4MHDA

Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermidine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
170
structure length
170
Chain Sequence
b'NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spermidine n1-acetyltransferase
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
total genus 51
structure length 170
sequence length 170
chains with identical sequence B, C
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mhdA00
3OWCA 2Q4YA 3UY5A 2J8MA 3D2PA 4F6AA 2WPWA 2Z11A 2OU2A 3EFAA 3BJ7A 3EO4A 3EXNA 2CY2A 2B4DB 4KLWA 2JEVA 3DDDA 4II9A 3LODA 1Q2DA 4JJXA 2R98A 1XIXA 1KUVA 4RS2A 4U9ZA 4R9MA 2GE3A 1PU9A 3T9YA 1QSMA 2QMLA 4UWIA 2H5MA 3ZZIA 3F8KA 5KTCA 3GYAA 1VHSA 4CAWA 3D8PA 4MY0A 4ONUA 5F49A 1YREA 1NE9A 1WWZA 3LD2A 1FY7A 2Q4VA 3I9SA 3G3SA 1M1DA 3EY5A 4UWJA 2C27A 3FBUA 4MHDA 1XE4A 3PP9A 1B6BA 4QUSA 3FNCA 4GS4A 3KKWA 4JD6A 2K5TA 4KZTA 3T90A 5HMNA 4FD5A 3TO9A 2EUIA 1I21A 2VI7A 2BUEA 2CNMA 5F47A 2ARHA 3TE4A 1SQHA 1M4IA 4H6UA 2BL1A 4OADA 4Y49B 1P0HA 1YGHA 4KOUA 3SXOA 1XEBA 1S7KA 2QECA 2ATRA 1CM0A 1B87A 3W91A 2HV2A 4JXQA 5FVJA 3FRMA 3TO7A 2REEA 3R9GA 4MBUA 3S6FA 5JQ4A 1RXTA 3R9FA 1CJWA 4NF1A 4K30A 2P6GA 1S3ZA 3JVNA 3DR6A 3SHPA 1KUXA 4CRYB 4JXRA 3DSBA 1IB1E 2RC4A 4AVCA 3TTHA 4NSQA 4H89A 5ISVA 1YX0A 4OLLA 2ZW7A 2JDDA 1N71A 4LX9A 4AVAA 2O28A 4PSXA 2B3UA 2PR1A 2HQYA 4B5OA 3BLNA 1L0CA 4PK2A 1LRZA 3FYNA 3IGRA 2FXFA 4E8OA 4XPDC 5EC4A 2Y0MA 3TOAA 1K4JA 3S6HA 2ZW6A 2FCKA 1MJBA 5F48A 1XMTA 2J8NA 2KCWA 1YK3A 1IICA 1KZFA 2FE7A 2R1IA 1QSNA 2AE6A 2X7BA 2DXQA 3MGDA 4J3GA 4R3LA 4FD7A 1Q2YA 3PGPA 4AG7A 4HKFA 1MJ9A 4XNHB 1IYLA 1QSTA 1UFHA 3W6SA 2FS5A 5C82A 2B5GA 4HNXB 3P2HA 4IF5A 2FL4A 2FIWA 4HNWB 5DWNA 3TCVA 4M85A 3VWEA 1Z9UA 2JDCA 3V8IA 4XPLA 1Y9WA 4B5PA 4BMHA 5HH1A 2B5GB 3GKRA 1VKCA 2OZGA 2J8RA 2OB0A 2HUZA 1M44A 1BOBA 2Q0YA 4JWPA 2PQ8A 3C26A 4AG9A 2P6EA 4UBRA 1WK4A 5H86A 2P0WA 4ZBGA 2PR8A 4B5PB 2R7HA 4KOYA 3IWGA 2GANA 4MJ8A 3G8WA 2ZW4A 2ZW5A 4KOXA 4L89A 5KTDA 2I00A 4R87A 5IB0A 2G3AA 4YFJA 2GIVA 4U5YA 4XPKA 2I79A 2WPXA 4IUSA 4YRHA 3F5BA 3H4QA 2OH1A 4KORA 2FIAA 4KUAA 4FD4A 4CAVA 3VWDA 2G0BA 4R57A 5F46A 1GHEA 2PDOA 1MK4A 1I1DA 1YVKA 3CXPA 1Z4EA 1KUYA 4E0AA 3TFYA 1PUAA 5E96A 3ZJ0A 4OAEA 1IIDA 4R3KA 4NXYA 1QSOA 2OZUA 1NSLA 4LUAA 4AVBA 2ZXVA 5EBVA 4PK3A 2D4OA 4KUBA 3NE7A 5H84A 4KLVA 3WR7A 4FD6A 4XPDB 2G3TA 3D3SA 5J8FA 3N7ZA 3R96A 1J4JA 2JLMA 1YVOA 3B8GA 1MJAA 2A4NA 3RYOA 3SXNA 2VXKA 1S7FA 2Q04A 2BSWA 4E2AA 2B3VA 4U9YA 3F0AA 1M4DA 3W6XA 4DNCA 3QB8A 3R9EA 3TT2A 4KOTA 4QVTA 2B58A 2CNSA 4CAXA 2B4BA 4CS0B 1XF8A 3R1KA 4YGOA 4XNHC 5IX3A 4I49A 1RO5A 4HNYB 2Q44A 2Q7BA 4RI1A 2VBQA 3FXTA 1M4GA 2QIRA 4EVYA 5GCNA 5C88A 2PSWA 4UA3A 3TOBA 1S7NA 4AB7A 2EVNA 4NEXA 3GY9A 2ZPAA 3TO6A 1YLEA 3R95A 2VQYA 1OZPA 1TIQA 3FIXA 5I0CA 2D4PA 1V0CA 1S60A 1P4NA 4PV6A 5JPHA 4MY3A 1S7LA 3PZJA 3FB3A 1Z4RA 2F5IA 2Z0ZA 1I12A 2CNTA 4KOVA 5IV0A 4NCZA 4QC6A 5DWMA 1IYKA 3S6GA 4ORFA 2BEIA 2FSRA 3DNSA 3D2MA 1R57A 4PSWA 2VZZA 3CXQA 3DR8A 4Y49C 2Z10A 4QBJA 2IL4A 2VZYA 2REFA 3JUWA 4H6ZA 4M3SA 3BJ8A 4QB9A 5J8CA 4KVXA 2PRBA 4L8AA 4MI4A 2NMTA 1NMTA 4KOSA 3E0KA 5KTAA 1U6MA 2FT0A 4JLYA 1Y9KA 4KOWA 2P6FA 2VEZA 1Y7RA 4KVME 1S5KA 2AJ6A 1ON0A 4KVOE 1BO4A 4CRZB 2PC1A 4F0YA 4X5KA 3S6KA 3P2FA 1YR0A 3EC4A 2R8VA 3QAHA 3I3GA 1QSRA 1Q2CA 2OZHA 2B4DA 3K9UA 5CNPA 3CXSA
chains in the Genus database with same CATH superfamily
3PBEA 3OWCA 2Q4YA 3UY5A 1IGBA 1LCPA 1TXRA 2PCUA 1CPSA 2AFZA 2J8MA 1YQEA 2WUUA 3CDXA 3IJ3A 4P45A 3D2PA 4F6AA 2WPWA 3FVLA 5I4MA 4ONWA 2Z11A 5LRKA 4A38A 1CP6A 2OU2A 1Z8TA 3EFAA 4KSAA 3BJ7A 3SI2A 3EO4A 3EXNA 2DEAA 2CY2A 4P4EA 2OR4A 1XJOA 2XEJA 4IK2A 2B4DB 4KLWA 4TWEA 4MCRA 2PJCA 4ZY1A 4DUKA 4NGRA 2JEVA 3DDDA 4MFLA 2CXAA 4II9A 3LODA 1Q2DA 3NH4A 4JJXA 4P10A 2ZOGA 4R6TA 2R98A 1XIXA 1KUVA 4Q7AA 2AFMA 4RS2A 2CTCA 4U9ZA 4R9MA 1IOFA 1YMEA 2GE3A 5THWA 4A95A 3IO1A 4F0XA 1CP7A 3PB4X 3T8WA 1PU9A 4WWVA 3T9YA 4DYOA 1QSMA 2QMLA 4UWIA 2H5MA 3ZZIA 3F8KA 5LRJA 2GFQA 4OMEA 2PIYA 5KTCA 3GYAA 1VHSA 2ZEDA 1AYEA 4CGLA 1M4LA 3IFEA 3B3VA 4X3RA 2AFOA 4ZYQA 3IC1A 4BBHA 3D8PA 4CAWA 3KHZA 2BOAA 4MY0A 2FVGA 4EFDA 4JZ0A 4NGQA 4ONUA 2DF5A 2HB6A 4MHYA 5F49A 1YREA 1NE9A 1WWZA 2NSMA 2PE3A 3LD2A 3PB8X 4CYNA 4FBEA 3HLPA 3MRUA 4OIDA 6CPAA 1FY7A 2Q4VA 3I9SA 3G3SA 3D7DA 1M1DA 3EY5A 3B2YA 4UWJA 4A30A 1LANA 2C27A 3FBUA 4MHDA 3JTKA 1NSAA 1XE4A 3PP9A 2PRQA 3HUVA 3RO0A 1B6BA 4B13A 4CGMA 3FF3A 4PXEA 3FNCA 4GS4A 4QUSA 3V7ZA 2Q51A 3KKWA 5JH9A 1PCAA 3PFOA 2ODFA 4A31A 1LAPA 2RB7A 3MN8A 4JD6A 2C6GA 2K5TA 3B3SA 4KZTA 3T90A 2BO9A 4MHNA 5AG7A 4FD5A 4CGOA 5HMNA 3TO9A 2EUIA 4R8FA 1I21A 2VI7A 3KGQA 3CT9A 4PQAA 4Q38A 2BUEA 3JRUA 3WC7A 2CNMA 5LYLA 3K2KA 5F47A 3PB7X 2ARHA 4F9VA 3TE4A 2BCOA 1SQHA 3CZXA 2ZEGA 1M4IA 2Z3MA 2ZEFA 4H6UA 2V8VA 2BL1A 2WZNA 3BI0A 2WYRA 3SJFA 1Y0YA 2Z3KA 4OADA 4Y49B 1P0HA 3PB6X 2ZEOA 1PYTB 1YGHA 4KOUA 3SXOA 1XEBA 2PJ4A 1S7KA 2QECA 1KWMA 2V8HA 2ATRA 3B35A 2GREA 1CM0A 1B87A 3W91A 2HV2A 2IJZA 4JXQA 4KSIA 5FVJA 3FRMA 4K3NA 1JWQA 3FEDA 4UEEA 2PJAA 3TO7A 3KQZA 2J9AA 2REEA 3K9TA 4M6HA 4MBUA 4NGNA 2C6CA 4ZX9A 1RXTA 3R9FA 3R9GA 3S6FA 1CJWA 4NF1A 5A27A 5CPAA 3KR4A 3FX6A 1QMUA 4K30A 2P6GA 1S3ZA 3JVNA 3DR6A 3SHPA 3S9NA 1KUXA 4CRYB 2ZELA 4JXRA 3SI1A 4ZGYB 3DSBA 1IB1E 2AFWA 2RC4A 4AVCA 4CYOA 2ZEMA 2YNDA 1XMBA 3TTHA 4NSQA 4F9UA 1ZLHA 4H89A 4A37A 5ISVA 2PVVA 4NGSA 4P4BA 1YX0A 4P4JA 4OLLA 4ZY2A 2ZW7A 2G9DA 2PJ7A 2JDDA 1N71A 4LX9A 4AVAA 5JGFA 2O28A 4PSXA 2B3UA 3GIUA 3IWWA 2PR1A 3WC5A 3B3WA 3A9LA 3D7HA 1Q7LA 3CPAA 2GLJA 1BPNA 2HQYA 3D66A 4CAFA 2XEIA 4OC5A 4B5OA 3L2NA 4C7IA 1XRYA 3I1UA 2IMOA 3BLNA 1L0CA 3PRTA 4MCSA 4B11A 3NE8A 4PK2A 5A28A 1LRZA 3FYNA 2QYVA 3IGRA 2FXFA 1VIXA 4E8OA 4XPDC 5EC4A 3RNZA 2Y0MA 3PFEA 3TOAA 3TC8A 4MHPA 5G20A 1K4JA 3FEEA 3S6HA 5EMIA 3QAYA 1LFWA 4CYPA 2ZW6A 1ZG9A 2NYQA 2FCKA 1MJBA 3D7FA 5F48A 4NGTA 1XMTA 4A32A 2J8NA 2KCWA 4BINA 1YK3A 1IICA 1KZFA 1XOVA 4UFVA 4OC3A 5D29A 2FE7A 7CPAA 2R1IA 3WABA 1QSNA 2AE6A 2X7BA 2DXQA 2O53A 3MGDA 4J3GA 4R3LA 4FD7A 1Q2YA 2ZENA 3PGPA 4AG7A 1FT7A 4NGPA 3PBBA 4HKFA 1MJ9A 4XNHB 1IYLA 1DTDA 1QSTA 1LOKA 3N5FA 1BLLE 1UFHA 2FS5A 3W6SA 5C82A 2B5GA 4HNXB 3P2HA 5HXDA 4MFQA 1F2PA 4IF5A 4MFJA 1CG2A 1GYTA 3WT4A 2FL4A 2CTBA 4C2YA 4P4IA 2DPSA 5JQ4A 1ELLP 2FIWA 3LWUA 4HNWB 5DWNA 3H8FA 3TCVA 3D4UA 4M85A 4MCQA 3VWEA 1Z9UA 4CGPA 2JDCA 3DGVA 4GM5A 1ELMP 3V8IA 2EBJA 4XPLA 5HVHA 1TKFA 1Y9WA 4B5PA 4BMHA 4EMEA 2IQ6A 3PB9X 5HH1A 3GLJA 2B5GB 2GLFA 2CF4A 2VL1A 3SJGA 4C2XA 5K8MA 3GKRA 2OB0A 2OZGA 2J8RA 1ARLA 1VKCA 2C6PA 2HUZA 4PPZA 3PEIA 3NH8A 2I3CA 1M44A 1R43A 4OC4A 4CYQA 5ELYA 1BOBA 2Q0YA 4JWPA 2PQ8A 3C26A 1IOIA 4RN7A 2ZEEA 5J1QA 2JEWA 4KS9A 4AG9A 5D8NA 2P6EA 4CPAA 2YNCC 3QNVA 4UBRA 4YU9A 4EWTA 1WK4A 5H86A 1ARMA 2P0WA 4ZBGA 3D67A 1BPMA 2PR8A 3BXMA 4B5PB 4DJLA 1TKHA 2R7HA 4KOYA 3ISZA 2EK9A 3IWGA 5AGEA 2F7VA 2PJ8A 2GANA 1YW6A 4WJBA 4MJ8A 3G8WA 5IB9A 2ZW4A 2DPTA 3CPXA 2ZW5A 4KOXA 2XEFA 4L89A 2PJ9A 5KTDA 2I00A 1LAMA 2F8HA 4R87A 5IB0A 2AFUA 1TF8A 2G3AA 4UCMA 4A2ZA 4YFJA 3S9MA 2ABZA 2GIVA 3IEHA 2POKA 4U5YA 4XPKA 2OOTA 2I79A 4B10A 2YGWA 4A33A 4RUHA 2WPXA 4MXUA 4IUSA 4YRHA 3F5BA 3ISXA 2EK8A 3H4QA 1CBXA 2OH1A 5K8PA 4KORA 2FIAA 1VHOA 5AG4A 4KUAA 1ZG7A 1ZG8A 4NJQA 2Z3LA 4P4FA 2JBKA 1JQGA 8CPAA 4OC0A 2V8GA 3IIBA 4FD4A 4LQGA 4CAVA 3NH5A 4X8IA 4OIWA 2QJ8A 1Z8LA 5AG5A 2G0BA 3VWDA 4A39A 4R57A 5F46A 4FAIA 1GHEA 2PDOA 1MK4A 1I1DA 1YVKA 5CBMA 3CXPA 2PJ2A 1Z4EA 4OC1A 1DE4C 1KUYA 4PXBA 4E0AA 3TFYA 1PUAA 2PVWA 4BD9A 4FWUA 3BHXA 4R76A 1YLOA 5E96A 3ZJ0A 4OAEA 1IIDA 4MRIA 4JYWA 4R3KA 3W6XA 4NXYA 4HPSA 1EE3P 1QSOA 1TF9A 2OZUA 3IU1A 4W9YA 4P44A 4UIAA 1X10A 1NSLA 4O23A 4LUAA 4AVBA 2ZXVA 3RZAA 5EBVA 4PK3A 4H2KA 2D4OA 4KUBA 1F57A 1Z8XA 3NE7A 4KSFA 3SJXA 5H84A 4KLVA 3WR7A 4FD6A 5AG6A 4XPDB 2G3TA 3D3SA 5J8FA 3KL9A 3N7ZA 3R96A 3LACA 5G21A 4AXVA 4UEFA 4OC2A 1J4JA 1H8LA 3GB0A 2JLMA 1YVOA 4Z65A 4IHMA 3B8GA 3B3CA 2QVPA 1MJAA 5LRGA 2A4NA 4P6YA 2RFHA 3RYOA 3SXNA 3FJUA 1Z2LA 2VXKA 4YWYA 1AUGA 3S9LA 3KI9A 1S7FA 2BSWA 2Q04A 3NA6A 4OP4A 2B3VA 4E2AA 2PJ6A 4U9YA 4PXDA 3F0AA 3SJEA 4CGNA 1M4DA 4UFXA 3H5ZA 2Q43A 3QB8A 2PJBA 3R9EA 4KOTA 4QVTA 3TT2A 4B6ZA 4DNCA 2B58A 4FUUA 2CNSA 4CAXA 1VGYA 2B4BA 4CS0B 1XF8A 3DLJA 3R1KA 4YGOA 4XNHC 4GXHA 5IX3A 2EO8A 1Y7EA 2V8DA 2PJ5A 4I49A 1TKJA 5LYDA 4A94A 3VARA 1RO5A 4HNYB 2Q44A 4NJRA 5DS0A 2EWBA 1A2ZA 2Q7BA 4C2ZA 1IU8A 4NGMA 3FH4A 1UWYA 4M6IA 4RI1A 2VBQA 3FXTA 4MHZA 1M4GA 2QIRA 2YNCA 4C7HA 5G1ZA 5HVFA 4B14A 4EVYA 2HC9A 1VHEA 5GCNA 5C88A 4X2TA 5LYFA 2AFSA 1FNOA 2PSWA 4UA3A 3TOBA 4MFKA 1S7NA 3RAMA 4AB7A 1XBUA 3H8EA 1YW4A 3BI1A 2EVNA 2JBJA 4NEXA 2Z3NA 4OKOA 3GY9A 2ZPAA 3B3TA 1YLEA 2Z3PA 2VQYA 2Z3OA 3FMCA 4MCPA 1OZPA 3R95A 3TO6A 1TIQA 3FIXA 1IY7A 4ZI6A 5I0CA 2D4PA 1V0CA 1S60A 1HEEA 1P4NA 4PV6A 3WC6A 2Q4ZA 5JPHA 2PJ1A 3KHXA 4MY3A 3TX8A 1S7LA 4C68A 2O4HA 2GU2A 4P4DA 3PZJA 2ANPA 2V77A 3FB3A 1Z4RA 2F5IA 2Z0ZA 1I12A 2PIZA 1XFOA 2CNTA 4KOVA 3VATA 4F8ZA 5IV0A 4G1PA 4NCZA 4QC6A 5DWMA 1AMPA 2XEGA 3LMSA 1YSJA 1IYKA 3S6GA 4M6GA 2BEIA 4ORFA 3RBUA 4IAVA 2FSRA 3DNSA 1ZO0A 3B7IA 3D2MA 2PJ0A 4UFWA 1R57A 1RTQA 2ZOFA 4PSWA 2VZZA 3CXQA 3DR8A 4UEZA 4Y49C 1OBRA 5K8OA 2Z10A 5BWAB 4ZX8A 4QBJA 2IL4A 2VZYA 1ZLIA 3GUXA 4Q36A 2C1CA 3KZWA 3KQXA 4UIBA 2REFA 3JUWA 1Y0RA 2ZEPA 3BJ8A 4H6ZA 4M3SA 4MMOA 4NFRA 4PXCA 4QB9A 4KVXA 5J8CA 1Z5RA 2PRBA 4TNUA 5G22A 3VH9A 3NFZA 1Z8WA 4L8AA 3V38A 1QQ9A 4MI4A 4CAEA 2YNEA 2NMTA 1NMTA 1R3NA 2AFXA 3KR5A 3E0KA 4KOSA 4UF4A 5KTAA 4LQ6A 5F09A 1HDUA 1U6MA 2FT0A 3IWEA 4JLYA 1Y9KA 3FECA 4KOWA 2P6FA 2VEZA 4MFZA 3D68A 5JM6A 1CX8A 1BAVA 1Y7RA 4KVME 1S5KA 1CPXA 2Q7SA 5LYIA 1X12A 2AJ6A 1ON0A 4KVOE 1BO4A 4CRZB 2ZEHA 2WSAA 2PC1A 4F0YA 3SI0A 4UCPA 4X5KA 4B12A 3IU2A 2PJ3A 3S6KA 5K8NA 3P2FA 1HDQA 1YR0A 3EC4A 2CIJA 2R8VA 3QAHA 3I3GA 1QSRA 4R7MA 4ZY0A 5HVGA 1Q2CA 2OZHA 3KASA 2B4DA 3D7GA 3K9UA 4MFPA 4UCNA 5CNPA 3H8GA 1F2OA 3CXSA
chains in the Genus database with same CATH topology
3OWCA 2Q4YA 3UY5A 2J8MA 2WUUA 3D2PA 4F6AA 2WPWA 2Z11A 2OU2A 3EFAA 4KSAA 3BJ7A 3EO4A 3EXNA 2CY2A 2B4DB 4KLWA 2JEVA 3DDDA 4MFLA 2CXAA 4II9A 3LODA 1Q2DA 4JJXA 2R98A 1XIXA 1KUVA 4RS2A 4U9ZA 4R9MA 4A95A 2GE3A 4F0XA 1PU9A 3T9YA 1QSMA 2QMLA 4UWIA 2H5MA 3ZZIA 3F8KA 5KTCA 3GYAA 1VHSA 4CGLA 4BBHA 3D8PA 4CAWA 4MY0A 4ONUA 5F49A 1YREA 1NE9A 1WWZA 3LD2A 4CYNA 1FY7A 2Q4VA 3I9SA 3G3SA 1M1DA 3EY5A 4UWJA 4A30A 2C27A 3FBUA 4MHDA 3JTKA 1XE4A 3PP9A 1B6BA 4B13A 4CGMA 4QUSA 3FNCA 4GS4A 3KKWA 4A31A 4JD6A 2K5TA 4KZTA 3T90A 5AG7A 5HMNA 4FD5A 4CGOA 3TO9A 2EUIA 1I21A 2VI7A 4Q38A 2BUEA 2CNMA 5F47A 2ARHA 3TE4A 1SQHA 1M4IA 2Z3MA 4H6UA 2BL1A 2Z3KA 4OADA 4Y49B 1P0HA 1YGHA 4KOUA 3SXOA 1XEBA 1S7KA 2QECA 2ATRA 1CM0A 1B87A 3W91A 2HV2A 4JXQA 5FVJA 3FRMA 3TO7A 2REEA 3R9GA 4MBUA 3S6FA 5A27A 5JQ4A 1RXTA 3R9FA 1CJWA 4NF1A 4K30A 2P6GA 1S3ZA 3JVNA 3DR6A 3SHPA 1KUXA 4CRYB 4JXRA 4ZGYB 3DSBA 1IB1E 2RC4A 4AVCA 4CYOA 2YNDA 3TTHA 4NSQA 4H89A 5ISVA 1YX0A 4OLLA 2ZW7A 2JDDA 1N71A 4LX9A 4AVAA 2O28A 4PSXA 2B3UA 2PR1A 3A9LA 2HQYA 4CAFA 4B5OA 4C7IA 3BLNA 1L0CA 4B11A 4PK2A 5A28A 1LRZA 3FYNA 3IGRA 2FXFA 4E8OA 4XPDC 5EC4A 2Y0MA 3TOAA 5G20A 1K4JA 3S6HA 4CYPA 2ZW6A 2FCKA 1MJBA 5F48A 1XMTA 4A32A 2J8NA 2KCWA 1YK3A 1IICA 1KZFA 4UFVA 2FE7A 2R1IA 1QSNA 2AE6A 2X7BA 2DXQA 3MGDA 4J3GA 4R3LA 4FD7A 1Q2YA 3PGPA 4AG7A 4HKFA 1MJ9A 4XNHB 1IYLA 1QSTA 1UFHA 3W6SA 2FS5A 5C82A 2B5GA 4HNXB 3P2HA 4MFQA 4MFJA 4IF5A 2FL4A 4C2YA 2DPSA 2FIWA 4HNWB 5DWNA 3TCVA 4M85A 3VWEA 1Z9UA 4CGPA 2JDCA 3V8IA 4XPLA 1Y9WA 4B5PA 4BMHA 5HH1A 2B5GB 4C2XA 3GKRA 1VKCA 2OZGA 2J8RA 2OB0A 2HUZA 1M44A 4CYQA 1BOBA 2Q0YA 4JWPA 2PQ8A 3C26A 4KS9A 4AG9A 2P6EA 2YNCC 4UBRA 1WK4A 5H86A 2P0WA 4ZBGA 2PR8A 4B5PB 2R7HA 4KOYA 3IWGA 5AGEA 2GANA 4MJ8A 3G8WA 2ZW4A 2DPTA 2ZW5A 4KOXA 4L89A 5KTDA 2I00A 4R87A 5IB0A 4UCMA 2G3AA 4A2ZA 4YFJA 2GIVA 4U5YA 4XPKA 2I79A 4B10A 2YGWA 4A33A 2WPXA 4IUSA 4YRHA 3F5BA 3H4QA 2OH1A 4KORA 2FIAA 5AG4A 4KUAA 2Z3LA 4FD4A 4CAVA 5AG5A 2G0BA 3VWDA 4R57A 5F46A 1GHEA 2PDOA 1MK4A 1I1DA 1YVKA 3CXPA 1Z4EA 1KUYA 4E0AA 3TFYA 1PUAA 5E96A 3ZJ0A 4OAEA 1IIDA 4R3KA 4NXYA 1QSOA 2OZUA 3IU1A 1NSLA 4LUAA 4AVBA 2ZXVA 5EBVA 4PK3A 2D4OA 4KUBA 3NE7A 4KSFA 5H84A 4KLVA 3WR7A 4FD6A 5AG6A 4XPDB 2G3TA 3D3SA 5J8FA 3N7ZA 3R96A 5G21A 1J4JA 2JLMA 1YVOA 3B8GA 1MJAA 2A4NA 3RYOA 3SXNA 2VXKA 1S7FA 2Q04A 2BSWA 4E2AA 2B3VA 4U9YA 3F0AA 4CGNA 1M4DA 4UFXA 3H5ZA 3W6XA 3QB8A 3R9EA 3TT2A 4KOTA 4QVTA 4DNCA 2B58A 2CNSA 4CAXA 2B4BA 4CS0B 1XF8A 3R1KA 4YGOA 4XNHC 5IX3A 4I49A 1RO5A 4HNYB 2Q44A 2Q7BA 4C2ZA 4RI1A 2VBQA 3FXTA 1M4GA 2QIRA 2YNCA 4C7HA 5G1ZA 4B14A 4EVYA 5GCNA 5C88A 2PSWA 4UA3A 3TOBA 4MFKA 1S7NA 4AB7A 2EVNA 4NEXA 2Z3NA 3GY9A 2ZPAA 3TO6A 1YLEA 2Z3PA 2VQYA 2Z3OA 3R95A 1OZPA 1TIQA 3FIXA 5I0CA 2D4PA 1V0CA 1S60A 1P4NA 4PV6A 5JPHA 4MY3A 4C68A 1S7LA 3PZJA 3FB3A 1Z4RA 2F5IA 2Z0ZA 1I12A 2CNTA 4KOVA 5IV0A 4NCZA 4QC6A 5DWMA 1IYKA 3S6GA 4ORFA 2BEIA 2FSRA 3DNSA 1ZO0A 3D2MA 4UFWA 1R57A 4PSWA 2VZZA 3CXQA 3DR8A 4Y49C 2Z10A 5BWAB 4QBJA 2IL4A 2VZYA 4Q36A 2REFA 3JUWA 4H6ZA 4M3SA 3BJ8A 4QB9A 5J8CA 4KVXA 2PRBA 5G22A 4L8AA 4CAEA 4MI4A 2YNEA 2NMTA 1NMTA 4KOSA 3E0KA 5KTAA 1U6MA 2FT0A 3IWEA 4JLYA 1Y9KA 4KOWA 2P6FA 2VEZA 4MFZA 1Y7RA 4KVME 1S5KA 2AJ6A 1ON0A 4KVOE 1BO4A 4CRZB 2WSAA 2PC1A 4F0YA 4UCPA 4X5KA 4B12A 3IU2A 3S6KA 3P2FA 1YR0A 3EC4A 2R8VA 3QAHA 3I3GA 1QSRA 1Q2CA 2OZHA 2B4DA 3K9UA 4MFPA 4UCNA 5CNPA 3CXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWC A;  2Q4Y A;  3UY5 A;  2J8M A;  3D2P A;  4F6A A;  2WPW A;  2Z11 A;  2OU2 A;  3EFA A;  3BJ7 A;  3EO4 A;  3EXN A;  2CY2 A;  2B4D B;  4KLW A;  2JEV A;  3DDD A;  4II9 A;  3LOD A;  1Q2D A;  4JJX A;  2R98 A;  1XIX A;  1KUV A;  4RS2 A;  4U9Z A;  4R9M A;  2GE3 A;  1PU9 A;  3T9Y A;  1QSM A;  2QML A;  4UWI A;  2H5M A;  3ZZI A;  3F8K A;  5KTC A;  3GYA A;  1VHS A;  4CAW A;  3D8P A;  4MY0 A;  4ONU A;  5F49 A;  1YRE A;  1NE9 A;  1WWZ A;  3LD2 A;  1FY7 A;  2Q4V A;  3I9S A;  3G3S A;  1M1D A;  3EY5 A;  4UWJ A;  2C27 A;  3FBU A;  4MHD A;  1XE4 A;  3PP9 A;  1B6B A;  4QUS A;  3FNC A;  4GS4 A;  3KKW A;  4JD6 A;  2K5T A;  4KZT A;  3T90 A;  5HMN A;  4FD5 A;  3TO9 A;  2EUI A;  1I21 A;  2VI7 A;  2BUE A;  2CNM A;  5F47 A;  2ARH A;  3TE4 A;  1SQH A;  1M4I A;  4H6U A;  2BL1 A;  4OAD A;  4Y49 B;  1P0H A;  1YGH A;  4KOU A;  3SXO A;  1XEB A;  1S7K A;  2QEC A;  2ATR A;  1CM0 A;  1B87 A;  3W91 A;  2HV2 A;  4JXQ A;  5FVJ A;  3FRM A;  3TO7 A;  2REE A;  3R9G A;  4MBU A;  3S6F A;  5JQ4 A;  1RXT A;  3R9F A;  1CJW A;  4NF1 A;  4K30 A;  2P6G A;  1S3Z A;  3JVN A;  3DR6 A;  3SHP A;  1KUX A;  4CRY B;  4JXR A;  3DSB A;  1IB1 E;  2RC4 A;  4AVC A;  3TTH A;  4NSQ A;  4H89 A;  5ISV A;  1YX0 A;  4OLL A;  2ZW7 A;  2JDD A;  1N71 A;  4LX9 A;  4AVA A;  2O28 A;  4PSX A;  2B3U A;  2PR1 A;  2HQY A;  4B5O A;  3BLN A;  1L0C A;  4PK2 A;  1LRZ A;  3FYN A;  3IGR A;  2FXF A;  4E8O A;  4XPD C;  5EC4 A;  2Y0M A;  3TOA A;  1K4J A;  3S6H A;  2ZW6 A;  2FCK A;  1MJB A;  5F48 A;  1XMT A;  2J8N A;  2KCW A;  1YK3 A;  1IIC A;  1KZF A;  2FE7 A;  2R1I A;  1QSN A;  2AE6 A;  2X7B A;  2DXQ A;  3MGD A;  4J3G A;  4R3L A;  4FD7 A;  1Q2Y A;  3PGP A;  4AG7 A;  4HKF A;  1MJ9 A;  4XNH B;  1IYL A;  1QST A;  1UFH A;  3W6S A;  2FS5 A;  5C82 A;  2B5G A;  4HNX B;  3P2H A;  4IF5 A;  2FL4 A;  2FIW A;  4HNW B;  5DWN A;  3TCV A;  4M85 A;  3VWE A;  1Z9U A;  2JDC A;  3V8I A;  4XPL A;  1Y9W A;  4B5P A;  4BMH A;  5HH1 A;  2B5G B;  3GKR A;  1VKC A;  2OZG A;  2J8R A;  2OB0 A;  2HUZ A;  1M44 A;  1BOB A;  2Q0Y A;  4JWP A;  2PQ8 A;  3C26 A;  4AG9 A;  2P6E A;  4UBR A;  1WK4 A;  5H86 A;  2P0W A;  4ZBG A;  2PR8 A;  4B5P B;  2R7H A;  4KOY A;  3IWG A;  2GAN A;  4MJ8 A;  3G8W A;  2ZW4 A;  2ZW5 A;  4KOX A;  4L89 A;  5KTD A;  2I00 A;  4R87 A;  5IB0 A;  2G3A A;  4YFJ A;  2GIV A;  4U5Y A;  4XPK A;  2I79 A;  2WPX A;  4IUS A;  4YRH A;  3F5B A;  3H4Q A;  2OH1 A;  4KOR A;  2FIA A;  4KUA A;  4FD4 A;  4CAV A;  3VWD A;  2G0B A;  4R57 A;  5F46 A;  1GHE A;  2PDO A;  1MK4 A;  1I1D A;  1YVK A;  3CXP A;  1Z4E A;  1KUY A;  4E0A A;  3TFY A;  1PUA A;  5E96 A;  3ZJ0 A;  4OAE A;  1IID A;  4R3K A;  4NXY A;  1QSO A;  2OZU A;  1NSL A;  4LUA A;  4AVB A;  2ZXV A;  5EBV A;  4PK3 A;  2D4O A;  4KUB A;  3NE7 A;  5H84 A;  4KLV A;  3WR7 A;  4FD6 A;  4XPD B;  2G3T A;  3D3S A;  5J8F A;  3N7Z A;  3R96 A;  1J4J A;  2JLM A;  1YVO A;  3B8G A;  1MJA A;  2A4N A;  3RYO A;  3SXN A;  2VXK A;  1S7F A;  2Q04 A;  2BSW A;  4E2A A;  2B3V A;  4U9Y A;  3F0A A;  1M4D A;  3W6X A;  4DNC A;  3QB8 A;  3R9E A;  3TT2 A;  4KOT A;  4QVT A;  2B58 A;  2CNS A;  4CAX A;  2B4B A;  4CS0 B;  1XF8 A;  3R1K A;  4YGO A;  4XNH C;  5IX3 A;  4I49 A;  1RO5 A;  4HNY B;  2Q44 A;  2Q7B A;  4RI1 A;  2VBQ A;  3FXT A;  1M4G A;  2QIR A;  4EVY A;  5GCN A;  5C88 A;  2PSW A;  4UA3 A;  3TOB A;  1S7N A;  4AB7 A;  2EVN A;  4NEX A;  3GY9 A;  2ZPA A;  3TO6 A;  1YLE A;  3R95 A;  2VQY A;  1OZP A;  1TIQ A;  3FIX A;  5I0C A;  2D4P A;  1V0C A;  1S60 A;  1P4N A;  4PV6 A;  5JPH A;  4MY3 A;  1S7L A;  3PZJ A;  3FB3 A;  1Z4R A;  2F5I A;  2Z0Z A;  1I12 A;  2CNT A;  4KOV A;  5IV0 A;  4NCZ A;  4QC6 A;  5DWM A;  1IYK A;  3S6G A;  4ORF A;  2BEI A;  2FSR A;  3DNS A;  3D2M A;  1R57 A;  4PSW A;  2VZZ A;  3CXQ A;  3DR8 A;  4Y49 C;  2Z10 A;  4QBJ A;  2IL4 A;  2VZY A;  2REF A;  3JUW A;  4H6Z A;  4M3S A;  3BJ8 A;  4QB9 A;  5J8C A;  4KVX A;  2PRB A;  4L8A A;  4MI4 A;  2NMT A;  1NMT A;  4KOS A;  3E0K A;  5KTA A;  1U6M A;  2FT0 A;  4JLY A;  1Y9K A;  4KOW A;  2P6F A;  2VEZ A;  1Y7R A;  4KVM E;  1S5K A;  2AJ6 A;  1ON0 A;  4KVO E;  1BO4 A;  4CRZ B;  2PC1 A;  4F0Y A;  4X5K A;  3S6K A;  3P2F A;  1YR0 A;  3EC4 A;  2R8V A;  3QAH A;  3I3G A;  1QSR A;  1Q2C A;  2OZH A;  2B4D A;  3K9U A;  5CNP A;  3CXS A; 
#chains in the Genus database with same CATH topology
 3PBE A;  3OWC A;  2Q4Y A;  3UY5 A;  1IGB A;  1LCP A;  1TXR A;  2PCU A;  1CPS A;  2AFZ A;  2J8M A;  1YQE A;  2WUU A;  3CDX A;  3IJ3 A;  4P45 A;  3D2P A;  4F6A A;  2WPW A;  3FVL A;  5I4M A;  4ONW A;  2Z11 A;  5LRK A;  4A38 A;  1CP6 A;  2OU2 A;  1Z8T A;  3EFA A;  4KSA A;  3BJ7 A;  3SI2 A;  3EO4 A;  3EXN A;  2DEA A;  2CY2 A;  4P4E A;  2OR4 A;  1XJO A;  2XEJ A;  4IK2 A;  2B4D B;  4KLW A;  4TWE A;  4MCR A;  2PJC A;  4ZY1 A;  4DUK A;  4NGR A;  2JEV A;  3DDD A;  4MFL A;  2CXA A;  4II9 A;  3LOD A;  1Q2D A;  3NH4 A;  4JJX A;  4P10 A;  2ZOG A;  4R6T A;  2R98 A;  1XIX A;  1KUV A;  4Q7A A;  2AFM A;  4RS2 A;  2CTC A;  4U9Z A;  4R9M A;  1IOF A;  1YME A;  2GE3 A;  5THW A;  4A95 A;  3IO1 A;  4F0X A;  1CP7 A;  3PB4 X;  3T8W A;  1PU9 A;  4WWV A;  3T9Y A;  4DYO A;  1QSM A;  2QML A;  4UWI A;  2H5M A;  3ZZI A;  3F8K A;  5LRJ A;  2GFQ A;  4OME A;  2PIY A;  5KTC A;  3GYA A;  1VHS A;  2ZED A;  1AYE A;  4CGL A;  1M4L A;  3IFE A;  3B3V A;  4X3R A;  2AFO A;  4ZYQ A;  3IC1 A;  4BBH A;  3D8P A;  4CAW A;  3KHZ A;  2BOA A;  4MY0 A;  2FVG A;  4EFD A;  4JZ0 A;  4NGQ A;  4ONU A;  2DF5 A;  2HB6 A;  4MHY A;  5F49 A;  1YRE A;  1NE9 A;  1WWZ A;  2NSM A;  2PE3 A;  3LD2 A;  3PB8 X;  4CYN A;  4FBE A;  3HLP A;  3MRU A;  4OID A;  6CPA A;  1FY7 A;  2Q4V A;  3I9S A;  3G3S A;  3D7D A;  1M1D A;  3EY5 A;  3B2Y A;  4UWJ A;  4A30 A;  1LAN A;  2C27 A;  3FBU A;  4MHD A;  3JTK A;  1NSA A;  1XE4 A;  3PP9 A;  2PRQ A;  3HUV A;  3RO0 A;  1B6B A;  4B13 A;  4CGM A;  3FF3 A;  4PXE A;  3FNC A;  4GS4 A;  4QUS A;  3V7Z A;  2Q51 A;  3KKW A;  5JH9 A;  1PCA A;  3PFO A;  2ODF A;  4A31 A;  1LAP A;  2RB7 A;  3MN8 A;  4JD6 A;  2C6G A;  2K5T A;  3B3S A;  4KZT A;  3T90 A;  2BO9 A;  4MHN A;  5AG7 A;  4FD5 A;  4CGO A;  5HMN A;  3TO9 A;  2EUI A;  4R8F A;  1I21 A;  2VI7 A;  3KGQ A;  3CT9 A;  4PQA A;  4Q38 A;  2BUE A;  3JRU A;  3WC7 A;  2CNM A;  5LYL A;  3K2K A;  5F47 A;  3PB7 X;  2ARH A;  4F9V A;  3TE4 A;  2BCO A;  1SQH A;  3CZX A;  2ZEG A;  1M4I A;  2Z3M A;  2ZEF A;  4H6U A;  2V8V A;  2BL1 A;  2WZN A;  3BI0 A;  2WYR A;  3SJF A;  1Y0Y A;  2Z3K A;  4OAD A;  4Y49 B;  1P0H A;  3PB6 X;  2ZEO A;  1PYT B;  1YGH A;  4KOU A;  3SXO A;  1XEB A;  2PJ4 A;  1S7K A;  2QEC A;  1KWM A;  2V8H A;  2ATR A;  3B35 A;  2GRE A;  1CM0 A;  1B87 A;  3W91 A;  2HV2 A;  2IJZ A;  4JXQ A;  4KSI A;  5FVJ A;  3FRM A;  4K3N A;  1JWQ A;  3FED A;  4UEE A;  2PJA A;  3TO7 A;  3KQZ A;  2J9A A;  2REE A;  3K9T A;  4M6H A;  4MBU A;  4NGN A;  2C6C A;  4ZX9 A;  1RXT A;  3R9F A;  3R9G A;  3S6F A;  1CJW A;  4NF1 A;  5A27 A;  5CPA A;  3KR4 A;  3FX6 A;  1QMU A;  4K30 A;  2P6G A;  1S3Z A;  3JVN A;  3DR6 A;  3SHP A;  3S9N A;  1KUX A;  4CRY B;  2ZEL A;  4JXR A;  3SI1 A;  4ZGY B;  3DSB A;  1IB1 E;  2AFW A;  2RC4 A;  4AVC A;  4CYO A;  2ZEM A;  2YND A;  1XMB A;  3TTH A;  4NSQ A;  4F9U A;  1ZLH A;  4H89 A;  4A37 A;  5ISV A;  2PVV A;  4NGS A;  4P4B A;  1YX0 A;  4P4J A;  4OLL A;  4ZY2 A;  2ZW7 A;  2G9D A;  2PJ7 A;  2JDD A;  1N71 A;  4LX9 A;  4AVA A;  5JGF A;  2O28 A;  4PSX A;  2B3U A;  3GIU A;  3IWW A;  2PR1 A;  3WC5 A;  3B3W A;  3A9L A;  3D7H A;  1Q7L A;  3CPA A;  2GLJ A;  1BPN A;  2HQY A;  3D66 A;  4CAF A;  2XEI A;  4OC5 A;  4B5O A;  3L2N A;  4C7I A;  1XRY A;  3I1U A;  2IMO A;  3BLN A;  1L0C A;  3PRT A;  4MCS A;  4B11 A;  3NE8 A;  4PK2 A;  5A28 A;  1LRZ A;  3FYN A;  2QYV A;  3IGR A;  2FXF A;  1VIX A;  4E8O A;  4XPD C;  5EC4 A;  3RNZ A;  2Y0M A;  3PFE A;  3TOA A;  3TC8 A;  4MHP A;  5G20 A;  1K4J A;  3FEE A;  3S6H A;  5EMI A;  3QAY A;  1LFW A;  4CYP A;  2ZW6 A;  1ZG9 A;  2NYQ A;  2FCK A;  1MJB A;  3D7F A;  5F48 A;  4NGT A;  1XMT A;  4A32 A;  2J8N A;  2KCW A;  4BIN A;  1YK3 A;  1IIC A;  1KZF A;  1XOV A;  4UFV A;  4OC3 A;  5D29 A;  2FE7 A;  7CPA A;  2R1I A;  3WAB A;  1QSN A;  2AE6 A;  2X7B A;  2DXQ A;  2O53 A;  3MGD A;  4J3G A;  4R3L A;  4FD7 A;  1Q2Y A;  2ZEN A;  3PGP A;  4AG7 A;  1FT7 A;  4NGP A;  3PBB A;  4HKF A;  1MJ9 A;  4XNH B;  1IYL A;  1DTD A;  1QST A;  1LOK A;  3N5F A;  1BLL E;  1UFH A;  2FS5 A;  3W6S A;  5C82 A;  2B5G A;  4HNX B;  3P2H A;  5HXD A;  4MFQ A;  1F2P A;  4IF5 A;  4MFJ A;  1CG2 A;  1GYT A;  3WT4 A;  2FL4 A;  2CTB A;  4C2Y A;  4P4I A;  2DPS A;  5JQ4 A;  1ELL P;  2FIW A;  3LWU A;  4HNW B;  5DWN A;  3H8F A;  3TCV A;  3D4U A;  4M85 A;  4MCQ A;  3VWE A;  1Z9U A;  4CGP A;  2JDC A;  3DGV A;  4GM5 A;  1ELM P;  3V8I A;  2EBJ A;  4XPL A;  5HVH A;  1TKF A;  1Y9W A;  4B5P A;  4BMH A;  4EME A;  2IQ6 A;  3PB9 X;  5HH1 A;  3GLJ A;  2B5G B;  2GLF A;  2CF4 A;  2VL1 A;  3SJG A;  4C2X A;  5K8M A;  3GKR A;  2OB0 A;  2OZG A;  2J8R A;  1ARL A;  1VKC A;  2C6P A;  2HUZ A;  4PPZ A;  3PEI A;  3NH8 A;  2I3C A;  1M44 A;  1R43 A;  4OC4 A;  4CYQ A;  5ELY A;  1BOB A;  2Q0Y A;  4JWP A;  2PQ8 A;  3C26 A;  1IOI A;  4RN7 A;  2ZEE A;  5J1Q A;  2JEW A;  4KS9 A;  4AG9 A;  5D8N A;  2P6E A;  4CPA A;  2YNC C;  3QNV A;  4UBR A;  4YU9 A;  4EWT A;  1WK4 A;  5H86 A;  1ARM A;  2P0W A;  4ZBG A;  3D67 A;  1BPM A;  2PR8 A;  3BXM A;  4B5P B;  4DJL A;  1TKH A;  2R7H A;  4KOY A;  3ISZ A;  2EK9 A;  3IWG A;  5AGE A;  2F7V A;  2PJ8 A;  2GAN A;  1YW6 A;  4WJB A;  4MJ8 A;  3G8W A;  5IB9 A;  2ZW4 A;  2DPT A;  3CPX A;  2ZW5 A;  4KOX A;  2XEF A;  4L89 A;  2PJ9 A;  5KTD A;  2I00 A;  1LAM A;  2F8H A;  4R87 A;  5IB0 A;  2AFU A;  1TF8 A;  2G3A A;  4UCM A;  4A2Z A;  4YFJ A;  3S9M A;  2ABZ A;  2GIV A;  3IEH A;  2POK A;  4U5Y A;  4XPK A;  2OOT A;  2I79 A;  4B10 A;  2YGW A;  4A33 A;  4RUH A;  2WPX A;  4MXU A;  4IUS A;  4YRH A;  3F5B A;  3ISX A;  2EK8 A;  3H4Q A;  1CBX A;  2OH1 A;  5K8P A;  4KOR A;  2FIA A;  1VHO A;  5AG4 A;  4KUA A;  1ZG7 A;  1ZG8 A;  4NJQ A;  2Z3L A;  4P4F A;  2JBK A;  1JQG A;  8CPA A;  4OC0 A;  2V8G A;  3IIB A;  4FD4 A;  4LQG A;  4CAV A;  3NH5 A;  4X8I A;  4OIW A;  2QJ8 A;  1Z8L A;  5AG5 A;  2G0B A;  3VWD A;  4A39 A;  4R57 A;  5F46 A;  4FAI A;  1GHE A;  2PDO A;  1MK4 A;  1I1D A;  1YVK A;  5CBM A;  3CXP A;  2PJ2 A;  1Z4E A;  4OC1 A;  1DE4 C;  1KUY A;  4PXB A;  4E0A A;  3TFY A;  1PUA A;  2PVW A;  4BD9 A;  4FWU A;  3BHX A;  4R76 A;  1YLO A;  5E96 A;  3ZJ0 A;  4OAE A;  1IID A;  4MRI A;  4JYW A;  4R3K A;  3W6X A;  4NXY A;  4HPS A;  1EE3 P;  1QSO A;  1TF9 A;  2OZU A;  3IU1 A;  4W9Y A;  4P44 A;  4UIA A;  1X10 A;  1NSL A;  4O23 A;  4LUA A;  4AVB A;  2ZXV A;  3RZA A;  5EBV A;  4PK3 A;  4H2K A;  2D4O A;  4KUB A;  1F57 A;  1Z8X A;  3NE7 A;  4KSF A;  3SJX A;  5H84 A;  4KLV A;  3WR7 A;  4FD6 A;  5AG6 A;  4XPD B;  2G3T A;  3D3S A;  5J8F A;  3KL9 A;  3N7Z A;  3R96 A;  3LAC A;  5G21 A;  4AXV A;  4UEF A;  4OC2 A;  1J4J A;  1H8L A;  3GB0 A;  2JLM A;  1YVO A;  4Z65 A;  4IHM A;  3B8G A;  3B3C A;  2QVP A;  1MJA A;  5LRG A;  2A4N A;  4P6Y A;  2RFH A;  3RYO A;  3SXN A;  3FJU A;  1Z2L A;  2VXK A;  4YWY A;  1AUG A;  3S9L A;  3KI9 A;  1S7F A;  2BSW A;  2Q04 A;  3NA6 A;  4OP4 A;  2B3V A;  4E2A A;  2PJ6 A;  4U9Y A;  4PXD A;  3F0A A;  3SJE A;  4CGN A;  1M4D A;  4UFX A;  3H5Z A;  2Q43 A;  3QB8 A;  2PJB A;  3R9E A;  4KOT A;  4QVT A;  3TT2 A;  4B6Z A;  4DNC A;  2B58 A;  4FUU A;  2CNS A;  4CAX A;  1VGY A;  2B4B A;  4CS0 B;  1XF8 A;  3DLJ A;  3R1K A;  4YGO A;  4XNH C;  4GXH A;  5IX3 A;  2EO8 A;  1Y7E A;  2V8D A;  2PJ5 A;  4I49 A;  1TKJ A;  5LYD A;  4A94 A;  3VAR A;  1RO5 A;  4HNY B;  2Q44 A;  4NJR A;  5DS0 A;  2EWB A;  1A2Z A;  2Q7B A;  4C2Z A;  1IU8 A;  4NGM A;  3FH4 A;  1UWY A;  4M6I A;  4RI1 A;  2VBQ A;  3FXT A;  4MHZ A;  1M4G A;  2QIR A;  2YNC A;  4C7H A;  5G1Z A;  5HVF A;  4B14 A;  4EVY A;  2HC9 A;  1VHE A;  5GCN A;  5C88 A;  4X2T A;  5LYF A;  2AFS A;  1FNO A;  2PSW A;  4UA3 A;  3TOB A;  4MFK A;  1S7N A;  3RAM A;  4AB7 A;  1XBU A;  3H8E A;  1YW4 A;  3BI1 A;  2EVN A;  2JBJ A;  4NEX A;  2Z3N A;  4OKO A;  3GY9 A;  2ZPA A;  3B3T A;  1YLE A;  2Z3P A;  2VQY A;  2Z3O A;  3FMC A;  4MCP A;  1OZP A;  3R95 A;  3TO6 A;  1TIQ A;  3FIX A;  1IY7 A;  4ZI6 A;  5I0C A;  2D4P A;  1V0C A;  1S60 A;  1HEE A;  1P4N A;  4PV6 A;  3WC6 A;  2Q4Z A;  5JPH A;  2PJ1 A;  3KHX A;  4MY3 A;  3TX8 A;  1S7L A;  4C68 A;  2O4H A;  2GU2 A;  4P4D A;  3PZJ A;  2ANP A;  2V77 A;  3FB3 A;  1Z4R A;  2F5I A;  2Z0Z A;  1I12 A;  2PIZ A;  1XFO A;  2CNT A;  4KOV A;  3VAT A;  4F8Z A;  5IV0 A;  4G1P A;  4NCZ A;  4QC6 A;  5DWM A;  1AMP A;  2XEG A;  3LMS A;  1YSJ A;  1IYK A;  3S6G A;  4M6G A;  2BEI A;  4ORF A;  3RBU A;  4IAV A;  2FSR A;  3DNS A;  1ZO0 A;  3B7I A;  3D2M A;  2PJ0 A;  4UFW A;  1R57 A;  1RTQ A;  2ZOF A;  4PSW A;  2VZZ A;  3CXQ A;  3DR8 A;  4UEZ A;  4Y49 C;  1OBR A;  5K8O A;  2Z10 A;  5BWA B;  4ZX8 A;  4QBJ A;  2IL4 A;  2VZY A;  1ZLI A;  3GUX A;  4Q36 A;  2C1C A;  3KZW A;  3KQX A;  4UIB A;  2REF A;  3JUW A;  1Y0R A;  2ZEP A;  3BJ8 A;  4H6Z A;  4M3S A;  4MMO A;  4NFR A;  4PXC A;  4QB9 A;  4KVX A;  5J8C A;  1Z5R A;  2PRB A;  4TNU A;  5G22 A;  3VH9 A;  3NFZ A;  1Z8W A;  4L8A A;  3V38 A;  1QQ9 A;  4MI4 A;  4CAE A;  2YNE A;  2NMT A;  1NMT A;  1R3N A;  2AFX A;  3KR5 A;  3E0K A;  4KOS A;  4UF4 A;  5KTA A;  4LQ6 A;  5F09 A;  1HDU A;  1U6M A;  2FT0 A;  3IWE A;  4JLY A;  1Y9K A;  3FEC A;  4KOW A;  2P6F A;  2VEZ A;  4MFZ A;  3D68 A;  5JM6 A;  1CX8 A;  1BAV A;  1Y7R A;  4KVM E;  1S5K A;  1CPX A;  2Q7S A;  5LYI A;  1X12 A;  2AJ6 A;  1ON0 A;  4KVO E;  1BO4 A;  4CRZ B;  2ZEH A;  2WSA A;  2PC1 A;  4F0Y A;  3SI0 A;  4UCP A;  4X5K A;  4B12 A;  3IU2 A;  2PJ3 A;  3S6K A;  5K8N A;  3P2F A;  1HDQ A;  1YR0 A;  3EC4 A;  2CIJ A;  2R8V A;  3QAH A;  3I3G A;  1QSR A;  4R7M A;  4ZY0 A;  5HVG A;  1Q2C A;  2OZH A;  3KAS A;  2B4D A;  3D7G A;  3K9U A;  4MFP A;  4UCN A;  5CNP A;  3H8G A;  1F2O A;  3CXS A; 
#chains in the Genus database with same CATH homology
 3OWC A;  2Q4Y A;  3UY5 A;  2J8M A;  2WUU A;  3D2P A;  4F6A A;  2WPW A;  2Z11 A;  2OU2 A;  3EFA A;  4KSA A;  3BJ7 A;  3EO4 A;  3EXN A;  2CY2 A;  2B4D B;  4KLW A;  2JEV A;  3DDD A;  4MFL A;  2CXA A;  4II9 A;  3LOD A;  1Q2D A;  4JJX A;  2R98 A;  1XIX A;  1KUV A;  4RS2 A;  4U9Z A;  4R9M A;  4A95 A;  2GE3 A;  4F0X A;  1PU9 A;  3T9Y A;  1QSM A;  2QML A;  4UWI A;  2H5M A;  3ZZI A;  3F8K A;  5KTC A;  3GYA A;  1VHS A;  4CGL A;  4BBH A;  3D8P A;  4CAW A;  4MY0 A;  4ONU A;  5F49 A;  1YRE A;  1NE9 A;  1WWZ A;  3LD2 A;  4CYN A;  1FY7 A;  2Q4V A;  3I9S A;  3G3S A;  1M1D A;  3EY5 A;  4UWJ A;  4A30 A;  2C27 A;  3FBU A;  4MHD A;  3JTK A;  1XE4 A;  3PP9 A;  1B6B A;  4B13 A;  4CGM A;  4QUS A;  3FNC A;  4GS4 A;  3KKW A;  4A31 A;  4JD6 A;  2K5T A;  4KZT A;  3T90 A;  5AG7 A;  5HMN A;  4FD5 A;  4CGO A;  3TO9 A;  2EUI A;  1I21 A;  2VI7 A;  4Q38 A;  2BUE A;  2CNM A;  5F47 A;  2ARH A;  3TE4 A;  1SQH A;  1M4I A;  2Z3M A;  4H6U A;  2BL1 A;  2Z3K A;  4OAD A;  4Y49 B;  1P0H A;  1YGH A;  4KOU A;  3SXO A;  1XEB A;  1S7K A;  2QEC A;  2ATR A;  1CM0 A;  1B87 A;  3W91 A;  2HV2 A;  4JXQ A;  5FVJ A;  3FRM A;  3TO7 A;  2REE A;  3R9G A;  4MBU A;  3S6F A;  5A27 A;  5JQ4 A;  1RXT A;  3R9F A;  1CJW A;  4NF1 A;  4K30 A;  2P6G A;  1S3Z A;  3JVN A;  3DR6 A;  3SHP A;  1KUX A;  4CRY B;  4JXR A;  4ZGY B;  3DSB A;  1IB1 E;  2RC4 A;  4AVC A;  4CYO A;  2YND A;  3TTH A;  4NSQ A;  4H89 A;  5ISV A;  1YX0 A;  4OLL A;  2ZW7 A;  2JDD A;  1N71 A;  4LX9 A;  4AVA A;  2O28 A;  4PSX A;  2B3U A;  2PR1 A;  3A9L A;  2HQY A;  4CAF A;  4B5O A;  4C7I A;  3BLN A;  1L0C A;  4B11 A;  4PK2 A;  5A28 A;  1LRZ A;  3FYN A;  3IGR A;  2FXF A;  4E8O A;  4XPD C;  5EC4 A;  2Y0M A;  3TOA A;  5G20 A;  1K4J A;  3S6H A;  4CYP A;  2ZW6 A;  2FCK A;  1MJB A;  5F48 A;  1XMT A;  4A32 A;  2J8N A;  2KCW A;  1YK3 A;  1IIC A;  1KZF A;  4UFV A;  2FE7 A;  2R1I A;  1QSN A;  2AE6 A;  2X7B A;  2DXQ A;  3MGD A;  4J3G A;  4R3L A;  4FD7 A;  1Q2Y A;  3PGP A;  4AG7 A;  4HKF A;  1MJ9 A;  4XNH B;  1IYL A;  1QST A;  1UFH A;  3W6S A;  2FS5 A;  5C82 A;  2B5G A;  4HNX B;  3P2H A;  4MFQ A;  4MFJ A;  4IF5 A;  2FL4 A;  4C2Y A;  2DPS A;  2FIW A;  4HNW B;  5DWN A;  3TCV A;  4M85 A;  3VWE A;  1Z9U A;  4CGP A;  2JDC A;  3V8I A;  4XPL A;  1Y9W A;  4B5P A;  4BMH A;  5HH1 A;  2B5G B;  4C2X A;  3GKR A;  1VKC A;  2OZG A;  2J8R A;  2OB0 A;  2HUZ A;  1M44 A;  4CYQ A;  1BOB A;  2Q0Y A;  4JWP A;  2PQ8 A;  3C26 A;  4KS9 A;  4AG9 A;  2P6E A;  2YNC C;  4UBR A;  1WK4 A;  5H86 A;  2P0W A;  4ZBG A;  2PR8 A;  4B5P B;  2R7H A;  4KOY A;  3IWG A;  5AGE A;  2GAN A;  4MJ8 A;  3G8W A;  2ZW4 A;  2DPT A;  2ZW5 A;  4KOX A;  4L89 A;  5KTD A;  2I00 A;  4R87 A;  5IB0 A;  4UCM A;  2G3A A;  4A2Z A;  4YFJ A;  2GIV A;  4U5Y A;  4XPK A;  2I79 A;  4B10 A;  2YGW A;  4A33 A;  2WPX A;  4IUS A;  4YRH A;  3F5B A;  3H4Q A;  2OH1 A;  4KOR A;  2FIA A;  5AG4 A;  4KUA A;  2Z3L A;  4FD4 A;  4CAV A;  5AG5 A;  2G0B A;  3VWD A;  4R57 A;  5F46 A;  1GHE A;  2PDO A;  1MK4 A;  1I1D A;  1YVK A;  3CXP A;  1Z4E A;  1KUY A;  4E0A A;  3TFY A;  1PUA A;  5E96 A;  3ZJ0 A;  4OAE A;  1IID A;  4R3K A;  4NXY A;  1QSO A;  2OZU A;  3IU1 A;  1NSL A;  4LUA A;  4AVB A;  2ZXV A;  5EBV A;  4PK3 A;  2D4O A;  4KUB A;  3NE7 A;  4KSF A;  5H84 A;  4KLV A;  3WR7 A;  4FD6 A;  5AG6 A;  4XPD B;  2G3T A;  3D3S A;  5J8F A;  3N7Z A;  3R96 A;  5G21 A;  1J4J A;  2JLM A;  1YVO A;  3B8G A;  1MJA A;  2A4N A;  3RYO A;  3SXN A;  2VXK A;  1S7F A;  2Q04 A;  2BSW A;  4E2A A;  2B3V A;  4U9Y A;  3F0A A;  4CGN A;  1M4D A;  4UFX A;  3H5Z A;  3W6X A;  3QB8 A;  3R9E A;  3TT2 A;  4KOT A;  4QVT A;  4DNC A;  2B58 A;  2CNS A;  4CAX A;  2B4B A;  4CS0 B;  1XF8 A;  3R1K A;  4YGO A;  4XNH C;  5IX3 A;  4I49 A;  1RO5 A;  4HNY B;  2Q44 A;  2Q7B A;  4C2Z A;  4RI1 A;  2VBQ A;  3FXT A;  1M4G A;  2QIR A;  2YNC A;  4C7H A;  5G1Z A;  4B14 A;  4EVY A;  5GCN A;  5C88 A;  2PSW A;  4UA3 A;  3TOB A;  4MFK A;  1S7N A;  4AB7 A;  2EVN A;  4NEX A;  2Z3N A;  3GY9 A;  2ZPA A;  3TO6 A;  1YLE A;  2Z3P A;  2VQY A;  2Z3O A;  3R95 A;  1OZP A;  1TIQ A;  3FIX A;  5I0C A;  2D4P A;  1V0C A;  1S60 A;  1P4N A;  4PV6 A;  5JPH A;  4MY3 A;  4C68 A;  1S7L A;  3PZJ A;  3FB3 A;  1Z4R A;  2F5I A;  2Z0Z A;  1I12 A;  2CNT A;  4KOV A;  5IV0 A;  4NCZ A;  4QC6 A;  5DWM A;  1IYK A;  3S6G A;  4ORF A;  2BEI A;  2FSR A;  3DNS A;  1ZO0 A;  3D2M A;  4UFW A;  1R57 A;  4PSW A;  2VZZ A;  3CXQ A;  3DR8 A;  4Y49 C;  2Z10 A;  5BWA B;  4QBJ A;  2IL4 A;  2VZY A;  4Q36 A;  2REF A;  3JUW A;  4H6Z A;  4M3S A;  3BJ8 A;  4QB9 A;  5J8C A;  4KVX A;  2PRB A;  5G22 A;  4L8A A;  4CAE A;  4MI4 A;  2YNE A;  2NMT A;  1NMT A;  4KOS A;  3E0K A;  5KTA A;  1U6M A;  2FT0 A;  3IWE A;  4JLY A;  1Y9K A;  4KOW A;  2P6F A;  2VEZ A;  4MFZ A;  1Y7R A;  4KVM E;  1S5K A;  2AJ6 A;  1ON0 A;  4KVO E;  1BO4 A;  4CRZ B;  2WSA A;  2PC1 A;  4F0Y A;  4UCP A;  4X5K A;  4B12 A;  3IU2 A;  3S6K A;  3P2F A;  1YR0 A;  3EC4 A;  2R8V A;  3QAH A;  3I3G A;  1QSR A;  1Q2C A;  2OZH A;  2B4D A;  3K9U A;  4MFP A;  4UCN A;  5CNP A;  3CXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...