  2Q4Y A;  2G0B A;  5H86 A;  1I21 A;  3IGR A;  2P6E A;  5F48 A;  1S7K A;  4R3L A;  4KOU A;  4QB9 A;  3R9G A;  2Z11 A;  2H5M A;  2PDO A;  2OZU A;  4AVA A;  1Z4E A;  2QML A;  4ORF A;  4OAE A;  3TOA A;  3IWG A;  2B4D A;  2Q04 A;  4MI4 A;  1M44 A;  2VZY A;  1CJW A;  4KOV A;  2VZZ A;  1XMT A;  3E0K A;  1Y9K A;  3TFY A;  1KZF A;  1YR0 A;  3F5B A;  4KOY A;  4XNH C;  4AVB A;  5KTD A;  5JQ4 A;  4FD5 A;  4L89 A;  2GIV A;  2BUE A;  4MHD A;  2J8N A;  2B5G A;  1KUX A;  4M85 A;  2F5I A;  5EC4 A;  3PGP A;  2R7H A;  1Q2C A;  2Y0M A;  3OWC A;  1YGH A;  2VEZ A;  2C27 A;  1B87 A;  4DNC A;  5E96 A;  2OU2 A;  3D2M A;  1L0C A;  4AG7 A;  2BEI A;  2FIW A;  1M1D A;  2B4B A;  2FE7 A;  1YVO A;  4E8O A;  4B5P A;  4PK3 A;  3I9S A;  4MBU A;  4MJ8 A;  2P6G A;  2RC4 A;  2I79 A;  2REF A;  2D4O A;  1V0C A;  2Z0Z A;  1M4I A;  3KKW A;  3QAH A;  4PV6 A;  4XNH B;  4XPL A;  4KOS A;  4LX9 A;  3TTH A;  4HNY B;  4Y49 C;  2HUZ A;  5IV0 A;  3FYN A;  3QB8 A;  3FB3 A;  1S3Z A;  2EVN A;  2IL4 A;  2A4N A;  4JWP A;  2D4P A;  1S7L A;  2PR1 A;  4KUB A;  2ATR A;  3TOB A;  2FSR A;  2VBQ A;  1YK3 A;  3DDD A;  3CXP A;  3D8P A;  3DNS A;  4II9 A;  1VKC A;  2FXF A;  4JXR A;  1Y7R A;  2Z10 A;  3T90 A;  4NF1 A;  3TE4 A;  1OZP A;  2J8R A;  2Q7B A;  3S6H A;  5KTA A;  2G3T A;  2Q44 A;  4YFJ A;  2ZW7 A;  5DWN A;  1Q2D A;  2O28 A;  4MY3 A;  4KLW A;  3W6X A;  5ISV A;  3N7Z A;  4XPD B;  2P0W A;  3P2H A;  4I49 A;  1P4N A;  4LUA A;  4PSW A;  4Y49 B;  4FD4 A;  3LOD A;  1MJA A;  1S60 A;  2HQY A;  2VQY A;  1Q2Y A;  3NE7 A;  3EO4 A;  5KTC A;  2WPX A;  2WPW A;  1IB1 E;  4E2A A;  2B3U A;  2ZXV A;  1VHS A;  2P6F A; 
#chains in the Genus database with same CATH topology
 1YME A;  2GE3 A;  1ON0 A;  2JLM A;  4NEX A;  4IHM A;  4YGO A;  3NFZ A;  4KOT A;  1KUY A;  3LD2 A;  3DSB A;  2ZEH A;  2ZEN A;  3K9T A;  3I3G A;  1TIQ A;  1IIC A;  4FD7 A;  4KVX A;  5AGE A;  3RO0 A;  5C82 A;  2R98 A;  1J4J A;  2C1C A;  3R9F A;  5BWA B;  4KVM E;  4UEE A;  4E0A A;  4ZBG A;  2DPS A;  3D66 A;  2V8D A;  1NSA A;  5GCN A;  4UA3 A;  2KCW A;  1RO5 A;  1K4J A;  2BL1 A;  2ZW5 A;  4OC1 A;  5AG7 A;  2FIA A;  4YRH A;  2Z3P A;  1IOF A;  1XE4 A;  1QSN A;  4M6I A;  3VWD A;  1ZG8 A;  4NGT A;  4BIN A;  1S5K A;  2EBJ A;  1B6B A;  4PSX A;  5F47 A;  2JEV A;  4U9Y A;  1QSO A;  3SXO A;  4A33 A;  4IUS A;  4P10 A;  3RBU A;  3SI1 A;  5JM6 A;  1FT7 A;  1ELL P;  1I12 A;  4HNW B;  4NCZ A;  3I1U A;  3IIB A;  4X5K A;  4QBJ A;  1AMP A;  1TKH A;  1Z9U A;  3B7I A;  5FVJ A;  1R3N A;  2ZEG A;  3IU1 A;  2PE3 A;  2VI7 A;  1BAV A;  3WR7 A;  3KHX A;  5AG5 A;  5C88 A;  4KVO E;  3SHP A;  4ZY2 A;  1KWM A;  2B58 A;  2BOA A;  2F7V A;  4NSQ A;  2IJZ A;  2Z3O A;  3WC5 A;  3R9E A;  5HVH A;  3MRU A;  1TKJ A;  4ONW A;  4GXH A;  5K8M A;  3F8K A;  1BPN A;  4KZT A;  3MN8 A;  3BI0 A;  2Q0Y A;  1LOK A;  2YNC A;  3IJ3 A;  4PK2 A;  3DGV A;  4NJQ A;  4KUA A;  3VAT A;  4A32 A;  1HDU A;  2FS5 A;  3KL9 A;  4ZX8 A;  3SJX A;  3RYO A;  3QNV A;  2ZEP A;  6CPA A;  2YNE A;  2Z3K A;  4OKO A;  4UWJ A;  3R95 A;  3SJE A;  2PJB A;  1XOV A;  3D2P A;  1MK4 A;  4H2K A;  4A2Z A;  4CYP A;  1XIX A;  4MCS A;  4PQA A;  4OC5 A;  4UEF A;  5IX3 A;  4H6Z A;  1NSL A;  4QUS A;  1QST A;  3D7G A;  3FXT A;  2B4D B;  1Z8W A;  2JDC A;  3H5Z A;  4C2Y A;  3RNZ A;  3GYA A;  3FMC A;  4CGO A;  5F46 A;  1M4D A;  3S9N A;  2R8V A;  3TC8 A;  4NGR A;  1WK4 A;  2BCO A;  4H6U A;  2QIR A;  4X8I A;  3S6F A;  2CY2 A;  1XJO A;  4KLV A;  4R6T A;  1PU9 A;  2QEC A;  4IAV A;  2ARH A;  2CIJ A;  3W6S A;  3EXN A;  3TCV A;  3ZZI A;  4F9V A;  1XF8 A;  5J1Q A;  1XBU A;  1KUV A;  2EK8 A;  5LRG A;  4L8A A;  2CNM A;  4B12 A;  1BOB A;  1XRY A;  2FCK A;  4OAD A;  4XPK A;  3PP9 A;  2ZW4 A;  1I1D A;  2NSM A;  2X7B A;  4HKF A;  2G3A A;  1ZG7 A;  2CNT A;  4A95 A;  4J3G A;  3JVN A;  3PZJ A;  3ZJ0 A;  4ZGY B;  4AB7 A;  4C2Z A;  3W91 A;  2NYQ A;  4FWU A;  1M4G A;  3H8G A;  4PXB A;  4KSA A;  1N71 A;  4NXY A;  4CAF A;  2I00 A;  2JEW A;  4CGP A;  2NMT A;  3CXQ A;  4KOX A;  5HVG A;  1GHE A;  3EC4 A;  2GLF A;  3GB0 A;  4OC3 A;  3GY9 A;  2AFU A;  1YRE A;  3BHX A;  3TT2 A;  4QVT A;  4CRZ B;  2WYR A;  5J8C A;  4K3N A;  1BLL E;  2V8H A;  3CPX A;  4PXC A;  3JUW A;  4Q38 A;  2OH1 A;  1PUA A;  4UIB A;  3R1K A;  1R57 A;  4BD9 A;  2OR4 A;  2PR8 A;  1UWY A;  4JD6 A;  5D8N A;  4EWT A;  3R96 A;  2GU2 A;  2AFO A;  2Q4V A;  1HDQ A;  4ZY1 A;  4B5P B;  4MFJ A;  4UCN A;  1LCP A;  4BMH A;  2WSA A;  3KGQ A;  1IID A;  1MJB A;  2ODF A;  3MGD A;  4CAV A;  2B3V A;  1TXR A;  1XEB A;  1JQG A;  3ISZ A;  3JTK A;  2CTB A;  3KI9 A;  5AG4 A;  2PJC A;  2PSW A;  4UBR A;  1IOI A;  3SI2 A;  2DF5 A;  4YU9 A;  3CDX A;  5LYF A;  4CS0 B;  2PQ8 A;  1LRZ A;  1LAM A;  1S7N A;  2GAN A;  2OZG A;  4U5Y A;  4MY0 A;  4X2T A;  5HMN A;  4RI1 A;  4CAX A;  4G1P A;  4UEZ A;  4EVY A;  2ZEF A;  2PJ4 A;  4R7M A;  3T9Y A;  3EFA A;  4F0Y A;  3D7F A;  4KS9 A;  2EWB A;  1LAN A;  3GKR A;  4DJL A;  3B2Y A;  3CXS A;  4KOW A;  1IYK A;  1CP6 A;  4X3R A;  1IGB A;  3NH5 A;  2YGW A;  4KSF A;  1UFH A;  3P2F A;  2QVP A;  1CM0 A;  3VWE A;  4UIA A;  5G22 A;  5LRK A;  3FBU A;  1NMT A;  3KAS A;  2JDD A;  2FL4 A;  4MCQ A;  2VXK A;  3N5F A;  4R3K A;  3TO7 A;  1XFO A;  3DLJ A;  1Z2L A;  1CG2 A;  4C2X A;  4ONU A;  2Z3L A;  2PJ2 A;  1YLE A;  3IFE A;  5K8P A;  1BO4 A;  2FT0 A;  4MRI A;  4U9Z A;  4OID A;  2Q4Z A;  3SJF A;  3TX8 A;  2OB0 A;  3B3T A;  1NE9 A;  2DXQ A;  3S6G A;  3B8G A;  3PB7 X;  1Z4R A;  4Q7A A;  3TO9 A;  5IB0 A;  3F0A A;  4P4E A;  5F49 A;  4MFL A;  4F8Z A;  1IYL A;  3D7H A;  4LQ6 A;  4RS2 A;  2HB6 A;  3PRT A;  4YWY A;  2Q43 A;  5H84 A;  1F2O A;  4P4I A;  4MCR A;  4R9M A;  4K30 A;  1SQH A;  3EY5 A;  3S6K A;  1S7F A;  4EME A;  2C6G A;  3BJ8 A;  2XEF A;  4RUH A;  1WWZ A;  5IB9 A;  2DPT A;  4NGP A;  1AUG A;  2CXA A;  1VGY A;  2GFQ A;  2G9D A;  4NFR A;  4JXQ A;  4M6G A;  5G1Z A;  4B6Z A;  1QSM A;  1TKF A;  3KZW A;  3NH4 A;  4OC0 A;  4OLL A;  3G8W A;  1LFW A;  3G3S A;  1IY7 A;  4HNX B;  4H89 A;  4UWI A;  1P0H A;  2RFH A;  2XEI A;  5G21 A;  2EUI A;  2PRQ A;  1EE3 P;  2J9A A;  5F09 A;  3K9U A;  4Q36 A;  2J8M A;  3PB6 X;  4R87 A;  3FIX A;  3KR5 A;  3PB4 X;  5J8F A;  3FRM A;  3H4Q A;  4UF4 A;  1PCA A;  4XPD C;  1YX0 A;  3KR4 A;  4OC2 A;  4ZY0 A;  4F6A A;  3WC6 A;  1GYT A;  4IF5 A;  2BSW A;  4P44 A;  3H8F A;  2CTC A;  1Y9W A;  4R57 A;  5THW A;  2POK A;  2PCU A;  2R1I A;  2PIZ A;  5EBV A;  4PXE A;  3DR6 A;  4A30 A;  3LMS A;  4JLY A;  2PJ9 A;  7CPA A;  4C68 A;  2PJ6 A;  2REE A;  3FF3 A;  2PRB A;  1CPX A;  4CAW A;  5HXD A;  1CBX A;  2PVW A;  2AFX A;  5AG6 A;  1QSR A;  3KQX A;  5HVF A;  4CGM A;  2K5T A;  3HLP A;  2YNC C;  2ZW6 A;  1QQ9 A;  5I0C A;  3FED A;  5HH1 A;  3NA6 A;  3IEH A;  3UY5 A;  1Z8L A;  3SXN A;  4WJB A;  4M3S A;  2B5G B;  2OZH A;  2O4H A;  1FY7 A;  1RXT A;  1Y0Y A;  3FNC A;  4C7I A;  4ZI6 A;  1YVK A;  3A9L A;  3D3S A;  3IWW A;  4DUK A;  4CRY B;  2PJ3 A;  4JJX A;  5DWM A;  3PBE A;  3TO6 A;  4FD6 A;  2CNS A;  4Z65 A;  3C26 A;  4GS4 A;  4CGL A;  5CBM A;  2ZPA A;  5CNP A;  1YW4 A;  3V8I A;  2AJ6 A;  3BLN A;  2ZOF A;  3PBB A;  4B5O A;  2HV2 A;  4GM5 A;  1U6M A;  4QC6 A;  2PC1 A;  4OME A;  5JPH A;  3DR8 A;  1QMU A;  4KOR A;  5JH9 A;  1MJ9 A;  4A38 A;  2PVV A;  3RAM A;  3BJ7 A;  3FEE A;  4AG9 A;  1ZG9 A;  4A39 A;  2AE6 A;  2CF4 A;  3CT9 A;  2Q4Y A;  4P4B A;  2G0B A;  1H8L A;  3D68 A;  5H86 A;  1OBR A;  4B14 A;  1I21 A;  4MFQ A;  3WT4 A;  2BO9 A;  2EK9 A;  3IU2 A;  3IGR A;  2AFS A;  2P6E A;  1XMB A;  5F48 A;  1S7K A;  3L2N A;  4KOU A;  4R3L A;  4QB9 A;  3R9G A;  3BI1 A;  2Z11 A;  2H5M A;  2C6C A;  2PDO A;  4C7H A;  4CYQ A;  1Q7L A;  2OZU A;  4AVA A;  1Z4E A;  2QML A;  4ORF A;  4OAE A;  3TOA A;  2ZEE A;  2WZN A;  3IWG A;  2B4D A;  3WAB A;  3GIU A;  2Q04 A;  3FJU A;  5LYI A;  2PIY A;  4MI4 A;  5LRJ A;  1M44 A;  2VZY A;  1CJW A;  1ARM A;  3KQZ A;  4RN7 A;  4KOV A;  2VZZ A;  1XMT A;  3E0K A;  3GLJ A;  1VHE A;  3IWE A;  1R43 A;  1DTD A;  2ZEL A;  2V77 A;  3GUX A;  3FVL A;  2ZED A;  1Y9K A;  3VH9 A;  2PJ7 A;  3TFY A;  1KZF A;  4UFW A;  5G20 A;  1YR0 A;  3F5B A;  4KOY A;  4UCM A;  4MFP A;  4XNH C;  4AVB A;  5KTD A;  4NGQ A;  4FUU A;  2IQ6 A;  2OOT A;  4FBE A;  5K8N A;  5JQ4 A;  4FD5 A;  1TF9 A;  2GLJ A;  4L89 A;  4OP4 A;  2GIV A;  5A27 A;  1Z8X A;  3LAC A;  3ISX A;  2BUE A;  2YND A;  4MHD A;  4CGN A;  1A2Z A;  2J8N A;  5I4M A;  4FAI A;  2AFW A;  2B5G A;  3H8E A;  1BPM A;  1KUX A;  3SI0 A;  1YW6 A;  8CPA A;  4M85 A;  4F9U A;  3PEI A;  3VAR A;  2F5I A;  2QJ8 A;  3FX6 A;  5EC4 A;  3PGP A;  3K2K A;  2R7H A;  1Q2C A;  2Y0M A;  4ZX9 A;  1Y7E A;  1YGH A;  3OWC A;  2GRE A;  2VEZ A;  2C27 A;  1B87 A;  3D4U A;  4DNC A;  5E96 A;  5ELY A;  2OU2 A;  3D2M A;  5LYL A;  2JBK A;  1L0C A;  4UFX A;  4AG7 A;  1PYT B;  2BEI A;  2V8G A;  4W9Y A;  2FIW A;  1M1D A;  3B3W A;  2B4B A;  4UCP A;  4AVC A;  2I3C A;  2FE7 A;  4MHY A;  1YVO A;  4NGN A;  3FH4 A;  4B5P A;  2ABZ A;  4E8O A;  4O23 A;  4PK3 A;  3I9S A;  4CPA A;  2EO8 A;  1M4L A;  4KSI A;  4P6Y A;  4MBU A;  4MJ8 A;  2Z3M A;  5A28 A;  2PJ8 A;  4CAE A;  3S9L A;  2P6G A;  2RC4 A;  4IK2 A;  2I79 A;  3NE8 A;  3FEC A;  2REF A;  4MMO A;  4TWE A;  2D4O A;  4B13 A;  1V0C A;  2Z0Z A;  3PB8 X;  4LQG A;  4DYO A;  2JBJ A;  1M4I A;  1Z8T A;  4MHN A;  3CZX A;  4P4F A;  2AFM A;  3KKW A;  3QAH A;  3WC7 A;  2HC9 A;  4PV6 A;  4PPZ A;  4XNH B;  4CYO A;  5EMI A;  2C6P A;  1CPS A;  1HEE A;  2PJA A;  2XEJ A;  1YQE A;  3PFE A;  4KOS A;  4XPL A;  2ZEM A;  4LX9 A;  3PB9 X;  2QYV A;  4OIW A;  4HNY B;  3TTH A;  3T8W A;  4Y49 C;  2HUZ A;  2PJ0 A;  4F0X A;  1RTQ A;  1Z5R A;  1CP7 A;  5IV0 A;  3FYN A;  1ZLH A;  1YSJ A;  3HUV A;  3B35 A;  3FB3 A;  1S3Z A;  2EVN A;  3QB8 A;  1Y0R A;  2IL4 A;  2IMO A;  4MHP A;  2A4N A;  4JWP A;  4P4D A;  1YLO A;  2D4P A;  1S7L A;  4OC4 A;  3B3C A;  2PR1 A;  3CPA A;  2ATR A;  4KUB A;  5JGF A;  3TOB A;  2FSR A;  4NGS A;  2Z3N A;  4MXU A;  2XEG A;  2VBQ A;  4MCP A;  1YK3 A;  1ELM P;  4R76 A;  3DDD A;  3CXP A;  3D8P A;  3D67 A;  3DNS A;  4II9 A;  1ARL A;  1FNO A;  2O53 A;  1VKC A;  3BXM A;  2FXF A;  4CYN A;  3KHZ A;  4JXR A;  1Y7R A;  2Z10 A;  3JRU A;  3IO1 A;  2V8V A;  3T90 A;  4M6H A;  4R8F A;  4NF1 A;  5LYD A;  3TE4 A;  1OZP A;  2J8R A;  2Q7B A;  4WWV A;  3PFO A;  4A37 A;  3S6H A;  5KTA A;  2G3T A;  3D7D A;  4A94 A;  1VIX A;  2Q51 A;  2Q44 A;  3V7Z A;  4YFJ A;  4BBH A;  1LAP A;  2ZW7 A;  4UFV A;  4JYW A;  5DWN A;  4MHZ A;  2AFZ A;  1Q2D A;  3NH8 A;  4B11 A;  5D29 A;  4TNU A;  2PJ1 A;  2ZEO A;  4AXV A;  5K8O A;  2O28 A;  1F2P A;  2ZOG A;  4MY3 A;  4KLW A;  3W6X A;  5ISV A;  4EFD A;  5DS0 A;  4HPS A;  2Q7S A;  5CPA A;  3N7Z A;  4XPD B;  2FVG A;  3IC1 A;  4P45 A;  4A31 A;  2P0W A;  1X10 A;  1DE4 C;  2PJ5 A;  3P2H A;  2VL1 A;  3QAY A;  4I49 A;  1P4N A;  4LUA A;  4P4J A;  1AYE A;  1JWQ A;  4FD4 A;  4MFK A;  4PSW A;  4JZ0 A;  1VHO A;  4Y49 B;  3V38 A;  3LOD A;  4MFZ A;  1MJA A;  1S60 A;  3B3S A;  1TF8 A;  2WUU A;  1ZO0 A;  2HQY A;  4ZYQ A;  2VQY A;  1Q2Y A;  3NE7 A;  3EO4 A;  3RZA A;  2DEA A;  4NGM A;  4PXD A;  2F8H A;  1CX8 A;  1F57 A;  3SJG A;  5KTC A;  1ZLI A;  2WPX A;  2WPW A;  1IB1 E;  4E2A A;  3S9M A;  1IU8 A;  2B3U A;  1X12 A;  2ZXV A;  3LWU A;  4NJR A;  1VHS A;  2RB7 A;  3B3V A;  2ANP A;  4B10 A;  2P6F A; 
#chains in the Genus database with same CATH homology
 2GE3 A;  1ON0 A;  2JLM A;  4NEX A;  4YGO A;  4KOT A;  1KUY A;  3LD2 A;  3DSB A;  4FD7 A;  3I3G A;  1TIQ A;  1IIC A;  4KVX A;  5AGE A;  5C82 A;  2R98 A;  1J4J A;  3R9F A;  5BWA B;  4KVM E;  4E0A A;  4ZBG A;  2DPS A;  5GCN A;  4UA3 A;  2KCW A;  1RO5 A;  1K4J A;  2BL1 A;  2ZW5 A;  5AG7 A;  2FIA A;  4YRH A;  2Z3P A;  1XE4 A;  1QSN A;  3VWD A;  1S5K A;  1B6B A;  4PSX A;  5F47 A;  2JEV A;  4U9Y A;  1QSO A;  3SXO A;  4A33 A;  4IUS A;  1I12 A;  4HNW B;  4NCZ A;  4X5K A;  4QBJ A;  1Z9U A;  5FVJ A;  3IU1 A;  2VI7 A;  5C88 A;  3WR7 A;  5AG5 A;  4KVO E;  3SHP A;  2B58 A;  4NSQ A;  2Z3O A;  3R9E A;  3F8K A;  4KZT A;  2Q0Y A;  2YNC A;  4PK2 A;  4KUA A;  4A32 A;  2FS5 A;  3RYO A;  2YNE A;  2Z3K A;  4UWJ A;  3R95 A;  3D2P A;  1MK4 A;  4A2Z A;  4CYP A;  1XIX A;  5IX3 A;  4H6Z A;  1NSL A;  4QUS A;  1QST A;  3FXT A;  2B4D B;  2JDC A;  3H5Z A;  4C2Y A;  3GYA A;  4CGO A;  5F46 A;  1M4D A;  2R8V A;  1WK4 A;  4H6U A;  2QIR A;  3S6F A;  2CY2 A;  4KLV A;  1PU9 A;  2QEC A;  2ARH A;  3W6S A;  3EXN A;  3TCV A;  3ZZI A;  1XF8 A;  1KUV A;  4L8A A;  2CNM A;  4B12 A;  1BOB A;  2FCK A;  4OAD A;  4XPK A;  3PP9 A;  2ZW4 A;  1I1D A;  2X7B A;  4HKF A;  2G3A A;  4A95 A;  2CNT A;  4J3G A;  3JVN A;  3PZJ A;  3ZJ0 A;  4ZGY B;  4AB7 A;  4C2Z A;  3W91 A;  1M4G A;  4KSA A;  1N71 A;  4NXY A;  4CAF A;  2I00 A;  4CGP A;  2NMT A;  3CXQ A;  4KOX A;  1GHE A;  3EC4 A;  3GY9 A;  1YRE A;  3TT2 A;  4QVT A;  4CRZ B;  5J8C A;  3JUW A;  4Q38 A;  2OH1 A;  1PUA A;  3R1K A;  1R57 A;  2PR8 A;  4JD6 A;  3R96 A;  2Q4V A;  4B5P B;  4MFJ A;  4UCN A;  4BMH A;  2WSA A;  3MGD A;  1IID A;  1MJB A;  4CAV A;  2B3V A;  1XEB A;  3JTK A;  5AG4 A;  2PSW A;  4UBR A;  4CS0 B;  2PQ8 A;  1LRZ A;  2GAN A;  1S7N A;  2OZG A;  4U5Y A;  4MY0 A;  5HMN A;  4RI1 A;  4CAX A;  4EVY A;  3T9Y A;  3EFA A;  4F0Y A;  4KS9 A;  3GKR A;  4KOW A;  3CXS A;  1IYK A;  2YGW A;  4KSF A;  1UFH A;  3P2F A;  1CM0 A;  3VWE A;  5G22 A;  3FBU A;  1NMT A;  2JDD A;  2FL4 A;  2VXK A;  4R3K A;  3TO7 A;  4C2X A;  4ONU A;  2Z3L A;  1YLE A;  1BO4 A;  2FT0 A;  4U9Z A;  2OB0 A;  1NE9 A;  2DXQ A;  3S6G A;  3B8G A;  1Z4R A;  3TO9 A;  5IB0 A;  3F0A A;  5F49 A;  4MFL A;  1IYL A;  4RS2 A;  5H84 A;  4R9M A;  4K30 A;  1SQH A;  3EY5 A;  3S6K A;  1S7F A;  3BJ8 A;  1WWZ A;  2DPT A;  2CXA A;  4JXQ A;  5G1Z A;  1QSM A;  4OLL A;  3G8W A;  3G3S A;  4HNX B;  4H89 A;  4UWI A;  1P0H A;  5G21 A;  2EUI A;  3K9U A;  4Q36 A;  2J8M A;  4R87 A;  3FIX A;  5J8F A;  3FRM A;  3H4Q A;  4XPD C;  1YX0 A;  4F6A A;  4IF5 A;  2BSW A;  4R57 A;  1Y9W A;  4A30 A;  4AVC A;  2R1I A;  5EBV A;  3DR6 A;  4JLY A;  4C68 A;  2REE A;  2PRB A;  4CAW A;  5AG6 A;  1QSR A;  4CGM A;  2K5T A;  2YNC C;  2ZW6 A;  5I0C A;  5HH1 A;  3UY5 A;  3SXN A;  4M3S A;  2B5G B;  2OZH A;  1FY7 A;  1RXT A;  3FNC A;  4C7I A;  1YVK A;  3A9L A;  3D3S A;  4CRY B;  4JJX A;  5DWM A;  3TO6 A;  4FD6 A;  2CNS A;  3C26 A;  4GS4 A;  4CGL A;  2ZPA A;  5CNP A;  3V8I A;  2AJ6 A;  3BLN A;  4B5O A;  2HV2 A;  1U6M A;  4QC6 A;  2PC1 A;  5JPH A;  3DR8 A;  4KOR A;  1MJ9 A;  3BJ7 A;  4AG9 A;  2AE6 A;  2Q4Y A;  2G0B A;  5H86 A;  4B14 A;  1I21 A;  4MFQ A;  3IU2 A;  3IGR A;  2P6E A;  5F48 A;  1S7K A;  4R3L A;  4KOU A;  4QB9 A;  3R9G A;  4CYQ A;  2Z11 A;  2H5M A;  2PDO A;  4C7H A;  2OZU A;  4AVA A;  1Z4E A;  2QML A;  4ORF A;  4OAE A;  3TOA A;  3IWG A;  2B4D A;  2Q04 A;  4MI4 A;  1M44 A;  2VZY A;  1CJW A;  4KOV A;  2VZZ A;  1XMT A;  3E0K A;  3IWE A;  1Y9K A;  3TFY A;  1KZF A;  4UFW A;  5G20 A;  1YR0 A;  3F5B A;  4KOY A;  4UCM A;  4MFP A;  4XNH C;  4AVB A;  5KTD A;  5JQ4 A;  4FD5 A;  4L89 A;  2GIV A;  5A27 A;  2BUE A;  2YND A;  4MHD A;  4CGN A;  2J8N A;  2B5G A;  1KUX A;  4M85 A;  2F5I A;  5EC4 A;  3PGP A;  2R7H A;  1Q2C A;  2Y0M A;  3OWC A;  1YGH A;  2VEZ A;  2C27 A;  1B87 A;  4DNC A;  5E96 A;  2OU2 A;  3D2M A;  1L0C A;  4UFX A;  4AG7 A;  2BEI A;  2FIW A;  1M1D A;  2B4B A;  4UCP A;  2FE7 A;  1YVO A;  4E8O A;  4B5P A;  4PK3 A;  3I9S A;  4MBU A;  4MJ8 A;  2Z3M A;  5A28 A;  4CAE A;  2P6G A;  2RC4 A;  2I79 A;  2REF A;  2D4O A;  4B13 A;  1V0C A;  2Z0Z A;  1M4I A;  3KKW A;  3QAH A;  4PV6 A;  4XNH B;  4CYO A;  4XPL A;  4KOS A;  4LX9 A;  3TTH A;  4HNY B;  4Y49 C;  2HUZ A;  4F0X A;  5IV0 A;  3FYN A;  3QB8 A;  3FB3 A;  1S3Z A;  2EVN A;  2IL4 A;  2A4N A;  4JWP A;  2D4P A;  1S7L A;  2PR1 A;  4KUB A;  2ATR A;  3TOB A;  2FSR A;  2Z3N A;  2VBQ A;  1YK3 A;  3DDD A;  3CXP A;  3D8P A;  3DNS A;  4II9 A;  4CYN A;  1VKC A;  2FXF A;  4JXR A;  1Y7R A;  2Z10 A;  3T90 A;  4NF1 A;  3TE4 A;  1OZP A;  2J8R A;  2Q7B A;  3S6H A;  5KTA A;  2G3T A;  2Q44 A;  4YFJ A;  4BBH A;  2ZW7 A;  4UFV A;  5DWN A;  1Q2D A;  4B11 A;  2O28 A;  4MY3 A;  4KLW A;  3W6X A;  5ISV A;  3N7Z A;  4XPD B;  4A31 A;  2P0W A;  3P2H A;  4I49 A;  1P4N A;  4LUA A;  4PSW A;  4Y49 B;  4FD4 A;  4MFK A;  3LOD A;  4MFZ A;  1MJA A;  1S60 A;  2WUU A;  1ZO0 A;  2HQY A;  2VQY A;  1Q2Y A;  3NE7 A;  3EO4 A;  5KTC A;  2WPX A;  2WPW A;  1IB1 E;  4E2A A;  2B3U A;  2ZXV A;  1VHS A;  4B10 A;  2P6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...