4MHDA

Crystal structure of spermidine n-acetyltransferase from vibrio cholerae in complex with spermidine
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
170
structure length
170
Chain Sequence
NSQLTLRALERGDLRFIHNLNNNRNIMSYWFEEPYESFDELEELYNKHIHDNAERRFVVEDAQKNLIGLVELIEINYIHRSAEFQIIIAPEHQGKGFARTLINRALDYSFTILNLHKIYLHVAVENPKAVHLYEECGFVEEGHLVEEFFINGRYQDVKRMYILQSKYLNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Novel Polyamine Allosteric Site of SpeG from Vibrio cholerae Is Revealed by Its Dodecameric Structure.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Transferase
molecule keywords Spermidine n1-acetyltransferase
total genus 51
structure length 170
sequence length 170
chains with identical sequence B, C
ec nomenclature ec 2.3.1.57: Diamine N-acetyltransferase.
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4mhdA00
2I00A 1BOBA 2GANA 2FCKA 1IIDA 1KUXA 1SQHA 3EXNA 1P0HA 2FXFA 4KLVA 2O28A 2BSWA 2P6FA 2J8RA 4KOUA 3V8IA 1N71A 4IF5A 1YVOA 4KOXA 1YREA 4QVTA 4NSQA 4R57A 4JWPA 1YK3A 3EY5A 2JLMA 3BJ8A 2ARHA 4ZBGA 2A4NA 4H89A 5CNPA 1MJAA 3TE4A 5J8CA 2B5GA 3TOBA 4JJXA 4FD7A 1NSLA 4U9YA 1I21A 2JDCA 4MY0A 4AVBA 5ISVA 1I1DA 4KVME 3R9FA 3IWGA 4JLYA 1TIQA 2EVNA 3FIXA 3G3SA 3C26A 1IB1E 4LX9A 4FD5A 4R3LA 5FVJA 2WPXA 4KVXA 2IL4A 1Y7RA 3I3GA 1UFHA 3JVNA 4MI4A 4X5KA 1L0CA 1Y9WA 2REEA 2PC1A 2CNSA 2G0BA 4L89A 2KCWA 2ZXVA 5HH1A 3D2PA 1IYKA 1Z4EA 2QECA 1B6BA 4I49A 1K4JA 2FIWA 2P6EA 2B5GB 3SHPA 5IX3A 2Q0YA 4OADA 4OLLA 1Q2CA 1U6MA 3TO6A 2ZW6A 5IB0A 3S6FA 4JXQA 4QC6A 4KOWA 2ZW4A 3TO7A 4FD4A 3DNSA 3UY5A 2VZYA 3R9GA 2B4BA 2Q4YA 3D2MA 4KLWA 3H4QA 5C88A 4OAEA 1YGHA 3R96A 2AE6A 3W6XA 2ZW7A 5DWMA 4II9A 2HQYA 2BEIA 5DWNA 2BUEA 1XE4A 4NEXA 4UBRA 4CAWA 2RC4A 3EC4A 1LRZA 2R1IA 2JDDA 1ON0A 2DXQA 2FE7A 4HNWB 4PK3A 2B3UA 4BMHA 1IICA 2OZHA 3P2FA 4PSWA 2G3TA 2C27A 3FXTA 4QUSA 1CJWA 3PZJA 4JXRA 2GE3A 3EO4A 3EFAA 4K30A 3CXQA 2OH1A 4U9ZA 2HUZA 4KORA 2OB0A 1B87A 3F0AA 2Y0MA 2Z0ZA 4AG9A 1S3ZA 4PK2A 4XPDB 2D4OA 5EBVA 4CRZB 3IGRA 2ZPAA 3FYNA 2GIVA 3TCVA 4B5PB 4E2AA 1RO5A 3FB3A 3S6GA 3DDDA 4UWJA 4CAVA 5E96A 4H6ZA 5GCNA 2FL4A 2Q04A 1MK4A 2PRBA 2G3AA 2NMTA 2PR1A 3SXNA 5F48A 1M1DA 5JQ4A 4KUBA 1Y9KA 3CXPA 3VWEA 4B5OA 5H84A 1KZFA 2JEVA 4M85A 1KUVA 4QBJA 1YX0A 2FIAA 3TFYA 4HKFA 2Q7BA 3DSBA 3WR7A 1BO4A 5C82A 1XIXA 1S5KA 4GS4A 2VI7A 3GY9A 2B58A 4LUAA 4H6UA 3RYOA 4KOVA 3BJ7A 4KZTA 3G8WA 1WWZA 4ORFA 5F49A 4U5YA 2K5TA 1MJ9A 2PDOA 2Z10A 4R3KA 2REFA 4MBUA 2VXKA 4XNHC 2I79A 4R9MA 1VHSA 3KKWA 1YVKA 4HNXB 4AB7A 2EUIA 2H5MA 2FT0A 2B4DB 2D4PA 2Z11A 2J8MA 1QSMA 2BL1A 3BLNA 4YGOA 1Z9UA 3MGDA 3T90A 3NE7A 2VZZA 1P4NA 1J4JA 1RXTA 3S6KA 1M44A 2VQYA 2P0WA 3B8GA 1QSRA 4L8AA 4FD6A 4R87A 1R57A 4RS2A 2VEZA 3TTHA 3GKRA 5F47A 1S60A 1OZPA 4J3GA 4EVYA 2R7HA 2QIRA 1QSNA 2FSRA 5J8FA 3SXOA 5HMNA 1I12A 1M4IA 4E8OA 1Q2YA 2PQ8A 3R95A 2OZUA 2J8NA 3D3SA 4NF1A 2AJ6A 2QMLA 2FS5A 4AG7A 1CM0A 4YFJA 3QAHA 1Z4RA 2B4DA 4KOYA 1S7FA 5H86A 4M3SA 3W91A 1V0CA 1PU9A 3R9EA 4CRYB 4YRHA 1GHEA 3LODA 1NMTA 3TOAA 1NE9A 1FY7A 3FRMA 5JPHA 1M4GA 3K9UA 2PSWA 3E0KA 4Y49B 2WPWA 3JUWA 4XNHB 2VBQA 3I9SA 3VWDA 2R98A 2OZGA 4KOTA 4RI1A 4AVCA 2ZW5A 1WK4A 3GYAA 1PUAA 2R8VA 2HV2A 4B5PA 4F6AA 3TO9A 4XPDC 3TT2A 1XEBA 1YR0A 3ZZIA 2B3VA 5F46A 2X7BA 3CXSA 4PSXA 3PP9A 2CY2A 1XMTA 3T9YA 4NXYA 4MJ8A 3S6HA 1Q2DA 3FNCA 4ONUA 4XPLA 4XPKA 2CNMA 1MJBA 2P6GA 1IYLA 3N7ZA 2OU2A 3DR6A 3F5BA 3FBUA 4AVAA 1KUYA 4CAXA 1S7KA 1XF8A 4HNYB 4KVOE 4UA3A 5IV0A 1QSTA 4MHDA 2Q4VA 1M4DA 3R1KA 5KTDA 5I0CA 2F5IA 4UWIA 4QB9A 5EC4A 3QB8A 4IUSA 4JD6A 3ZJ0A 2Q44A 3DR8A 4NCZA 4DNCA 2ATRA 3PGPA 4KOSA 4CS0B 5KTCA 2CNTA 4PV6A 5KTAA 1S7LA 3P2HA 1QSOA 1VKCA 3OWCA 4E0AA 1YLEA 1S7NA 2PR8A 3F8KA 4F0YA 3LD2A 3W6SA 4Y49C 3D8PA 4KUAA 4MY3A
chains in the Genus database with same CATH superfamily
2I00A 2NSMA 3DGVA 4Q38A 1BOBA 2RFHA 3LMSA 4KUAA 2GANA 5ELYA 4IK2A 2FCKA 1CP6A 1IIDA 1ZLHA 2V8HA 1KUXA 5LRJA 4CGNA 1SQHA 4O23A 4UCNA 3GB0A 4C2YA 3B3CA 4PXDA 3EXNA 1P0HA 2FXFA 4KLVA 2O28A 2BSWA 4KS9A 1HDQA 4ZX9A 4MHYA 3S9NA 2GLJA 2P6FA 2J8RA 4KOUA 2Z3NA 3V8IA 4NGQA 1N71A 4IF5A 4OC4A 4MFZA 1YVOA 4KOXA 3RBUA 4C7IA 1YREA 3CZXA 3B35A 4QVTA 4NSQA 3PBBA 3CPAA 4R57A 4JWPA 1YK3A 1FT7A 3EY5A 2PJBA 2JLMA 2AFWA 3NH8A 3BJ8A 2ARHA 4ZBGA 3NE8A 2A4NA 2AFOA 4H89A 5CNPA 1MJAA 1ZO0A 2PJ1A 3SJFA 4CAEA 4Q7AA 2QYVA 2POKA 3IO1A 1Q7LA 3TE4A 5J8CA 2B5GA 3TOBA 2PVWA 3KL9A 2O53A 4JJXA 3ISZA 4FD7A 2BCOA 1NSLA 3JRUA 1QMUA 4A32A 4U9YA 1LAPA 1I21A 2JDCA 3H5ZA 4MY0A 4C2XA 4AVBA 5ISVA 1I1DA 3PB6X 4KVME 3FJUA 3R9FA 3IWGA 4JLYA 4B12A 5I4MA 1TIQA 2EVNA 1Y0RA 3FIXA 3G3SA 4GXHA 4HPSA 4KSFA 3D4UA 2PJ2A 1H8LA 3C26A 3JTKA 2IJZA 4M6IA 1IB1E 4DUKA 4LX9A 4FD5A 4R3LA 4MCQA 4NGMA 5FVJA 1TF9A 2WPXA 2Z3MA 4KVXA 2G9DA 4UCMA 1VHEA 2IL4A 4GM5A 1Y7RA 2OOTA 3I3GA 1UFHA 3JVNA 1BAVA 5IB9A 3D68A 4MI4A 4P4JA 1L0CA 4NGNA 1Y9WA 4X5KA 5LYDA 2REEA 2YNEA 2WUUA 2PC1A 7CPAA 2C6GA 2CNSA 2DPSA 2G0BA 1A2ZA 4L89A 1IOFA 2KCWA 2ZXVA 3TC8A 2GU2A 3FMCA 3SI0A 3MN8A 3LWUA 5HH1A 3D2PA 1IYKA 4A37A 2WZNA 1Z4EA 1ZG8A 2QECA 3KR4A 1B6BA 2NYQA 1X12A 1VHOA 1K4JA 4I49A 2FIWA 2YNCA 5EMIA 3VARA 5A27A 4OMEA 1Z5RA 2P6EA 1M4LA 2F7VA 2Z3PA 2HC9A 3VH9A 2Z3LA 3CDXA 2B5GB 4W9YA 3SHPA 3B7IA 4FUUA 4B13A 5IX3A 2Q0YA 4OADA 2C6CA 3PB4X 2Z3OA 4UFVA 4OLLA 1Q2CA 4UEEA 5LRGA 1U6MA 4MCSA 3TO6A 2ZW6A 1X10A 5IB0A 4A31A 1IGBA 4UF4A 4X3RA 3S6FA 4JXQA 4OIDA 4QC6A 4KOWA 2ZW4A 4NGPA 3LACA 3TO7A 4FD4A 3DNSA 2QJ8A 4MCRA 3SI1A 3D7HA 2CXAA 4CAWA 4Z65A 4H2KA 3UY5A 2VZYA 3R9GA 2B4BA 5K8PA 2Q7SA 4P4IA 2Q4YA 4JYWA 3D2MA 2DF5A 4KLWA 1BPMA 3KHZA 4M6HA 3RZAA 4CGPA 3H4QA 5C88A 1XJOA 4OAEA 1CPXA 1YGHA 3RO0A 5K8NA 2V8DA 1YSJA 1DTDA 3R96A 2AE6A 4OP4A 4B14A 3B3WA 3PB9X 3W6XA 2ZW7A 4LQGA 5DWMA 4II9A 2HQYA 4BINA 2Q51A 3B2YA 1LCPA 1JQGA 2BEIA 5DWNA 5LYIA 2BUEA 1XE4A 1Y7EA 1Z8LA 3KQZA 4NEXA 4OIWA 2RC4A 2WYRA 3FX6A 4UBRA 4DJLA 1AYEA 4YU9A 3EC4A 4NGTA 3CPXA 1LRZA 2R1IA 1QQ9A 2JDDA 1ON0A 2DXQA 1ZG9A 5CPAA 3PRTA 2FE7A 4HNWB 2Q4ZA 4PK3A 3IIBA 1XOVA 2B3UA 4CYPA 4BMHA 1IICA 2OZHA 5LYLA 1YLOA 3P2FA 4PSWA 1Z8XA 2G3TA 2C27A 3FXTA 4QUSA 3NA6A 5AGEA 2PRQA 4ZYQA 1CJWA 3SJXA 2AFZA 3PZJA 4JXRA 5A28A 4OC5A 4KSIA 2PJ6A 4MRIA 2GE3A 3EO4A 4OKOA 2XEIA 4YWYA 3EFAA 4K30A 3SJEA 3B3TA 3CXQA 5G21A 2OH1A 4U9ZA 4UIAA 2V8VA 4OC1A 3IU1A 4A39A 2HUZA 4KORA 2OB0A 1TXRA 4X2TA 4PXCA 1B87A 1Z2LA 3F0AA 4OC3A 2Y0MA 2Z0ZA 4AG9A 4FWUA 1S3ZA 1HEEA 5G22A 4EWTA 5JH9A 5BWAB 4NGRA 4PK2A 4B10A 3S9LA 4XPDB 1LAMA 2D4OA 4K3NA 4P10A 5EBVA 4MFKA 3PEIA 3IGRA 2YNCC 2ZPAA 3FYNA 4CRZB 2GIVA 2ZEDA 3TCVA 4CGLA 2EO8A 4B5PB 4MCPA 4E2AA 3FH4A 4CGMA 1RO5A 4P4FA 3KASA 2PCUA 3FB3A 4UEFA 5D29A 4ZY2A 3S6GA 4ZGYB 3DDDA 4UWJA 1PCAA 4CAVA 5E96A 3B3VA 4X8IA 1OBRA 4PXBA 2CTBA 4H6ZA 3VATA 1ELLP 2ZELA 5GCNA 2FL4A 5AG4A 2Q04A 2JEWA 1MK4A 2PRBA 3IU2A 2G3AA 1XBUA 2NMTA 2PR1A 2Q43A 3H8GA 3PFOA 5F48A 3SXNA 4ZI6A 5CBMA 3S9MA 1M1DA 3SJGA 5JQ4A 4KUBA 1CP7A 1Y9KA 3CXPA 3MRUA 3PBEA 3I1UA 3KQXA 1UWYA 4JZ0A 3VWEA 4B5OA 5H84A 1KZFA 2JEVA 1VGYA 1KUVA 4M85A 4QBJA 1YX0A 1YMEA 2EBJA 2FIAA 4HKFA 4EFDA 1Y0YA 2Q7BA 4C2ZA 3D7FA 3TFYA 3DSBA 4F9UA 4MXUA 3WR7A 1BPNA 1BO4A 4CYOA 1RTQA 5C82A 1XIXA 2PJCA 1S5KA 3IC1A 2DPTA 5LRKA 4ZX8A 2ZEPA 4GS4A 5THWA 2AFSA 2VI7A 3GY9A 4TWEA 2B58A 4LUAA 4H6UA 3RYOA 4KOVA 5DS0A 3BJ7A 4KZTA 3V7ZA 3G8WA 1WWZA 3BHXA 4ORFA 4AXVA 3L2NA 2EK8A 5F49A 4F8ZA 1YW6A 4U5YA 2K5TA 1DE4C 4A30A 4B6ZA 5K8OA 1MJ9A 4MMOA 1TF8A 2XEJA 2PDOA 2Z10A 4R3KA 2REFA 4MBUA 1XFOA 2VXKA 3GUXA 2I79A 4XNHC 4R9MA 1CPSA 1VHSA 3KKWA 4A95A 1YVKA 3SI2A 4P44A 4HNXB 4IAVA 3N5FA 4AB7A 2PJ4A 2EUIA 6CPAA 2H5MA 2GFQA 2FT0A 5HVHA 2VL1A 2B4DB 1YW4A 4WJBA 3WABA 2D4PA 2Z11A 2J8MA 1CG2A 4IHMA 1QSMA 2BL1A 4CYQA 3BLNA 3T8WA 4YGOA 1JWQA 1Z9UA 3IWWA 2GLFA 2Z3KA 3PFEA 3MGDA 4R7MA 3NE7A 2VZZA 1J4JA 1P4NA 3IWEA 3T90A 1PYTB 1RXTA 1F57A 3S6KA 4A2ZA 1M44A 3D7DA 1BLLE 2VQYA 2YGWA 2ZEHA 3PB8X 4CPAA 5J1QA 1FNOA 4NFRA 2P0WA 4PPZA 1IOIA 3B8GA 3FVLA 1QSRA 4L8AA 4FD6A 5G20A 1R43A 1TKJA 3H8EA 1CX8A 4R87A 4B11A 4CAFA 1R57A 4MFJA 4PXEA 4RS2A 2VEZA 4A33A 3TTHA 3GKRA 5F47A 4C7HA 1F2PA 1S60A 1OZPA 4J3GA 4EVYA 3GLJA 2R7HA 2AFUA 1Z8WA 8CPAA 2I3CA 2QIRA 4NGSA 5D8NA 1AMPA 5HVFA 1QSNA 2FSRA 4P4EA 4TNUA 3SXOA 5J8FA 5HMNA 1ELMP 1I12A 1M4IA 4E8OA 2JBJA 2PQ8A 3R95A 1IY7A 4NJQA 5JM6A 2IMOA 4MHNA 2ANPA 2AFXA 2PJ7A 2OZUA 2EWBA 2J8NA 3D3SA 4DYOA 1EE3P 4NF1A 3FEDA 4A94A 2AJ6A 2QMLA 4OC2A 2CTCA 3WC7A 2FS5A 3BI0A 3FECA 3CT9A 4AG7A 2YNDA 1CM0A 4YFJA 5AG6A 4MFQA 3WC6A 4NJRA 2ZEOA 3QAHA 1Z4RA 4P4BA 2PIZA 2B4DA 4F9VA 4KOYA 1S7FA 3QAYA 4R6TA 5H86A 2F8HA 3TX8A 3WC5A 4M3SA 4FAIA 4RN7A 3W91A 1V0CA 1PU9A 3R9EA 4CRYB 4YRHA 2V8GA 3KZWA 4EMEA 4CYNA 2O4HA 2PJ0A 1GHEA 3LODA 1NMTA 4Q36A 3TOAA 4ONWA 1NE9A 1FY7A 3FRMA 5JPHA 4BD9A 1M4GA 2AFMA 3K9UA 4MFPA 2PIYA 2PSWA 3E0KA 4Y49B 5K8MA 3FEEA 4CGOA 2DEAA 2WPWA 1XRYA 3JUWA 4XNHB 2PE3A 2ODFA 1R3NA 2VBQA 3I9SA 4WWVA 2R98A 3VWDA 2ZEFA 2OZGA 4KOTA 4RI1A 4ZY0A 4AVCA 2ZW5A 2PJ5A 1WK4A 3GYAA 4C68A 3QNVA 1PUAA 1GYTA 2FVGA 4UIBA 2R8VA 2HV2A 4B5PA 4MHPA 3BI1A 1YQEA 4F6AA 3TO9A 4XPDC 3TT2A 1XEBA 1YR0A 3KGQA 3ZZIA 2B3VA 4P4DA 2PJ9A 5F46A 3RNZA 2X7BA 1XMBA 2JBKA 3CXSA 4G1PA 4PSXA 3PP9A 2CY2A 4UFXA 5F09A 2ABZA 1XMTA 2IQ6A 1IU8A 1ZG7A 3T9YA 1CBXA 1LOKA 4NXYA 3BXMA 3HLPA 4MJ8A 2BOAA 3D66A 4BBHA 3S6HA 1Q2DA 2ZEMA 1F2OA 4UEZA 3K9TA 3FNCA 2OR4A 2ZEGA 2PJ8A 3IJ3A 4KSAA 4ONUA 4XPLA 4XPKA 2C1CA 2CNMA 1Z8TA 1MJBA 2PVVA 2P6GA 1IYLA 1TKHA 3N7ZA 2OU2A 2HB6A 4MHZA 1ARLA 3D7GA 3DR6A 2EK9A 3NH5A 3F5BA 2PJAA 3FBUA 3NFZA 4P6YA 4AVAA 1KUYA 4CAXA 1NSAA 5G1ZA 1S7KA 2GREA 1TKFA 1XF8A 3KHXA 4HNYB 4KVOE 4A38A 1HDUA 2RB7A 4UA3A 5HXDA 2ZEEA 2V77A 5IV0A 3NH4A 1QSTA 4MHDA 2Q4VA 1M4DA 3DLJA 3R1KA 5KTDA 2CIJA 3ISXA 4P45A 1LFWA 5I0CA 2F5IA 4UWIA 4QB9A 5EC4A 3QB8A 3WT4A 2ZENA 4IUSA 4UCPA 3FF3A 2QVPA 2WSAA 3IEHA 4JD6A 3ZJ0A 4M6GA 4FBEA 1VIXA 2Q44A 2XEGA 4F0XA 3DR8A 4NCZA 4DNCA 2ATRA 3D67A 3PGPA 4KOSA 4CS0B 2CNTA 5KTCA 4R76A 4PV6A 5KTAA 2ZOGA 5LYFA 1S7LA 2C6PA 4MFLA 3P2HA 4R8FA 1QSOA 3H8FA 1VKCA 3K2KA 3PB7X 3V38A 3OWCA 4ZY1A 2CF4A 5HVGA 2BO9A 5AG7A 4UFWA 1KWMA 4E0AA 2ZOFA 1ZLIA 2J9AA 3IFEA 3B3SA 1YLEA 3KR5A 4OC0A 3GIUA 4PQAA 3RAMA 1S7NA 2PR8A 3F8KA 5JGFA 3HUVA 2XEFA 4RUHA 1AUGA 4LQ6A 1ARMA 3KI9A 4F0YA 3LD2A 3W6SA 4Y49C 2PJ3A 3A9LA 1LANA 1Q2YA 3D8PA 5AG5A 4MY3A
chains in the Genus database with same CATH topology
2I00A 4Q38A 1BOBA 2GANA 2FCKA 1IIDA 1KUXA 4CGNA 1SQHA 4UCNA 4C2YA 3EXNA 1P0HA 2FXFA 4KLVA 2O28A 2BSWA 4KS9A 2P6FA 2J8RA 4KOUA 2Z3NA 3V8IA 1N71A 4IF5A 4MFZA 1YVOA 4KOXA 4C7IA 1YREA 4QVTA 4NSQA 4R57A 4JWPA 1YK3A 3EY5A 2JLMA 3BJ8A 2ARHA 4ZBGA 2A4NA 4H89A 5CNPA 1MJAA 1ZO0A 4CAEA 3TE4A 5J8CA 2B5GA 3TOBA 4JJXA 4FD7A 1NSLA 4A32A 4U9YA 1I21A 2JDCA 3H5ZA 4MY0A 4C2XA 4AVBA 5ISVA 1I1DA 4KVME 3R9FA 3IWGA 4JLYA 4B12A 1TIQA 2EVNA 3FIXA 3G3SA 4KSFA 3C26A 3JTKA 1IB1E 4LX9A 4FD5A 4R3LA 5FVJA 2WPXA 2Z3MA 4KVXA 4UCMA 2IL4A 1Y7RA 3I3GA 1UFHA 3JVNA 4MI4A 4X5KA 1L0CA 1Y9WA 2REEA 2YNEA 2WUUA 2PC1A 2CNSA 2DPSA 2G0BA 4L89A 2KCWA 2ZXVA 5HH1A 3D2PA 1IYKA 1Z4EA 2QECA 1B6BA 4I49A 1K4JA 2FIWA 2YNCA 5A27A 2P6EA 2Z3PA 2Z3LA 2B5GB 3SHPA 4B13A 5IX3A 2Q0YA 4OADA 4UFVA 2Z3OA 4OLLA 1Q2CA 1U6MA 3TO6A 2ZW6A 5IB0A 4A31A 3S6FA 4JXQA 4QC6A 4KOWA 2ZW4A 3TO7A 4FD4A 3DNSA 2CXAA 3UY5A 2VZYA 3R9GA 2B4BA 2Q4YA 3D2MA 4KLWA 4CGPA 3H4QA 5C88A 4OAEA 1YGHA 3R96A 2AE6A 4B14A 3W6XA 2ZW7A 5DWMA 4II9A 2HQYA 2BEIA 5DWNA 2BUEA 1XE4A 4NEXA 4UBRA 4CAWA 2RC4A 3EC4A 1LRZA 2R1IA 2JDDA 1ON0A 2DXQA 2FE7A 4HNWB 4PK3A 2B3UA 4CYPA 4BMHA 1IICA 2OZHA 3P2FA 4PSWA 2G3TA 2C27A 3FXTA 4QUSA 5AGEA 1CJWA 5A28A 3PZJA 4JXRA 2GE3A 3EO4A 3EFAA 4K30A 5G21A 3CXQA 2OH1A 4U9ZA 3IU1A 2HUZA 4KORA 2OB0A 1B87A 3F0AA 2Y0MA 2Z0ZA 4AG9A 1S3ZA 5G22A 5BWAB 4PK2A 4B10A 4XPDB 2D4OA 5EBVA 4MFKA 4CRZB 3IGRA 2YNCC 2ZPAA 3FYNA 2GIVA 3TCVA 4CGLA 4B5PB 4E2AA 4CGMA 1RO5A 3FB3A 3S6GA 4ZGYB 3DDDA 4UWJA 4CAVA 5E96A 4H6ZA 5GCNA 2FL4A 5AG4A 2Q04A 1MK4A 2PRBA 3IU2A 2G3AA 2NMTA 2PR1A 3SXNA 5F48A 1M1DA 5JQ4A 4KUBA 1Y9KA 3CXPA 3VWEA 4B5OA 5H84A 1KZFA 2JEVA 4M85A 1KUVA 4QBJA 1YX0A 2FIAA 3TFYA 4HKFA 2Q7BA 4C2ZA 3DSBA 3WR7A 1BO4A 4CYOA 5C82A 1XIXA 1S5KA 2DPTA 4GS4A 2VI7A 3GY9A 2B58A 4LUAA 4H6UA 3RYOA 4KOVA 3BJ7A 4KZTA 3G8WA 1WWZA 4ORFA 5F49A 4U5YA 2K5TA 4A30A 1MJ9A 2PDOA 2Z10A 4R3KA 2REFA 4MBUA 2VXKA 4XNHC 2I79A 4R9MA 1VHSA 3KKWA 4A95A 1YVKA 4HNXB 4AB7A 2EUIA 2H5MA 2FT0A 2B4DB 2D4PA 2Z11A 2J8MA 1QSMA 2BL1A 4CYQA 3BLNA 4YGOA 1Z9UA 2Z3KA 3MGDA 3T90A 3NE7A 3IWEA 1P4NA 1J4JA 2VZZA 1RXTA 3S6KA 4A2ZA 1M44A 2VQYA 2YGWA 2P0WA 3B8GA 1QSRA 4L8AA 4FD6A 5G20A 4R87A 4B11A 4CAFA 1R57A 4MFJA 4RS2A 4A33A 2VEZA 3TTHA 3GKRA 5F47A 4C7HA 1S60A 1OZPA 4J3GA 4EVYA 2R7HA 2QIRA 1QSNA 2FSRA 5J8FA 3SXOA 5HMNA 1I12A 1M4IA 4E8OA 1Q2YA 2PQ8A 3R95A 2OZUA 2J8NA 3D3SA 4NF1A 2AJ6A 2QMLA 2FS5A 4AG7A 2YNDA 1CM0A 4YFJA 5AG6A 4MFQA 3QAHA 1Z4RA 2B4DA 4KOYA 1S7FA 5H86A 4M3SA 3W91A 1V0CA 1PU9A 3R9EA 4CRYB 4YRHA 4CYNA 1GHEA 3LODA 1NMTA 4Q36A 3TOAA 1NE9A 1FY7A 3FRMA 5JPHA 1M4GA 3K9UA 4MFPA 2PSWA 3E0KA 4Y49B 4CGOA 2WPWA 3JUWA 4XNHB 2VBQA 3I9SA 3VWDA 2R98A 2OZGA 4KOTA 4RI1A 4AVCA 2ZW5A 1WK4A 3GYAA 4C68A 1PUAA 2R8VA 2HV2A 4B5PA 4F6AA 3TO9A 4XPDC 3TT2A 1XEBA 1YR0A 3ZZIA 2B3VA 5F46A 2X7BA 3CXSA 4PSXA 3PP9A 2CY2A 4UFXA 1XMTA 3T9YA 4NXYA 4MJ8A 4BBHA 3S6HA 1Q2DA 3FNCA 4KSAA 4ONUA 4XPLA 4XPKA 2CNMA 1MJBA 2P6GA 1IYLA 3N7ZA 2OU2A 3DR6A 3F5BA 3FBUA 4AVAA 1KUYA 4CAXA 5G1ZA 1S7KA 1XF8A 4HNYB 4KVOE 4UA3A 5IV0A 1QSTA 4MHDA 2Q4VA 1M4DA 3R1KA 5KTDA 5I0CA 2F5IA 4UWIA 4QB9A 5EC4A 3QB8A 4IUSA 4UCPA 2WSAA 4JD6A 3ZJ0A 2Q44A 4F0XA 3DR8A 4NCZA 4DNCA 2ATRA 3PGPA 4KOSA 4CS0B 5KTCA 2CNTA 4PV6A 5KTAA 1S7LA 4MFLA 3P2HA 1QSOA 1VKCA 3OWCA 5AG7A 4UFWA 4E0AA 1YLEA 1S7NA 2PR8A 3F8KA 4F0YA 3LD2A 3W6SA 4Y49C 3A9LA 3D8PA 5AG5A 4KUAA 4MY3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I00 A;  1BOB A;  2GAN A;  2FCK A;  1IID A;  1KUX A;  1SQH A;  3EXN A;  1P0H A;  2FXF A;  4KLV A;  2O28 A;  2BSW A;  2P6F A;  2J8R A;  4KOU A;  3V8I A;  1N71 A;  4IF5 A;  1YVO A;  4KOX A;  1YRE A;  4QVT A;  4NSQ A;  4R57 A;  4JWP A;  1YK3 A;  3EY5 A;  2JLM A;  3BJ8 A;  2ARH A;  4ZBG A;  2A4N A;  4H89 A;  5CNP A;  1MJA A;  3TE4 A;  5J8C A;  2B5G A;  3TOB A;  4JJX A;  4FD7 A;  1NSL A;  4U9Y A;  1I21 A;  2JDC A;  4MY0 A;  4AVB A;  5ISV A;  1I1D A;  4KVM E;  3R9F A;  3IWG A;  4JLY A;  1TIQ A;  2EVN A;  3FIX A;  3G3S A;  3C26 A;  1IB1 E;  4LX9 A;  4FD5 A;  4R3L A;  5FVJ A;  2WPX A;  4KVX A;  2IL4 A;  1Y7R A;  3I3G A;  1UFH A;  3JVN A;  4MI4 A;  4X5K A;  1L0C A;  1Y9W A;  2REE A;  2PC1 A;  2CNS A;  2G0B A;  4L89 A;  2KCW A;  2ZXV A;  5HH1 A;  3D2P A;  1IYK A;  1Z4E A;  2QEC A;  1B6B A;  4I49 A;  1K4J A;  2FIW A;  2P6E A;  2B5G B;  3SHP A;  5IX3 A;  2Q0Y A;  4OAD A;  4OLL A;  1Q2C A;  1U6M A;  3TO6 A;  2ZW6 A;  5IB0 A;  3S6F A;  4JXQ A;  4QC6 A;  4KOW A;  2ZW4 A;  3TO7 A;  4FD4 A;  3DNS A;  3UY5 A;  2VZY A;  3R9G A;  2B4B A;  2Q4Y A;  3D2M A;  4KLW A;  3H4Q A;  5C88 A;  4OAE A;  1YGH A;  3R96 A;  2AE6 A;  3W6X A;  2ZW7 A;  5DWM A;  4II9 A;  2HQY A;  2BEI A;  5DWN A;  2BUE A;  1XE4 A;  4NEX A;  4UBR A;  4CAW A;  2RC4 A;  3EC4 A;  1LRZ A;  2R1I A;  2JDD A;  1ON0 A;  2DXQ A;  2FE7 A;  4HNW B;  4PK3 A;  2B3U A;  4BMH A;  1IIC A;  2OZH A;  3P2F A;  4PSW A;  2G3T A;  2C27 A;  3FXT A;  4QUS A;  1CJW A;  3PZJ A;  4JXR A;  2GE3 A;  3EO4 A;  3EFA A;  4K30 A;  3CXQ A;  2OH1 A;  4U9Z A;  2HUZ A;  4KOR A;  2OB0 A;  1B87 A;  3F0A A;  2Y0M A;  2Z0Z A;  4AG9 A;  1S3Z A;  4PK2 A;  4XPD B;  2D4O A;  5EBV A;  4CRZ B;  3IGR A;  2ZPA A;  3FYN A;  2GIV A;  3TCV A;  4B5P B;  4E2A A;  1RO5 A;  3FB3 A;  3S6G A;  3DDD A;  4UWJ A;  4CAV A;  5E96 A;  4H6Z A;  5GCN A;  2FL4 A;  2Q04 A;  1MK4 A;  2PRB A;  2G3A A;  2NMT A;  2PR1 A;  3SXN A;  5F48 A;  1M1D A;  5JQ4 A;  4KUB A;  1Y9K A;  3CXP A;  3VWE A;  4B5O A;  5H84 A;  1KZF A;  2JEV A;  4M85 A;  1KUV A;  4QBJ A;  1YX0 A;  2FIA A;  3TFY A;  4HKF A;  2Q7B A;  3DSB A;  3WR7 A;  1BO4 A;  5C82 A;  1XIX A;  1S5K A;  4GS4 A;  2VI7 A;  3GY9 A;  2B58 A;  4LUA A;  4H6U A;  3RYO A;  4KOV A;  3BJ7 A;  4KZT A;  3G8W A;  1WWZ A;  4ORF A;  5F49 A;  4U5Y A;  2K5T A;  1MJ9 A;  2PDO A;  2Z10 A;  4R3K A;  2REF A;  4MBU A;  2VXK A;  4XNH C;  2I79 A;  4R9M A;  1VHS A;  3KKW A;  1YVK A;  4HNX B;  4AB7 A;  2EUI A;  2H5M A;  2FT0 A;  2B4D B;  2D4P A;  2Z11 A;  2J8M A;  1QSM A;  2BL1 A;  3BLN A;  4YGO A;  1Z9U A;  3MGD A;  3T90 A;  3NE7 A;  2VZZ A;  1P4N A;  1J4J A;  1RXT A;  3S6K A;  1M44 A;  2VQY A;  2P0W A;  3B8G A;  1QSR A;  4L8A A;  4FD6 A;  4R87 A;  1R57 A;  4RS2 A;  2VEZ A;  3TTH A;  3GKR A;  5F47 A;  1S60 A;  1OZP A;  4J3G A;  4EVY A;  2R7H A;  2QIR A;  1QSN A;  2FSR A;  5J8F A;  3SXO A;  5HMN A;  1I12 A;  1M4I A;  4E8O A;  1Q2Y A;  2PQ8 A;  3R95 A;  2OZU A;  2J8N A;  3D3S A;  4NF1 A;  2AJ6 A;  2QML A;  2FS5 A;  4AG7 A;  1CM0 A;  4YFJ A;  3QAH A;  1Z4R A;  2B4D A;  4KOY A;  1S7F A;  5H86 A;  4M3S A;  3W91 A;  1V0C A;  1PU9 A;  3R9E A;  4CRY B;  4YRH A;  1GHE A;  3LOD A;  1NMT A;  3TOA A;  1NE9 A;  1FY7 A;  3FRM A;  5JPH A;  1M4G A;  3K9U A;  2PSW A;  3E0K A;  4Y49 B;  2WPW A;  3JUW A;  4XNH B;  2VBQ A;  3I9S A;  3VWD A;  2R98 A;  2OZG A;  4KOT A;  4RI1 A;  4AVC A;  2ZW5 A;  1WK4 A;  3GYA A;  1PUA A;  2R8V A;  2HV2 A;  4B5P A;  4F6A A;  3TO9 A;  4XPD C;  3TT2 A;  1XEB A;  1YR0 A;  3ZZI A;  2B3V A;  5F46 A;  2X7B A;  3CXS A;  4PSX A;  3PP9 A;  2CY2 A;  1XMT A;  3T9Y A;  4NXY A;  4MJ8 A;  3S6H A;  1Q2D A;  3FNC A;  4ONU A;  4XPL A;  4XPK A;  2CNM A;  1MJB A;  2P6G A;  1IYL A;  3N7Z A;  2OU2 A;  3DR6 A;  3F5B A;  3FBU A;  4AVA A;  1KUY A;  4CAX A;  1S7K A;  1XF8 A;  4HNY B;  4KVO E;  4UA3 A;  5IV0 A;  1QST A;  4MHD A;  2Q4V A;  1M4D A;  3R1K A;  5KTD A;  5I0C A;  2F5I A;  4UWI A;  4QB9 A;  5EC4 A;  3QB8 A;  4IUS A;  4JD6 A;  3ZJ0 A;  2Q44 A;  3DR8 A;  4NCZ A;  4DNC A;  2ATR A;  3PGP A;  4KOS A;  4CS0 B;  5KTC A;  2CNT A;  4PV6 A;  5KTA A;  1S7L A;  3P2H A;  1QSO A;  1VKC A;  3OWC A;  4E0A A;  1YLE A;  1S7N A;  2PR8 A;  3F8K A;  4F0Y A;  3LD2 A;  3W6S A;  4Y49 C;  3D8P A;  4KUA A;  4MY3 A; 
#chains in the Genus database with same CATH topology
 2I00 A;  2NSM A;  3DGV A;  4Q38 A;  1BOB A;  2RFH A;  3LMS A;  4KUA A;  2GAN A;  5ELY A;  4IK2 A;  2FCK A;  1CP6 A;  1IID A;  1ZLH A;  2V8H A;  1KUX A;  5LRJ A;  4CGN A;  1SQH A;  4O23 A;  4UCN A;  3GB0 A;  4C2Y A;  3B3C A;  4PXD A;  3EXN A;  1P0H A;  2FXF A;  4KLV A;  2O28 A;  2BSW A;  4KS9 A;  1HDQ A;  4ZX9 A;  4MHY A;  3S9N A;  2GLJ A;  2P6F A;  2J8R A;  4KOU A;  2Z3N A;  3V8I A;  4NGQ A;  1N71 A;  4IF5 A;  4OC4 A;  4MFZ A;  1YVO A;  4KOX A;  3RBU A;  4C7I A;  1YRE A;  3CZX A;  3B35 A;  4QVT A;  4NSQ A;  3PBB A;  3CPA A;  4R57 A;  4JWP A;  1YK3 A;  1FT7 A;  3EY5 A;  2PJB A;  2JLM A;  2AFW A;  3NH8 A;  3BJ8 A;  2ARH A;  4ZBG A;  3NE8 A;  2A4N A;  2AFO A;  4H89 A;  5CNP A;  1MJA A;  1ZO0 A;  2PJ1 A;  3SJF A;  4CAE A;  4Q7A A;  2QYV A;  2POK A;  3IO1 A;  1Q7L A;  3TE4 A;  5J8C A;  2B5G A;  3TOB A;  2PVW A;  3KL9 A;  2O53 A;  4JJX A;  3ISZ A;  4FD7 A;  2BCO A;  1NSL A;  3JRU A;  1QMU A;  4A32 A;  4U9Y A;  1LAP A;  1I21 A;  2JDC A;  3H5Z A;  4MY0 A;  4C2X A;  4AVB A;  5ISV A;  1I1D A;  3PB6 X;  4KVM E;  3FJU A;  3R9F A;  3IWG A;  4JLY A;  4B12 A;  5I4M A;  1TIQ A;  2EVN A;  1Y0R A;  3FIX A;  3G3S A;  4GXH A;  4HPS A;  4KSF A;  3D4U A;  2PJ2 A;  1H8L A;  3C26 A;  3JTK A;  2IJZ A;  4M6I A;  1IB1 E;  4DUK A;  4LX9 A;  4FD5 A;  4R3L A;  4MCQ A;  4NGM A;  5FVJ A;  1TF9 A;  2WPX A;  2Z3M A;  4KVX A;  2G9D A;  4UCM A;  1VHE A;  2IL4 A;  4GM5 A;  1Y7R A;  2OOT A;  3I3G A;  1UFH A;  3JVN A;  1BAV A;  5IB9 A;  3D68 A;  4MI4 A;  4P4J A;  1L0C A;  4NGN A;  1Y9W A;  4X5K A;  5LYD A;  2REE A;  2YNE A;  2WUU A;  2PC1 A;  7CPA A;  2C6G A;  2CNS A;  2DPS A;  2G0B A;  1A2Z A;  4L89 A;  1IOF A;  2KCW A;  2ZXV A;  3TC8 A;  2GU2 A;  3FMC A;  3SI0 A;  3MN8 A;  3LWU A;  5HH1 A;  3D2P A;  1IYK A;  4A37 A;  2WZN A;  1Z4E A;  1ZG8 A;  2QEC A;  3KR4 A;  1B6B A;  2NYQ A;  1X12 A;  1VHO A;  1K4J A;  4I49 A;  2FIW A;  2YNC A;  5EMI A;  3VAR A;  5A27 A;  4OME A;  1Z5R A;  2P6E A;  1M4L A;  2F7V A;  2Z3P A;  2HC9 A;  3VH9 A;  2Z3L A;  3CDX A;  2B5G B;  4W9Y A;  3SHP A;  3B7I A;  4FUU A;  4B13 A;  5IX3 A;  2Q0Y A;  4OAD A;  2C6C A;  3PB4 X;  2Z3O A;  4UFV A;  4OLL A;  1Q2C A;  4UEE A;  5LRG A;  1U6M A;  4MCS A;  3TO6 A;  2ZW6 A;  1X10 A;  5IB0 A;  4A31 A;  1IGB A;  4UF4 A;  4X3R A;  3S6F A;  4JXQ A;  4OID A;  4QC6 A;  4KOW A;  2ZW4 A;  4NGP A;  3LAC A;  3TO7 A;  4FD4 A;  3DNS A;  2QJ8 A;  4MCR A;  3SI1 A;  3D7H A;  2CXA A;  4CAW A;  4Z65 A;  4H2K A;  3UY5 A;  2VZY A;  3R9G A;  2B4B A;  5K8P A;  2Q7S A;  4P4I A;  2Q4Y A;  4JYW A;  3D2M A;  2DF5 A;  4KLW A;  1BPM A;  3KHZ A;  4M6H A;  3RZA A;  4CGP A;  3H4Q A;  5C88 A;  1XJO A;  4OAE A;  1CPX A;  1YGH A;  3RO0 A;  5K8N A;  2V8D A;  1YSJ A;  1DTD A;  3R96 A;  2AE6 A;  4OP4 A;  4B14 A;  3B3W A;  3PB9 X;  3W6X A;  2ZW7 A;  4LQG A;  5DWM A;  4II9 A;  2HQY A;  4BIN A;  2Q51 A;  3B2Y A;  1LCP A;  1JQG A;  2BEI A;  5DWN A;  5LYI A;  2BUE A;  1XE4 A;  1Y7E A;  1Z8L A;  3KQZ A;  4NEX A;  4OIW A;  2RC4 A;  2WYR A;  3FX6 A;  4UBR A;  4DJL A;  1AYE A;  4YU9 A;  3EC4 A;  4NGT A;  3CPX A;  1LRZ A;  2R1I A;  1QQ9 A;  2JDD A;  1ON0 A;  2DXQ A;  1ZG9 A;  5CPA A;  3PRT A;  2FE7 A;  4HNW B;  2Q4Z A;  4PK3 A;  3IIB A;  1XOV A;  2B3U A;  4CYP A;  4BMH A;  1IIC A;  2OZH A;  5LYL A;  1YLO A;  3P2F A;  4PSW A;  1Z8X A;  2G3T A;  2C27 A;  3FXT A;  4QUS A;  3NA6 A;  5AGE A;  2PRQ A;  4ZYQ A;  1CJW A;  3SJX A;  2AFZ A;  3PZJ A;  4JXR A;  5A28 A;  4OC5 A;  4KSI A;  2PJ6 A;  4MRI A;  2GE3 A;  3EO4 A;  4OKO A;  2XEI A;  4YWY A;  3EFA A;  4K30 A;  3SJE A;  3B3T A;  3CXQ A;  5G21 A;  2OH1 A;  4U9Z A;  4UIA A;  2V8V A;  4OC1 A;  3IU1 A;  4A39 A;  2HUZ A;  4KOR A;  2OB0 A;  1TXR A;  4X2T A;  4PXC A;  1B87 A;  1Z2L A;  3F0A A;  4OC3 A;  2Y0M A;  2Z0Z A;  4AG9 A;  4FWU A;  1S3Z A;  1HEE A;  5G22 A;  4EWT A;  5JH9 A;  5BWA B;  4NGR A;  4PK2 A;  4B10 A;  3S9L A;  4XPD B;  1LAM A;  2D4O A;  4K3N A;  4P10 A;  5EBV A;  4MFK A;  3PEI A;  3IGR A;  2YNC C;  2ZPA A;  3FYN A;  4CRZ B;  2GIV A;  2ZED A;  3TCV A;  4CGL A;  2EO8 A;  4B5P B;  4MCP A;  4E2A A;  3FH4 A;  4CGM A;  1RO5 A;  4P4F A;  3KAS A;  2PCU A;  3FB3 A;  4UEF A;  5D29 A;  4ZY2 A;  3S6G A;  4ZGY B;  3DDD A;  4UWJ A;  1PCA A;  4CAV A;  5E96 A;  3B3V A;  4X8I A;  1OBR A;  4PXB A;  2CTB A;  4H6Z A;  3VAT A;  1ELL P;  2ZEL A;  5GCN A;  2FL4 A;  5AG4 A;  2Q04 A;  2JEW A;  1MK4 A;  2PRB A;  3IU2 A;  2G3A A;  1XBU A;  2NMT A;  2PR1 A;  2Q43 A;  3H8G A;  3PFO A;  5F48 A;  3SXN A;  4ZI6 A;  5CBM A;  3S9M A;  1M1D A;  3SJG A;  5JQ4 A;  4KUB A;  1CP7 A;  1Y9K A;  3CXP A;  3MRU A;  3PBE A;  3I1U A;  3KQX A;  1UWY A;  4JZ0 A;  3VWE A;  4B5O A;  5H84 A;  1KZF A;  2JEV A;  1VGY A;  1KUV A;  4M85 A;  4QBJ A;  1YX0 A;  1YME A;  2EBJ A;  2FIA A;  4HKF A;  4EFD A;  1Y0Y A;  2Q7B A;  4C2Z A;  3D7F A;  3TFY A;  3DSB A;  4F9U A;  4MXU A;  3WR7 A;  1BPN A;  1BO4 A;  4CYO A;  1RTQ A;  5C82 A;  1XIX A;  2PJC A;  1S5K A;  3IC1 A;  2DPT A;  5LRK A;  4ZX8 A;  2ZEP A;  4GS4 A;  5THW A;  2AFS A;  2VI7 A;  3GY9 A;  4TWE A;  2B58 A;  4LUA A;  4H6U A;  3RYO A;  4KOV A;  5DS0 A;  3BJ7 A;  4KZT A;  3V7Z A;  3G8W A;  1WWZ A;  3BHX A;  4ORF A;  4AXV A;  3L2N A;  2EK8 A;  5F49 A;  4F8Z A;  1YW6 A;  4U5Y A;  2K5T A;  1DE4 C;  4A30 A;  4B6Z A;  5K8O A;  1MJ9 A;  4MMO A;  1TF8 A;  2XEJ A;  2PDO A;  2Z10 A;  4R3K A;  2REF A;  4MBU A;  1XFO A;  2VXK A;  3GUX A;  2I79 A;  4XNH C;  4R9M A;  1CPS A;  1VHS A;  3KKW A;  4A95 A;  1YVK A;  3SI2 A;  4P44 A;  4HNX B;  4IAV A;  3N5F A;  4AB7 A;  2PJ4 A;  2EUI A;  6CPA A;  2H5M A;  2GFQ A;  2FT0 A;  5HVH A;  2VL1 A;  2B4D B;  1YW4 A;  4WJB A;  3WAB A;  2D4P A;  2Z11 A;  2J8M A;  1CG2 A;  4IHM A;  1QSM A;  2BL1 A;  4CYQ A;  3BLN A;  3T8W A;  4YGO A;  1JWQ A;  1Z9U A;  3IWW A;  2GLF A;  2Z3K A;  3PFE A;  3MGD A;  4R7M A;  3NE7 A;  2VZZ A;  1J4J A;  1P4N A;  3IWE A;  3T90 A;  1PYT B;  1RXT A;  1F57 A;  3S6K A;  4A2Z A;  1M44 A;  3D7D A;  1BLL E;  2VQY A;  2YGW A;  2ZEH A;  3PB8 X;  4CPA A;  5J1Q A;  1FNO A;  4NFR A;  2P0W A;  4PPZ A;  1IOI A;  3B8G A;  3FVL A;  1QSR A;  4L8A A;  4FD6 A;  5G20 A;  1R43 A;  1TKJ A;  3H8E A;  1CX8 A;  4R87 A;  4B11 A;  4CAF A;  1R57 A;  4MFJ A;  4PXE A;  4RS2 A;  2VEZ A;  4A33 A;  3TTH A;  3GKR A;  5F47 A;  4C7H A;  1F2P A;  1S60 A;  1OZP A;  4J3G A;  4EVY A;  3GLJ A;  2R7H A;  2AFU A;  1Z8W A;  8CPA A;  2I3C A;  2QIR A;  4NGS A;  5D8N A;  1AMP A;  5HVF A;  1QSN A;  2FSR A;  4P4E A;  4TNU A;  3SXO A;  5J8F A;  5HMN A;  1ELM P;  1I12 A;  1M4I A;  4E8O A;  2JBJ A;  2PQ8 A;  3R95 A;  1IY7 A;  4NJQ A;  5JM6 A;  2IMO A;  4MHN A;  2ANP A;  2AFX A;  2PJ7 A;  2OZU A;  2EWB A;  2J8N A;  3D3S A;  4DYO A;  1EE3 P;  4NF1 A;  3FED A;  4A94 A;  2AJ6 A;  2QML A;  4OC2 A;  2CTC A;  3WC7 A;  2FS5 A;  3BI0 A;  3FEC A;  3CT9 A;  4AG7 A;  2YND A;  1CM0 A;  4YFJ A;  5AG6 A;  4MFQ A;  3WC6 A;  4NJR A;  2ZEO A;  3QAH A;  1Z4R A;  4P4B A;  2PIZ A;  2B4D A;  4F9V A;  4KOY A;  1S7F A;  3QAY A;  4R6T A;  5H86 A;  2F8H A;  3TX8 A;  3WC5 A;  4M3S A;  4FAI A;  4RN7 A;  3W91 A;  1V0C A;  1PU9 A;  3R9E A;  4CRY B;  4YRH A;  2V8G A;  3KZW A;  4EME A;  4CYN A;  2O4H A;  2PJ0 A;  1GHE A;  3LOD A;  1NMT A;  4Q36 A;  3TOA A;  4ONW A;  1NE9 A;  1FY7 A;  3FRM A;  5JPH A;  4BD9 A;  1M4G A;  2AFM A;  3K9U A;  4MFP A;  2PIY A;  2PSW A;  3E0K A;  4Y49 B;  5K8M A;  3FEE A;  4CGO A;  2DEA A;  2WPW A;  1XRY A;  3JUW A;  4XNH B;  2PE3 A;  2ODF A;  1R3N A;  2VBQ A;  3I9S A;  4WWV A;  2R98 A;  3VWD A;  2ZEF A;  2OZG A;  4KOT A;  4RI1 A;  4ZY0 A;  4AVC A;  2ZW5 A;  2PJ5 A;  1WK4 A;  3GYA A;  4C68 A;  3QNV A;  1PUA A;  1GYT A;  2FVG A;  4UIB A;  2R8V A;  2HV2 A;  4B5P A;  4MHP A;  3BI1 A;  1YQE A;  4F6A A;  3TO9 A;  4XPD C;  3TT2 A;  1XEB A;  1YR0 A;  3KGQ A;  3ZZI A;  2B3V A;  4P4D A;  2PJ9 A;  5F46 A;  3RNZ A;  2X7B A;  1XMB A;  2JBK A;  3CXS A;  4G1P A;  4PSX A;  3PP9 A;  2CY2 A;  4UFX A;  5F09 A;  2ABZ A;  1XMT A;  2IQ6 A;  1IU8 A;  1ZG7 A;  3T9Y A;  1CBX A;  1LOK A;  4NXY A;  3BXM A;  3HLP A;  4MJ8 A;  2BOA A;  3D66 A;  4BBH A;  3S6H A;  1Q2D A;  2ZEM A;  1F2O A;  4UEZ A;  3K9T A;  3FNC A;  2OR4 A;  2ZEG A;  2PJ8 A;  3IJ3 A;  4KSA A;  4ONU A;  4XPL A;  4XPK A;  2C1C A;  2CNM A;  1Z8T A;  1MJB A;  2PVV A;  2P6G A;  1IYL A;  1TKH A;  3N7Z A;  2OU2 A;  2HB6 A;  4MHZ A;  1ARL A;  3D7G A;  3DR6 A;  2EK9 A;  3NH5 A;  3F5B A;  2PJA A;  3FBU A;  3NFZ A;  4P6Y A;  4AVA A;  1KUY A;  4CAX A;  1NSA A;  5G1Z A;  1S7K A;  2GRE A;  1TKF A;  1XF8 A;  3KHX A;  4HNY B;  4KVO E;  4A38 A;  1HDU A;  2RB7 A;  4UA3 A;  5HXD A;  2ZEE A;  2V77 A;  5IV0 A;  3NH4 A;  1QST A;  4MHD A;  2Q4V A;  1M4D A;  3DLJ A;  3R1K A;  5KTD A;  2CIJ A;  3ISX A;  4P45 A;  1LFW A;  5I0C A;  2F5I A;  4UWI A;  4QB9 A;  5EC4 A;  3QB8 A;  3WT4 A;  2ZEN A;  4IUS A;  4UCP A;  3FF3 A;  2QVP A;  2WSA A;  3IEH A;  4JD6 A;  3ZJ0 A;  4M6G A;  4FBE A;  1VIX A;  2Q44 A;  2XEG A;  4F0X A;  3DR8 A;  4NCZ A;  4DNC A;  2ATR A;  3D67 A;  3PGP A;  4KOS A;  4CS0 B;  2CNT A;  5KTC A;  4R76 A;  4PV6 A;  5KTA A;  2ZOG A;  5LYF A;  1S7L A;  2C6P A;  4MFL A;  3P2H A;  4R8F A;  1QSO A;  3H8F A;  1VKC A;  3K2K A;  3PB7 X;  3V38 A;  3OWC A;  4ZY1 A;  2CF4 A;  5HVG A;  2BO9 A;  5AG7 A;  4UFW A;  1KWM A;  4E0A A;  2ZOF A;  1ZLI A;  2J9A A;  3IFE A;  3B3S A;  1YLE A;  3KR5 A;  4OC0 A;  3GIU A;  4PQA A;  3RAM A;  1S7N A;  2PR8 A;  3F8K A;  5JGF A;  3HUV A;  2XEF A;  4RUH A;  1AUG A;  4LQ6 A;  1ARM A;  3KI9 A;  4F0Y A;  3LD2 A;  3W6S A;  4Y49 C;  2PJ3 A;  3A9L A;  1LAN A;  1Q2Y A;  3D8P A;  5AG5 A;  4MY3 A; 
#chains in the Genus database with same CATH homology
 2I00 A;  4Q38 A;  1BOB A;  2GAN A;  2FCK A;  1IID A;  1KUX A;  4CGN A;  1SQH A;  4UCN A;  4C2Y A;  3EXN A;  1P0H A;  2FXF A;  4KLV A;  2O28 A;  2BSW A;  4KS9 A;  2P6F A;  2J8R A;  4KOU A;  2Z3N A;  3V8I A;  1N71 A;  4IF5 A;  4MFZ A;  1YVO A;  4KOX A;  4C7I A;  1YRE A;  4QVT A;  4NSQ A;  4R57 A;  4JWP A;  1YK3 A;  3EY5 A;  2JLM A;  3BJ8 A;  2ARH A;  4ZBG A;  2A4N A;  4H89 A;  5CNP A;  1MJA A;  1ZO0 A;  4CAE A;  3TE4 A;  5J8C A;  2B5G A;  3TOB A;  4JJX A;  4FD7 A;  1NSL A;  4A32 A;  4U9Y A;  1I21 A;  2JDC A;  3H5Z A;  4MY0 A;  4C2X A;  4AVB A;  5ISV A;  1I1D A;  4KVM E;  3R9F A;  3IWG A;  4JLY A;  4B12 A;  1TIQ A;  2EVN A;  3FIX A;  3G3S A;  4KSF A;  3C26 A;  3JTK A;  1IB1 E;  4LX9 A;  4FD5 A;  4R3L A;  5FVJ A;  2WPX A;  2Z3M A;  4KVX A;  4UCM A;  2IL4 A;  1Y7R A;  3I3G A;  1UFH A;  3JVN A;  4MI4 A;  4X5K A;  1L0C A;  1Y9W A;  2REE A;  2YNE A;  2WUU A;  2PC1 A;  2CNS A;  2DPS A;  2G0B A;  4L89 A;  2KCW A;  2ZXV A;  5HH1 A;  3D2P A;  1IYK A;  1Z4E A;  2QEC A;  1B6B A;  4I49 A;  1K4J A;  2FIW A;  2YNC A;  5A27 A;  2P6E A;  2Z3P A;  2Z3L A;  2B5G B;  3SHP A;  4B13 A;  5IX3 A;  2Q0Y A;  4OAD A;  4UFV A;  2Z3O A;  4OLL A;  1Q2C A;  1U6M A;  3TO6 A;  2ZW6 A;  5IB0 A;  4A31 A;  3S6F A;  4JXQ A;  4QC6 A;  4KOW A;  2ZW4 A;  3TO7 A;  4FD4 A;  3DNS A;  2CXA A;  3UY5 A;  2VZY A;  3R9G A;  2B4B A;  2Q4Y A;  3D2M A;  4KLW A;  4CGP A;  3H4Q A;  5C88 A;  4OAE A;  1YGH A;  3R96 A;  2AE6 A;  4B14 A;  3W6X A;  2ZW7 A;  5DWM A;  4II9 A;  2HQY A;  2BEI A;  5DWN A;  2BUE A;  1XE4 A;  4NEX A;  4UBR A;  4CAW A;  2RC4 A;  3EC4 A;  1LRZ A;  2R1I A;  2JDD A;  1ON0 A;  2DXQ A;  2FE7 A;  4HNW B;  4PK3 A;  2B3U A;  4CYP A;  4BMH A;  1IIC A;  2OZH A;  3P2F A;  4PSW A;  2G3T A;  2C27 A;  3FXT A;  4QUS A;  5AGE A;  1CJW A;  5A28 A;  3PZJ A;  4JXR A;  2GE3 A;  3EO4 A;  3EFA A;  4K30 A;  5G21 A;  3CXQ A;  2OH1 A;  4U9Z A;  3IU1 A;  2HUZ A;  4KOR A;  2OB0 A;  1B87 A;  3F0A A;  2Y0M A;  2Z0Z A;  4AG9 A;  1S3Z A;  5G22 A;  5BWA B;  4PK2 A;  4B10 A;  4XPD B;  2D4O A;  5EBV A;  4MFK A;  4CRZ B;  3IGR A;  2YNC C;  2ZPA A;  3FYN A;  2GIV A;  3TCV A;  4CGL A;  4B5P B;  4E2A A;  4CGM A;  1RO5 A;  3FB3 A;  3S6G A;  4ZGY B;  3DDD A;  4UWJ A;  4CAV A;  5E96 A;  4H6Z A;  5GCN A;  2FL4 A;  5AG4 A;  2Q04 A;  1MK4 A;  2PRB A;  3IU2 A;  2G3A A;  2NMT A;  2PR1 A;  3SXN A;  5F48 A;  1M1D A;  5JQ4 A;  4KUB A;  1Y9K A;  3CXP A;  3VWE A;  4B5O A;  5H84 A;  1KZF A;  2JEV A;  4M85 A;  1KUV A;  4QBJ A;  1YX0 A;  2FIA A;  3TFY A;  4HKF A;  2Q7B A;  4C2Z A;  3DSB A;  3WR7 A;  1BO4 A;  4CYO A;  5C82 A;  1XIX A;  1S5K A;  2DPT A;  4GS4 A;  2VI7 A;  3GY9 A;  2B58 A;  4LUA A;  4H6U A;  3RYO A;  4KOV A;  3BJ7 A;  4KZT A;  3G8W A;  1WWZ A;  4ORF A;  5F49 A;  4U5Y A;  2K5T A;  4A30 A;  1MJ9 A;  2PDO A;  2Z10 A;  4R3K A;  2REF A;  4MBU A;  2VXK A;  4XNH C;  2I79 A;  4R9M A;  1VHS A;  3KKW A;  4A95 A;  1YVK A;  4HNX B;  4AB7 A;  2EUI A;  2H5M A;  2FT0 A;  2B4D B;  2D4P A;  2Z11 A;  2J8M A;  1QSM A;  2BL1 A;  4CYQ A;  3BLN A;  4YGO A;  1Z9U A;  2Z3K A;  3MGD A;  3T90 A;  3NE7 A;  3IWE A;  1P4N A;  1J4J A;  2VZZ A;  1RXT A;  3S6K A;  4A2Z A;  1M44 A;  2VQY A;  2YGW A;  2P0W A;  3B8G A;  1QSR A;  4L8A A;  4FD6 A;  5G20 A;  4R87 A;  4B11 A;  4CAF A;  1R57 A;  4MFJ A;  4RS2 A;  4A33 A;  2VEZ A;  3TTH A;  3GKR A;  5F47 A;  4C7H A;  1S60 A;  1OZP A;  4J3G A;  4EVY A;  2R7H A;  2QIR A;  1QSN A;  2FSR A;  5J8F A;  3SXO A;  5HMN A;  1I12 A;  1M4I A;  4E8O A;  1Q2Y A;  2PQ8 A;  3R95 A;  2OZU A;  2J8N A;  3D3S A;  4NF1 A;  2AJ6 A;  2QML A;  2FS5 A;  4AG7 A;  2YND A;  1CM0 A;  4YFJ A;  5AG6 A;  4MFQ A;  3QAH A;  1Z4R A;  2B4D A;  4KOY A;  1S7F A;  5H86 A;  4M3S A;  3W91 A;  1V0C A;  1PU9 A;  3R9E A;  4CRY B;  4YRH A;  4CYN A;  1GHE A;  3LOD A;  1NMT A;  4Q36 A;  3TOA A;  1NE9 A;  1FY7 A;  3FRM A;  5JPH A;  1M4G A;  3K9U A;  4MFP A;  2PSW A;  3E0K A;  4Y49 B;  4CGO A;  2WPW A;  3JUW A;  4XNH B;  2VBQ A;  3I9S A;  3VWD A;  2R98 A;  2OZG A;  4KOT A;  4RI1 A;  4AVC A;  2ZW5 A;  1WK4 A;  3GYA A;  4C68 A;  1PUA A;  2R8V A;  2HV2 A;  4B5P A;  4F6A A;  3TO9 A;  4XPD C;  3TT2 A;  1XEB A;  1YR0 A;  3ZZI A;  2B3V A;  5F46 A;  2X7B A;  3CXS A;  4PSX A;  3PP9 A;  2CY2 A;  4UFX A;  1XMT A;  3T9Y A;  4NXY A;  4MJ8 A;  4BBH A;  3S6H A;  1Q2D A;  3FNC A;  4KSA A;  4ONU A;  4XPL A;  4XPK A;  2CNM A;  1MJB A;  2P6G A;  1IYL A;  3N7Z A;  2OU2 A;  3DR6 A;  3F5B A;  3FBU A;  4AVA A;  1KUY A;  4CAX A;  5G1Z A;  1S7K A;  1XF8 A;  4HNY B;  4KVO E;  4UA3 A;  5IV0 A;  1QST A;  4MHD A;  2Q4V A;  1M4D A;  3R1K A;  5KTD A;  5I0C A;  2F5I A;  4UWI A;  4QB9 A;  5EC4 A;  3QB8 A;  4IUS A;  4UCP A;  2WSA A;  4JD6 A;  3ZJ0 A;  2Q44 A;  4F0X A;  3DR8 A;  4NCZ A;  4DNC A;  2ATR A;  3PGP A;  4KOS A;  4CS0 B;  5KTC A;  2CNT A;  4PV6 A;  5KTA A;  1S7L A;  4MFL A;  3P2H A;  1QSO A;  1VKC A;  3OWC A;  5AG7 A;  4UFW A;  4E0A A;  1YLE A;  1S7N A;  2PR8 A;  3F8K A;  4F0Y A;  3LD2 A;  3W6S A;  4Y49 C;  3A9L A;  3D8P A;  5AG5 A;  4KUA A;  4MY3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...