4MHGA

Crystal structure of etv6 bound to a specific dna sequence
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
90
Chain Sequence
b'RLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Specific 14 bp DNA
publication title Steric Mechanism of Auto-Inhibitory Regulation of Specific and Non-Specific DNA Binding by the ETS Transcriptional Repressor ETV6.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 29
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4mhgA01
3B73A 3KZYA 1V3FA 3RDIA 3LSTA 2LKPA 3LQQA 4UUVA 3FMSA 2DTRA 1SMTA 1GVJA 5DCFA 4HX8A 3COAC 1FP1D 4ZZLA 3HSFA 2WV0A 5DUIA 5E1ZB 3GFLA 3P9KA 3C7JA 3VFZA 4CXFA 2A07F 1QO0D 1WWXA 1FNNA 1O3QA 2FU4A 3WTVC 2DU9A 5BPIA 4JQFA 1XDSA 1JE8A 5CLSA 1XGMA 1FYKA 3GO5A 2MH2A 2P6TA 4ON0A 2IJLA 1B1BA 5D8LB 1H0MA 3FWEA 4LLNA 2HZTA 1Z9CA 2ZFWA 2YU3A 3MWMA 5KVRA 4RB3C 1R5GA 4CHUA 1J75A 3R0JA 2M8EA 4OMYA 4TV7A 4WXDA 2P7CB 5HLIA 1DP7P 2WC2A 3IKTA 2BYVE 2XROA 1YLFA 2O8XA 1TLHB 5AONA 3RPQA 1RI7A 4IRIA 1S7AA 3BJ6A 3ML6A 5E8IA 2H6CA 2LF7A 2J5OA 4IJAA 2GAUA 2ZNZA 4ZYHA 3Q9SA 3WTUC 2W85A 2E7WA 2JTVA 2K27A 1ZG3A 5DYMA 1SMYF 3RKXA 2HGCA 5F6FA 2Z33A 1E17A 2KJCA 3V4GA 4OIRF 4A0XA 4E70A 3H3ZA 1IZ1A 4I02A 1FSHA 5D5WB 1FBSA 4JBAA 3N97A 2F5FA 2F2EA 2XAHA 1KQ8A 2Q2EA 3TOAA 1O57A 1SFUA 1ZARA 3DKWA 2OA4A 3GZ6A 2VOOA 1TQIA 3F23A 1IN5A 3I59A 2L3DA 2K7LA 4Z2YA 4OIOF 3E6DA 3LA2A 4KUMA 5AIQA 1OKRA 1SFEA 2YSRA 5J8FA 2FSWA 5ED4A 1ZGJA 3P9CA 1MJBA 2DI3A 4MEYF 3OOPA 5CVUA 2V1DA 4BQAA 3KCCA 1Z91A 1YFHA 3P9IA 5EEGA 3PQKA 2EB7A 2ELHA 4UVAA 2ESHA 4HOBA 1ZGAA 1JHFA 2Z99A 4MQ9F 1S7OA 3ZN1A 2J5PA 2V1UA 3MZYA 4HAMA 1G3YA 2M87A 5ILVA 2KKOA 1FC3A 1YG2A 2FBIA 1SD4A 4F7ZA 3S2WA 3I59B 5DUKA 4EVIA 2V79A 4A0YA 1HBXG 4LB5A 2JRTA 4CGZA 2R3SA 1HQCA 2P5KA 3LA3A 4A6DA 2DQLA 2FXAA 3L00A 5LHHA 5A2QZ 1ZAOA 1HXDA 3HIFA 1GXPA 4ENJA 2YX7A 1T38A 1I5ZA 4EGYA 1RUNA 3ULQB 3K2ZA 3KP7A 4M9ZA 1XSVA 3ZMZA 5LGNA 4FX4A 2M45A 2DLLA 2EA4A 1YTYA 3ZP5A 2MBFA 1YIOA 4A2UA 2ISYA 4EJWA 4P55A 2LDUA 4ETSA 5HDGA 2FMYA 2P4WA 4P96A 1R58A 3QPTA 3KLNA 2QUFA 4L18B 3GLXA 1BOAA 1O7FA 2HKOA 3I58A 2P8TA 2X4HA 3I53A 1LEBA 1P2FA 2QENA 1TBXA 1KGSA 3ZMUA 2K86A 3E5XA 4MQVA 1PP7U 4HQMA 1XSXA 1R1TA 1XCBA 3NRVA 1YO5C 3B02A 2L4AA 2IA1A 4MTEA 4MNUA 2OU2A 1LNWA 1B4AA 1MDMA 1XMAA 2ZKZA 5LRSA 4G7OF 3KZZA 4Q48A 3F8MA 4KN4X 1FZPB 4BHBA 2VC1A 4KIGA 3WTXC 3BWGA 3NEUA 3EDPA 2NRAC 2UZKA 2TDXA 2DO7A 3RKWA 3EYIA 1HKTA 3ECHA 2ZCWA 4I98B 2A6HF 1KA8A 4IXAA 3IRRA 4I01A 1HKSA 4KN7X 4CICA 1FT9A 3FMQA 2QVOA 2VE9A 5E20A 2VBWA 2QM3A 1G6NA 4ASNA 1FOKA 2FMLA 2NAZA 2HOEA 3BJOA 2QBYA 2BEOA 2ZBKA 2VBXA 3CO6C 1T6SA 5FD5A 1TTYA 1SD7A 2VONA 2BBYA 4M71A 5ILUA 2CO5A 1T0FA 4HLYA 1BBYA 4HV5A 1QQIA 4AWXB 3BOQA 2RN7A 3J80Z 3T1BA 1R1VA 2VT3A 4OMZA 1O3TA 1O7LA 3GW2A 4ZYEA 5JVTA 3SZTA 2D1HA 1R7JA 2HWVA 4ESBA 3M1EA 1P4WA 3ZQ7A 1U8RA 4OU0A 2QBYB 4A0ZA 4IRHA 1F4KA 1B59A 4M72A 3WE3A 1RUOA 1FY7A 1ZRFA 4HX7A 2OBPA 1DUXC 2Z9OA 4LLLA 5FFXA 1XMKA 5BS6A 1MKMA 5K5RA 5D4SA 2KRFA 4BYYA 4M6XA 1SD6A 3HRSA 4YFXF 1RIOH 2PI0A 2XKOA 2DT5A 4ZYGA 2CWEA 1BIBA 3M8EA 1KU3A 1FWZA 2NNYA 4XSZF 3I5UA 3F21A 5F64A 2IW5A 3JSPA 3F6OA 2Q0OA 3KEQA 1U78A 1ZYRF 2M5WA 3F6VA 4S04A 2W24A 2DQRA 2STWA 5HLGA 5D5UB 2GA2A 5FGMA 3QPHA 3ISPA 5ERIA 3K1MA 2FEZA 1J5YA 2XV4S 1G3WA 4EQQA 3CO7C 3I54A 2XAJA 4YFNF 1YYVA 1A04A 4EJVA 4GCVA 1BC8C 1JHHA 5IT9K 4QLCU 1EH8A 4IRGA 3TOBA 1QNTA 1ZRCA 1ZH5A 4L5IA 2WTEA 4A12A 3L09A 1FBQA 3L2CA 4EMSA 4G6QA 1LJ9A 2K4JA 3K69A 5BQTA 3BDDA 2V1XA 3I64A 4A6EA 5TRDA 4RAYA 4EJTA 1G3SA 3I4PA 4HZFA 3IKVA 1H9TA 4EM0B 5ILSA 3U2RA 1EH6A 2EWNA 3FXRA 1Z6RA 4U88A 1SFXA 3TKYA 4CYDA 2PN6A 4I0BA 3EUHA 3QP5A 4JK1X 2ZMEA 2BGCA 3DFGA 4AIHA 1QBJA 2PJPA 2NNNA 2O6GE 5CVVA 4LGWA 1DDNA 3F8CA 4AVPA 1IXRC 3KP5A 5DV5A 3TO9A 1RNLA 4ENMA 5F1RA 1IN6A 1ON2A 2HYGD 3MAJA 2WWYA 1REPC 2FBHA 4P9FA 4MTDA 2DK5A 2M30A 2JZYA 2A6EF 4CO8A 2PMHA 1J9IA 2CSOA 2XAQA 2EK5A 2BV6A 2MD5A 1QZZA 4RGXA 4RGRA 2G9WA 1IF1A 2G7HA 3HSRA 3SQNA 1WQ2A 1ZRDA 2R7DA 3BZ6A 3V8LA 3IC7A 3WU1B 3MQ0A 2ZMEB 2RDPA 3SFZA 1OYWA 3CLOA 3REOA 4EV0A 2W57A 3M7GA 1AOYA 2ZJ2A 3CUQC 2EFPA 4BHCA 1U3EM 2XASA 2O03A 4WCGA 1D5VA 5DD8A 3KE2A 3GUDA 2IP2A 2QZ8A 3ZMVA 1HW1A 2MLGA 5DEQA 4S05A 3G73A 4CZZA 4Q5SF 4HLXA 4ZZDA 2UXNA 2IA0A 4PDKA 1AWCA 2V9VA 4KIBA 2L01A 1IN8A 3QU6A 3JW4A 2ESNA 5E18F 4HW0A 3Q5FA 1S6LA 1GXQA 5D8KB 5JFRA 3FXUA 4WK8F 1R36A 1BI0A 2A5YB 2A69F 3LFKA 2VBZA 2VOPA 4UVBA 3QP6A 2COMA 4U7DA 3L9FA 3KP4A 3RIRA 2ACJA 4L0YB 3JTHA 2NYXA 2QYOA 4FT8A 3C1DA 2YX4A 3RYRA 1I1SA 4KICA 2AXLA 4AIKA 2A61A 3I0TA 1TQPA 3R4KA 1T98A 1RZ4A 1YW9A 5L3BA 3CUQA 1X3UA 2RQPA 4LLGF 5HS9A 1D3YA 1WKMA 1R23A 3GXOA 3M8FA 1R1UA 4RB1A 2XKPA 1HSJA 3O2PE 4RS8A 5HOOA 3BY6A 4L0ZB 3K1PA 1STZA 4UNOA 5DDGA 1YQAA 2QWWA 3E3VA 3FX3A 2A3SA 3U1DA 4KA4A 1UHWA 1XDUA 3BJAA 3GX4X 1IW7F 2O61A 3HTSB 1MGTA 3KETA 1IN7A 2E1NA 3DEUA 5LHGA 4KIFA 3GZ5A 1B9NA 1KU7A 1JGSA 3CUQB 3WE2A 4QWQA 4G94A 2MLKA 1J59A 1D8JA 3TGNA 3LWFA 2L02A 2VBYA 1FYMA 3T8TA 1K78A 4U0WA 5JI6A 5H6QA 4ESFA 3TDUC 4I0AA 4R8HA 3E97A 2JSCA 1PP8F 3V8KA 3TO6A 1FLIA 2HKXA 4KT5C 3WG9A 1ZG5A 2PLYA 2XHKA 2DW4A 2PMUA 5HDNA 2DPDA 4R79A 5J6XA 1T39A 2H27A 1EH7A 3ZMSA 3ELKA 5BMZA 5CVRA 3ZMDA 1NHAA 3O3KA 3WU0A 1I1GA 3K0LA 1MZBA 2VODA 2Z3YA 1FP2A 4NB5A 4M6YA 4HBLA 3TO7A 3MEXA 1ZREA 3N4MA 4FHTA 3JSOA 2E7XA 4XRFA 1K78B 3EQLF 3VOEA 4NHJA 3WTYC 5JHUA 1V4RA 2Q8KA 3PFIA 5E1WA 3FZVA 1YS7A 4OIPF 4EGZA 2ZNYA 4UV8A 1L0OC 3RTRA 3HHHA 4PGHA 1J7KA 4RAZA 4RB2C 1MDMB 5JR3A 4LJZF 4LG0A 3DF8A 5IT9Z 3E5QA 4MEXF 4PCQA 4BNCA 1BIAA 1BC7C 1QGPA 5J8CA 1CF7A 4KYWA 1IN4A 1GHCA 5FD6A 2JT1A 3RI4A 4HF1A 1JXSA 4IF4A 4M73A 1KYZA 3GYHX 1U5TC 2EV6A 1WSUA 3PQJA 1CGPA 2OD5A 2OQRA 3QU3A 1Q1HA 1IRFA 4HYEA 3R6SA 4FX0A 3MCZA 3RPUA 2LSOA 2GA1A 3GWZA 1W5SA 3HRMA 2F5CA 1ZN2A 3R60A 2DK8A 2RGVA 4G7HF 2W25A 3JTGA 2YR2A 5HS8A 1FPQA 4LG0B 1QZYA 2Y0MA 2RV8A 2FRHA 5LEJA 2RVCA 2P5LC 4M9XA 3ECOA 1LDJA 4GYIA 1CF7B 3LAJA 3F8BA 3K9TA 1TW2A 1QPMA 2HDCA 3L7WA 3W6KB 4R1HA 3T5XA 2ZO4A 3C18A 2X0LA 1HW2A 4GXOA 4AD9A 3O6BB 2JPBA 5DCMA 1K6OA 4HA8A 2QQ9A 1I6XA 4OOIA 2IVMA 1YW8A 4WWCA 2PG4A 4HQEA 2F5DA 2EFQA 4PGGA 3IL2A 2YPRA 3GVAA 1U5TA 1ULYA 2GQQA 5TJJA 1BI2A 1ODDA 4XLPF 3ERED 1XCVA 3DQVC 4EM2A 2HTJA 2FBKA 2LNBA 5FLXK 3DXJF 4BAYA 3WGIA 2EFWA 3HRTA 5E17F 3Q9VA 1XGOA 4M74A 1K79A 3KP3A 1FSEA 4K2EA 4U0VA 5ICFA 1HW5A 1OYYA 1HKQA 3ROUA 3GFIA 4HDUA 1F5TA 2M1BA 1I27A 3F72A 3VB2A 3EETA 2C6YA 4EJOA 1DPUA 2CFXA 5DCMB 5ICEA 4WXHA 3WTZA 2PFBA 1YW7A 4RGUA 1S3JA 1F1ZA 1IXCA 5D6FA 3KP6A 2QQAA 5FB2A 1P4AA 2GWRA 1U5TB 5E8GA 3KP2A 1OYIA 1K7AA 4H0EA 1KU2A 4KNYA 1XGNA 3V7RA 5BPDA 3BPVA 3F22A 2FNAA 3ZMTA 4GYGA 3FMRA 2XGXA 1SAXA 1B6AA 2IRFG 2KIMA 4LMYA 5D4RA 1G4DA 4IVNA 4LD5A 2CW0F 5HVQC 4I09A 2EFNA 4D0PA 3H92A 3T0YA 3SXYA 2H94A 4KFCA 2EFOA 5E1XA 3JAMK 3E5UA 3HTUA 3IWZA 3WODF 4MHGA 1B9MA 2B0LA 5ICGA 2D2WA 2BE5F 3P7NA 3V7CA 1UCRA 4LK0F 1S29A 3CJNA 3HYIA 2P7VB 2ISZA 3ABUA 1KU9A 4GGGA 3BP8A 1LDKB 3QRFF 5BOXA 1FX7A 5L3EA 4HF2A 5L3DA 2IA2A 2FNPA 3IWFA 1SD5A 2RKHA 2XAGA 1UB9A 1VTNC 5L3GA 1BM9A 5H6RA 4MGRA 1HSTA 2DPUA 5D6EA 2E1CA 1P4XA 4IPAA 4NQWA 3J81Z 4WF2A 4Y13A 3MFKA 4L9TA 3RYPA 1Z1DA 2XIGA 1W5TA 2KJBA 3M9AA 3H3UA 5CYVA 3U9GA 2W84A 3E6CC 1W4MA 1KYWA 4U0YA 2V6CA 2GZWA 1EV7A 1LB2A 3F8NA 4YIIA 1C0WA 4EJUA 3W6JB 5L3CA 2VC0A 5FO5A 3VEPA 1MJ9A 2Y75A 2HYFA 2PQ8A 4WXCA 2Y48A 5HS7A 3HHGA 1XN7A 3D0SA 3TQNA 2ADUA 1ZG1A 4G6DA 3KLOA 1KQ0A 3HUGA 3DPLC 1TNSA 3E6BA 3AAFA 2OAZA 2EV0A 4G8XA 3WTWC 1J2XA 2P5VA 4UV9A 2FF4A 4ESJA 1J0RA 1XSDA 3CUOA 5D5VB 4IHSA 5D5XB 3K1NA 2O3FA 4UHTA 4ENNA 4Y15A 4Y17A 1O3RA 2G7UA 4P9UA 1U6GA 2NS0A 2QLZA 1IXSB 2XAFA 2XUBA 1TQMA 2K02A 2RNJA 4O3MA 2VE8A 1XB4A 3J81K 1MJAA 4KDPA 3F3XA 3BPXA 1T2KA 1ZHFA 2IT0A 2DAOA 1H9GA 5K5QA 1DPRA 4XSXF 4BHPA 2CQKA 2HR3A 3C3WA 1Y0UA 3DV8A 4UVCA 4KMFA 3FM5A 2D45A 3MZHA 1MD0A 2CYYA 2KIUA 5CJ9A 1LVAA 3T8RA 3RJPA 3LA7A 1UHMA 3HOSA 3V7SA 2HTSA 5K5OA 5LHIA 4Q4ZF 4HF0A 2AS5F 1PUEE 1LDDA 3ABTA 2OZ6A 3GFMA 1TNTA 2L4MA 4N0BA 4O5VA 2O0YA 2HEOA 1Z6TA 4LFUA 2GXBA 2CGPA 4AIJA 3HRUA 1ZLJA 1R22A 3TDZC 4HDVA 4O6JA 2MC3A 2PEXA 3WTTC 4U7BA 3E6MA 2GXGA 4Q47A 3KEOA 1R00A 1UFMA 3QAHA 2IPQX 1FYLA 3GEZA 2L54A 3OV8A 2UWMA 2DFIA 3DPTA 2ETHA 3QOPA 1F9NA 2HQNA 4B09A 3FM3A 5DD4A 5A2QK 5LEKA 1USSA 1ON1A 2PBIA 2MA3A 5EEHA 4BH9A 2OQGA 4YFKF 2FA5A 3IRQA 2JPCA 1P92A 4DNCA 5LGTA 4CDGA 5FLXZ 2R7FA 1WI9A 1PDNC 2F5EA 4M9SA 2FE3A 1ZLKA 1IRGA 4EM1A 4XLNF 4XBFA 1BJAA 1BI1A 1Z05A 2DBBA 4HV6A 2HQRA 4PZJA 2STTA 2XVCA 2RC4A 5LRRA 3R0AA 3LAPA 2ZXJA 4B8XA 3I71A 3WGGA 3IHUA 3D5LA 2EV5A 2CG4A 3G3ZA 1OPCA 4YIFA 2KIFA 2P6SA 4ZYDA 3RKYA 4ENKA 5ICCA 4P5OA 1KQ9A 2Z5UA 3SHFA 4L9JA 2FOKA 6PAXA 4OINF 4G9YA 3NQOA 1TW3A 3DP7A 5LLQA 3FXQA 4LB6B 4WX9A 1ONVA 3VODA 1OR7A 1USTA 2EA2A 3GF2A 1YS6A 2VXZA 3WTSC 3ZPLA 1OMIA 2EJRA 4RB0A 3J7AO 5L3FA 2OZUA 3F8FA 4A5MA 4RGSA 3EYYA 1R5HA 3HOTA 5HLHA 5HDKA 2VT2A 2H6BA 3KFWX 3LQRA 3BROA 4GO1A 1L3LA 1LQ1A 4L9VA 5KK1A 1BN5A 3FHZA 4IHTA 5K1YA 4LK1F 1U2WA 1W7PA 5AIPA 1FBUA 3FF5A 3WGHA 5IT3A 4YG2F 1D8KA 1BI3A 2HS5A 2A68F 1W7PD 4HX4A 2QQBA 3JAMZ 1WRJA 4N9IA 2FQ3A 4BXUA 1P6RA 5H20A 3V8JA 2VN2A 4UXNA 2UXXA 4L5JA 4DQ2A 3R61A 2GIVA 2LF8A 4G7ZF 4A5NA 1IAWA 4I7HA 2H09A 3SZPA 1XGSA 1S8NA 5CVIA 5LGUA 3HSEA 2K4BA 3CTAA 5FFZA 1G3TA 4ZH4F 3ZN0A 4OIQF 2D1VA 4L9NA 1XD7A 1Z7UA 2HFHA 4I2OA 1O3SA 3GFJA 4KMUX 2XRNA 1LEAA 1W7PB 5LBQA 2MH9A 4N9HA 5CVJA 3J80K 3CDHA 1E2XA 1IUYA
chains in the Genus database with same CATH superfamily
4RLQA 3B73A 3KZYA 1V3FA 3CCMI 2VJIA 3RDIA 3LSTA 5EJCA 2LKPA 2E60A 3LQQA 2XRLA 3OYNA 4UUVA 3FMSA 2DTRA 1SMTA 4JYKA 1FIPA 1GVJA 5DCFA 2R5YA 2UV1A 4HX8A 1Z67A 3COAC 1JUPA 3NWSA 3LSKA 1FP1D 4ZZLA 2A05A 3HSFA 2WV0A 1RC9A 5DUIA 1Z21A 5E1ZB 3GFLA 2X85A 3P9KA 3C7JA 4C2UA 3AKZA 3VFZA 4CXFA 1WPKA 2A07F 1QO0D 1WWXA 2R4GA 2QKLB 2XF6A 2ELKA 1FNNA 3PL8A 1TC3C 3S1QJ 3VYTB 1O3QA 2BVLA 4D1QA 5CQGA 2FU4A 4IHYA 4DIQA 3WTVC 3I4NJ 1FOYA 2DU9A 1WZ2A 5BPIA 1GT0C 3K4KA 2X1DA 4JQFA 1XDSA 1JE8A 1MNMC 1BW6A 1WFXA 4A93J 5CLSA 1XGMA 2DFEA 2XGCA 3CCJI 1FYKA 2K9LA 4HNUA 3GO5A 2MH2A 2P6TA 3OYDA 4ON0A 2IJLA 1IJWC 1NG7A 2LLKA 4NBQA 1B1BA 4BQNA 5D8LB 5EF6A 1H0MA 3FWEA 4LLNA 2HZTA 1Z9CA 2ZFWA 2YU3A 3M8JA 3MWMA 2PMZA 1E3PA 5E3OA 3HOUJ 5KVRA 4RB3C 1YHQI 2VQHA 2V4JC 1R5GA 4CCNA 1EA3A 4CHUA 1J75A 3R0JA 1V5FA 2HZDA 2M8EA 4OMYA 4TV7A 2HVRA 5EZGA 4WXDA 2P7CB 2CQQA 5EDNA 5HLIA 3TP0A 2WC2A 1DP7P 3IKTA 2BYVE 2WAQN 2I10A 2XROA 3OYMA 1YLFA 5C4XJ 5EG0A 3BQZA 1NTCA 1VQMI 2O8XA 1TLHB 5AONA 3RPQA 3JREA 1QA6A 2L9VA 1RI7A 2RREA 1X1AA 3G2BA 4B43A 3OYJA 4IRIA 1S7AA 4A3IJ 3BJ6A 2DMNA 2G0EA 3ML6A 5E8IA 3ZQQA 2H6CA 2LF7A 2J5OA 4IJAA 3CMAI 3U1KA 2GAUA 2ZNZA 4ZYHA 3HC7A 2KLOA 2M4GA 2VQCA 4KJZA 2CMPA 3Q9SA 3WTUC 4PJNA 4BU2A 3K4MA 3OYAA 1BL0A 4NDLA 1IUFA 3HPGA 1IV6A 4J19A 2W85A 2E7WA 4XN3A 3VPRA 2JTVA 2K27A 1SANA 1ZG3A 4A3BJ 1YI2I 1Z3XA 5DM6F 5DYMA 3BTLA 1SMYF 3RKXA 2HGCA 5F6FA 2Z33A 1E17A 2KJCA 3V4GA 4YRVA 4OIRF 4Y33A 3FIWA 4A0XA 4E70A 3A01A 2ZXWH 3H3ZA 3A4CA 1IZ1A 4I02A 2F6CA 3KX2A 4HSRA 1FSHA 4DZPA 3DTKA 5D5WB 1FBSA 4JBAA 3N97A 2F5FA 2HOTA 2F2EA 1MMNA 1I6HJ 2XAHA 3GZNB 4XIDA 4XRSG 2VQGA 4IHVA 1KQ8A 3SZGA 2JWTA 2Q2EA 3TOAA 4DBQA 4BDYA 1JUSA 1O57A 2HDWA 2XF7A 1SFUA 5EG0B 1ZARA 3LSPA 3DKWA 2OA4A 3GZ6A 1IGNA 2VOOA 1TQIA 3F23A 1T8IA 1IN5A 3I59A 5F1JA 2L3DA 2K7LA 2JQ7A 2DFHA 2M4KA 2ZFUA 4Z2YA 4B47A 4OIOF 3K6GA 3E6DA 3H3VK 3LA2A 5H2FC 2FQ4A 1YITI 4KUMA 5AIQA 1JGGA 1NK3P 1ENHA 5FKMA 1OKRA 1SFEA 3DWLE 1ZK8A 2YSRA 5J8FA 3S2DJ 2BW3B 2BXYA 2FSWA 5ED4A 4ZDOA 1ZGJA 2VQLA 3P9CA 1MJBA 3PUFA 2DI3A 4MEYF 3OOPA 2CRGA 3LSRA 5CVUA 2V1DA 4RBOA 2K40A 2OTJI 2BXZA 1MSEC 1R6RA 1ZTRA 4BQAA 1WI3A 1IDZA 2L7KA 1QU3A 2NS7A 2L7ZA 2HNHA 3L1PA 3KCCA 1Z91A 4PJ0C 1YFHA 2EH3A 3P9IA 5EEGA 3PQKA 2EB7A 5E3LA 2XPUA 2ELHA 4UVAA 4XRMA 3JRCA 1MMGA 2ESHA 4HOBA 4M3EA 1ZGAA 1JHFA 3DU5A 2Z99A 4MQ9F 2DOEA 5EGOB 2Q2EB 1S7OA 3ZN1A 2J5PA 3D1NI 4BY1J 2V1UA 3OMYA 3MZYA 4HAMA 1G3YA 2M87A 5ILVA 2KKOA 1FC3A 1YG2A 2FBIA 2JSPA 1TP4A 4PSWA 1SD4A 4NC6A 3S2WA 4F7ZA 3I59B 5DUKA 3S32A 2K85A 1QZEA 4EVIA 2V79A 4A0YA 4BKXA 1HBXG 2HPMA 1R49A 4LB5A 2JRTA 5IOYA 2R3SA 1B72A 4CGZA 1HQCA 1OJLA 4PSXA 2P5KA 3LA3A 2LRDA 4A6DA 2DQLA 2FXAA 3AG3H 3L00A 5LHHA 5A2QZ 3W2VA 1MNEA 5J4VA 1ZAOA 1HXDA 3DLLF 3HIFA 1DU6A 3CDIA 5GP9A 1GXPA 4ENJA 4E4HA 2YX7A 1A31A 1T38A 1I5ZA 3KZIC 4EGYA 1RUNA 3ULQB 5FRMA 2QEXI 1BR4A 1XMXA 2NVTJ 4QIWN 4BXXJ 2HDDA 4DYQA 1P7JA 2W82A 3K2ZA 3S2HJ 3KP7A 2QCOA 4J01A 4M9ZA 1XSVA 3IAM2 3QOEA 3ZMZA 5LGNA 3DKYA 4FX4A 2M45A 1IO2A 2EZHA 2DLLA 2V9PA 3CC7I 2EA4A 3CCEI 1YTYA 3ZP5A 2MBFA 5FKNA 1YIOA 4A2UA 2ISYA 2Z1DA 4XONA 4EJWA 2MYSA 2NVUB 4P55A 2LDUA 2I5UA 4II3A 3OYLA 3CMYA 4ETSA 1CQTA 5HDGA 1ETQA 3QWLA 2FMYA 2P4WA 4P96A 1R58A 3QPTA 4YELA 3KLNA 3H1CA 3PNVA 2QUFA 4L18B 3FXOA 3GLXA 1BOAA 1O7FA 2DA5A 1K6YA 1GVDA 2HKOA 3I58A 2P8TA 2VKHA 2X4HA 3I53A 3QYBA 3OYIA 4ANJA 1MBFA 1LEBA 1B72B 3CDLA 1P2FA 2QENA 1TBXA 2VPRA 1KGSA 3OYHA 3ZMUA 2K86A 1OCRH 1T0FC 3E5XA 4MQVA 1PP7U 4HQMA 2LOOA 1XSXA 2DFFA 1R1TA 2IS6A 1XCBA 3NRVA 1X1CA 3J7YJ 1YO5C 3B02A 4DOZA 1FMWA 2L4AA 3KYCB 1Z3YA 2IA1A 2RNGA 4MTEA 1ETOA 4MNUA 4FASD 2DOAA 2OU2A 1LNWA 1B4AA 1MDMA 1W0UA 1XMAA 2ZKZA 1OQYA 3CQZJ 5LRSA 1N78A 4G7OF 1G2HA 3KZZA 4Q48A 4U87A 3M3YJ 3ASOH 4D7NA 3F8MA 3DEWA 4KN4X 1FZPB 3BQYA 4BHBA 1RKTA 2VC1A 4KIGA 3WTXC 5FKKA 1D1BA 2O7OA 2GLOA 3BWGA 3NEUA 3AL0C 5E3MA 1M1EB 3EDPA 2NRAC 2UZKA 3MD2A 2TDXA 2DO7A 2JA2A 4X1EA 3RKWA 3G4SI 3EYIA 2R7UA 3MMYB 3TEDA 3ECHA 2ZCWA 3HJEA 3SDBA 1HKTA 3A0HC 1Y0NA 3DPUA 4I98B 2A6HF 2XSDC 2X51A 1ETWA 2LH9A 3MVPA 5BNGA 3QODA 2ICWG 1KA8A 1FEXA 2Y0SN 4IXAA 2IXSA 4XLAA 2K9NA 3ZXSA 3IRRA 4I01A 3A02A 1HKSA 4KN7X 4CICA 2R93J 1FT9A 3FMQA 1JI8A 2QVOA 4QSHA 2VE9A 3DEEA 1V54H 2EINH 5E20A 2VBWA 2HYJA 3A03A 2QM3A 1X1DA 5IYBJ 1G6NA 2W00A 3MN2A 3K70C 4BACA 1Y56A 1B8IA 1MH4A 4ASNA 1FOKA 2FMLA 2NAZA 2MSYA 2HOEA 1ETVA 4F55A 3BJOA 2QBYA 3S93A 2BEOA 4KISA 2ZBKA 1WJAA 2VBXA 3X2QH 3CO6C 1T6SA 5FD5A 2ZJQF 1TTYA 1TT5B 1A36A 1AA7A 1SD7A 2VONA 2BBYA 4M71A 3OL3A 5ILUA 4S0HB 2CO5A 4LG3A 3HEFA 3L2QA 2E2IJ 1JUMA 1T0FA 3PIPF 3GTJJ 5M5YJ 1HOMA 3BG7A 2JUGA 4HLYA 3K2AA 4BE1A 2E71A 3BG6A 4PJJA 2CV0A 2H8RA 1BBYA 4HV5A 4YEJA 1QQIA 4ZTJA 2KHMA 4AWXB 2W4SA 1F43A 3QPSA 2EZKA 3BOQA 4AYBN 2RN7A 3J80Z 2BHYA 2DODA 3T1BA 4CCLA 1JT0A 1HC8A 4BEHA 1R1VA 2VT3A 1KZHA 4OMZA 1VQNI 1O3TA 2M7BA 1O7LA 1YJ9I 3VYRB 3GW2A 4ZYEA 2XC7A 2JMWA 1X4PA 5J47A 4H4KC 5JVTA 3H9GA 1D5YA 4CH7A 3HDDA 5IPAA 5KHDA 3SZTA 2WY7Q 2L9SA 2D1HA 1R7JA 2HWVA 5J1UA 2DTZA 5B5EC 4ESBA 3Q0UA 3M1EA 3FISA 1OCCH 1P4WA 3ZQ7A 1U8RA 4DYRA 3S1RJ 1B8IB 3M1CA 1TZLA 4OU0A 3BCAA 4DGWB 1HCRA 2DDBA 1ZQ3P 2QBYB 4M3GA 4A0ZA 4IRHA 5J1RA 1F4KA 1B59A 4M72A 4BY7J 3WE3A 5GPCA 1RUOA 1FY7A 1ZRFA 4HX7A 1ZR2A 2OBPA 2X48A 1DUXC 3N05A 4XNFA 4LLLA 5FFXA 1XMKA 2Z9OA 5BS6A 4FETA 2CW7A 2WAQA 1MKMA 5B1AH 2NOJB 1BW5A 4FCYA 2R7ZJ 5IP9J 3TL4X 5K5RA 2V1NA 5D4SA 2GBYA 2KRFA 2M34A 4BYYA 4M6XA 1JKRC 3J7ZI 1A35A 2HOSA 1SD6A 3HRSA 4YFXF 1RIOH 2PI0A 2XKOA 2DT5A 3EUHC 3JRGA 4BXFA 4ZYGA 2CWEA 1BIBA 4NC7A 2WY8Q 2ZMEC 2KDZA 3M8EA 2R7XA 1KU3A 2ZSIB 1FWZA 2NNYA 4UB6C 2VKEA 4XSZF 3I5UA 4ZC3A 3K70D 3F21A 5F64A 2IW5A 1X58A 3CJQB 3HXLA 3JSPA 4BEHB 3F6OA 4J00A 4XKWA 2R92J 2Q0OA 3KEQA 4D5CA 2F5VA 1U78A 2KQRA 1ZYRF 1D0XA 1U9NA 2M5WA 3F6VA 4S04A 4E7HA 4RLFA 4I99C 2W24A 2DQRA 5HLTA 3PM1A 2STWA 5HLGA 4M3BA 5D5UB 2GA2A 3I9V2 3E7LA 5FGMA 3QPHA 3ISPA 5ERIA 3K4NA 3K1MA 3HOZJ 2FEZA 1J5YA 4A3FJ 2XV4S 2DA4A 1G3WA 3VDXA 4EQQA 3CO7C 2L5QA 1ACIA 3I54A 2XAJA 4YFNF 2E19A 1HDDC 1YYVA 2QQ8A 1A04A 2CUFA 4EJVA 3KPHA 4MFDA 4GCVA 1BC8C 5EYRA 1JHHA 4IL6C 1SVLA 5IT9K 4QLCU 2M0MA 1EH8A 2QA4I 4IRGA 3TOBA 3OYEA 1QNTA 1ZRCA 2ZB9A 1ZH5A 4L5IA 2WTEA 4A12A 4C3IJ 2OUMA 4JX6A 3L09A 3CCRI 3FKIJ 1FBQA 3L2CA 4EMSA 2QKMB 4G6QA 1LJ9A 1AU7A 2K4JA 2OTLI 2K9MA 3K69A 5BQTA 3BDDA 2V1XA 3I64A 4A6EA 3CC4I 1S9HA 5TRDA 2W48A 3BTIA 4RAYA 1H89C 1E0EA 4EJTA 1G3SA 2DYRH 3I4PA 4HZFA 3ZOBA 3IKVA 1H9TA 4DZJA 4EM0B 1V5EA 5ILSA 1BOBA 3U2RA 1EH6A 2EWNA 3BR5A 3FXRA 2DMTA 2VUMJ 1OFCX 1Z6RA 4U88A 2OCCH 1SFXA 1V55H 2LFBA 3TKYA 5J4YA 4CYDA 2PN6A 4I0BA 3EUHA 3QP5A 4JK1X 2ZMEA 1YJWI 2BGCA 3DFGA 4AIHA 4B44A 5EEAA 1QBJA 4UUTA 2PJPA 2XF5A 1XS9A 3SYTA 3Q0VA 2CS3A 2NNNA 2VIXA 3V42A 2O6GE 5CVVA 3BG9A 3S16J 5IOZA 4LGWA 5LD2C 1DDNA 2CW8A 3F8CA 1DGRM 4AVPA 4A3CJ 1IXRC 1WJEA 3KP5A 5DV5A 3TO9A 3OIOA 3CCVI 3GTLJ 1BJZA 1RNLA 4ENMA 3HKZN 5F1RA 3W2WA 1IN6A 1ON2A 2BVMA 3FK6A 1Y1WJ 2HYGD 4QPOA 3MAJA 1QHGA 2LREA 2WWYA 1R71A 5GAGJ 1JJ8C 3EPZA 1REPC 2FBHA 1W1WE 3BR6A 3BZKA 4P9FA 4AVZA 4MTDA 1TWCJ 4C30A 3OYKA 2DK5A 2M30A 2JZYA 2A6EF 3K4BA 4CO8A 2PMHA 3LSJA 1J9IA 2CSOA 4JP0A 2XAQA 3GTQJ 1LFUP 1RPWA 1NH3A 4HNVA 2EK5A 3M4OJ 2DDAA 2BV6A 2MD5A 1PYVA 1QZZA 2LVSA 3RZDJ 4RGXA 4RGRA 5FJ8J 1VQKI 1Q1VA 2G9WA 3OWTA 2WADA 1IF1A 2E1OA 2G7HA 3JRDA 2R5YB 3ZQGA 2KPMA 1V5GA 3FXKA 3HSRA 3SQNA 1SFKA 1WQ2A 1ZRDA 2R7DA 4M6VA 3BZ6A 3V8LA 2DMPA 3DU6A 3IC7A 2KL4A 3WU1B 1N25A 4Y52J 1TWFJ 3MQ0A 2JA6J 3OS2A 2ZMEB 2RDPA 3SFZA 1OYWA 3CLOA 2JN6A 4A3DJ 3REOA 4EV0A 2W57A 2XSJC 2ZXIA 3M7GA 2X6YA 5E3NA 1DU0A 2ZJ2A 3CUQC 2OPTA 1AOYA 2EFPA 4BHCA 1U3EM 2XASA 2O03A 3LSIA 4WCGA 1D5VA 5DD8A 3KE2A 3FBNB 2EPFA 2XGEA 3GUDA 3P5JA 2IP2A 2QZ8A 1R4NB 3ZMVA 3OYFA 1HW1A 3S1NJ 2MLGA 3S14J 3WHCA 2ZSHB 3GMEA 1BR2A 4CUGA 5DEQA 4S05A 1FMVA 3G73A 3OYCA 4CZZA 2A5WA 2HXIA 3CMEI 3UKGA 5E79C 4Q5SF 4HLXA 4ZZDA 2UXNA 2HU9A 2IA0A 4RDUA 3K4LA 3OS0A 3OYGA 3HOYJ 2K5CA 1SFOJ 2MFZA 4PDKA 1DP3A 1AWCA 2L9RA 4RA2A 2V9VA 2EIMH 4KIBA 2DOFA 2L01A 2LC2A 1IDYA 1IN8A 1IV8A 2LTPA 2X6WA 1FIAA 3ESWB 3E1SA 3QU6A 2B9SA 3WG7H 3ASNH 3JW4A 4CCOA 2ESNA 4ZJZA 3S1MJ 4D5FA 1TT0A 5E18F 2VPLA 4HW0A 3CC2I 3Q5FA 1S6LA 2KDOA 1RR8C 1GXQA 4JX5A 3GTPJ 5D8KB 3MKZA 5JFRA 3GTKJ 3FXUA 3K4JA 4WK8F 1R36A 1D1CA 1BI0A 2A5YB 2A69F 3LFKA 1RR7A 2VBZA 2VASA 2VOPA 4UVBA 3QP6A 2COMA 4HPQA 1X4OA 4U7DA 1SEUA 3ZRGA 1R4MB 5C3EJ 3HPHA 4XICA 3L9FA 4E7IA 1YE9A 3LL7A 3KP4A 3LMMA 3RIRA 2ACJA 4L0YB 3JTHA 2NYXA 3SJMA 2QYOA 1XX5A 4FT8A 3C1DA 4Y4RA 2YX4A 3RYRA 2DYSH 1I1SA 4KICA 2AXLA 2DJIA 2ZJPF 4AIKA 2A61A 2LG4A 3I0TA 2OF7A 1TQPA 5JHFA 1JKQC 3R4KA 1T98A 1RZ4A 1YW9A 5L3BA 3OR1C 3JRAA 4BQOA 4BUPA 3ABKH 3CUQA 2DMQA 1X3UA 5GPAA 3HGGA 3A01B 4FE4A 3W3CA 2R7RA 2RQPA 4LITA 2R7QA 4LLGF 3L2UA 4HEA2 5HS9A 2ECBA 1OCTC 4CA0A 1D3YA 1WKMA 4UUSA 3OIPA 1R23A 3NWTA 4B4CA 1YRNA 3GXOA 3S3MA 3M8FA 1R1UA 3SDGA 4RB1A 1A6QA 2XKPA 2XB5A 1HSJA 2VXDA 3O2PE 4M3DA 4NUBA 5GAHJ 4RS8A 2H1LA 3FXMA 3VSLA 1N75A 1U0JA 5TISC 5HOOA 1YJNI 3BY6A 3BZCA 4L0ZB 3K1PA 1STZA 4XN0A 4UNOA 5DDGA 1QVTA 1YQAA 1SVMA 3CF2A 2QWWA 3E3VA 1RESA 3FX3A 2A3SA 2ECCA 1ITYA 2YS9A 3CP8A 3U1DA 2ID3A 4KA4A 1MBEA 3CP2A 2L7MP 4DW6A 1UHWA 2K9QA 3BJAA 1XDUA 3GX4X 3FK7A 2PMZN 2E1MC 1IW7F 5F08A 2O61A 3M07A 1MGTA 3HTSB 3KETA 1K83J 1IN7A 2E1NA 2RAEA 4FISA 3DEUA 4X0GA 5LHGA 4KIFA 5J1YA 3GZ5A 1B9NA 1QPIA 1KU7A 1JGSA 2MW8A 3CUQB 4F91B 2JRMA 3WE2A 1WJDA 5GAEJ 4QWQA 2E5ZA 1YIJI 2K3FA 2LK2A 4G94A 5FLMJ 2UUZA 3RZOJ 2MLKA 2F4IA 5FRNA 2BY0A 5EZHA 1J59A 1D8JA 2CQXA 3TGNA 3LWFA 3VSKA 2L02A 2VBYA 3H5RA 1GLNA 4UUSB 1FYMA 5FROA 3T8TA 4DYCA 4CZCA 3CESA 5GTHC 2JVGA 2JUCA 1YRNB 2P81A 2VKDA 2YUSA 1VNDA 1K78A 1LFBA 2WB1A 4GFBA 4U0WA 1UG0A 5JI6A 5H6QA 3TW6A 4ESFA 3TDUC 4I0AA 4II2A 4R8HA 3E97A 4JX4A 2L7FP 2AQFA 2JSCA 4XLEA 1PP8F 3V8KA 1YOVB 2IS4A 1RKWA 3TO6A 1FLIA 2HKXA 4KT5C 3WG9A 1QVUA 2BY2A 1ZG5A 4P1WA 1G59A 2PLYA 2XHKA 1UZCA 2AHQA 2BY3A 1A6IA 1XTAA 3GLLA 2DW4A 2PMUA 2CUJA 5HDNA 2HXOA 2JJ7A 2DPDA 2E34A 4BE0A 4R79A 1HLVA 3PNTA 4XK4A 1K4SA 3AG1H 2R7VA 5J6XA 1T39A 2H27A 1EH7A 5KCMA 4QPQA 4B3XA 1Y1VJ 2CH0A 5CKTA 2Y30A 3DBLB 3ZMSA 3ELKA 5BMZA 5CVRA 3ZMDA 1NHAA 3IH2A 3C2BA 3O3KA 3G1LA 4IOCF 5F27A 3WU0A 5M5WJ 2CV2A 4F92B 1HA8A 4HNTA 1I1GA 3K0LA 2B7EA 1MZBA 3LSGA 2VODA 2Z3YA 1FP2A 4NB5A 4M6YA 1T95A 2FD5A 5DM7F 4HBLA 3TO7A 4IKFA 3CLQA 3MEXA 3TBIA 2AO9A 3H0DA 1OCZH 3N4MA 1ZREA 2B63J 3FXLA 4JOMA 4BBRJ 4FHTA 3JSOA 2E7XA 3BC8A 4XRFA 4BJ5C 2LYCA 2KT0A 1K78B 3EQLF 3K10A 3VOEA 2E35A 3W2AA 4NHJA 1X3WB 3WTYC 2EIJH 5FLVA 3VYUB 3ZQFA 5JHUA 1PUFA 2KZVA 2O9LA 1V4RA 2Q8KA 5GADJ 3PFIA 5E1WA 4BJTA 3MKYB 3FZVA 1TWHJ 1XPXA 4XQFA 1FTZA 4HRIA 1YS7A 2OV7A 1SC7A 5FKOA 3IAS2 4OIPF 2N8GA 4EGZA 2Y31A 1LVKA 2ZNYA 1MSFC 2IGKA 4UV8A 1L0OC 1YX3A 3K4CA 2M8GX 3JRHA 3RTRA 4BGDA 3HHHA 1LE8A 4PGHA 1J7KA 1D1AA 4RAZA 4CCKA 4QTRA 3FKJA 5CQEA 4IZZA 1E3OC 2EIKH 2LMDA 4RB2C 3GBGA 1UG2A 3NARA 1MDMB 5JR3A 4LJZF 4LG0A 3DF8A 2JA7J 5IT9Z 3E5QA 4MEXF 1WH5A 4PCQA 3H9JA 3AG2H 1GV2A 4BNCA 1BIAA 1GV5A 4NNJA 1BC7C 1NK2P 1QGPA 4UY8I 2KRHA 2WBMA 5J40A 4XKVA 5J8CA 3LSHA 3ZQHA 1CF7A 4KYWA 1IN4A 4A3EJ 1GHCA 5FD6A 2JT1A 3RI4A 4HF1A 1JXSA 2DCEA 4IF4A 4GRIA 2KMUA 4XMYA 4C3HJ 3CCQI 4M73A 1KYZA 1XG1A 2WV1A 1UAAA 3GYHX 1WJBA 3TW7A 1FOXA 3BLYA 1ERDA 2R7TA 4G6TB 1VI0A 3OOUA 4M3FA 1Y6IA 4MO7A 1U5TC 3S3OA 2EV6A 3HKZA 1PUFB 3C2GA 1WSUA 3PQJA 3ZCOA 1CGPA 3CJRB 2OD5A 3OR2C 2DA7A 4HSTA 2OQRA 3QU3A 1HF0A 2Y9YA 3FDYA 1Q1HA 2V6EA 1IRFA 4HYEA 3R6SA 3RQIA 4C2MJ 4E7KA 3IP4B 4FX0A 3MCZA 3HM5A 4XKBA 2M3AA 9ANTA 2HVSA 3KEYA 3RPUA 2LSOA 2VJ4A 3PSIA 2GA1A 2ZJRF 5JLXA 3GWZA 3ZQCA 3NAUA 1TWGJ 1W5SA 3HRMA 2F5CA 1ZN2A 1LE8B 1WCMJ 3F0CA 3D5RC 3R60A 2CQNA 2DK8A 2RGVA 3KYDB 3RPUD 4G7HF 2W25A 1MMAA 3D5SC 4XOPA 3JTGA 2YR2A 4OWRB 5K7FA 5HS8A 1FPQA 2DT6A 3IH3A 3OIQA 1QZYA 4V2GA 2Y0MA 1VQLI 4LG0B 2RV8A 2FRHA 5IP7J 5LEJA 2R7WA 2RVCA 2P5LC 4E6KG 2HQ5A 4M9XA 3ECOA 1LDJA 1WVRA 4CYCA 4GYIA 1CF7B 3LAJA 4B48A 3F8BA 3K9TA 1VF9A 4A3KJ 4YIRX 1TW2A 1QPMA 3L2RA 2HDCA 5IYDJ 5DS9A 3L7WA 1P7IA 1PVEA 3BTJA 4ZDLA 1ZKGA 3W6KB 4R1HA 3T5XA 4N4NB 2ZO4A 2R7SA 3C18A 2X0LA 1I50J 1HW2A 4GXOA 1MMDA 3HG9A 4AD9A 3O6BB 2JPBA 1Z0XA 5DCMA 2R0QC 3AL0B 2KP6A 1OISA 1K6OA 4D7MA 5FKLA 4HA8A 2QQ9A 1X1PA 1I6XA 1MH3A 4OOIA 2KZGA 2E5NA 2IVMA 3CJTB 2L0KA 3KYLA 1YW8A 2PG4A 4WWCA 4HQEA 2IS2A 2F5DA 4W97A 2EFQA 4XOTA 4PGGA 3DBRB 3IL2A 1ETXA 2YPRA 3GVAA 2NVXJ 1U5TA 1ULYA 2GQQA 3BR0A 5JVGF 3GTOJ 3ONQA 2VLAA 5TJJA 1BI2A 1ODDA 4XLPF 3ERED 1XCVA 4UB8C 2XAUA 3DQVC 4EM2A 1T56A 2OC6A 2HTJA 2E36A 2FBKA 2LNBA 1A5JA 1D0YA 5FLXK 3DXJF 4BAYA 3OSGA 3WGIA 2NOGA 4A69C 1EKEA 2BZTA 2EFWA 3HRTA 2R5ZA 5E17F 3Q9VA 5C4JJ 1XGOA 2AQEA 4M74A 3ABLH 4CYCB 1MBKA 1K79A 2P0WA 1MNDA 3KP3A 3OYBA 1FSEA 4K2EA 4U0VA 5ICFA 1HW5A 1OYYA 1HKQA 3DLAA 3LFUA 3ROUA 3VYSB 2M7AA 2ELJA 5C44J 4IX7A 3GFIA 4HDUA 1F5TA 2M1BA 1I27A 3F9KA 1JT6A 3F72A 4XL9A 3VB2A 3EETA 2C6YA 4EJOA 1DPUA 3CMMA 2XGDA 1I3QJ 5IY5H 1AKHA 1VZ0A 1PJRA 2CFXA 2FOWA 5DCMB 5ICEA 1WJFA 4WXHA 2LY9A 3WTZA 1DQUA 3QYEA 2LR8A 2PFBA 1YW7A 1FTTA 4RGUA 1S3JA 1F1ZA 4PFPA 1IXCA 4OAZA 5D6FA 3KP6A 2Y9ZA 3QPLA 1DGWY 2QQAA 5FB2A 1P4AA 2FUG2 2GWRA 2V26A 4IOAF 1U5TB 5E8GA 3BR3A 3KP2A 1OYIA 2XB0X 3HZJA 1K7AA 4H0EA 1KU2A 1LPQA 4OAYA 4KNYA 2BOLA 5HODA 3CCYA 1XGNA 3V7RA 3BPVA 2KIQA 3LOCA 3DCFA 3F22A 2FNAA 5BPDA 1E3HA 2TRTA 3ZMTA 2EZIA 2EQRA 4GYGA 3FMRA 2AXTC 2XGXA 2VJ5A 2R7OA 1J09A 1POGA 1EF4A 4BL0B 2R5ZB 2KISA 3A1YA 4AIDA 2D5VA 1SAXA 2OJED 5J3LA 1B6AA 3AG4H 2IRFG 2KIMA 4LMYA 5D4RA 4I76A 3DTEA 1G4DA 1O4XA 4IHWA 1WJCA 4IVNA 3FBIB 2CW0F 4LD5A 4CSWA 4RAGA 5HVQC 4I09A 2EFNA 3PSFA 4D0PA 3BCBA 3H92A 3I55I 2O5RA 1H88C 3T0YA 4F52A 3SXYA 2H94A 4KFCA 2EFOA 5E1XA 1VFCA 3JAMK 3E5UA 3HTUA 1AKHB 3IWZA 4AM3A 3WODF 3L2VA 4MHGA 1B9MA 3LNQA 3RQ4A 2GM4A 2B0LA 3S3NA 1LUJB 5ICGA 2M0CA 2D2WA 2LKSA 3U21A 5F0CA 2BE5F 3P7NA 3HOXJ 3V7CA 4V19K 3PJRA 3RCOA 1UCRA 4MLOA 3B6CA 4LK0F 4IQJA 3S15J 1ETKA 1S29A 3BT9A 2HPIA 3QYFA 3CJNA 1ZELA 3TMOA 2M9HA 4Y7NJ 3HYIA 2P7VB 2ISZA 1W36D 1JJ6C 2FJ1A 3ABUA 5HNHA 4F93B 1KU9A 2BW3A 2LBFA 1HDPA 3H0GJ 2VB6A 2CV1A 3LSMA 2IAIA 1I3AA 4GGGA 2FX0A 3BP8A 1MW7A 3SEQA 1LDKB 2IGOA 3QRFF 1GDTA 1FOWA 4MIMA 4XKCA 5B1BH 4KITB 5BOXA 1FX7A 3O8GA 5L3EA 4HF2A 5L3DA 2IA2A 3VWBA 2FNPA 3IWFA 3PFYA 2W1OA 2HOAA 1SD5A 2IGNA 1D0ZA 1IRXA 2RKHA 3IH4A 2XAGA 3HOWJ 1MMSA 1UB9A 1VTNC 2DXIA 1KONA 5L3GA 1BM9A 5H6RA 3MKLA 5EGOA 4MGRA 1HSTA 4ZTFA 2DA3A 4IHXA 2DPUA 5D6EA 3JRIA 1P4XA 2E1CA 4IPAA 4NQWA 4FQGA 3J81Z 4WF2A 4Y13A 3MFKA 3HGYA 2Y69H 3G71I 2NVQJ 4L9TA 2IEKA 4AUXA 5HNFA 2LY2A 5IYCJ 3RYPA 2ME6A 1Z1DA 2XIGA 1W5TA 2KJBA 4E7SA 4DJAA 4IO9F 3AFHA 1F36A 3FXJA 4RM2A 4XM3A 3ABMH 3M9AA 3H3UA 4LOCA 2PJRA 4EATA 5GTIC 5CYVA 3U9GA 2W84A 5K7HA 3E6CC 1W4MA 2K9SA 3OS1A 1KYWA 4U0YA 2Y0SA 2V6CA 2GZWA 1BR1A 1ETYA 2F48A 2LBFB 2BY1A 1EV7A 1LB2A 3F8NA 4YIIA 4G12A 4A3JJ 1C0WA 2QF7A 4Y3OA 4EJUA 3W6JB 5L3CA 3H9QA 3H36A 4LIUA 2VC0A 5FO5A 2I8DA 1MBGA 1U8BA 3H5AA 2JA5J 1Y8RB 2MGQA 3VEPA 1JTYA 1MJ9A 2Y75A 3I56I 3Q0WA 2H1KA 5M3MJ 2HYFA 2PQ8A 4WXCA 2QSFX 2Y48A 4A3GJ 5HS7A 3A2KA 1WH7A 4HG2A 3HHGA 1EJ9A 1XN7A 1X2MA 3D0SA 3TQNA 2ADUA 1APLC 1ZG1A 4G6DA 3KLOA 4X6AJ 1KQ0A 3HUGA 1IC8A 2YU9J 2DA2A 2EBIA 2A6TA 1W0TA 4NQWB 4XRSA 1IRZA 3DPLC 1TNSA 3E6BA 3AAFA 2K3PA 2OAZA 5K7ZA 2EV0A 4AYBA 3GTGJ 4G8XA 5KAIC 3WTWC 1J2XA 3ERMA 1H8AC 2GXAA 2PJRB 2P5VA 2DA1A 2LP0A 2FF4A 2NS8A 4UV9A 3HB9A 2VI6A 4E7ZA 4ESJA 1J0RA 1XSDA 3ZQLA 3I3LA 3GTMJ 2LD5A 1YX5A 3CUOA 3DTIA 5D5VB 3UR3C 1VQ4I 1RETA 2W7NA 4C3JJ 3GCMA 3SEZA 2MD0A 4IHSA 3O8HA 5D5XB 2CUEA 3K1NA 2O3FA 2ZC2A 3K7AJ 1K61A 1LKXA 4V2FA 2CQ7A 5F0HA 1VQ5I 4UHTA 5LFAA 3WU2C 4ENNA 3I4MJ 4Y15A 4Y17A 1O3RA 2G7UA 4P9UA 1U6GA 2NS0A 4BQQA 2LY1A 2QLZA 1IXSB 1X2NA 2XAFA 2XUBA 1TQMA 4BDZA 2K02A 1X19A 5KAFC 3OL4A 4A3MJ 2RNJA 4O3MA 4D9JA 3CD6I 1UJ8A 2VE8A 1RRJA 1XB4A 2H8WA 4GDFA 3JR9A 3J81K 1Y39A 1MJAA 3C2HA 4KDPA 3F3XA 2Y2ZA 2NVYJ 3BPXA 5F04A 3ZGKA 1T2KA 4BBSJ 3B6AA 3HUGB 1ZHFA 5B66C 2IT0A 2PX9A 2DAOA 2WAFA 2NXNB 3G1MA 4N4OB 1H9GA 3HBLA 3JRBA 5K5QA 1DPRA 4XSXF 2CU7A 4RM3A 4IQ4A 4BHPA 2CQKA 2HR3A 3C3WA 1Y0UA 3DV8A 4UVCA 4KMFA 3ZQIA 2IS1A 4LIVA 1I39A 4W1UA 3FM5A 2D45A 3MZHA 2Z16A 4I6ZA 1MD0A 2CYYA 2KIUA 3WHBA 1VQ7I 3BTCA 5CJ9A 1LVAA 3T8RA 2E2JJ 1IG7A 3A0BC 3LA7A 1UHMA 4L5EA 3RJPA 3V7SA 3HOSA 2HTSA 2HQAA 5K5OA 5LHIA 4ITVA 4HF0A 2XPWA 4Q4ZF 3HOVJ 1MBHA 2ME0A 4E7JA 2O8KA 2F4MB 2AS5F 1PUEE 1LDDA 3ABTA 2OZ6A 3GFMA 4FTHA 1TNTA 2GOXB 2L4MA 3EUKL 2O0YA 4N0BA 4O5VA 2HEOA 4Z6YA 1Z6TA 3CZ6A 3S8PA 3SFIA 4LFUA 2L9NA 1X1BA 2GXBA 1SAUA 4KT6A 2CGPA 3J7AY 4AIJA 3HRUA 4NC8A 1ZLJA 1R22A 4PJMA 3TDZC 4HDVA 1WJ5A 3CCUI 1FJLA 4CCMA 4O6JA 1SVOA 2MC3A 1OR7C 2RQQA 2PEXA 2X6OA 3WTTC 3OY9A 5F0FA 4U7BA 2L2OA 3E6MA 1T33A 2GXGA 1S7EA 4Q47A 3KEOA 1R00A 1UFMA 3QAHA 1K4TA 5TGTA 2IPQX 3PUBA 1FYLA 1R5ID 3ZR8X 2BHZA 3GEZA 4AU7A 3MKWB 2JVHA 2L54A 1LFPA 2WA0A 3OV8A 2UWMA 2DFIA 3DPTA 2ETHA 2V7FA 3QOPA 4CCJA 1F9NA 2HQNA 2IBDA 2XPVA 1NG6A 4XR6A 4B09A 3CCSI 3FM3A 4F3QA 5DD4A 1OCPA 2MG4A 1USSA 1ON1A 2PBIA 5LEKA 3EUAA 5A2QK 2MA3A 5EEHA 4BH9A 4DBRA 2OQGA 4BE2A 4YFKF 3DKXA 3RKQA 2FA5A 2DJNA 3IRQA 2JPCA 3W6VA 4RMNA 1UELB 4C9YA 1P92A 4DNCA 1JKOC 3L2WA 5LGTA 4CDGA 1G8XA 2R7FA 5FLXZ 2M2EA 1WI9A 3PIOF 1PDNC 2F5EA 4M9SA 2FE3A 1ZLKA 2VL8A 1IRGA 2E1MB 1X3ZB 3QQAA 1Z7LA 4EM1A 4XLNF 3CCLI 1BJAA 1BI1A 4XBFA 1Z05A 2DBBA 4HV6A 2HQRA 2LKXA 2KFDA 4PZJA 2F4OB 2QSGX 3JRFA 2STTA 2XVCA 2RC4A 5LRRA 3R0AA 3LAPA 2ZXJA 4B8XA 3I71A 4PK4A 3WGGA 1VQPI 3IHUA 1P9QC 3D5LA 2DMUA 2CG4A 2EV5A 3G3ZA 1QRYA 2Z2SB 1OPCA 2QSHX 4YIFA 1OLTA 2ZXHA 3RSNA 2KIFA 5M3FJ 2P6SA 4ZYDA 3RKYA 3DBHB 1Z77A 1OCOH 3PNYA 4ENKA 1T08B 1ORKA 5ICCA 4P5OA 1KQ9A 2Z5UA 3SHFA 1WGXA 3OSFA 3Q3SA 4L9JA 2FOKA 6PAXA 4ZYAA 4OINF 2EZLA 2CFOA 4G9YA 2X1EA 3NQOA 5M5XJ 3UNGC 5KNLA 4C2TA 4IEJA 1TW3A 3DP7A 4PUSA 5LLQA 2IGMA 3FXQA 4LB6B 5IP6A 4WX9A 1ONVA 1BA5A 2TCTA 1ZR4A 3VODA 1OR7A 1USTA 2EA2A 3GF2A 3E0JB 1YS6A 2VXZA 5B3SH 1VQ9I 5CPRB 3WTSC 1QHHD 3ZPLA 1OMIA 2EJRA 1W5CC 4RB0A 3J7AO 5L3FA 1TL8A 2OZUA 1U9OA 3F8FA 4A5MA 1UMQA 1MIJA 2WB1N 1VQ6I 2JA8J 4RGSA 3EYYA 1R5HA 3HOTA 4XLFA 2CJJA 5HLHA 5HDKA 2VT2A 2EILH 4B1RA 4XORA 2H6BA 3KFWX 2E2HJ 2DN0A 3LQRA 4MFEA 4A3LJ 1TWAJ 2HI3A 3BROA 4GO1A 1Y8QB 2COBA 3CF5F 1L3LA 2DA6A 1LQ1A 3PO3J 4L9VA 1XC5A 3H5NA 5KK1A 1BN5A 3FHZA 4PFOA 4AC0A 4IHTA 5K1YA 4LK1F 1U2WA 2HVQA 1W7PA 2MC4A 5AIPA 1ZGWA 1UHSA 1FBUA 2XDVA 4RAFA 3BG5A 3FF5A 3WGHA 5IT3A 1S72I 4YG2F 2DT7B 3H35A 1D8KA 2VJJA 5JLWA 1GUUA 1BI3A 4BJ6C 3G6EI 2HS5A 2A68F 1W7PD 3BR1A 4HX4A 3IV5A 2QQBA 3JAMZ 2MABA 1WRJA 4N9IA 2JK3A 2FQ3A 1WHUA 4BXUA 1R9TJ 4XLHA 4E7LA 1P6RA 5H20A 3V8JA 2VN2A 4UXNA 2UXXA 3HL2A 4L5JA 4DQ2A 3R61A 2GIVA 1S5LC 2X6XA 3PO2J 2QGUA 2LF8A 4G7ZF 4A5NA 1IAWA 4I7HA 3S17J 2H09A 3SZPA 2ID6A 4BS9A 1XGSA 3TP3A 1S8NA 1AHDP 3G1OA 5CVIA 3FHNA 2X1CA 4FE7A 5LGUA 3HSEA 3MZ8A 2K4BA 3CTAA 1N77A 5DTDA 2Q1ZB 4B3AA 3BG3A 5FFZA 2OCEA 1G3TA 4PJLA 4ZH4F 3ZN0A 4OIQF 2X9DA 2V9KA 2D1VA 2GIZA 4ABZA 4L9NA 1XD7A 1Z7UA 2HFHA 4I2OA 3JCUC 4ZDPA 1O3SA 3GFJA 1JKPC 3IUOA 4KMUX 2XRNA 1VQ8I 1LEAA 1JTXA 2WAEA 3BR2A 1W7PB 5LBQA 2KRCA 2MH9A 2GOMA 1MBJA 2CUZA 4N9HA 4XLCA 4EEFG 1VQOI 1W36C 2VKVA 5CVJA 3J80K 3CDHA 3KIOA 1E2XA 1IUYA
chains in the Genus database with same CATH topology
3B73A 3KZYA 1V3FA 3RDIA 3LSTA 2LKPA 3LQQA 4UUVA 3FMSA 2DTRA 1SMTA 1GVJA 5DCFA 4HX8A 3COAC 1FP1D 4ZZLA 3HSFA 2WV0A 5DUIA 5E1ZB 3GFLA 3P9KA 3C7JA 3VFZA 4CXFA 2A07F 1QO0D 1WWXA 1FNNA 1O3QA 2FU4A 3WTVC 2DU9A 5BPIA 4JQFA 1XDSA 1JE8A 5CLSA 1XGMA 1FYKA 3GO5A 2MH2A 2P6TA 4ON0A 2IJLA 1B1BA 5D8LB 1H0MA 3FWEA 4LLNA 2HZTA 1Z9CA 2ZFWA 2YU3A 3MWMA 5KVRA 4RB3C 1R5GA 4CHUA 1J75A 3R0JA 2M8EA 4OMYA 4TV7A 4WXDA 2P7CB 5HLIA 1DP7P 2WC2A 3IKTA 2BYVE 2XROA 1YLFA 2O8XA 1TLHB 5AONA 3RPQA 1RI7A 4IRIA 1S7AA 3BJ6A 3ML6A 5E8IA 2H6CA 2LF7A 2J5OA 4IJAA 2GAUA 2ZNZA 4ZYHA 3Q9SA 3WTUC 2W85A 2E7WA 2JTVA 2K27A 1ZG3A 5DYMA 1SMYF 3RKXA 2HGCA 5F6FA 2Z33A 1E17A 2KJCA 3V4GA 4OIRF 4A0XA 4E70A 3H3ZA 1IZ1A 4I02A 1FSHA 5D5WB 1FBSA 4JBAA 3N97A 2F5FA 2F2EA 2XAHA 1KQ8A 2Q2EA 3TOAA 1O57A 1SFUA 1ZARA 3DKWA 2OA4A 3GZ6A 2VOOA 1TQIA 3F23A 1IN5A 3I59A 2L3DA 2K7LA 4Z2YA 4OIOF 3E6DA 3LA2A 4KUMA 5AIQA 1OKRA 1SFEA 2YSRA 5J8FA 2FSWA 5ED4A 1ZGJA 3P9CA 1MJBA 2DI3A 4MEYF 3OOPA 5CVUA 2V1DA 4BQAA 3KCCA 1Z91A 1YFHA 3P9IA 5EEGA 3PQKA 2EB7A 2ELHA 4UVAA 2ESHA 4HOBA 1ZGAA 1JHFA 2Z99A 4MQ9F 1S7OA 3ZN1A 2J5PA 2V1UA 3MZYA 4HAMA 1G3YA 2M87A 5ILVA 2KKOA 1FC3A 1YG2A 2FBIA 1SD4A 4F7ZA 3S2WA 3I59B 5DUKA 4EVIA 2V79A 4A0YA 1HBXG 4LB5A 2JRTA 4CGZA 2R3SA 1HQCA 2P5KA 3LA3A 4A6DA 2DQLA 2FXAA 3L00A 5LHHA 5A2QZ 1ZAOA 1HXDA 3HIFA 1GXPA 4ENJA 2YX7A 1T38A 1I5ZA 4EGYA 1RUNA 3ULQB 3K2ZA 3KP7A 4M9ZA 1XSVA 3ZMZA 5LGNA 4FX4A 2M45A 2DLLA 2EA4A 1YTYA 3ZP5A 2MBFA 1YIOA 4A2UA 2ISYA 4EJWA 4P55A 2LDUA 4ETSA 5HDGA 2FMYA 2P4WA 4P96A 1R58A 3QPTA 3KLNA 2QUFA 4L18B 3GLXA 1BOAA 1O7FA 2HKOA 3I58A 2P8TA 2X4HA 3I53A 1LEBA 1P2FA 2QENA 1TBXA 1KGSA 3ZMUA 2K86A 3E5XA 4MQVA 1PP7U 4HQMA 1XSXA 1R1TA 1XCBA 3NRVA 1YO5C 3B02A 2L4AA 2IA1A 4MTEA 4MNUA 2OU2A 1LNWA 1B4AA 1MDMA 1XMAA 2ZKZA 5LRSA 4G7OF 3KZZA 4Q48A 3F8MA 4KN4X 1FZPB 4BHBA 2VC1A 4KIGA 3WTXC 3BWGA 3NEUA 3EDPA 2NRAC 2UZKA 2TDXA 2DO7A 3RKWA 3EYIA 1HKTA 3ECHA 2ZCWA 4I98B 2A6HF 1KA8A 4IXAA 3IRRA 4I01A 1HKSA 4KN7X 4CICA 1FT9A 3FMQA 2QVOA 2VE9A 5E20A 2VBWA 2QM3A 1G6NA 4ASNA 1FOKA 2FMLA 2NAZA 2HOEA 3BJOA 2QBYA 2BEOA 2ZBKA 2VBXA 3CO6C 1T6SA 5FD5A 1TTYA 1SD7A 2VONA 2BBYA 4M71A 5ILUA 2CO5A 1T0FA 4HLYA 1BBYA 4HV5A 1QQIA 4AWXB 3BOQA 2RN7A 3J80Z 3T1BA 1R1VA 2VT3A 4OMZA 1O3TA 1O7LA 3GW2A 4ZYEA 5JVTA 3SZTA 2D1HA 1R7JA 2HWVA 4ESBA 3M1EA 1P4WA 3ZQ7A 1U8RA 4OU0A 2QBYB 4A0ZA 4IRHA 1F4KA 1B59A 4M72A 3WE3A 1RUOA 1FY7A 1ZRFA 4HX7A 2OBPA 1DUXC 2Z9OA 4LLLA 5FFXA 1XMKA 5BS6A 1MKMA 5K5RA 5D4SA 2KRFA 4BYYA 4M6XA 1SD6A 3HRSA 4YFXF 1RIOH 2PI0A 2XKOA 2DT5A 4ZYGA 2CWEA 1BIBA 3M8EA 1KU3A 1FWZA 2NNYA 4XSZF 3I5UA 3F21A 5F64A 2IW5A 3JSPA 3F6OA 2Q0OA 3KEQA 1U78A 1ZYRF 2M5WA 3F6VA 4S04A 2W24A 2DQRA 2STWA 5HLGA 5D5UB 2GA2A 5FGMA 3QPHA 3ISPA 5ERIA 3K1MA 2FEZA 1J5YA 2XV4S 1G3WA 4EQQA 3CO7C 3I54A 2XAJA 4YFNF 1YYVA 1A04A 4EJVA 4GCVA 1BC8C 1JHHA 5IT9K 4QLCU 1EH8A 4IRGA 3TOBA 1QNTA 1ZRCA 1ZH5A 4L5IA 2WTEA 4A12A 3L09A 1FBQA 3L2CA 4EMSA 4G6QA 1LJ9A 2K4JA 3K69A 5BQTA 3BDDA 2V1XA 3I64A 4A6EA 5TRDA 4RAYA 4EJTA 1G3SA 3I4PA 4HZFA 3IKVA 1H9TA 4EM0B 5ILSA 3U2RA 1EH6A 2EWNA 3FXRA 1Z6RA 4U88A 1SFXA 3TKYA 4CYDA 2PN6A 4I0BA 3EUHA 3QP5A 4JK1X 2ZMEA 2BGCA 3DFGA 4AIHA 1QBJA 2PJPA 2NNNA 2O6GE 5CVVA 4LGWA 1DDNA 3F8CA 4AVPA 1IXRC 3KP5A 5DV5A 3TO9A 1RNLA 4ENMA 5F1RA 1IN6A 1ON2A 2HYGD 3MAJA 2WWYA 1REPC 2FBHA 4P9FA 4MTDA 2DK5A 2M30A 2JZYA 2A6EF 4CO8A 2PMHA 1J9IA 2CSOA 2XAQA 2EK5A 2BV6A 2MD5A 1QZZA 4RGXA 4RGRA 2G9WA 1IF1A 2G7HA 3HSRA 3SQNA 1WQ2A 1ZRDA 2R7DA 3BZ6A 3V8LA 3IC7A 3WU1B 3MQ0A 2ZMEB 2RDPA 3SFZA 1OYWA 3CLOA 3REOA 4EV0A 2W57A 3M7GA 1AOYA 2ZJ2A 3CUQC 2EFPA 4BHCA 1U3EM 2XASA 2O03A 4WCGA 1D5VA 5DD8A 3KE2A 3GUDA 2IP2A 2QZ8A 3ZMVA 1HW1A 2MLGA 5DEQA 4S05A 3G73A 4CZZA 4Q5SF 4HLXA 4ZZDA 2UXNA 2IA0A 4PDKA 1AWCA 2V9VA 4KIBA 2L01A 1IN8A 3QU6A 3JW4A 2ESNA 5E18F 4HW0A 3Q5FA 1S6LA 1GXQA 5D8KB 5JFRA 3FXUA 4WK8F 1R36A 1BI0A 2A5YB 2A69F 3LFKA 2VBZA 2VOPA 4UVBA 3QP6A 2COMA 4U7DA 3L9FA 3KP4A 3RIRA 2ACJA 4L0YB 3JTHA 2NYXA 2QYOA 4FT8A 3C1DA 2YX4A 3RYRA 1I1SA 4KICA 2AXLA 4AIKA 2A61A 3I0TA 1TQPA 3R4KA 1T98A 1RZ4A 1YW9A 5L3BA 3CUQA 1X3UA 2RQPA 4LLGF 5HS9A 1D3YA 1WKMA 1R23A 3GXOA 3M8FA 1R1UA 4RB1A 2XKPA 1HSJA 3O2PE 4RS8A 5HOOA 3BY6A 4L0ZB 3K1PA 1STZA 4UNOA 5DDGA 1YQAA 2QWWA 3E3VA 3FX3A 2A3SA 3U1DA 4KA4A 1UHWA 1XDUA 3BJAA 3GX4X 1IW7F 2O61A 3HTSB 1MGTA 3KETA 1IN7A 2E1NA 3DEUA 5LHGA 4KIFA 3GZ5A 1B9NA 1KU7A 1JGSA 3CUQB 3WE2A 4QWQA 4G94A 2MLKA 1J59A 1D8JA 3TGNA 3LWFA 2L02A 2VBYA 1FYMA 3T8TA 1K78A 4U0WA 5JI6A 5H6QA 4ESFA 3TDUC 4I0AA 4R8HA 3E97A 2JSCA 1PP8F 3V8KA 3TO6A 1FLIA 2HKXA 4KT5C 3WG9A 1ZG5A 2PLYA 2XHKA 2DW4A 2PMUA 5HDNA 2DPDA 4R79A 5J6XA 1T39A 2H27A 1EH7A 3ZMSA 3ELKA 5BMZA 5CVRA 3ZMDA 1NHAA 3O3KA 3WU0A 1I1GA 3K0LA 1MZBA 2VODA 2Z3YA 1FP2A 4NB5A 4M6YA 4HBLA 3TO7A 3MEXA 1ZREA 3N4MA 4FHTA 3JSOA 2E7XA 4XRFA 1K78B 3EQLF 3VOEA 4NHJA 3WTYC 5JHUA 1V4RA 2Q8KA 3PFIA 5E1WA 3FZVA 1YS7A 4OIPF 4EGZA 2ZNYA 4UV8A 1L0OC 3RTRA 3HHHA 4PGHA 1J7KA 4RAZA 4RB2C 1MDMB 5JR3A 4LJZF 4LG0A 3DF8A 5IT9Z 3E5QA 4MEXF 4PCQA 4BNCA 1BIAA 1BC7C 1QGPA 5J8CA 1CF7A 4KYWA 1IN4A 1GHCA 5FD6A 2JT1A 3RI4A 4HF1A 1JXSA 4IF4A 4M73A 1KYZA 3GYHX 1U5TC 2EV6A 1WSUA 3PQJA 1CGPA 2OD5A 2OQRA 3QU3A 1Q1HA 1IRFA 4HYEA 3R6SA 4FX0A 3MCZA 3RPUA 2LSOA 2GA1A 3GWZA 1W5SA 3HRMA 2F5CA 1ZN2A 3R60A 2DK8A 2RGVA 4G7HF 2W25A 3JTGA 2YR2A 5HS8A 1FPQA 4LG0B 1QZYA 2Y0MA 2RV8A 2FRHA 5LEJA 2RVCA 2P5LC 4M9XA 3ECOA 1LDJA 4GYIA 1CF7B 3LAJA 3F8BA 3K9TA 1TW2A 1QPMA 2HDCA 3L7WA 3W6KB 4R1HA 3T5XA 2ZO4A 3C18A 2X0LA 1HW2A 4GXOA 4AD9A 3O6BB 2JPBA 5DCMA 1K6OA 4HA8A 2QQ9A 1I6XA 4OOIA 2IVMA 1YW8A 4WWCA 2PG4A 4HQEA 2F5DA 2EFQA 4PGGA 3IL2A 2YPRA 3GVAA 1U5TA 1ULYA 2GQQA 5TJJA 1BI2A 1ODDA 4XLPF 3ERED 1XCVA 3DQVC 4EM2A 2HTJA 2FBKA 2LNBA 5FLXK 3DXJF 4BAYA 3WGIA 2EFWA 3HRTA 5E17F 3Q9VA 1XGOA 4M74A 1K79A 3KP3A 1FSEA 4K2EA 4U0VA 5ICFA 1HW5A 1OYYA 1HKQA 3ROUA 3GFIA 4HDUA 1F5TA 2M1BA 1I27A 3F72A 3VB2A 3EETA 2C6YA 4EJOA 1DPUA 2CFXA 5DCMB 5ICEA 4WXHA 3WTZA 2PFBA 1YW7A 4RGUA 1S3JA 1F1ZA 1IXCA 5D6FA 3KP6A 2QQAA 5FB2A 1P4AA 2GWRA 1U5TB 5E8GA 3KP2A 1OYIA 1K7AA 4H0EA 1KU2A 4KNYA 1XGNA 3V7RA 5BPDA 3BPVA 3F22A 2FNAA 3ZMTA 4GYGA 3FMRA 2XGXA 1SAXA 1B6AA 2IRFG 2KIMA 4LMYA 5D4RA 1G4DA 4IVNA 4LD5A 2CW0F 5HVQC 4I09A 2EFNA 4D0PA 3H92A 3T0YA 3SXYA 2H94A 4KFCA 2EFOA 5E1XA 3JAMK 3E5UA 3HTUA 3IWZA 3WODF 4MHGA 1B9MA 2B0LA 5ICGA 2D2WA 2BE5F 3P7NA 3V7CA 1UCRA 4LK0F 1S29A 3CJNA 3HYIA 2P7VB 2ISZA 3ABUA 1KU9A 4GGGA 3BP8A 1LDKB 3QRFF 5BOXA 1FX7A 5L3EA 4HF2A 5L3DA 2IA2A 2FNPA 3IWFA 1SD5A 2RKHA 2XAGA 1UB9A 1VTNC 5L3GA 1BM9A 5H6RA 4MGRA 1HSTA 2DPUA 5D6EA 2E1CA 1P4XA 4IPAA 4NQWA 3J81Z 4WF2A 4Y13A 3MFKA 4L9TA 3RYPA 1Z1DA 2XIGA 1W5TA 2KJBA 3M9AA 3H3UA 5CYVA 3U9GA 2W84A 3E6CC 1W4MA 1KYWA 4U0YA 2V6CA 2GZWA 1EV7A 1LB2A 3F8NA 4YIIA 1C0WA 4EJUA 3W6JB 5L3CA 2VC0A 5FO5A 3VEPA 1MJ9A 2Y75A 2HYFA 2PQ8A 4WXCA 2Y48A 5HS7A 3HHGA 1XN7A 3D0SA 3TQNA 2ADUA 1ZG1A 4G6DA 3KLOA 1KQ0A 3HUGA 3DPLC 1TNSA 3E6BA 3AAFA 2OAZA 2EV0A 4G8XA 3WTWC 1J2XA 2P5VA 4UV9A 2FF4A 4ESJA 1J0RA 1XSDA 3CUOA 5D5VB 4IHSA 5D5XB 3K1NA 2O3FA 4UHTA 4ENNA 4Y15A 4Y17A 1O3RA 2G7UA 4P9UA 1U6GA 2NS0A 2QLZA 1IXSB 2XAFA 2XUBA 1TQMA 2K02A 2RNJA 4O3MA 2VE8A 1XB4A 3J81K 1MJAA 4KDPA 3F3XA 3BPXA 1T2KA 1ZHFA 2IT0A 2DAOA 1H9GA 5K5QA 1DPRA 4XSXF 4BHPA 2CQKA 2HR3A 3C3WA 1Y0UA 3DV8A 4UVCA 4KMFA 3FM5A 2D45A 3MZHA 1MD0A 2CYYA 2KIUA 5CJ9A 1LVAA 3T8RA 3RJPA 3LA7A 1UHMA 3HOSA 3V7SA 2HTSA 5K5OA 5LHIA 4Q4ZF 4HF0A 2AS5F 1PUEE 1LDDA 3ABTA 2OZ6A 3GFMA 1TNTA 2L4MA 4N0BA 4O5VA 2O0YA 2HEOA 1Z6TA 4LFUA 2GXBA 2CGPA 4AIJA 3HRUA 1ZLJA 1R22A 3TDZC 4HDVA 4O6JA 2MC3A 2PEXA 3WTTC 4U7BA 3E6MA 2GXGA 4Q47A 3KEOA 1R00A 1UFMA 3QAHA 2IPQX 1FYLA 3GEZA 2L54A 3OV8A 2UWMA 2DFIA 3DPTA 2ETHA 3QOPA 1F9NA 2HQNA 4B09A 3FM3A 5DD4A 5A2QK 5LEKA 1USSA 1ON1A 2PBIA 2MA3A 5EEHA 4BH9A 2OQGA 4YFKF 2FA5A 3IRQA 2JPCA 1P92A 4DNCA 5LGTA 4CDGA 5FLXZ 2R7FA 1WI9A 1PDNC 2F5EA 4M9SA 2FE3A 1ZLKA 1IRGA 4EM1A 4XLNF 4XBFA 1BJAA 1BI1A 1Z05A 2DBBA 4HV6A 2HQRA 4PZJA 2STTA 2XVCA 2RC4A 5LRRA 3R0AA 3LAPA 2ZXJA 4B8XA 3I71A 3WGGA 3IHUA 3D5LA 2EV5A 2CG4A 3G3ZA 1OPCA 4YIFA 2KIFA 2P6SA 4ZYDA 3RKYA 4ENKA 5ICCA 4P5OA 1KQ9A 2Z5UA 3SHFA 4L9JA 2FOKA 6PAXA 4OINF 4G9YA 3NQOA 1TW3A 3DP7A 5LLQA 3FXQA 4LB6B 4WX9A 1ONVA 3VODA 1OR7A 1USTA 2EA2A 3GF2A 1YS6A 2VXZA 3WTSC 3ZPLA 1OMIA 2EJRA 4RB0A 3J7AO 5L3FA 2OZUA 3F8FA 4A5MA 4RGSA 3EYYA 1R5HA 3HOTA 5HLHA 5HDKA 2VT2A 2H6BA 3KFWX 3LQRA 3BROA 4GO1A 1L3LA 1LQ1A 4L9VA 5KK1A 1BN5A 3FHZA 4IHTA 5K1YA 4LK1F 1U2WA 1W7PA 5AIPA 1FBUA 3FF5A 3WGHA 5IT3A 4YG2F 1D8KA 1BI3A 2HS5A 2A68F 1W7PD 4HX4A 2QQBA 3JAMZ 1WRJA 4N9IA 2FQ3A 4BXUA 1P6RA 5H20A 3V8JA 2VN2A 4UXNA 2UXXA 4L5JA 4DQ2A 3R61A 2GIVA 2LF8A 4G7ZF 4A5NA 1IAWA 4I7HA 2H09A 3SZPA 1XGSA 1S8NA 5CVIA 5LGUA 3HSEA 2K4BA 3CTAA 5FFZA 1G3TA 4ZH4F 3ZN0A 4OIQF 2D1VA 4L9NA 1XD7A 1Z7UA 2HFHA 4I2OA 1O3SA 3GFJA 4KMUX 2XRNA 1LEAA 1W7PB 5LBQA 2MH9A 4N9HA 5CVJA 3J80K 3CDHA 1E2XA 1IUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B73 A;  3KZY A;  1V3F A;  3RDI A;  3LST A;  2LKP A;  3LQQ A;  4UUV A;  3FMS A;  2DTR A;  1SMT A;  1GVJ A;  5DCF A;  4HX8 A;  3COA C;  1FP1 D;  4ZZL A;  3HSF A;  2WV0 A;  5DUI A;  5E1Z B;  3GFL A;  3P9K A;  3C7J A;  3VFZ A;  4CXF A;  2A07 F;  1QO0 D;  1WWX A;  1FNN A;  1O3Q A;  2FU4 A;  3WTV C;  2DU9 A;  5BPI A;  4JQF A;  1XDS A;  1JE8 A;  5CLS A;  1XGM A;  1FYK A;  3GO5 A;  2MH2 A;  2P6T A;  4ON0 A;  2IJL A;  1B1B A;  5D8L B;  1H0M A;  3FWE A;  4LLN A;  2HZT A;  1Z9C A;  2ZFW A;  2YU3 A;  3MWM A;  5KVR A;  4RB3 C;  1R5G A;  4CHU A;  1J75 A;  3R0J A;  2M8E A;  4OMY A;  4TV7 A;  4WXD A;  2P7C B;  5HLI A;  1DP7 P;  2WC2 A;  3IKT A;  2BYV E;  2XRO A;  1YLF A;  2O8X A;  1TLH B;  5AON A;  3RPQ A;  1RI7 A;  4IRI A;  1S7A A;  3BJ6 A;  3ML6 A;  5E8I A;  2H6C A;  2LF7 A;  2J5O A;  4IJA A;  2GAU A;  2ZNZ A;  4ZYH A;  3Q9S A;  3WTU C;  2W85 A;  2E7W A;  2JTV A;  2K27 A;  1ZG3 A;  5DYM A;  1SMY F;  3RKX A;  2HGC A;  5F6F A;  2Z33 A;  1E17 A;  2KJC A;  3V4G A;  4OIR F;  4A0X A;  4E70 A;  3H3Z A;  1IZ1 A;  4I02 A;  1FSH A;  5D5W B;  1FBS A;  4JBA A;  3N97 A;  2F5F A;  2F2E A;  2XAH A;  1KQ8 A;  2Q2E A;  3TOA A;  1O57 A;  1SFU A;  1ZAR A;  3DKW A;  2OA4 A;  3GZ6 A;  2VOO A;  1TQI A;  3F23 A;  1IN5 A;  3I59 A;  2L3D A;  2K7L A;  4Z2Y A;  4OIO F;  3E6D A;  3LA2 A;  4KUM A;  5AIQ A;  1OKR A;  1SFE A;  2YSR A;  5J8F A;  2FSW A;  5ED4 A;  1ZGJ A;  3P9C A;  1MJB A;  2DI3 A;  4MEY F;  3OOP A;  5CVU A;  2V1D A;  4BQA A;  3KCC A;  1Z91 A;  1YFH A;  3P9I A;  5EEG A;  3PQK A;  2EB7 A;  2ELH A;  4UVA A;  2ESH A;  4HOB A;  1ZGA A;  1JHF A;  2Z99 A;  4MQ9 F;  1S7O A;  3ZN1 A;  2J5P A;  2V1U A;  3MZY A;  4HAM A;  1G3Y A;  2M87 A;  5ILV A;  2KKO A;  1FC3 A;  1YG2 A;  2FBI A;  1SD4 A;  4F7Z A;  3S2W A;  3I59 B;  5DUK A;  4EVI A;  2V79 A;  4A0Y A;  1HBX G;  4LB5 A;  2JRT A;  4CGZ A;  2R3S A;  1HQC A;  2P5K A;  3LA3 A;  4A6D A;  2DQL A;  2FXA A;  3L00 A;  5LHH A;  5A2Q Z;  1ZAO A;  1HXD A;  3HIF A;  1GXP A;  4ENJ A;  2YX7 A;  1T38 A;  1I5Z A;  4EGY A;  1RUN A;  3ULQ B;  3K2Z A;  3KP7 A;  4M9Z A;  1XSV A;  3ZMZ A;  5LGN A;  4FX4 A;  2M45 A;  2DLL A;  2EA4 A;  1YTY A;  3ZP5 A;  2MBF A;  1YIO A;  4A2U A;  2ISY A;  4EJW A;  4P55 A;  2LDU A;  4ETS A;  5HDG A;  2FMY A;  2P4W A;  4P96 A;  1R58 A;  3QPT A;  3KLN A;  2QUF A;  4L18 B;  3GLX A;  1BOA A;  1O7F A;  2HKO A;  3I58 A;  2P8T A;  2X4H A;  3I53 A;  1LEB A;  1P2F A;  2QEN A;  1TBX A;  1KGS A;  3ZMU A;  2K86 A;  3E5X A;  4MQV A;  1PP7 U;  4HQM A;  1XSX A;  1R1T A;  1XCB A;  3NRV A;  1YO5 C;  3B02 A;  2L4A A;  2IA1 A;  4MTE A;  4MNU A;  2OU2 A;  1LNW A;  1B4A A;  1MDM A;  1XMA A;  2ZKZ A;  5LRS A;  4G7O F;  3KZZ A;  4Q48 A;  3F8M A;  4KN4 X;  1FZP B;  4BHB A;  2VC1 A;  4KIG A;  3WTX C;  3BWG A;  3NEU A;  3EDP A;  2NRA C;  2UZK A;  2TDX A;  2DO7 A;  3RKW A;  3EYI A;  1HKT A;  3ECH A;  2ZCW A;  4I98 B;  2A6H F;  1KA8 A;  4IXA A;  3IRR A;  4I01 A;  1HKS A;  4KN7 X;  4CIC A;  1FT9 A;  3FMQ A;  2QVO A;  2VE9 A;  5E20 A;  2VBW A;  2QM3 A;  1G6N A;  4ASN A;  1FOK A;  2FML A;  2NAZ A;  2HOE A;  3BJO A;  2QBY A;  2BEO A;  2ZBK A;  2VBX A;  3CO6 C;  1T6S A;  5FD5 A;  1TTY A;  1SD7 A;  2VON A;  2BBY A;  4M71 A;  5ILU A;  2CO5 A;  1T0F A;  4HLY A;  1BBY A;  4HV5 A;  1QQI A;  4AWX B;  3BOQ A;  2RN7 A;  3J80 Z;  3T1B A;  1R1V A;  2VT3 A;  4OMZ A;  1O3T A;  1O7L A;  3GW2 A;  4ZYE A;  5JVT A;  3SZT A;  2D1H A;  1R7J A;  2HWV A;  4ESB A;  3M1E A;  1P4W A;  3ZQ7 A;  1U8R A;  4OU0 A;  2QBY B;  4A0Z A;  4IRH A;  1F4K A;  1B59 A;  4M72 A;  3WE3 A;  1RUO A;  1FY7 A;  1ZRF A;  4HX7 A;  2OBP A;  1DUX C;  2Z9O A;  4LLL A;  5FFX A;  1XMK A;  5BS6 A;  1MKM A;  5K5R A;  5D4S A;  2KRF A;  4BYY A;  4M6X A;  1SD6 A;  3HRS A;  4YFX F;  1RIO H;  2PI0 A;  2XKO A;  2DT5 A;  4ZYG A;  2CWE A;  1BIB A;  3M8E A;  1KU3 A;  1FWZ A;  2NNY A;  4XSZ F;  3I5U A;  3F21 A;  5F64 A;  2IW5 A;  3JSP A;  3F6O A;  2Q0O A;  3KEQ A;  1U78 A;  1ZYR F;  2M5W A;  3F6V A;  4S04 A;  2W24 A;  2DQR A;  2STW A;  5HLG A;  5D5U B;  2GA2 A;  5FGM A;  3QPH A;  3ISP A;  5ERI A;  3K1M A;  2FEZ A;  1J5Y A;  2XV4 S;  1G3W A;  4EQQ A;  3CO7 C;  3I54 A;  2XAJ A;  4YFN F;  1YYV A;  1A04 A;  4EJV A;  4GCV A;  1BC8 C;  1JHH A;  5IT9 K;  4QLC U;  1EH8 A;  4IRG A;  3TOB A;  1QNT A;  1ZRC A;  1ZH5 A;  4L5I A;  2WTE A;  4A12 A;  3L09 A;  1FBQ A;  3L2C A;  4EMS A;  4G6Q A;  1LJ9 A;  2K4J A;  3K69 A;  5BQT A;  3BDD A;  2V1X A;  3I64 A;  4A6E A;  5TRD A;  4RAY A;  4EJT A;  1G3S A;  3I4P A;  4HZF A;  3IKV A;  1H9T A;  4EM0 B;  5ILS A;  3U2R A;  1EH6 A;  2EWN A;  3FXR A;  1Z6R A;  4U88 A;  1SFX A;  3TKY A;  4CYD A;  2PN6 A;  4I0B A;  3EUH A;  3QP5 A;  4JK1 X;  2ZME A;  2BGC A;  3DFG A;  4AIH A;  1QBJ A;  2PJP A;  2NNN A;  2O6G E;  5CVV A;  4LGW A;  1DDN A;  3F8C A;  4AVP A;  1IXR C;  3KP5 A;  5DV5 A;  3TO9 A;  1RNL A;  4ENM A;  5F1R A;  1IN6 A;  1ON2 A;  2HYG D;  3MAJ A;  2WWY A;  1REP C;  2FBH A;  4P9F A;  4MTD A;  2DK5 A;  2M30 A;  2JZY A;  2A6E F;  4CO8 A;  2PMH A;  1J9I A;  2CSO A;  2XAQ A;  2EK5 A;  2BV6 A;  2MD5 A;  1QZZ A;  4RGX A;  4RGR A;  2G9W A;  1IF1 A;  2G7H A;  3HSR A;  3SQN A;  1WQ2 A;  1ZRD A;  2R7D A;  3BZ6 A;  3V8L A;  3IC7 A;  3WU1 B;  3MQ0 A;  2ZME B;  2RDP A;  3SFZ A;  1OYW A;  3CLO A;  3REO A;  4EV0 A;  2W57 A;  3M7G A;  1AOY A;  2ZJ2 A;  3CUQ C;  2EFP A;  4BHC A;  1U3E M;  2XAS A;  2O03 A;  4WCG A;  1D5V A;  5DD8 A;  3KE2 A;  3GUD A;  2IP2 A;  2QZ8 A;  3ZMV A;  1HW1 A;  2MLG A;  5DEQ A;  4S05 A;  3G73 A;  4CZZ A;  4Q5S F;  4HLX A;  4ZZD A;  2UXN A;  2IA0 A;  4PDK A;  1AWC A;  2V9V A;  4KIB A;  2L01 A;  1IN8 A;  3QU6 A;  3JW4 A;  2ESN A;  5E18 F;  4HW0 A;  3Q5F A;  1S6L A;  1GXQ A;  5D8K B;  5JFR A;  3FXU A;  4WK8 F;  1R36 A;  1BI0 A;  2A5Y B;  2A69 F;  3LFK A;  2VBZ A;  2VOP A;  4UVB A;  3QP6 A;  2COM A;  4U7D A;  3L9F A;  3KP4 A;  3RIR A;  2ACJ A;  4L0Y B;  3JTH A;  2NYX A;  2QYO A;  4FT8 A;  3C1D A;  2YX4 A;  3RYR A;  1I1S A;  4KIC A;  2AXL A;  4AIK A;  2A61 A;  3I0T A;  1TQP A;  3R4K A;  1T98 A;  1RZ4 A;  1YW9 A;  5L3B A;  3CUQ A;  1X3U A;  2RQP A;  4LLG F;  5HS9 A;  1D3Y A;  1WKM A;  1R23 A;  3GXO A;  3M8F A;  1R1U A;  4RB1 A;  2XKP A;  1HSJ A;  3O2P E;  4RS8 A;  5HOO A;  3BY6 A;  4L0Z B;  3K1P A;  1STZ A;  4UNO A;  5DDG A;  1YQA A;  2QWW A;  3E3V A;  3FX3 A;  2A3S A;  3U1D A;  4KA4 A;  1UHW A;  1XDU A;  3BJA A;  3GX4 X;  1IW7 F;  2O61 A;  3HTS B;  1MGT A;  3KET A;  1IN7 A;  2E1N A;  3DEU A;  5LHG A;  4KIF A;  3GZ5 A;  1B9N A;  1KU7 A;  1JGS A;  3CUQ B;  3WE2 A;  4QWQ A;  4G94 A;  2MLK A;  1J59 A;  1D8J A;  3TGN A;  3LWF A;  2L02 A;  2VBY A;  1FYM A;  3T8T A;  1K78 A;  4U0W A;  5JI6 A;  5H6Q A;  4ESF A;  3TDU C;  4I0A A;  4R8H A;  3E97 A;  2JSC A;  1PP8 F;  3V8K A;  3TO6 A;  1FLI A;  2HKX A;  4KT5 C;  3WG9 A;  1ZG5 A;  2PLY A;  2XHK A;  2DW4 A;  2PMU A;  5HDN A;  2DPD A;  4R79 A;  5J6X A;  1T39 A;  2H27 A;  1EH7 A;  3ZMS A;  3ELK A;  5BMZ A;  5CVR A;  3ZMD A;  1NHA A;  3O3K A;  3WU0 A;  1I1G A;  3K0L A;  1MZB A;  2VOD A;  2Z3Y A;  1FP2 A;  4NB5 A;  4M6Y A;  4HBL A;  3TO7 A;  3MEX A;  1ZRE A;  3N4M A;  4FHT A;  3JSO A;  2E7X A;  4XRF A;  1K78 B;  3EQL F;  3VOE A;  4NHJ A;  3WTY C;  5JHU A;  1V4R A;  2Q8K A;  3PFI A;  5E1W A;  3FZV A;  1YS7 A;  4OIP F;  4EGZ A;  2ZNY A;  4UV8 A;  1L0O C;  3RTR A;  3HHH A;  4PGH A;  1J7K A;  4RAZ A;  4RB2 C;  1MDM B;  5JR3 A;  4LJZ F;  4LG0 A;  3DF8 A;  5IT9 Z;  3E5Q A;  4MEX F;  4PCQ A;  4BNC A;  1BIA A;  1BC7 C;  1QGP A;  5J8C A;  1CF7 A;  4KYW A;  1IN4 A;  1GHC A;  5FD6 A;  2JT1 A;  3RI4 A;  4HF1 A;  1JXS A;  4IF4 A;  4M73 A;  1KYZ A;  3GYH X;  1U5T C;  2EV6 A;  1WSU A;  3PQJ A;  1CGP A;  2OD5 A;  2OQR A;  3QU3 A;  1Q1H A;  1IRF A;  4HYE A;  3R6S A;  4FX0 A;  3MCZ A;  3RPU A;  2LSO A;  2GA1 A;  3GWZ A;  1W5S A;  3HRM A;  2F5C A;  1ZN2 A;  3R60 A;  2DK8 A;  2RGV A;  4G7H F;  2W25 A;  3JTG A;  2YR2 A;  5HS8 A;  1FPQ A;  4LG0 B;  1QZY A;  2Y0M A;  2RV8 A;  2FRH A;  5LEJ A;  2RVC A;  2P5L C;  4M9X A;  3ECO A;  1LDJ A;  4GYI A;  1CF7 B;  3LAJ A;  3F8B A;  3K9T A;  1TW2 A;  1QPM A;  2HDC A;  3L7W A;  3W6K B;  4R1H A;  3T5X A;  2ZO4 A;  3C18 A;  2X0L A;  1HW2 A;  4GXO A;  4AD9 A;  3O6B B;  2JPB A;  5DCM A;  1K6O A;  4HA8 A;  2QQ9 A;  1I6X A;  4OOI A;  2IVM A;  1YW8 A;  4WWC A;  2PG4 A;  4HQE A;  2F5D A;  2EFQ A;  4PGG A;  3IL2 A;  2YPR A;  3GVA A;  1U5T A;  1ULY A;  2GQQ A;  5TJJ A;  1BI2 A;  1ODD A;  4XLP F;  3ERE D;  1XCV A;  3DQV C;  4EM2 A;  2HTJ A;  2FBK A;  2LNB A;  5FLX K;  3DXJ F;  4BAY A;  3WGI A;  2EFW A;  3HRT A;  5E17 F;  3Q9V A;  1XGO A;  4M74 A;  1K79 A;  3KP3 A;  1FSE A;  4K2E A;  4U0V A;  5ICF A;  1HW5 A;  1OYY A;  1HKQ A;  3ROU A;  3GFI A;  4HDU A;  1F5T A;  2M1B A;  1I27 A;  3F72 A;  3VB2 A;  3EET A;  2C6Y A;  4EJO A;  1DPU A;  2CFX A;  5DCM B;  5ICE A;  4WXH A;  3WTZ A;  2PFB A;  1YW7 A;  4RGU A;  1S3J A;  1F1Z A;  1IXC A;  5D6F A;  3KP6 A;  2QQA A;  5FB2 A;  1P4A A;  2GWR A;  1U5T B;  5E8G A;  3KP2 A;  1OYI A;  1K7A A;  4H0E A;  1KU2 A;  4KNY A;  1XGN A;  3V7R A;  5BPD A;  3BPV A;  3F22 A;  2FNA A;  3ZMT A;  4GYG A;  3FMR A;  2XGX A;  1SAX A;  1B6A A;  2IRF G;  2KIM A;  4LMY A;  5D4R A;  1G4D A;  4IVN A;  4LD5 A;  2CW0 F;  5HVQ C;  4I09 A;  2EFN A;  4D0P A;  3H92 A;  3T0Y A;  3SXY A;  2H94 A;  4KFC A;  2EFO A;  5E1X A;  3JAM K;  3E5U A;  3HTU A;  3IWZ A;  3WOD F;  4MHG A;  1B9M A;  2B0L A;  5ICG A;  2D2W A;  2BE5 F;  3P7N A;  3V7C A;  1UCR A;  4LK0 F;  1S29 A;  3CJN A;  3HYI A;  2P7V B;  2ISZ A;  3ABU A;  1KU9 A;  4GGG A;  3BP8 A;  1LDK B;  3QRF F;  5BOX A;  1FX7 A;  5L3E A;  4HF2 A;  5L3D A;  2IA2 A;  2FNP A;  3IWF A;  1SD5 A;  2RKH A;  2XAG A;  1UB9 A;  1VTN C;  5L3G A;  1BM9 A;  5H6R A;  4MGR A;  1HST A;  2DPU A;  5D6E A;  2E1C A;  1P4X A;  4IPA A;  4NQW A;  3J81 Z;  4WF2 A;  4Y13 A;  3MFK A;  4L9T A;  3RYP A;  1Z1D A;  2XIG A;  1W5T A;  2KJB A;  3M9A A;  3H3U A;  5CYV A;  3U9G A;  2W84 A;  3E6C C;  1W4M A;  1KYW A;  4U0Y A;  2V6C A;  2GZW A;  1EV7 A;  1LB2 A;  3F8N A;  4YII A;  1C0W A;  4EJU A;  3W6J B;  5L3C A;  2VC0 A;  5FO5 A;  3VEP A;  1MJ9 A;  2Y75 A;  2HYF A;  2PQ8 A;  4WXC A;  2Y48 A;  5HS7 A;  3HHG A;  1XN7 A;  3D0S A;  3TQN A;  2ADU A;  1ZG1 A;  4G6D A;  3KLO A;  1KQ0 A;  3HUG A;  3DPL C;  1TNS A;  3E6B A;  3AAF A;  2OAZ A;  2EV0 A;  4G8X A;  3WTW C;  1J2X A;  2P5V A;  4UV9 A;  2FF4 A;  4ESJ A;  1J0R A;  1XSD A;  3CUO A;  5D5V B;  4IHS A;  5D5X B;  3K1N A;  2O3F A;  4UHT A;  4ENN A;  4Y15 A;  4Y17 A;  1O3R A;  2G7U A;  4P9U A;  1U6G A;  2NS0 A;  2QLZ A;  1IXS B;  2XAF A;  2XUB A;  1TQM A;  2K02 A;  2RNJ A;  4O3M A;  2VE8 A;  1XB4 A;  3J81 K;  1MJA A;  4KDP A;  3F3X A;  3BPX A;  1T2K A;  1ZHF A;  2IT0 A;  2DAO A;  1H9G A;  5K5Q A;  1DPR A;  4XSX F;  4BHP A;  2CQK A;  2HR3 A;  3C3W A;  1Y0U A;  3DV8 A;  4UVC A;  4KMF A;  3FM5 A;  2D45 A;  3MZH A;  1MD0 A;  2CYY A;  2KIU A;  5CJ9 A;  1LVA A;  3T8R A;  3RJP A;  3LA7 A;  1UHM A;  3HOS A;  3V7S A;  2HTS A;  5K5O A;  5LHI A;  4Q4Z F;  4HF0 A;  2AS5 F;  1PUE E;  1LDD A;  3ABT A;  2OZ6 A;  3GFM A;  1TNT A;  2L4M A;  4N0B A;  4O5V A;  2O0Y A;  2HEO A;  1Z6T A;  4LFU A;  2GXB A;  2CGP A;  4AIJ A;  3HRU A;  1ZLJ A;  1R22 A;  3TDZ C;  4HDV A;  4O6J A;  2MC3 A;  2PEX A;  3WTT C;  4U7B A;  3E6M A;  2GXG A;  4Q47 A;  3KEO A;  1R00 A;  1UFM A;  3QAH A;  2IPQ X;  1FYL A;  3GEZ A;  2L54 A;  3OV8 A;  2UWM A;  2DFI A;  3DPT A;  2ETH A;  3QOP A;  1F9N A;  2HQN A;  4B09 A;  3FM3 A;  5DD4 A;  5A2Q K;  5LEK A;  1USS A;  1ON1 A;  2PBI A;  2MA3 A;  5EEH A;  4BH9 A;  2OQG A;  4YFK F;  2FA5 A;  3IRQ A;  2JPC A;  1P92 A;  4DNC A;  5LGT A;  4CDG A;  5FLX Z;  2R7F A;  1WI9 A;  1PDN C;  2F5E A;  4M9S A;  2FE3 A;  1ZLK A;  1IRG A;  4EM1 A;  4XLN F;  4XBF A;  1BJA A;  1BI1 A;  1Z05 A;  2DBB A;  4HV6 A;  2HQR A;  4PZJ A;  2STT A;  2XVC A;  2RC4 A;  5LRR A;  3R0A A;  3LAP A;  2ZXJ A;  4B8X A;  3I71 A;  3WGG A;  3IHU A;  3D5L A;  2EV5 A;  2CG4 A;  3G3Z A;  1OPC A;  4YIF A;  2KIF A;  2P6S A;  4ZYD A;  3RKY A;  4ENK A;  5ICC A;  4P5O A;  1KQ9 A;  2Z5U A;  3SHF A;  4L9J A;  2FOK A;  6PAX A;  4OIN F;  4G9Y A;  3NQO A;  1TW3 A;  3DP7 A;  5LLQ A;  3FXQ A;  4LB6 B;  4WX9 A;  1ONV A;  3VOD A;  1OR7 A;  1UST A;  2EA2 A;  3GF2 A;  1YS6 A;  2VXZ A;  3WTS C;  3ZPL A;  1OMI A;  2EJR A;  4RB0 A;  3J7A O;  5L3F A;  2OZU A;  3F8F A;  4A5M A;  4RGS A;  3EYY A;  1R5H A;  3HOT A;  5HLH A;  5HDK A;  2VT2 A;  2H6B A;  3KFW X;  3LQR A;  3BRO A;  4GO1 A;  1L3L A;  1LQ1 A;  4L9V A;  5KK1 A;  1BN5 A;  3FHZ A;  4IHT A;  5K1Y A;  4LK1 F;  1U2W A;  1W7P A;  5AIP A;  1FBU A;  3FF5 A;  3WGH A;  5IT3 A;  4YG2 F;  1D8K A;  1BI3 A;  2HS5 A;  2A68 F;  1W7P D;  4HX4 A;  2QQB A;  3JAM Z;  1WRJ A;  4N9I A;  2FQ3 A;  4BXU A;  1P6R A;  5H20 A;  3V8J A;  2VN2 A;  4UXN A;  2UXX A;  4L5J A;  4DQ2 A;  3R61 A;  2GIV A;  2LF8 A;  4G7Z F;  4A5N A;  1IAW A;  4I7H A;  2H09 A;  3SZP A;  1XGS A;  1S8N A;  5CVI A;  5LGU A;  3HSE A;  2K4B A;  3CTA A;  5FFZ A;  1G3T A;  4ZH4 F;  3ZN0 A;  4OIQ F;  2D1V A;  4L9N A;  1XD7 A;  1Z7U A;  2HFH A;  4I2O A;  1O3S A;  3GFJ A;  4KMU X;  2XRN A;  1LEA A;  1W7P B;  5LBQ A;  2MH9 A;  4N9H A;  5CVJ A;  3J80 K;  3CDH A;  1E2X A;  1IUY A; 
#chains in the Genus database with same CATH topology
 4RLQ A;  3B73 A;  3KZY A;  1V3F A;  3CCM I;  2VJI A;  3RDI A;  3LST A;  5EJC A;  2LKP A;  2E60 A;  3LQQ A;  2XRL A;  3OYN A;  4UUV A;  3FMS A;  2DTR A;  1SMT A;  4JYK A;  1FIP A;  1GVJ A;  5DCF A;  2R5Y A;  2UV1 A;  4HX8 A;  1Z67 A;  3COA C;  1JUP A;  3NWS A;  3LSK A;  1FP1 D;  4ZZL A;  2A05 A;  3HSF A;  2WV0 A;  1RC9 A;  5DUI A;  1Z21 A;  5E1Z B;  3GFL A;  2X85 A;  3P9K A;  3C7J A;  4C2U A;  3AKZ A;  3VFZ A;  4CXF A;  1WPK A;  2A07 F;  1QO0 D;  1WWX A;  2R4G A;  2QKL B;  2XF6 A;  2ELK A;  1FNN A;  3PL8 A;  1TC3 C;  3S1Q J;  3VYT B;  1O3Q A;  2BVL A;  4D1Q A;  5CQG A;  2FU4 A;  4IHY A;  4DIQ A;  3WTV C;  3I4N J;  1FOY A;  2DU9 A;  1WZ2 A;  5BPI A;  1GT0 C;  3K4K A;  2X1D A;  4JQF A;  1XDS A;  1JE8 A;  1MNM C;  1BW6 A;  1WFX A;  4A93 J;  5CLS A;  1XGM A;  2DFE A;  2XGC A;  3CCJ I;  1FYK A;  2K9L A;  4HNU A;  3GO5 A;  2MH2 A;  2P6T A;  3OYD A;  4ON0 A;  2IJL A;  1IJW C;  1NG7 A;  2LLK A;  4NBQ A;  1B1B A;  4BQN A;  5D8L B;  5EF6 A;  1H0M A;  3FWE A;  4LLN A;  2HZT A;  1Z9C A;  2ZFW A;  2YU3 A;  3M8J A;  3MWM A;  2PMZ A;  1E3P A;  5E3O A;  3HOU J;  5KVR A;  4RB3 C;  1YHQ I;  2VQH A;  2V4J C;  1R5G A;  4CCN A;  1EA3 A;  4CHU A;  1J75 A;  3R0J A;  1V5F A;  2HZD A;  2M8E A;  4OMY A;  4TV7 A;  2HVR A;  5EZG A;  4WXD A;  2P7C B;  2CQQ A;  5EDN A;  5HLI A;  3TP0 A;  2WC2 A;  1DP7 P;  3IKT A;  2BYV E;  2WAQ N;  2I10 A;  2XRO A;  3OYM A;  1YLF A;  5C4X J;  5EG0 A;  3BQZ A;  1NTC A;  1VQM I;  2O8X A;  1TLH B;  5AON A;  3RPQ A;  3JRE A;  1QA6 A;  2L9V A;  1RI7 A;  2RRE A;  1X1A A;  3G2B A;  4B43 A;  3OYJ A;  4IRI A;  1S7A A;  4A3I J;  3BJ6 A;  2DMN A;  2G0E A;  3ML6 A;  5E8I A;  3ZQQ A;  2H6C A;  2LF7 A;  2J5O A;  4IJA A;  3CMA I;  3U1K A;  2GAU A;  2ZNZ A;  4ZYH A;  3HC7 A;  2KLO A;  2M4G A;  2VQC A;  4KJZ A;  2CMP A;  3Q9S A;  3WTU C;  4PJN A;  4BU2 A;  3K4M A;  3OYA A;  1BL0 A;  4NDL A;  1IUF A;  3HPG A;  1IV6 A;  4J19 A;  2W85 A;  2E7W A;  4XN3 A;  3VPR A;  2JTV A;  2K27 A;  1SAN A;  1ZG3 A;  4A3B J;  1YI2 I;  1Z3X A;  5DM6 F;  5DYM A;  3BTL A;  1SMY F;  3RKX A;  2HGC A;  5F6F A;  2Z33 A;  1E17 A;  2KJC A;  3V4G A;  4YRV A;  4OIR F;  4Y33 A;  3FIW A;  4A0X A;  4E70 A;  3A01 A;  2ZXW H;  3H3Z A;  3A4C A;  1IZ1 A;  4I02 A;  2F6C A;  3KX2 A;  4HSR A;  1FSH A;  4DZP A;  3DTK A;  5D5W B;  1FBS A;  4JBA A;  3N97 A;  2F5F A;  2HOT A;  2F2E A;  1MMN A;  1I6H J;  2XAH A;  3GZN B;  4XID A;  4XRS G;  2VQG A;  4IHV A;  1KQ8 A;  3SZG A;  2JWT A;  2Q2E A;  3TOA A;  4DBQ A;  4BDY A;  1JUS A;  1O57 A;  2HDW A;  2XF7 A;  1SFU A;  5EG0 B;  1ZAR A;  3LSP A;  3DKW A;  2OA4 A;  3GZ6 A;  1IGN A;  2VOO A;  1TQI A;  3F23 A;  1T8I A;  1IN5 A;  3I59 A;  5F1J A;  2L3D A;  2K7L A;  2JQ7 A;  2DFH A;  2M4K A;  2ZFU A;  4Z2Y A;  4B47 A;  4OIO F;  3K6G A;  3E6D A;  3H3V K;  3LA2 A;  5H2F C;  2FQ4 A;  1YIT I;  4KUM A;  5AIQ A;  1JGG A;  1NK3 P;  1ENH A;  5FKM A;  1OKR A;  1SFE A;  3DWL E;  1ZK8 A;  2YSR A;  5J8F A;  3S2D J;  2BW3 B;  2BXY A;  2FSW A;  5ED4 A;  4ZDO A;  1ZGJ A;  2VQL A;  3P9C A;  1MJB A;  3PUF A;  2DI3 A;  4MEY F;  3OOP A;  2CRG A;  3LSR A;  5CVU A;  2V1D A;  4RBO A;  2K40 A;  2OTJ I;  2BXZ A;  1MSE C;  1R6R A;  1ZTR A;  4BQA A;  1WI3 A;  1IDZ A;  2L7K A;  1QU3 A;  2NS7 A;  2L7Z A;  2HNH A;  3L1P A;  3KCC A;  1Z91 A;  4PJ0 C;  1YFH A;  2EH3 A;  3P9I A;  5EEG A;  3PQK A;  2EB7 A;  5E3L A;  2XPU A;  2ELH A;  4UVA A;  4XRM A;  3JRC A;  1MMG A;  2ESH A;  4HOB A;  4M3E A;  1ZGA A;  1JHF A;  3DU5 A;  2Z99 A;  4MQ9 F;  2DOE A;  5EGO B;  2Q2E B;  1S7O A;  3ZN1 A;  2J5P A;  3D1N I;  4BY1 J;  2V1U A;  3OMY A;  3MZY A;  4HAM A;  1G3Y A;  2M87 A;  5ILV A;  2KKO A;  1FC3 A;  1YG2 A;  2FBI A;  2JSP A;  1TP4 A;  4PSW A;  1SD4 A;  4NC6 A;  3S2W A;  4F7Z A;  3I59 B;  5DUK A;  3S32 A;  2K85 A;  1QZE A;  4EVI A;  2V79 A;  4A0Y A;  4BKX A;  1HBX G;  2HPM A;  1R49 A;  4LB5 A;  2JRT A;  5IOY A;  2R3S A;  1B72 A;  4CGZ A;  1HQC A;  1OJL A;  4PSX A;  2P5K A;  3LA3 A;  2LRD A;  4A6D A;  2DQL A;  2FXA A;  3AG3 H;  3L00 A;  5LHH A;  5A2Q Z;  3W2V A;  1MNE A;  5J4V A;  1ZAO A;  1HXD A;  3DLL F;  3HIF A;  1DU6 A;  3CDI A;  5GP9 A;  1GXP A;  4ENJ A;  4E4H A;  2YX7 A;  1A31 A;  1T38 A;  1I5Z A;  3KZI C;  4EGY A;  1RUN A;  3ULQ B;  5FRM A;  2QEX I;  1BR4 A;  1XMX A;  2NVT J;  4QIW N;  4BXX J;  2HDD A;  4DYQ A;  1P7J A;  2W82 A;  3K2Z A;  3S2H J;  3KP7 A;  2QCO A;  4J01 A;  4M9Z A;  1XSV A;  3IAM 2;  3QOE A;  3ZMZ A;  5LGN A;  3DKY A;  4FX4 A;  2M45 A;  1IO2 A;  2EZH A;  2DLL A;  2V9P A;  3CC7 I;  2EA4 A;  3CCE I;  1YTY A;  3ZP5 A;  2MBF A;  5FKN A;  1YIO A;  4A2U A;  2ISY A;  2Z1D A;  4XON A;  4EJW A;  2MYS A;  2NVU B;  4P55 A;  2LDU A;  2I5U A;  4II3 A;  3OYL A;  3CMY A;  4ETS A;  1CQT A;  5HDG A;  1ETQ A;  3QWL A;  2FMY A;  2P4W A;  4P96 A;  1R58 A;  3QPT A;  4YEL A;  3KLN A;  3H1C A;  3PNV A;  2QUF A;  4L18 B;  3FXO A;  3GLX A;  1BOA A;  1O7F A;  2DA5 A;  1K6Y A;  1GVD A;  2HKO A;  3I58 A;  2P8T A;  2VKH A;  2X4H A;  3I53 A;  3QYB A;  3OYI A;  4ANJ A;  1MBF A;  1LEB A;  1B72 B;  3CDL A;  1P2F A;  2QEN A;  1TBX A;  2VPR A;  1KGS A;  3OYH A;  3ZMU A;  2K86 A;  1OCR H;  1T0F C;  3E5X A;  4MQV A;  1PP7 U;  4HQM A;  2LOO A;  1XSX A;  2DFF A;  1R1T A;  2IS6 A;  1XCB A;  3NRV A;  1X1C A;  3J7Y J;  1YO5 C;  3B02 A;  4DOZ A;  1FMW A;  2L4A A;  3KYC B;  1Z3Y A;  2IA1 A;  2RNG A;  4MTE A;  1ETO A;  4MNU A;  4FAS D;  2DOA A;  2OU2 A;  1LNW A;  1B4A A;  1MDM A;  1W0U A;  1XMA A;  2ZKZ A;  1OQY A;  3CQZ J;  5LRS A;  1N78 A;  4G7O F;  1G2H A;  3KZZ A;  4Q48 A;  4U87 A;  3M3Y J;  3ASO H;  4D7N A;  3F8M A;  3DEW A;  4KN4 X;  1FZP B;  3BQY A;  4BHB A;  1RKT A;  2VC1 A;  4KIG A;  3WTX C;  5FKK A;  1D1B A;  2O7O A;  2GLO A;  3BWG A;  3NEU A;  3AL0 C;  5E3M A;  1M1E B;  3EDP A;  2NRA C;  2UZK A;  3MD2 A;  2TDX A;  2DO7 A;  2JA2 A;  4X1E A;  3RKW A;  3G4S I;  3EYI A;  2R7U A;  3MMY B;  3TED A;  3ECH A;  2ZCW A;  3HJE A;  3SDB A;  1HKT A;  3A0H C;  1Y0N A;  3DPU A;  4I98 B;  2A6H F;  2XSD C;  2X51 A;  1ETW A;  2LH9 A;  3MVP A;  5BNG A;  3QOD A;  2ICW G;  1KA8 A;  1FEX A;  2Y0S N;  4IXA A;  2IXS A;  4XLA A;  2K9N A;  3ZXS A;  3IRR A;  4I01 A;  3A02 A;  1HKS A;  4KN7 X;  4CIC A;  2R93 J;  1FT9 A;  3FMQ A;  1JI8 A;  2QVO A;  4QSH A;  2VE9 A;  3DEE A;  1V54 H;  2EIN H;  5E20 A;  2VBW A;  2HYJ A;  3A03 A;  2QM3 A;  1X1D A;  5IYB J;  1G6N A;  2W00 A;  3MN2 A;  3K70 C;  4BAC A;  1Y56 A;  1B8I A;  1MH4 A;  4ASN A;  1FOK A;  2FML A;  2NAZ A;  2MSY A;  2HOE A;  1ETV A;  4F55 A;  3BJO A;  2QBY A;  3S93 A;  2BEO A;  4KIS A;  2ZBK A;  1WJA A;  2VBX A;  3X2Q H;  3CO6 C;  1T6S A;  5FD5 A;  2ZJQ F;  1TTY A;  1TT5 B;  1A36 A;  1AA7 A;  1SD7 A;  2VON A;  2BBY A;  4M71 A;  3OL3 A;  5ILU A;  4S0H B;  2CO5 A;  4LG3 A;  3HEF A;  3L2Q A;  2E2I J;  1JUM A;  1T0F A;  3PIP F;  3GTJ J;  5M5Y J;  1HOM A;  3BG7 A;  2JUG A;  4HLY A;  3K2A A;  4BE1 A;  2E71 A;  3BG6 A;  4PJJ A;  2CV0 A;  2H8R A;  1BBY A;  4HV5 A;  4YEJ A;  1QQI A;  4ZTJ A;  2KHM A;  4AWX B;  2W4S A;  1F43 A;  3QPS A;  2EZK A;  3BOQ A;  4AYB N;  2RN7 A;  3J80 Z;  2BHY A;  2DOD A;  3T1B A;  4CCL A;  1JT0 A;  1HC8 A;  4BEH A;  1R1V A;  2VT3 A;  1KZH A;  4OMZ A;  1VQN I;  1O3T A;  2M7B A;  1O7L A;  1YJ9 I;  3VYR B;  3GW2 A;  4ZYE A;  2XC7 A;  2JMW A;  1X4P A;  5J47 A;  4H4K C;  5JVT A;  3H9G A;  1D5Y A;  4CH7 A;  3HDD A;  5IPA A;  5KHD A;  3SZT A;  2WY7 Q;  2L9S A;  2D1H A;  1R7J A;  2HWV A;  5J1U A;  2DTZ A;  5B5E C;  4ESB A;  3Q0U A;  3M1E A;  3FIS A;  1OCC H;  1P4W A;  3ZQ7 A;  1U8R A;  4DYR A;  3S1R J;  1B8I B;  3M1C A;  1TZL A;  4OU0 A;  3BCA A;  4DGW B;  1HCR A;  2DDB A;  1ZQ3 P;  2QBY B;  4M3G A;  4A0Z A;  4IRH A;  5J1R A;  1F4K A;  1B59 A;  4M72 A;  4BY7 J;  3WE3 A;  5GPC A;  1RUO A;  1FY7 A;  1ZRF A;  4HX7 A;  1ZR2 A;  2OBP A;  2X48 A;  1DUX C;  3N05 A;  4XNF A;  4LLL A;  5FFX A;  1XMK A;  2Z9O A;  5BS6 A;  4FET A;  2CW7 A;  2WAQ A;  1MKM A;  5B1A H;  2NOJ B;  1BW5 A;  4FCY A;  2R7Z J;  5IP9 J;  3TL4 X;  5K5R A;  2V1N A;  5D4S A;  2GBY A;  2KRF A;  2M34 A;  4BYY A;  4M6X A;  1JKR C;  3J7Z I;  1A35 A;  2HOS A;  1SD6 A;  3HRS A;  4YFX F;  1RIO H;  2PI0 A;  2XKO A;  2DT5 A;  3EUH C;  3JRG A;  4BXF A;  4ZYG A;  2CWE A;  1BIB A;  4NC7 A;  2WY8 Q;  2ZME C;  2KDZ A;  3M8E A;  2R7X A;  1KU3 A;  2ZSI B;  1FWZ A;  2NNY A;  4UB6 C;  2VKE A;  4XSZ F;  3I5U A;  4ZC3 A;  3K70 D;  3F21 A;  5F64 A;  2IW5 A;  1X58 A;  3CJQ B;  3HXL A;  3JSP A;  4BEH B;  3F6O A;  4J00 A;  4XKW A;  2R92 J;  2Q0O A;  3KEQ A;  4D5C A;  2F5V A;  1U78 A;  2KQR A;  1ZYR F;  1D0X A;  1U9N A;  2M5W A;  3F6V A;  4S04 A;  4E7H A;  4RLF A;  4I99 C;  2W24 A;  2DQR A;  5HLT A;  3PM1 A;  2STW A;  5HLG A;  4M3B A;  5D5U B;  2GA2 A;  3I9V 2;  3E7L A;  5FGM A;  3QPH A;  3ISP A;  5ERI A;  3K4N A;  3K1M A;  3HOZ J;  2FEZ A;  1J5Y A;  4A3F J;  2XV4 S;  2DA4 A;  1G3W A;  3VDX A;  4EQQ A;  3CO7 C;  2L5Q A;  1ACI A;  3I54 A;  2XAJ A;  4YFN F;  2E19 A;  1HDD C;  1YYV A;  2QQ8 A;  1A04 A;  2CUF A;  4EJV A;  3KPH A;  4MFD A;  4GCV A;  1BC8 C;  5EYR A;  1JHH A;  4IL6 C;  1SVL A;  5IT9 K;  4QLC U;  2M0M A;  1EH8 A;  2QA4 I;  4IRG A;  3TOB A;  3OYE A;  1QNT A;  1ZRC A;  2ZB9 A;  1ZH5 A;  4L5I A;  2WTE A;  4A12 A;  4C3I J;  2OUM A;  4JX6 A;  3L09 A;  3CCR I;  3FKI J;  1FBQ A;  3L2C A;  4EMS A;  2QKM B;  4G6Q A;  1LJ9 A;  1AU7 A;  2K4J A;  2OTL I;  2K9M A;  3K69 A;  5BQT A;  3BDD A;  2V1X A;  3I64 A;  4A6E A;  3CC4 I;  1S9H A;  5TRD A;  2W48 A;  3BTI A;  4RAY A;  1H89 C;  1E0E A;  4EJT A;  1G3S A;  2DYR H;  3I4P A;  4HZF A;  3ZOB A;  3IKV A;  1H9T A;  4DZJ A;  4EM0 B;  1V5E A;  5ILS A;  1BOB A;  3U2R A;  1EH6 A;  2EWN A;  3BR5 A;  3FXR A;  2DMT A;  2VUM J;  1OFC X;  1Z6R A;  4U88 A;  2OCC H;  1SFX A;  1V55 H;  2LFB A;  3TKY A;  5J4Y A;  4CYD A;  2PN6 A;  4I0B A;  3EUH A;  3QP5 A;  4JK1 X;  2ZME A;  1YJW I;  2BGC A;  3DFG A;  4AIH A;  4B44 A;  5EEA A;  1QBJ A;  4UUT A;  2PJP A;  2XF5 A;  1XS9 A;  3SYT A;  3Q0V A;  2CS3 A;  2NNN A;  2VIX A;  3V42 A;  2O6G E;  5CVV A;  3BG9 A;  3S16 J;  5IOZ A;  4LGW A;  5LD2 C;  1DDN A;  2CW8 A;  3F8C A;  1DGR M;  4AVP A;  4A3C J;  1IXR C;  1WJE A;  3KP5 A;  5DV5 A;  3TO9 A;  3OIO A;  3CCV I;  3GTL J;  1BJZ A;  1RNL A;  4ENM A;  3HKZ N;  5F1R A;  3W2W A;  1IN6 A;  1ON2 A;  2BVM A;  3FK6 A;  1Y1W J;  2HYG D;  4QPO A;  3MAJ A;  1QHG A;  2LRE A;  2WWY A;  1R71 A;  5GAG J;  1JJ8 C;  3EPZ A;  1REP C;  2FBH A;  1W1W E;  3BR6 A;  3BZK A;  4P9F A;  4AVZ A;  4MTD A;  1TWC J;  4C30 A;  3OYK A;  2DK5 A;  2M30 A;  2JZY A;  2A6E F;  3K4B A;  4CO8 A;  2PMH A;  3LSJ A;  1J9I A;  2CSO A;  4JP0 A;  2XAQ A;  3GTQ J;  1LFU P;  1RPW A;  1NH3 A;  4HNV A;  2EK5 A;  3M4O J;  2DDA A;  2BV6 A;  2MD5 A;  1PYV A;  1QZZ A;  2LVS A;  3RZD J;  4RGX A;  4RGR A;  5FJ8 J;  1VQK I;  1Q1V A;  2G9W A;  3OWT A;  2WAD A;  1IF1 A;  2E1O A;  2G7H A;  3JRD A;  2R5Y B;  3ZQG A;  2KPM A;  1V5G A;  3FXK A;  3HSR A;  3SQN A;  1SFK A;  1WQ2 A;  1ZRD A;  2R7D A;  4M6V A;  3BZ6 A;  3V8L A;  2DMP A;  3DU6 A;  3IC7 A;  2KL4 A;  3WU1 B;  1N25 A;  4Y52 J;  1TWF J;  3MQ0 A;  2JA6 J;  3OS2 A;  2ZME B;  2RDP A;  3SFZ A;  1OYW A;  3CLO A;  2JN6 A;  4A3D J;  3REO A;  4EV0 A;  2W57 A;  2XSJ C;  2ZXI A;  3M7G A;  2X6Y A;  5E3N A;  1DU0 A;  2ZJ2 A;  3CUQ C;  2OPT A;  1AOY A;  2EFP A;  4BHC A;  1U3E M;  2XAS A;  2O03 A;  3LSI A;  4WCG A;  1D5V A;  5DD8 A;  3KE2 A;  3FBN B;  2EPF A;  2XGE A;  3GUD A;  3P5J A;  2IP2 A;  2QZ8 A;  1R4N B;  3ZMV A;  3OYF A;  1HW1 A;  3S1N J;  2MLG A;  3S14 J;  3WHC A;  2ZSH B;  3GME A;  1BR2 A;  4CUG A;  5DEQ A;  4S05 A;  1FMV A;  3G73 A;  3OYC A;  4CZZ A;  2A5W A;  2HXI A;  3CME I;  3UKG A;  5E79 C;  4Q5S F;  4HLX A;  4ZZD A;  2UXN A;  2HU9 A;  2IA0 A;  4RDU A;  3K4L A;  3OS0 A;  3OYG A;  3HOY J;  2K5C A;  1SFO J;  2MFZ A;  4PDK A;  1DP3 A;  1AWC A;  2L9R A;  4RA2 A;  2V9V A;  2EIM H;  4KIB A;  2DOF A;  2L01 A;  2LC2 A;  1IDY A;  1IN8 A;  1IV8 A;  2LTP A;  2X6W A;  1FIA A;  3ESW B;  3E1S A;  3QU6 A;  2B9S A;  3WG7 H;  3ASN H;  3JW4 A;  4CCO A;  2ESN A;  4ZJZ A;  3S1M J;  4D5F A;  1TT0 A;  5E18 F;  2VPL A;  4HW0 A;  3CC2 I;  3Q5F A;  1S6L A;  2KDO A;  1RR8 C;  1GXQ A;  4JX5 A;  3GTP J;  5D8K B;  3MKZ A;  5JFR A;  3GTK J;  3FXU A;  3K4J A;  4WK8 F;  1R36 A;  1D1C A;  1BI0 A;  2A5Y B;  2A69 F;  3LFK A;  1RR7 A;  2VBZ A;  2VAS A;  2VOP A;  4UVB A;  3QP6 A;  2COM A;  4HPQ A;  1X4O A;  4U7D A;  1SEU A;  3ZRG A;  1R4M B;  5C3E J;  3HPH A;  4XIC A;  3L9F A;  4E7I A;  1YE9 A;  3LL7 A;  3KP4 A;  3LMM A;  3RIR A;  2ACJ A;  4L0Y B;  3JTH A;  2NYX A;  3SJM A;  2QYO A;  1XX5 A;  4FT8 A;  3C1D A;  4Y4R A;  2YX4 A;  3RYR A;  2DYS H;  1I1S A;  4KIC A;  2AXL A;  2DJI A;  2ZJP F;  4AIK A;  2A61 A;  2LG4 A;  3I0T A;  2OF7 A;  1TQP A;  5JHF A;  1JKQ C;  3R4K A;  1T98 A;  1RZ4 A;  1YW9 A;  5L3B A;  3OR1 C;  3JRA A;  4BQO A;  4BUP A;  3ABK H;  3CUQ A;  2DMQ A;  1X3U A;  5GPA A;  3HGG A;  3A01 B;  4FE4 A;  3W3C A;  2R7R A;  2RQP A;  4LIT A;  2R7Q A;  4LLG F;  3L2U A;  4HEA 2;  5HS9 A;  2ECB A;  1OCT C;  4CA0 A;  1D3Y A;  1WKM A;  4UUS A;  3OIP A;  1R23 A;  3NWT A;  4B4C A;  1YRN A;  3GXO A;  3S3M A;  3M8F A;  1R1U A;  3SDG A;  4RB1 A;  1A6Q A;  2XKP A;  2XB5 A;  1HSJ A;  2VXD A;  3O2P E;  4M3D A;  4NUB A;  5GAH J;  4RS8 A;  2H1L A;  3FXM A;  3VSL A;  1N75 A;  1U0J A;  5TIS C;  5HOO A;  1YJN I;  3BY6 A;  3BZC A;  4L0Z B;  3K1P A;  1STZ A;  4XN0 A;  4UNO A;  5DDG A;  1QVT A;  1YQA A;  1SVM A;  3CF2 A;  2QWW A;  3E3V A;  1RES A;  3FX3 A;  2A3S A;  2ECC A;  1ITY A;  2YS9 A;  3CP8 A;  3U1D A;  2ID3 A;  4KA4 A;  1MBE A;  3CP2 A;  2L7M P;  4DW6 A;  1UHW A;  2K9Q A;  3BJA A;  1XDU A;  3GX4 X;  3FK7 A;  2PMZ N;  2E1M C;  1IW7 F;  5F08 A;  2O61 A;  3M07 A;  1MGT A;  3HTS B;  3KET A;  1K83 J;  1IN7 A;  2E1N A;  2RAE A;  4FIS A;  3DEU A;  4X0G A;  5LHG A;  4KIF A;  5J1Y A;  3GZ5 A;  1B9N A;  1QPI A;  1KU7 A;  1JGS A;  2MW8 A;  3CUQ B;  4F91 B;  2JRM A;  3WE2 A;  1WJD A;  5GAE J;  4QWQ A;  2E5Z A;  1YIJ I;  2K3F A;  2LK2 A;  4G94 A;  5FLM J;  2UUZ A;  3RZO J;  2MLK A;  2F4I A;  5FRN A;  2BY0 A;  5EZH A;  1J59 A;  1D8J A;  2CQX A;  3TGN A;  3LWF A;  3VSK A;  2L02 A;  2VBY A;  3H5R A;  1GLN A;  4UUS B;  1FYM A;  5FRO A;  3T8T A;  4DYC A;  4CZC A;  3CES A;  5GTH C;  2JVG A;  2JUC A;  1YRN B;  2P81 A;  2VKD A;  2YUS A;  1VND A;  1K78 A;  1LFB A;  2WB1 A;  4GFB A;  4U0W A;  1UG0 A;  5JI6 A;  5H6Q A;  3TW6 A;  4ESF A;  3TDU C;  4I0A A;  4II2 A;  4R8H A;  3E97 A;  4JX4 A;  2L7F P;  2AQF A;  2JSC A;  4XLE A;  1PP8 F;  3V8K A;  1YOV B;  2IS4 A;  1RKW A;  3TO6 A;  1FLI A;  2HKX A;  4KT5 C;  3WG9 A;  1QVU A;  2BY2 A;  1ZG5 A;  4P1W A;  1G59 A;  2PLY A;  2XHK A;  1UZC A;  2AHQ A;  2BY3 A;  1A6I A;  1XTA A;  3GLL A;  2DW4 A;  2PMU A;  2CUJ A;  5HDN A;  2HXO A;  2JJ7 A;  2DPD A;  2E34 A;  4BE0 A;  4R79 A;  1HLV A;  3PNT A;  4XK4 A;  1K4S A;  3AG1 H;  2R7V A;  5J6X A;  1T39 A;  2H27 A;  1EH7 A;  5KCM A;  4QPQ A;  4B3X A;  1Y1V J;  2CH0 A;  5CKT A;  2Y30 A;  3DBL B;  3ZMS A;  3ELK A;  5BMZ A;  5CVR A;  3ZMD A;  1NHA A;  3IH2 A;  3C2B A;  3O3K A;  3G1L A;  4IOC F;  5F27 A;  3WU0 A;  5M5W J;  2CV2 A;  4F92 B;  1HA8 A;  4HNT A;  1I1G A;  3K0L A;  2B7E A;  1MZB A;  3LSG A;  2VOD A;  2Z3Y A;  1FP2 A;  4NB5 A;  4M6Y A;  1T95 A;  2FD5 A;  5DM7 F;  4HBL A;  3TO7 A;  4IKF A;  3CLQ A;  3MEX A;  3TBI A;  2AO9 A;  3H0D A;  1OCZ H;  3N4M A;  1ZRE A;  2B63 J;  3FXL A;  4JOM A;  4BBR J;  4FHT A;  3JSO A;  2E7X A;  3BC8 A;  4XRF A;  4BJ5 C;  2LYC A;  2KT0 A;  1K78 B;  3EQL F;  3K10 A;  3VOE A;  2E35 A;  3W2A A;  4NHJ A;  1X3W B;  3WTY C;  2EIJ H;  5FLV A;  3VYU B;  3ZQF A;  5JHU A;  1PUF A;  2KZV A;  2O9L A;  1V4R A;  2Q8K A;  5GAD J;  3PFI A;  5E1W A;  4BJT A;  3MKY B;  3FZV A;  1TWH J;  1XPX A;  4XQF A;  1FTZ A;  4HRI A;  1YS7 A;  2OV7 A;  1SC7 A;  5FKO A;  3IAS 2;  4OIP F;  2N8G A;  4EGZ A;  2Y31 A;  1LVK A;  2ZNY A;  1MSF C;  2IGK A;  4UV8 A;  1L0O C;  1YX3 A;  3K4C A;  2M8G X;  3JRH A;  3RTR A;  4BGD A;  3HHH A;  1LE8 A;  4PGH A;  1J7K A;  1D1A A;  4RAZ A;  4CCK A;  4QTR A;  3FKJ A;  5CQE A;  4IZZ A;  1E3O C;  2EIK H;  2LMD A;  4RB2 C;  3GBG A;  1UG2 A;  3NAR A;  1MDM B;  5JR3 A;  4LJZ F;  4LG0 A;  3DF8 A;  2JA7 J;  5IT9 Z;  3E5Q A;  4MEX F;  1WH5 A;  4PCQ A;  3H9J A;  3AG2 H;  1GV2 A;  4BNC A;  1BIA A;  1GV5 A;  4NNJ A;  1BC7 C;  1NK2 P;  1QGP A;  4UY8 I;  2KRH A;  2WBM A;  5J40 A;  4XKV A;  5J8C A;  3LSH A;  3ZQH A;  1CF7 A;  4KYW A;  1IN4 A;  4A3E J;  1GHC A;  5FD6 A;  2JT1 A;  3RI4 A;  4HF1 A;  1JXS A;  2DCE A;  4IF4 A;  4GRI A;  2KMU A;  4XMY A;  4C3H J;  3CCQ I;  4M73 A;  1KYZ A;  1XG1 A;  2WV1 A;  1UAA A;  3GYH X;  1WJB A;  3TW7 A;  1FOX A;  3BLY A;  1ERD A;  2R7T A;  4G6T B;  1VI0 A;  3OOU A;  4M3F A;  1Y6I A;  4MO7 A;  1U5T C;  3S3O A;  2EV6 A;  3HKZ A;  1PUF B;  3C2G A;  1WSU A;  3PQJ A;  3ZCO A;  1CGP A;  3CJR B;  2OD5 A;  3OR2 C;  2DA7 A;  4HST A;  2OQR A;  3QU3 A;  1HF0 A;  2Y9Y A;  3FDY A;  1Q1H A;  2V6E A;  1IRF A;  4HYE A;  3R6S A;  3RQI A;  4C2M J;  4E7K A;  3IP4 B;  4FX0 A;  3MCZ A;  3HM5 A;  4XKB A;  2M3A A;  9ANT A;  2HVS A;  3KEY A;  3RPU A;  2LSO A;  2VJ4 A;  3PSI A;  2GA1 A;  2ZJR F;  5JLX A;  3GWZ A;  3ZQC A;  3NAU A;  1TWG J;  1W5S A;  3HRM A;  2F5C A;  1ZN2 A;  1LE8 B;  1WCM J;  3F0C A;  3D5R C;  3R60 A;  2CQN A;  2DK8 A;  2RGV A;  3KYD B;  3RPU D;  4G7H F;  2W25 A;  1MMA A;  3D5S C;  4XOP A;  3JTG A;  2YR2 A;  4OWR B;  5K7F A;  5HS8 A;  1FPQ A;  2DT6 A;  3IH3 A;  3OIQ A;  1QZY A;  4V2G A;  2Y0M A;  1VQL I;  4LG0 B;  2RV8 A;  2FRH A;  5IP7 J;  5LEJ A;  2R7W A;  2RVC A;  2P5L C;  4E6K G;  2HQ5 A;  4M9X A;  3ECO A;  1LDJ A;  1WVR A;  4CYC A;  4GYI A;  1CF7 B;  3LAJ A;  4B48 A;  3F8B A;  3K9T A;  1VF9 A;  4A3K J;  4YIR X;  1TW2 A;  1QPM A;  3L2R A;  2HDC A;  5IYD J;  5DS9 A;  3L7W A;  1P7I A;  1PVE A;  3BTJ A;  4ZDL A;  1ZKG A;  3W6K B;  4R1H A;  3T5X A;  4N4N B;  2ZO4 A;  2R7S A;  3C18 A;  2X0L A;  1I50 J;  1HW2 A;  4GXO A;  1MMD A;  3HG9 A;  4AD9 A;  3O6B B;  2JPB A;  1Z0X A;  5DCM A;  2R0Q C;  3AL0 B;  2KP6 A;  1OIS A;  1K6O A;  4D7M A;  5FKL A;  4HA8 A;  2QQ9 A;  1X1P A;  1I6X A;  1MH3 A;  4OOI A;  2KZG A;  2E5N A;  2IVM A;  3CJT B;  2L0K A;  3KYL A;  1YW8 A;  2PG4 A;  4WWC A;  4HQE A;  2IS2 A;  2F5D A;  4W97 A;  2EFQ A;  4XOT A;  4PGG A;  3DBR B;  3IL2 A;  1ETX A;  2YPR A;  3GVA A;  2NVX J;  1U5T A;  1ULY A;  2GQQ A;  3BR0 A;  5JVG F;  3GTO J;  3ONQ A;  2VLA A;  5TJJ A;  1BI2 A;  1ODD A;  4XLP F;  3ERE D;  1XCV A;  4UB8 C;  2XAU A;  3DQV C;  4EM2 A;  1T56 A;  2OC6 A;  2HTJ A;  2E36 A;  2FBK A;  2LNB A;  1A5J A;  1D0Y A;  5FLX K;  3DXJ F;  4BAY A;  3OSG A;  3WGI A;  2NOG A;  4A69 C;  1EKE A;  2BZT A;  2EFW A;  3HRT A;  2R5Z A;  5E17 F;  3Q9V A;  5C4J J;  1XGO A;  2AQE A;  4M74 A;  3ABL H;  4CYC B;  1MBK A;  1K79 A;  2P0W A;  1MND A;  3KP3 A;  3OYB A;  1FSE A;  4K2E A;  4U0V A;  5ICF A;  1HW5 A;  1OYY A;  1HKQ A;  3DLA A;  3LFU A;  3ROU A;  3VYS B;  2M7A A;  2ELJ A;  5C44 J;  4IX7 A;  3GFI A;  4HDU A;  1F5T A;  2M1B A;  1I27 A;  3F9K A;  1JT6 A;  3F72 A;  4XL9 A;  3VB2 A;  3EET A;  2C6Y A;  4EJO A;  1DPU A;  3CMM A;  2XGD A;  1I3Q J;  5IY5 H;  1AKH A;  1VZ0 A;  1PJR A;  2CFX A;  2FOW A;  5DCM B;  5ICE A;  1WJF A;  4WXH A;  2LY9 A;  3WTZ A;  1DQU A;  3QYE A;  2LR8 A;  2PFB A;  1YW7 A;  1FTT A;  4RGU A;  1S3J A;  1F1Z A;  4PFP A;  1IXC A;  4OAZ A;  5D6F A;  3KP6 A;  2Y9Z A;  3QPL A;  1DGW Y;  2QQA A;  5FB2 A;  1P4A A;  2FUG 2;  2GWR A;  2V26 A;  4IOA F;  1U5T B;  5E8G A;  3BR3 A;  3KP2 A;  1OYI A;  2XB0 X;  3HZJ A;  1K7A A;  4H0E A;  1KU2 A;  1LPQ A;  4OAY A;  4KNY A;  2BOL A;  5HOD A;  3CCY A;  1XGN A;  3V7R A;  3BPV A;  2KIQ A;  3LOC A;  3DCF A;  3F22 A;  2FNA A;  5BPD A;  1E3H A;  2TRT A;  3ZMT A;  2EZI A;  2EQR A;  4GYG A;  3FMR A;  2AXT C;  2XGX A;  2VJ5 A;  2R7O A;  1J09 A;  1POG A;  1EF4 A;  4BL0 B;  2R5Z B;  2KIS A;  3A1Y A;  4AID A;  2D5V A;  1SAX A;  2OJE D;  5J3L A;  1B6A A;  3AG4 H;  2IRF G;  2KIM A;  4LMY A;  5D4R A;  4I76 A;  3DTE A;  1G4D A;  1O4X A;  4IHW A;  1WJC A;  4IVN A;  3FBI B;  2CW0 F;  4LD5 A;  4CSW A;  4RAG A;  5HVQ C;  4I09 A;  2EFN A;  3PSF A;  4D0P A;  3BCB A;  3H92 A;  3I55 I;  2O5R A;  1H88 C;  3T0Y A;  4F52 A;  3SXY A;  2H94 A;  4KFC A;  2EFO A;  5E1X A;  1VFC A;  3JAM K;  3E5U A;  3HTU A;  1AKH B;  3IWZ A;  4AM3 A;  3WOD F;  3L2V A;  4MHG A;  1B9M A;  3LNQ A;  3RQ4 A;  2GM4 A;  2B0L A;  3S3N A;  1LUJ B;  5ICG A;  2M0C A;  2D2W A;  2LKS A;  3U21 A;  5F0C A;  2BE5 F;  3P7N A;  3HOX J;  3V7C A;  4V19 K;  3PJR A;  3RCO A;  1UCR A;  4MLO A;  3B6C A;  4LK0 F;  4IQJ A;  3S15 J;  1ETK A;  1S29 A;  3BT9 A;  2HPI A;  3QYF A;  3CJN A;  1ZEL A;  3TMO A;  2M9H A;  4Y7N J;  3HYI A;  2P7V B;  2ISZ A;  1W36 D;  1JJ6 C;  2FJ1 A;  3ABU A;  5HNH A;  4F93 B;  1KU9 A;  2BW3 A;  2LBF A;  1HDP A;  3H0G J;  2VB6 A;  2CV1 A;  3LSM A;  2IAI A;  1I3A A;  4GGG A;  2FX0 A;  3BP8 A;  1MW7 A;  3SEQ A;  1LDK B;  2IGO A;  3QRF F;  1GDT A;  1FOW A;  4MIM A;  4XKC A;  5B1B H;  4KIT B;  5BOX A;  1FX7 A;  3O8G A;  5L3E A;  4HF2 A;  5L3D A;  2IA2 A;  3VWB A;  2FNP A;  3IWF A;  3PFY A;  2W1O A;  2HOA A;  1SD5 A;  2IGN A;  1D0Z A;  1IRX A;  2RKH A;  3IH4 A;  2XAG A;  3HOW J;  1MMS A;  1UB9 A;  1VTN C;  2DXI A;  1KON A;  5L3G A;  1BM9 A;  5H6R A;  3MKL A;  5EGO A;  4MGR A;  1HST A;  4ZTF A;  2DA3 A;  4IHX A;  2DPU A;  5D6E A;  3JRI A;  1P4X A;  2E1C A;  4IPA A;  4NQW A;  4FQG A;  3J81 Z;  4WF2 A;  4Y13 A;  3MFK A;  3HGY A;  2Y69 H;  3G71 I;  2NVQ J;  4L9T A;  2IEK A;  4AUX A;  5HNF A;  2LY2 A;  5IYC J;  3RYP A;  2ME6 A;  1Z1D A;  2XIG A;  1W5T A;  2KJB A;  4E7S A;  4DJA A;  4IO9 F;  3AFH A;  1F36 A;  3FXJ A;  4RM2 A;  4XM3 A;  3ABM H;  3M9A A;  3H3U A;  4LOC A;  2PJR A;  4EAT A;  5GTI C;  5CYV A;  3U9G A;  2W84 A;  5K7H A;  3E6C C;  1W4M A;  2K9S A;  3OS1 A;  1KYW A;  4U0Y A;  2Y0S A;  2V6C A;  2GZW A;  1BR1 A;  1ETY A;  2F48 A;  2LBF B;  2BY1 A;  1EV7 A;  1LB2 A;  3F8N A;  4YII A;  4G12 A;  4A3J J;  1C0W A;  2QF7 A;  4Y3O A;  4EJU A;  3W6J B;  5L3C A;  3H9Q A;  3H36 A;  4LIU A;  2VC0 A;  5FO5 A;  2I8D A;  1MBG A;  1U8B A;  3H5A A;  2JA5 J;  1Y8R B;  2MGQ A;  3VEP A;  1JTY A;  1MJ9 A;  2Y75 A;  3I56 I;  3Q0W A;  2H1K A;  5M3M J;  2HYF A;  2PQ8 A;  4WXC A;  2QSF X;  2Y48 A;  4A3G J;  5HS7 A;  3A2K A;  1WH7 A;  4HG2 A;  3HHG A;  1EJ9 A;  1XN7 A;  1X2M A;  3D0S A;  3TQN A;  2ADU A;  1APL C;  1ZG1 A;  4G6D A;  3KLO A;  4X6A J;  1KQ0 A;  3HUG A;  1IC8 A;  2YU9 J;  2DA2 A;  2EBI A;  2A6T A;  1W0T A;  4NQW B;  4XRS A;  1IRZ A;  3DPL C;  1TNS A;  3E6B A;  3AAF A;  2K3P A;  2OAZ A;  5K7Z A;  2EV0 A;  4AYB A;  3GTG J;  4G8X A;  5KAI C;  3WTW C;  1J2X A;  3ERM A;  1H8A C;  2GXA A;  2PJR B;  2P5V A;  2DA1 A;  2LP0 A;  2FF4 A;  2NS8 A;  4UV9 A;  3HB9 A;  2VI6 A;  4E7Z A;  4ESJ A;  1J0R A;  1XSD A;  3ZQL A;  3I3L A;  3GTM J;  2LD5 A;  1YX5 A;  3CUO A;  3DTI A;  5D5V B;  3UR3 C;  1VQ4 I;  1RET A;  2W7N A;  4C3J J;  3GCM A;  3SEZ A;  2MD0 A;  4IHS A;  3O8H A;  5D5X B;  2CUE A;  3K1N A;  2O3F A;  2ZC2 A;  3K7A J;  1K61 A;  1LKX A;  4V2F A;  2CQ7 A;  5F0H A;  1VQ5 I;  4UHT A;  5LFA A;  3WU2 C;  4ENN A;  3I4M J;  4Y15 A;  4Y17 A;  1O3R A;  2G7U A;  4P9U A;  1U6G A;  2NS0 A;  4BQQ A;  2LY1 A;  2QLZ A;  1IXS B;  1X2N A;  2XAF A;  2XUB A;  1TQM A;  4BDZ A;  2K02 A;  1X19 A;  5KAF C;  3OL4 A;  4A3M J;  2RNJ A;  4O3M A;  4D9J A;  3CD6 I;  1UJ8 A;  2VE8 A;  1RRJ A;  1XB4 A;  2H8W A;  4GDF A;  3JR9 A;  3J81 K;  1Y39 A;  1MJA A;  3C2H A;  4KDP A;  3F3X A;  2Y2Z A;  2NVY J;  3BPX A;  5F04 A;  3ZGK A;  1T2K A;  4BBS J;  3B6A A;  3HUG B;  1ZHF A;  5B66 C;  2IT0 A;  2PX9 A;  2DAO A;  2WAF A;  2NXN B;  3G1M A;  4N4O B;  1H9G A;  3HBL A;  3JRB A;  5K5Q A;  1DPR A;  4XSX F;  2CU7 A;  4RM3 A;  4IQ4 A;  4BHP A;  2CQK A;  2HR3 A;  3C3W A;  1Y0U A;  3DV8 A;  4UVC A;  4KMF A;  3ZQI A;  2IS1 A;  4LIV A;  1I39 A;  4W1U A;  3FM5 A;  2D45 A;  3MZH A;  2Z16 A;  4I6Z A;  1MD0 A;  2CYY A;  2KIU A;  3WHB A;  1VQ7 I;  3BTC A;  5CJ9 A;  1LVA A;  3T8R A;  2E2J J;  1IG7 A;  3A0B C;  3LA7 A;  1UHM A;  4L5E A;  3RJP A;  3V7S A;  3HOS A;  2HTS A;  2HQA A;  5K5O A;  5LHI A;  4ITV A;  4HF0 A;  2XPW A;  4Q4Z F;  3HOV J;  1MBH A;  2ME0 A;  4E7J A;  2O8K A;  2F4M B;  2AS5 F;  1PUE E;  1LDD A;  3ABT A;  2OZ6 A;  3GFM A;  4FTH A;  1TNT A;  2GOX B;  2L4M A;  3EUK L;  2O0Y A;  4N0B A;  4O5V A;  2HEO A;  4Z6Y A;  1Z6T A;  3CZ6 A;  3S8P A;  3SFI A;  4LFU A;  2L9N A;  1X1B A;  2GXB A;  1SAU A;  4KT6 A;  2CGP A;  3J7A Y;  4AIJ A;  3HRU A;  4NC8 A;  1ZLJ A;  1R22 A;  4PJM A;  3TDZ C;  4HDV A;  1WJ5 A;  3CCU I;  1FJL A;  4CCM A;  4O6J A;  1SVO A;  2MC3 A;  1OR7 C;  2RQQ A;  2PEX A;  2X6O A;  3WTT C;  3OY9 A;  5F0F A;  4U7B A;  2L2O A;  3E6M A;  1T33 A;  2GXG A;  1S7E A;  4Q47 A;  3KEO A;  1R00 A;  1UFM A;  3QAH A;  1K4T A;  5TGT A;  2IPQ X;  3PUB A;  1FYL A;  1R5I D;  3ZR8 X;  2BHZ A;  3GEZ A;  4AU7 A;  3MKW B;  2JVH A;  2L54 A;  1LFP A;  2WA0 A;  3OV8 A;  2UWM A;  2DFI A;  3DPT A;  2ETH A;  2V7F A;  3QOP A;  4CCJ A;  1F9N A;  2HQN A;  2IBD A;  2XPV A;  1NG6 A;  4XR6 A;  4B09 A;  3CCS I;  3FM3 A;  4F3Q A;  5DD4 A;  1OCP A;  2MG4 A;  1USS A;  1ON1 A;  2PBI A;  5LEK A;  3EUA A;  5A2Q K;  2MA3 A;  5EEH A;  4BH9 A;  4DBR A;  2OQG A;  4BE2 A;  4YFK F;  3DKX A;  3RKQ A;  2FA5 A;  2DJN A;  3IRQ A;  2JPC A;  3W6V A;  4RMN A;  1UEL B;  4C9Y A;  1P92 A;  4DNC A;  1JKO C;  3L2W A;  5LGT A;  4CDG A;  1G8X A;  2R7F A;  5FLX Z;  2M2E A;  1WI9 A;  3PIO F;  1PDN C;  2F5E A;  4M9S A;  2FE3 A;  1ZLK A;  2VL8 A;  1IRG A;  2E1M B;  1X3Z B;  3QQA A;  1Z7L A;  4EM1 A;  4XLN F;  3CCL I;  1BJA A;  1BI1 A;  4XBF A;  1Z05 A;  2DBB A;  4HV6 A;  2HQR A;  2LKX A;  2KFD A;  4PZJ A;  2F4O B;  2QSG X;  3JRF A;  2STT A;  2XVC A;  2RC4 A;  5LRR A;  3R0A A;  3LAP A;  2ZXJ A;  4B8X A;  3I71 A;  4PK4 A;  3WGG A;  1VQP I;  3IHU A;  1P9Q C;  3D5L A;  2DMU A;  2CG4 A;  2EV5 A;  3G3Z A;  1QRY A;  2Z2S B;  1OPC A;  2QSH X;  4YIF A;  1OLT A;  2ZXH A;  3RSN A;  2KIF A;  5M3F J;  2P6S A;  4ZYD A;  3RKY A;  3DBH B;  1Z77 A;  1OCO H;  3PNY A;  4ENK A;  1T08 B;  1ORK A;  5ICC A;  4P5O A;  1KQ9 A;  2Z5U A;  3SHF A;  1WGX A;  3OSF A;  3Q3S A;  4L9J A;  2FOK A;  6PAX A;  4ZYA A;  4OIN F;  2EZL A;  2CFO A;  4G9Y A;  2X1E A;  3NQO A;  5M5X J;  3UNG C;  5KNL A;  4C2T A;  4IEJ A;  1TW3 A;  3DP7 A;  4PUS A;  5LLQ A;  2IGM A;  3FXQ A;  4LB6 B;  5IP6 A;  4WX9 A;  1ONV A;  1BA5 A;  2TCT A;  1ZR4 A;  3VOD A;  1OR7 A;  1UST A;  2EA2 A;  3GF2 A;  3E0J B;  1YS6 A;  2VXZ A;  5B3S H;  1VQ9 I;  5CPR B;  3WTS C;  1QHH D;  3ZPL A;  1OMI A;  2EJR A;  1W5C C;  4RB0 A;  3J7A O;  5L3F A;  1TL8 A;  2OZU A;  1U9O A;  3F8F A;  4A5M A;  1UMQ A;  1MIJ A;  2WB1 N;  1VQ6 I;  2JA8 J;  4RGS A;  3EYY A;  1R5H A;  3HOT A;  4XLF A;  2CJJ A;  5HLH A;  5HDK A;  2VT2 A;  2EIL H;  4B1R A;  4XOR A;  2H6B A;  3KFW X;  2E2H J;  2DN0 A;  3LQR A;  4MFE A;  4A3L J;  1TWA J;  2HI3 A;  3BRO A;  4GO1 A;  1Y8Q B;  2COB A;  3CF5 F;  1L3L A;  2DA6 A;  1LQ1 A;  3PO3 J;  4L9V A;  1XC5 A;  3H5N A;  5KK1 A;  1BN5 A;  3FHZ A;  4PFO A;  4AC0 A;  4IHT A;  5K1Y A;  4LK1 F;  1U2W A;  2HVQ A;  1W7P A;  2MC4 A;  5AIP A;  1ZGW A;  1UHS A;  1FBU A;  2XDV A;  4RAF A;  3BG5 A;  3FF5 A;  3WGH A;  5IT3 A;  1S72 I;  4YG2 F;  2DT7 B;  3H35 A;  1D8K A;  2VJJ A;  5JLW A;  1GUU A;  1BI3 A;  4BJ6 C;  3G6E I;  2HS5 A;  2A68 F;  1W7P D;  3BR1 A;  4HX4 A;  3IV5 A;  2QQB A;  3JAM Z;  2MAB A;  1WRJ A;  4N9I A;  2JK3 A;  2FQ3 A;  1WHU A;  4BXU A;  1R9T J;  4XLH A;  4E7L A;  1P6R A;  5H20 A;  3V8J A;  2VN2 A;  4UXN A;  2UXX A;  3HL2 A;  4L5J A;  4DQ2 A;  3R61 A;  2GIV A;  1S5L C;  2X6X A;  3PO2 J;  2QGU A;  2LF8 A;  4G7Z F;  4A5N A;  1IAW A;  4I7H A;  3S17 J;  2H09 A;  3SZP A;  2ID6 A;  4BS9 A;  1XGS A;  3TP3 A;  1S8N A;  1AHD P;  3G1O A;  5CVI A;  3FHN A;  2X1C A;  4FE7 A;  5LGU A;  3HSE A;  3MZ8 A;  2K4B A;  3CTA A;  1N77 A;  5DTD A;  2Q1Z B;  4B3A A;  3BG3 A;  5FFZ A;  2OCE A;  1G3T A;  4PJL A;  4ZH4 F;  3ZN0 A;  4OIQ F;  2X9D A;  2V9K A;  2D1V A;  2GIZ A;  4ABZ A;  4L9N A;  1XD7 A;  1Z7U A;  2HFH A;  4I2O A;  3JCU C;  4ZDP A;  1O3S A;  3GFJ A;  1JKP C;  3IUO A;  4KMU X;  2XRN A;  1VQ8 I;  1LEA A;  1JTX A;  2WAE A;  3BR2 A;  1W7P B;  5LBQ A;  2KRC A;  2MH9 A;  2GOM A;  1MBJ A;  2CUZ A;  4N9H A;  4XLC A;  4EEF G;  1VQO I;  1W36 C;  2VKV A;  5CVJ A;  3J80 K;  3CDH A;  3KIO A;  1E2X A;  1IUY A; 
#chains in the Genus database with same CATH homology
 3B73 A;  3KZY A;  1V3F A;  3RDI A;  3LST A;  2LKP A;  3LQQ A;  4UUV A;  3FMS A;  2DTR A;  1SMT A;  1GVJ A;  5DCF A;  4HX8 A;  3COA C;  1FP1 D;  4ZZL A;  3HSF A;  2WV0 A;  5DUI A;  5E1Z B;  3GFL A;  3P9K A;  3C7J A;  3VFZ A;  4CXF A;  2A07 F;  1QO0 D;  1WWX A;  1FNN A;  1O3Q A;  2FU4 A;  3WTV C;  2DU9 A;  5BPI A;  4JQF A;  1XDS A;  1JE8 A;  5CLS A;  1XGM A;  1FYK A;  3GO5 A;  2MH2 A;  2P6T A;  4ON0 A;  2IJL A;  1B1B A;  5D8L B;  1H0M A;  3FWE A;  4LLN A;  2HZT A;  1Z9C A;  2ZFW A;  2YU3 A;  3MWM A;  5KVR A;  4RB3 C;  1R5G A;  4CHU A;  1J75 A;  3R0J A;  2M8E A;  4OMY A;  4TV7 A;  4WXD A;  2P7C B;  5HLI A;  1DP7 P;  2WC2 A;  3IKT A;  2BYV E;  2XRO A;  1YLF A;  2O8X A;  1TLH B;  5AON A;  3RPQ A;  1RI7 A;  4IRI A;  1S7A A;  3BJ6 A;  3ML6 A;  5E8I A;  2H6C A;  2LF7 A;  2J5O A;  4IJA A;  2GAU A;  2ZNZ A;  4ZYH A;  3Q9S A;  3WTU C;  2W85 A;  2E7W A;  2JTV A;  2K27 A;  1ZG3 A;  5DYM A;  1SMY F;  3RKX A;  2HGC A;  5F6F A;  2Z33 A;  1E17 A;  2KJC A;  3V4G A;  4OIR F;  4A0X A;  4E70 A;  3H3Z A;  1IZ1 A;  4I02 A;  1FSH A;  5D5W B;  1FBS A;  4JBA A;  3N97 A;  2F5F A;  2F2E A;  2XAH A;  1KQ8 A;  2Q2E A;  3TOA A;  1O57 A;  1SFU A;  1ZAR A;  3DKW A;  2OA4 A;  3GZ6 A;  2VOO A;  1TQI A;  3F23 A;  1IN5 A;  3I59 A;  2L3D A;  2K7L A;  4Z2Y A;  4OIO F;  3E6D A;  3LA2 A;  4KUM A;  5AIQ A;  1OKR A;  1SFE A;  2YSR A;  5J8F A;  2FSW A;  5ED4 A;  1ZGJ A;  3P9C A;  1MJB A;  2DI3 A;  4MEY F;  3OOP A;  5CVU A;  2V1D A;  4BQA A;  3KCC A;  1Z91 A;  1YFH A;  3P9I A;  5EEG A;  3PQK A;  2EB7 A;  2ELH A;  4UVA A;  2ESH A;  4HOB A;  1ZGA A;  1JHF A;  2Z99 A;  4MQ9 F;  1S7O A;  3ZN1 A;  2J5P A;  2V1U A;  3MZY A;  4HAM A;  1G3Y A;  2M87 A;  5ILV A;  2KKO A;  1FC3 A;  1YG2 A;  2FBI A;  1SD4 A;  4F7Z A;  3S2W A;  3I59 B;  5DUK A;  4EVI A;  2V79 A;  4A0Y A;  1HBX G;  4LB5 A;  2JRT A;  4CGZ A;  2R3S A;  1HQC A;  2P5K A;  3LA3 A;  4A6D A;  2DQL A;  2FXA A;  3L00 A;  5LHH A;  5A2Q Z;  1ZAO A;  1HXD A;  3HIF A;  1GXP A;  4ENJ A;  2YX7 A;  1T38 A;  1I5Z A;  4EGY A;  1RUN A;  3ULQ B;  3K2Z A;  3KP7 A;  4M9Z A;  1XSV A;  3ZMZ A;  5LGN A;  4FX4 A;  2M45 A;  2DLL A;  2EA4 A;  1YTY A;  3ZP5 A;  2MBF A;  1YIO A;  4A2U A;  2ISY A;  4EJW A;  4P55 A;  2LDU A;  4ETS A;  5HDG A;  2FMY A;  2P4W A;  4P96 A;  1R58 A;  3QPT A;  3KLN A;  2QUF A;  4L18 B;  3GLX A;  1BOA A;  1O7F A;  2HKO A;  3I58 A;  2P8T A;  2X4H A;  3I53 A;  1LEB A;  1P2F A;  2QEN A;  1TBX A;  1KGS A;  3ZMU A;  2K86 A;  3E5X A;  4MQV A;  1PP7 U;  4HQM A;  1XSX A;  1R1T A;  1XCB A;  3NRV A;  1YO5 C;  3B02 A;  2L4A A;  2IA1 A;  4MTE A;  4MNU A;  2OU2 A;  1LNW A;  1B4A A;  1MDM A;  1XMA A;  2ZKZ A;  5LRS A;  4G7O F;  3KZZ A;  4Q48 A;  3F8M A;  4KN4 X;  1FZP B;  4BHB A;  2VC1 A;  4KIG A;  3WTX C;  3BWG A;  3NEU A;  3EDP A;  2NRA C;  2UZK A;  2TDX A;  2DO7 A;  3RKW A;  3EYI A;  1HKT A;  3ECH A;  2ZCW A;  4I98 B;  2A6H F;  1KA8 A;  4IXA A;  3IRR A;  4I01 A;  1HKS A;  4KN7 X;  4CIC A;  1FT9 A;  3FMQ A;  2QVO A;  2VE9 A;  5E20 A;  2VBW A;  2QM3 A;  1G6N A;  4ASN A;  1FOK A;  2FML A;  2NAZ A;  2HOE A;  3BJO A;  2QBY A;  2BEO A;  2ZBK A;  2VBX A;  3CO6 C;  1T6S A;  5FD5 A;  1TTY A;  1SD7 A;  2VON A;  2BBY A;  4M71 A;  5ILU A;  2CO5 A;  1T0F A;  4HLY A;  1BBY A;  4HV5 A;  1QQI A;  4AWX B;  3BOQ A;  2RN7 A;  3J80 Z;  3T1B A;  1R1V A;  2VT3 A;  4OMZ A;  1O3T A;  1O7L A;  3GW2 A;  4ZYE A;  5JVT A;  3SZT A;  2D1H A;  1R7J A;  2HWV A;  4ESB A;  3M1E A;  1P4W A;  3ZQ7 A;  1U8R A;  4OU0 A;  2QBY B;  4A0Z A;  4IRH A;  1F4K A;  1B59 A;  4M72 A;  3WE3 A;  1RUO A;  1FY7 A;  1ZRF A;  4HX7 A;  2OBP A;  1DUX C;  2Z9O A;  4LLL A;  5FFX A;  1XMK A;  5BS6 A;  1MKM A;  5K5R A;  5D4S A;  2KRF A;  4BYY A;  4M6X A;  1SD6 A;  3HRS A;  4YFX F;  1RIO H;  2PI0 A;  2XKO A;  2DT5 A;  4ZYG A;  2CWE A;  1BIB A;  3M8E A;  1KU3 A;  1FWZ A;  2NNY A;  4XSZ F;  3I5U A;  3F21 A;  5F64 A;  2IW5 A;  3JSP A;  3F6O A;  2Q0O A;  3KEQ A;  1U78 A;  1ZYR F;  2M5W A;  3F6V A;  4S04 A;  2W24 A;  2DQR A;  2STW A;  5HLG A;  5D5U B;  2GA2 A;  5FGM A;  3QPH A;  3ISP A;  5ERI A;  3K1M A;  2FEZ A;  1J5Y A;  2XV4 S;  1G3W A;  4EQQ A;  3CO7 C;  3I54 A;  2XAJ A;  4YFN F;  1YYV A;  1A04 A;  4EJV A;  4GCV A;  1BC8 C;  1JHH A;  5IT9 K;  4QLC U;  1EH8 A;  4IRG A;  3TOB A;  1QNT A;  1ZRC A;  1ZH5 A;  4L5I A;  2WTE A;  4A12 A;  3L09 A;  1FBQ A;  3L2C A;  4EMS A;  4G6Q A;  1LJ9 A;  2K4J A;  3K69 A;  5BQT A;  3BDD A;  2V1X A;  3I64 A;  4A6E A;  5TRD A;  4RAY A;  4EJT A;  1G3S A;  3I4P A;  4HZF A;  3IKV A;  1H9T A;  4EM0 B;  5ILS A;  3U2R A;  1EH6 A;  2EWN A;  3FXR A;  1Z6R A;  4U88 A;  1SFX A;  3TKY A;  4CYD A;  2PN6 A;  4I0B A;  3EUH A;  3QP5 A;  4JK1 X;  2ZME A;  2BGC A;  3DFG A;  4AIH A;  1QBJ A;  2PJP A;  2NNN A;  2O6G E;  5CVV A;  4LGW A;  1DDN A;  3F8C A;  4AVP A;  1IXR C;  3KP5 A;  5DV5 A;  3TO9 A;  1RNL A;  4ENM A;  5F1R A;  1IN6 A;  1ON2 A;  2HYG D;  3MAJ A;  2WWY A;  1REP C;  2FBH A;  4P9F A;  4MTD A;  2DK5 A;  2M30 A;  2JZY A;  2A6E F;  4CO8 A;  2PMH A;  1J9I A;  2CSO A;  2XAQ A;  2EK5 A;  2BV6 A;  2MD5 A;  1QZZ A;  4RGX A;  4RGR A;  2G9W A;  1IF1 A;  2G7H A;  3HSR A;  3SQN A;  1WQ2 A;  1ZRD A;  2R7D A;  3BZ6 A;  3V8L A;  3IC7 A;  3WU1 B;  3MQ0 A;  2ZME B;  2RDP A;  3SFZ A;  1OYW A;  3CLO A;  3REO A;  4EV0 A;  2W57 A;  3M7G A;  1AOY A;  2ZJ2 A;  3CUQ C;  2EFP A;  4BHC A;  1U3E M;  2XAS A;  2O03 A;  4WCG A;  1D5V A;  5DD8 A;  3KE2 A;  3GUD A;  2IP2 A;  2QZ8 A;  3ZMV A;  1HW1 A;  2MLG A;  5DEQ A;  4S05 A;  3G73 A;  4CZZ A;  4Q5S F;  4HLX A;  4ZZD A;  2UXN A;  2IA0 A;  4PDK A;  1AWC A;  2V9V A;  4KIB A;  2L01 A;  1IN8 A;  3QU6 A;  3JW4 A;  2ESN A;  5E18 F;  4HW0 A;  3Q5F A;  1S6L A;  1GXQ A;  5D8K B;  5JFR A;  3FXU A;  4WK8 F;  1R36 A;  1BI0 A;  2A5Y B;  2A69 F;  3LFK A;  2VBZ A;  2VOP A;  4UVB A;  3QP6 A;  2COM A;  4U7D A;  3L9F A;  3KP4 A;  3RIR A;  2ACJ A;  4L0Y B;  3JTH A;  2NYX A;  2QYO A;  4FT8 A;  3C1D A;  2YX4 A;  3RYR A;  1I1S A;  4KIC A;  2AXL A;  4AIK A;  2A61 A;  3I0T A;  1TQP A;  3R4K A;  1T98 A;  1RZ4 A;  1YW9 A;  5L3B A;  3CUQ A;  1X3U A;  2RQP A;  4LLG F;  5HS9 A;  1D3Y A;  1WKM A;  1R23 A;  3GXO A;  3M8F A;  1R1U A;  4RB1 A;  2XKP A;  1HSJ A;  3O2P E;  4RS8 A;  5HOO A;  3BY6 A;  4L0Z B;  3K1P A;  1STZ A;  4UNO A;  5DDG A;  1YQA A;  2QWW A;  3E3V A;  3FX3 A;  2A3S A;  3U1D A;  4KA4 A;  1UHW A;  1XDU A;  3BJA A;  3GX4 X;  1IW7 F;  2O61 A;  3HTS B;  1MGT A;  3KET A;  1IN7 A;  2E1N A;  3DEU A;  5LHG A;  4KIF A;  3GZ5 A;  1B9N A;  1KU7 A;  1JGS A;  3CUQ B;  3WE2 A;  4QWQ A;  4G94 A;  2MLK A;  1J59 A;  1D8J A;  3TGN A;  3LWF A;  2L02 A;  2VBY A;  1FYM A;  3T8T A;  1K78 A;  4U0W A;  5JI6 A;  5H6Q A;  4ESF A;  3TDU C;  4I0A A;  4R8H A;  3E97 A;  2JSC A;  1PP8 F;  3V8K A;  3TO6 A;  1FLI A;  2HKX A;  4KT5 C;  3WG9 A;  1ZG5 A;  2PLY A;  2XHK A;  2DW4 A;  2PMU A;  5HDN A;  2DPD A;  4R79 A;  5J6X A;  1T39 A;  2H27 A;  1EH7 A;  3ZMS A;  3ELK A;  5BMZ A;  5CVR A;  3ZMD A;  1NHA A;  3O3K A;  3WU0 A;  1I1G A;  3K0L A;  1MZB A;  2VOD A;  2Z3Y A;  1FP2 A;  4NB5 A;  4M6Y A;  4HBL A;  3TO7 A;  3MEX A;  1ZRE A;  3N4M A;  4FHT A;  3JSO A;  2E7X A;  4XRF A;  1K78 B;  3EQL F;  3VOE A;  4NHJ A;  3WTY C;  5JHU A;  1V4R A;  2Q8K A;  3PFI A;  5E1W A;  3FZV A;  1YS7 A;  4OIP F;  4EGZ A;  2ZNY A;  4UV8 A;  1L0O C;  3RTR A;  3HHH A;  4PGH A;  1J7K A;  4RAZ A;  4RB2 C;  1MDM B;  5JR3 A;  4LJZ F;  4LG0 A;  3DF8 A;  5IT9 Z;  3E5Q A;  4MEX F;  4PCQ A;  4BNC A;  1BIA A;  1BC7 C;  1QGP A;  5J8C A;  1CF7 A;  4KYW A;  1IN4 A;  1GHC A;  5FD6 A;  2JT1 A;  3RI4 A;  4HF1 A;  1JXS A;  4IF4 A;  4M73 A;  1KYZ A;  3GYH X;  1U5T C;  2EV6 A;  1WSU A;  3PQJ A;  1CGP A;  2OD5 A;  2OQR A;  3QU3 A;  1Q1H A;  1IRF A;  4HYE A;  3R6S A;  4FX0 A;  3MCZ A;  3RPU A;  2LSO A;  2GA1 A;  3GWZ A;  1W5S A;  3HRM A;  2F5C A;  1ZN2 A;  3R60 A;  2DK8 A;  2RGV A;  4G7H F;  2W25 A;  3JTG A;  2YR2 A;  5HS8 A;  1FPQ A;  4LG0 B;  1QZY A;  2Y0M A;  2RV8 A;  2FRH A;  5LEJ A;  2RVC A;  2P5L C;  4M9X A;  3ECO A;  1LDJ A;  4GYI A;  1CF7 B;  3LAJ A;  3F8B A;  3K9T A;  1TW2 A;  1QPM A;  2HDC A;  3L7W A;  3W6K B;  4R1H A;  3T5X A;  2ZO4 A;  3C18 A;  2X0L A;  1HW2 A;  4GXO A;  4AD9 A;  3O6B B;  2JPB A;  5DCM A;  1K6O A;  4HA8 A;  2QQ9 A;  1I6X A;  4OOI A;  2IVM A;  1YW8 A;  4WWC A;  2PG4 A;  4HQE A;  2F5D A;  2EFQ A;  4PGG A;  3IL2 A;  2YPR A;  3GVA A;  1U5T A;  1ULY A;  2GQQ A;  5TJJ A;  1BI2 A;  1ODD A;  4XLP F;  3ERE D;  1XCV A;  3DQV C;  4EM2 A;  2HTJ A;  2FBK A;  2LNB A;  5FLX K;  3DXJ F;  4BAY A;  3WGI A;  2EFW A;  3HRT A;  5E17 F;  3Q9V A;  1XGO A;  4M74 A;  1K79 A;  3KP3 A;  1FSE A;  4K2E A;  4U0V A;  5ICF A;  1HW5 A;  1OYY A;  1HKQ A;  3ROU A;  3GFI A;  4HDU A;  1F5T A;  2M1B A;  1I27 A;  3F72 A;  3VB2 A;  3EET A;  2C6Y A;  4EJO A;  1DPU A;  2CFX A;  5DCM B;  5ICE A;  4WXH A;  3WTZ A;  2PFB A;  1YW7 A;  4RGU A;  1S3J A;  1F1Z A;  1IXC A;  5D6F A;  3KP6 A;  2QQA A;  5FB2 A;  1P4A A;  2GWR A;  1U5T B;  5E8G A;  3KP2 A;  1OYI A;  1K7A A;  4H0E A;  1KU2 A;  4KNY A;  1XGN A;  3V7R A;  5BPD A;  3BPV A;  3F22 A;  2FNA A;  3ZMT A;  4GYG A;  3FMR A;  2XGX A;  1SAX A;  1B6A A;  2IRF G;  2KIM A;  4LMY A;  5D4R A;  1G4D A;  4IVN A;  4LD5 A;  2CW0 F;  5HVQ C;  4I09 A;  2EFN A;  4D0P A;  3H92 A;  3T0Y A;  3SXY A;  2H94 A;  4KFC A;  2EFO A;  5E1X A;  3JAM K;  3E5U A;  3HTU A;  3IWZ A;  3WOD F;  4MHG A;  1B9M A;  2B0L A;  5ICG A;  2D2W A;  2BE5 F;  3P7N A;  3V7C A;  1UCR A;  4LK0 F;  1S29 A;  3CJN A;  3HYI A;  2P7V B;  2ISZ A;  3ABU A;  1KU9 A;  4GGG A;  3BP8 A;  1LDK B;  3QRF F;  5BOX A;  1FX7 A;  5L3E A;  4HF2 A;  5L3D A;  2IA2 A;  2FNP A;  3IWF A;  1SD5 A;  2RKH A;  2XAG A;  1UB9 A;  1VTN C;  5L3G A;  1BM9 A;  5H6R A;  4MGR A;  1HST A;  2DPU A;  5D6E A;  2E1C A;  1P4X A;  4IPA A;  4NQW A;  3J81 Z;  4WF2 A;  4Y13 A;  3MFK A;  4L9T A;  3RYP A;  1Z1D A;  2XIG A;  1W5T A;  2KJB A;  3M9A A;  3H3U A;  5CYV A;  3U9G A;  2W84 A;  3E6C C;  1W4M A;  1KYW A;  4U0Y A;  2V6C A;  2GZW A;  1EV7 A;  1LB2 A;  3F8N A;  4YII A;  1C0W A;  4EJU A;  3W6J B;  5L3C A;  2VC0 A;  5FO5 A;  3VEP A;  1MJ9 A;  2Y75 A;  2HYF A;  2PQ8 A;  4WXC A;  2Y48 A;  5HS7 A;  3HHG A;  1XN7 A;  3D0S A;  3TQN A;  2ADU A;  1ZG1 A;  4G6D A;  3KLO A;  1KQ0 A;  3HUG A;  3DPL C;  1TNS A;  3E6B A;  3AAF A;  2OAZ A;  2EV0 A;  4G8X A;  3WTW C;  1J2X A;  2P5V A;  4UV9 A;  2FF4 A;  4ESJ A;  1J0R A;  1XSD A;  3CUO A;  5D5V B;  4IHS A;  5D5X B;  3K1N A;  2O3F A;  4UHT A;  4ENN A;  4Y15 A;  4Y17 A;  1O3R A;  2G7U A;  4P9U A;  1U6G A;  2NS0 A;  2QLZ A;  1IXS B;  2XAF A;  2XUB A;  1TQM A;  2K02 A;  2RNJ A;  4O3M A;  2VE8 A;  1XB4 A;  3J81 K;  1MJA A;  4KDP A;  3F3X A;  3BPX A;  1T2K A;  1ZHF A;  2IT0 A;  2DAO A;  1H9G A;  5K5Q A;  1DPR A;  4XSX F;  4BHP A;  2CQK A;  2HR3 A;  3C3W A;  1Y0U A;  3DV8 A;  4UVC A;  4KMF A;  3FM5 A;  2D45 A;  3MZH A;  1MD0 A;  2CYY A;  2KIU A;  5CJ9 A;  1LVA A;  3T8R A;  3RJP A;  3LA7 A;  1UHM A;  3HOS A;  3V7S A;  2HTS A;  5K5O A;  5LHI A;  4Q4Z F;  4HF0 A;  2AS5 F;  1PUE E;  1LDD A;  3ABT A;  2OZ6 A;  3GFM A;  1TNT A;  2L4M A;  4N0B A;  4O5V A;  2O0Y A;  2HEO A;  1Z6T A;  4LFU A;  2GXB A;  2CGP A;  4AIJ A;  3HRU A;  1ZLJ A;  1R22 A;  3TDZ C;  4HDV A;  4O6J A;  2MC3 A;  2PEX A;  3WTT C;  4U7B A;  3E6M A;  2GXG A;  4Q47 A;  3KEO A;  1R00 A;  1UFM A;  3QAH A;  2IPQ X;  1FYL A;  3GEZ A;  2L54 A;  3OV8 A;  2UWM A;  2DFI A;  3DPT A;  2ETH A;  3QOP A;  1F9N A;  2HQN A;  4B09 A;  3FM3 A;  5DD4 A;  5A2Q K;  5LEK A;  1USS A;  1ON1 A;  2PBI A;  2MA3 A;  5EEH A;  4BH9 A;  2OQG A;  4YFK F;  2FA5 A;  3IRQ A;  2JPC A;  1P92 A;  4DNC A;  5LGT A;  4CDG A;  5FLX Z;  2R7F A;  1WI9 A;  1PDN C;  2F5E A;  4M9S A;  2FE3 A;  1ZLK A;  1IRG A;  4EM1 A;  4XLN F;  4XBF A;  1BJA A;  1BI1 A;  1Z05 A;  2DBB A;  4HV6 A;  2HQR A;  4PZJ A;  2STT A;  2XVC A;  2RC4 A;  5LRR A;  3R0A A;  3LAP A;  2ZXJ A;  4B8X A;  3I71 A;  3WGG A;  3IHU A;  3D5L A;  2EV5 A;  2CG4 A;  3G3Z A;  1OPC A;  4YIF A;  2KIF A;  2P6S A;  4ZYD A;  3RKY A;  4ENK A;  5ICC A;  4P5O A;  1KQ9 A;  2Z5U A;  3SHF A;  4L9J A;  2FOK A;  6PAX A;  4OIN F;  4G9Y A;  3NQO A;  1TW3 A;  3DP7 A;  5LLQ A;  3FXQ A;  4LB6 B;  4WX9 A;  1ONV A;  3VOD A;  1OR7 A;  1UST A;  2EA2 A;  3GF2 A;  1YS6 A;  2VXZ A;  3WTS C;  3ZPL A;  1OMI A;  2EJR A;  4RB0 A;  3J7A O;  5L3F A;  2OZU A;  3F8F A;  4A5M A;  4RGS A;  3EYY A;  1R5H A;  3HOT A;  5HLH A;  5HDK A;  2VT2 A;  2H6B A;  3KFW X;  3LQR A;  3BRO A;  4GO1 A;  1L3L A;  1LQ1 A;  4L9V A;  5KK1 A;  1BN5 A;  3FHZ A;  4IHT A;  5K1Y A;  4LK1 F;  1U2W A;  1W7P A;  5AIP A;  1FBU A;  3FF5 A;  3WGH A;  5IT3 A;  4YG2 F;  1D8K A;  1BI3 A;  2HS5 A;  2A68 F;  1W7P D;  4HX4 A;  2QQB A;  3JAM Z;  1WRJ A;  4N9I A;  2FQ3 A;  4BXU A;  1P6R A;  5H20 A;  3V8J A;  2VN2 A;  4UXN A;  2UXX A;  4L5J A;  4DQ2 A;  3R61 A;  2GIV A;  2LF8 A;  4G7Z F;  4A5N A;  1IAW A;  4I7H A;  2H09 A;  3SZP A;  1XGS A;  1S8N A;  5CVI A;  5LGU A;  3HSE A;  2K4B A;  3CTA A;  5FFZ A;  1G3T A;  4ZH4 F;  3ZN0 A;  4OIQ F;  2D1V A;  4L9N A;  1XD7 A;  1Z7U A;  2HFH A;  4I2O A;  1O3S A;  3GFJ A;  4KMU X;  2XRN A;  1LEA A;  1W7P B;  5LBQ A;  2MH9 A;  4N9H A;  5CVJ A;  3J80 K;  3CDH A;  1E2X A;  1IUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...