4MHGA

Crystal structure of etv6 bound to a specific dna sequence
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
90
structure length
90
Chain Sequence
RLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRHYYKLNIIRKEPGQRLLFRFMKTPDEIMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Specific 14 bp DNA
publication title Steric Mechanism of Auto-Inhibitory Regulation of Specific and Non-Specific DNA Binding by the ETS Transcriptional Repressor ETV6.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 29
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4mhgA01
3F8CA 1OYWA 1MJ9A 1U78A 2ZNYA 3T8TA 4ZYGA 2VBXA 3DQVC 1ZYRF 4I0BA 4HF1A 3HOSA 4HV5A 4RS8A 3DPLC 1FX7A 1KQ8A 1QZZA 4KT5C 3WTTC 2P7CB 3RIRA 5BQTA 2V79A 1BN5A 3F8FA 3ZMTA 2XAFA 1ZGJA 4YFNF 4HX7A 3KP7A 1ONVA 2HEOA 5JR3A 3DP7A 1B59A 2OQRA 3K1MA 2XAHA 2F5CA 2VN2A 2E1NA 4WK8F 4PDKA 4PGGA 4IXAA 5E8GA 5JFRA 5E1ZB 4MNUA 1QQIA 2P5KA 3P9KA 2A6HF 3LFKA 4CXFA 1CF7B 3GZ6A 2Q8KA 3DFGA 3RJPA 4HQEA 2DQRA 2YX7A 1IW7F 4M72A 3GVAA 3QU6A 2E1CA 3NEUA 2W84A 1ZRFA 2JPCA 4GGGA 3ROUA 1BI2A 3WTUC 4L18B 1Z1DA 3TDUC 1YLFA 2FNAA 2VBYA 3PQKA 3VEPA 4HLXA 2CW0F 2XAQA 3WU0A 5FO5A 3SFZA 4H0EA 3RDIA 1ZREA 4HF0A 4CICA 4ZYDA 5DCFA 2PFBA 3LQRA 4HV6A 2Y0MA 1XGMA 4WX9A 4NB5A 5IT3A 1HBXG 5K1YA 1W7PD 2WTEA 4KN4X 2L4MA 4LLLA 3WTWC 2P5LC 1H9GA 3BJOA 2VODA 2PMHA 3BJ6A 3F6VA 3RPQA 3SXYA 1WRJA 2YPRA 3R60A 3I59A 1FYLA 2PEXA 2PG4A 3FWEA 4Q4ZF 2HOEA 5ILUA 3DPTA 1ZAOA 3QPHA 1K78B 2VE9A 2JPBA 4Q48A 4MEXF 1SD6A 3ABUA 5D4RA 4WXHA 3QOPA 2QQ9A 5JVTA 2LDUA 2O3FA 3R61A 2M45A 1SD4A 3EQLF 4GCVA 2KIMA 4B09A 4OIPF 1P4XA 4DNCA 1LDDA 2HKXA 2PMUA 3L00A 4P96A 3MAJA 4CYDA 5BOXA 3F23A 2XV4S 4K2EA 1TQPA 5E8IA 3I4PA 1YS7A 3U9GA 4Y17A 4BAYA 3BWGA 1O3TA 4KNYA 1FSEA 2CYYA 1OYYA 3IKTA 1IXCA 1LJ9A 3BPXA 5ICGA 4RGSA 3RKWA 2FOKA 3RTRA 5ICFA 2GIVA 3QP6A 5HDGA 3VB2A 2Q2EA 1KYZA 5JHUA 2YR2A 5L3BA 1MDMA 4MEYF 2RKHA 4N9HA 1U8RA 5LLQA 2W85A 2HS5A 1ZLKA 2D1HA 4XBFA 2STWA 3F6OA 1Z91A 3CLOA 4PZJA 1Y0UA 1ON2A 4A0YA 1FP2A 2GA2A 1YW9A 1XGSA 2Z99A 5CVJA 3ABTA 4CHUA 3GFLA 3E5XA 2JRTA 3ELKA 6PAXA 3T5XA 1YS6A 4P5OA 2AXLA 1EH6A 3E6MA 4WWCA 4MTEA 4ENMA 4EGZA 2VONA 4L5IA 2FMYA 2FE3A 4Y13A 5BPDA 4UV9A 2MH2A 2BEOA 1CF7A 1S7AA 1V4RA 4Z2YA 3EETA 1R1VA 2VXZA 1J2XA 5AIQA 2HYGD 5LHIA 1FOKA 4AD9A 1ZN2A 1KYWA 4FT8A 4I0AA 1O3SA 1YYVA 2DI3A 2QQBA 3E5UA 3GEZA 5ILVA 3BROA 3KZZA 2EWNA 2ELHA 1J75A 1P4AA 2MD5A 3WTXC 3T8RA 4IF4A 2GWRA 3CUQA 1BBYA 2P4WA 2R7DA 2Y48A 4YIFA 3DV8A 4KIFA 3HOTA 4R1HA 5E1XA 2F5EA 4A6EA 2EA4A 2ADUA 4CO8A 2FF4A 2OU2A 1RUOA 1UHWA 2RGVA 3CUQC 4OIRF 2TDXA 5LHHA 2YX4A 5FB2A 3VODA 3P7NA 3DXJF 1SD7A 2Z3YA 5D5WB 3HRSA 3HTUA 2ZXJA 4ZYEA 2A61A 3ZN0A 2A68F 4OIQF 2ZMEB 3M9AA 5HLIA 5LRRA 3WG9A 2COMA 4EVIA 3P9IA 3R6SA 3F22A 4GO1A 4UVCA 3D5LA 4KN7X 3W6JB 1K78A 1ZRDA 4UUVA 5HS8A 4AIJA 1MKMA 1IZ1A 3KFWX 3D0SA 1XD7A 2IVMA 4KFCA 2MA3A 2P6SA 2DAOA 2EK5A 2XIGA 3GFMA 4MGRA 5LEJA 4GYGA 3F8BA 3TOBA 4ASNA 4IRGA 1G6NA 1K6OA 4G6DA 2G9WA 2Z5UA 2VT2A 3V8JA 1FBUA 4A5MA 3TQNA 3V8LA 1HKSA 4I09A 1DDNA 3GWZA 3MFKA 4A0XA 4MTDA 2E7WA 1AWCA 4M9ZA 4G7ZF 2DK5A 1U6GA 1D5VA 4ETSA 2H27A 1XMKA 1PUEE 1MZBA 3COAC 3ZPLA 1TNTA 2VBWA 2DW4A 2V1UA 4M71A 4IJAA 4IHTA 1J9IA 1OPCA 2EFWA 3HSEA 1ZGAA 4JQFA 2ZFWA 2PJPA 4OMZA 5L3FA 1D8KA 2HQNA 1QBJA 4LB5A 3EYYA 2G7HA 3HRMA 2ACJA 3ZP5A 4QLCU 1OR7A 4CZZA 2RQPA 2F5DA 1BI0A 4YIIA 5BS6A 3LA7A 1ZG1A 4B8XA 2PQ8A 2GXGA 3O6BB 4UHTA 3KP5A 4Q5SF 1GXPA 4BH9A 2LSOA 3DKWA 2OA4A 3EUHA 4M9XA 1U5TB 3G3ZA 2P5VA 1BIAA 5LEKA 2JSCA 5DV5A 5BMZA 1SFUA 3DEUA 3I54A 2CO5A 1BOAA 3E97A 2PI0A 2MC3A 4JK1X 2UZKA 1W5SA 1RZ4A 1LDKB 1BIBA 5HDKA 3G73A 4IRIA 4O3MA 4P9UA 3U2RA 2D45A 1W5TA 2HZTA 2K4BA 1FYMA 5D8KB 4KDPA 4AIHA 5TJJA 5LGNA 4A2UA 2PLYA 2QLZA 3IHUA 1USSA 2ZNZA 4HYEA 5LHGA 1Z7UA 1REPC 1STZA 4G9YA 2F2EA 1YQAA 4CGZA 4RB1A 3FM3A 4LB6B 2Y75A 2ZBKA 1G3TA 3CTAA 1HKTA 1K7AA 1EH7A 3F72A 2DBBA 4Q47A 3RYPA 1UB9A 3HTSB 5FGMA 3V4GA 1SFEA 3IWZA 5CVIA 1JHFA 1Q1HA 3BDDA 1QZYA 2FEZA 1BI3A 1T6SA 5LGUA 4G8XA 3Q5FA 1R5HA 1S3JA 3IKVA 1FWZA 3QRFF 2STTA 2NS0A 1Z6RA 1R36A 2OZ6A 3WE2A 1F4KA 2FQ3A 2FRHA 2XAGA 3WGIA 2WC2A 1C0WA 3RKYA 2ZKZA 1W7PB 3CO7C 1L0OC 2A3SA 2O03A 4BNCA 2DO7A 5DUKA 3F8NA 2KKOA 2D1VA 1XGNA 1LQ1A 2KJBA 2EV5A 2HKOA 4KIGA 1TQIA 2W57A 3H3UA 3QU3A 2QYOA 5J8CA 2FBHA 1BJAA 2HWVA 3GX4X 1OMIA 1HSJA 2EFPA 2K27A 2BE5F 4KICA 3TDZC 5F1RA 3MEXA 2NRAC 3B73A 2VOPA 3F21A 3L2CA 2NYXA 3JTHA 3I64A 1NHAA 2K4JA 4OMYA 1DP7P 2JTVA 5LGTA 2C6YA 3ZMSA 1E2XA 2H6BA 1FP1D 2IA2A 4ENKA 3NQOA 2QQAA 1I1GA 1O7FA 1HQCA 4L0YB 1YFHA 2UXNA 2B0LA 4LK0F 3FM5A 2DPDA 3Q9VA 3GZ5A 5K5RA 4EM1A 4ENNA 5DD4A 4LJZF 3LWFA 1U2WA 2FBKA 2FU4A 5K5QA 4IPAA 4ZH4F 3TGNA 3J81Z 2X4HA 5ILSA 1DPRA 1KU9A 5HOOA 1KU3A 3HYIA 2R3SA 1XSXA 1HW2A 1R7JA 4LLGF 1U5TA 3KLNA 3HIFA 5HLGA 1FT9A 3CJNA 1O3RA 5DCMB 5LRSA 2GAUA 4EJVA 4RAYA 1HSTA 2QVOA 5CJ9A 2DK8A 1U5TC 1WKMA 3WTZA 4AVPA 3V7SA 3WGHA 3K0LA 4BYYA 5E20A 1RI7A 4LK1F 2CGPA 2Z33A 3O2PE 1ZHFA 4P55A 2XUBA 3B02A 2XVCA 2NNYA 1XB4A 2LNBA 2CFXA 5H20A 3R0AA 5D5XB 3W6KB 1KA8A 3FHZA 1IN8A 3VOEA 1JGSA 1TNSA 2BBYA 2VT3A 4LFUA 1XDUA 1R00A 4ESJA 4PGHA 3Q9SA 1QNTA 5H6QA 1XMAA 3C18A 2L02A 3JW4A 3N97A 1QO0D 1T39A 3E5QA 1S29A 2QBYB 2F5FA 1L3LA 5D6EA 1PP8F 1XGOA 3RPUA 2K02A 3MQ0A 3QP5A 2EJRA 2DQLA 4LG0B 4UVBA 1DUXC 2P6TA 4L5JA 1UFMA 5D5UB 1BC8C 2EA2A 1I6XA 1PDNC 1OKRA 1SMYF 4RB0A 1H9TA 1G4DA 1A04A 2IA1A 3MZYA 2VBZA 2XROA 3HSRA 4O6JA 4RB3C 5IT9Z 3E6CC 3WGGA 4L0ZB 5CVRA 1J5YA 3MCZA 4OOIA 3KP6A 4WXDA 1W7PA 3JSOA 3KZYA 3TO9A 4FHTA 2XRNA 3QPTA 3BJAA 2UXXA 1I1SA 3CUOA 2P8TA 1AOYA 1S8NA 3J81K 4F7ZA 2FNPA 3V8KA 4I01A 1KQ0A 4EM0B 1CGPA 3RYRA 1HXDA 1I5ZA 2QENA 5TRDA 2A6EF 1GHCA 2ETHA 3K1NA 5ERIA 2VOOA 1B1BA 5ED4A 3IRRA 1JXSA 3BOQA 4N9IA 3ZMZA 3REOA 1G3YA 3WTSC 4RGRA 5DEQA 1IN4A 4ON0A 4ESBA 1FLIA 3RKXA 1KU2A 5A2QK 3I59B 3V7CA 4Y15A 3R4KA 4WCGA 3V7RA 1FPQA 1FNNA 4NHJA 3U1DA 3LAJA 3MWMA 4FX0A 3WU1B 4OU0A 2HGCA 1IRGA 4R8HA 2QWWA 1YIOA 5FD5A 1G3SA 1LB2A 1WSUA 2AS5F 1FSHA 1FYKA 2HDCA 4LLNA 4HF2A 3N4MA 2FSWA 3E6DA 5D4SA 3LAPA 2H6CA 2BYVE 2KRFA 1MJBA 3OOPA 1TLHB 5CLSA 2MLGA 3M8EA 3PQJA 4XLPF 3FX3A 2V1DA 3K1PA 4HZFA 3H3ZA 1Z9CA 3KETA 1UHMA 1XDSA 3BP8A 4E70A 3HUGA 1KGSA 4HOBA 4OINF 4A6DA 3SZTA 1XSVA 5DDGA 1J7KA 3GYHX 3ZQ7A 5F64A 4MQVA 2XKOA 1O57A 5EEGA 3TKYA 2O6GE 5H6RA 2A07F 1D8JA 1D3YA 5AONA 2CQKA 1U3EM 3JAMZ 2HTSA 5J8FA 3BZ6A 5AIPA 4GYIA 3SZPA 1X3UA 4IHSA 3EYIA 2W24A 2O0YA 5IT9K 1S7OA 1LEAA 2ZJ2A 1ZH5A 2RVCA 1R22A 1ZG3A 2XKPA 2EFOA 4HLYA 4RB2C 3JSPA 1R1UA 2PN6A 1ON1A 2YU3A 2DT5A 4HX4A 3ECHA 3M8FA 5CYVA 4RGXA 1MDMB 4ZZLA 1XN7A 2QBYA 3GF2A 1LVAA 3LSTA 2H94A 2OZUA 1USTA 1MJAA 3OV8A 1XSDA 5DUIA 4LG0A 3DF8A 4BHPA 1TW3A 3I53A 5FFXA 2E7XA 2QZ8A 5L3CA 4XLNF 5E1WA 2GZWA 1HW5A 4YFKF 2RNJA 5ICEA 2G7UA 3LA3A 4KA4A 4U0YA 1T38A 1H0MA 3LQQA 3JTGA 4R79A 5L3EA 1WQ2A 5L3DA 3HHGA 3IL2A 2VC1A 3I0TA 4IRHA 2V1XA 1ZLJA 4HBLA 4XSZF 1ODDA 2D2WA 3BPVA 3SHFA 1WI9A 2L54A 3TOAA 4S05A 1IN6A 2X0LA 2ZMEA 5L3GA 1J59A 3FMSA 5K5OA 4L9JA 3GUDA 3KEOA 2A69F 2ISYA 5FD6A 3MZHA 2VE8A 4LMYA 4M73A 1R5GA 2OAZA 4GXOA 2BV6A 2A5YB 3CUQB 3ZN1A 5F6FA 4KYWA 2LF8A 2L4AA 3L9FA 4A0ZA 3S2WA 1YW8A 2ZCWA 1BC7C 1B6AA 2KIUA 1IAWA 4I2OA 1BI1A 5KK1A 3M7GA 4BHCA 4I02A 2RC4A 4PCQA 3C3WA 2M1BA 3KP3A 2FXAA 2HR3A 3ML6A 4G6QA 2FMLA 4HDVA 3T0YA 3WTVC 3I5UA 3JAMK 1OYIA 1WWXA 2EV6A 4CDGA 4EMSA 1TQMA 1IF1A 3ZMUA 4KIBA 2M8EA 5HVQC 3E3VA 1FBQA 1LDJA 4JBAA 2QUFA 3ECOA 4HA8A 3KP2A 1Z6TA 3K2ZA 1EV7A 2DLLA 1ZG5A 4U88A 2M30A 2MLKA 1XCBA 4MHGA 2MBFA 1F5TA 4G94A 1Z05A 3CDHA 1I27A 5BPIA 5HLHA 5CVVA 2VC0A 4L9NA 3K69A 2ZO4A 1RUNA 3L09A 4EJTA 3RI4A 1F1ZA 2OBPA 1RIOH 1SMTA 4O5VA 4KMFA 1T0FA 4HQMA 3ERED 2R7FA 2ESHA 3CO6C 2XGXA 5FLXZ 5FFZA 1ZRCA 3M1EA 3L7WA 1E17A 2O61A 3C7JA 3BY6A 1MGTA 3GO5A 3FMRA 1SFXA 1SAXA 2LF7A 3F3XA 4ENJA 2CWEA 4M6YA 4RGUA 5D8LB 4UXNA 1R23A 4EQQA 2EB7A 1YO5C 3K9TA 5LBQA 1T2KA 1ZARA 3WODF 3H92A 3HRTA 2KJCA 3PFIA 4U0VA 4QWQA 1S6LA 3HHHA 4EM2A 2UWMA 1JE8A 1IUYA 2MH9A 5A2QZ 2Z9OA 4UVAA 3FZVA 1UCRA 1GXQA 3C1DA 1F9NA 1JHHA 3I71A 3KEQA 3TO6A 2OD5A 3GW2A 3VFZA 3I58A 3ISPA 1TBXA 3FXRA 1IRFA 4ESFA 3QAHA 4XRFA 2KIFA 1EH8A 4M6XA 1T98A 2M5WA 2V6CA 3O3KA 1O7LA 4XSXF 1LNWA 2DTRA 1IXSB 1BM9A 3P9CA 2HQRA 3SQNA 4G7HF 2WV0A 2HFHA 1QGPA 2NNNA 1FZPB 3WTYC 3J7AO 2L01A 5JI6A 1TW2A 3ULQB 2YSRA 4A5NA 3IWFA 4EJOA 3FXUA 4OIOF 1J0RA 2K86A 5J6XA 2P7VB 2NAZA 4BXUA 1PP7U 4AIKA 2XAJA 2W25A 4HDUA 1LEBA 4G7OF 4EJWA 3F8MA 3J80Z 4M74A 2FBIA 4U0WA 1B4AA 1R1TA 2J5PA 2GQQA 4FX4A 2J5OA 4HAMA 4S04A 2IRFG 2EFNA 4UNOA 3T1BA 1YTYA 1IN7A 3KP4A 1TTYA 4RAZA 4LD5A 5E18F 4P9FA 5HS9A 1SD5A 2DFIA 1R58A 2V9VA 2L3DA 2IPQX 5FLXK 4HX8A 3WE3A 2IP2A 2JZYA 4EV0A 2K7LA 1P4WA 4DQ2A 1V3FA 1GVJA 3LA2A 3IRQA 2HYFA 4UV8A 3FMQA 3GLXA 4NQWA 1P2FA 2BGCA 3KE2A 2GXBA 4I98B 4L9VA 1K79A 4WXCA 5HDNA 1FC3A 2WWYA 3KLOA 3ZMDA 3GFJA 3E6BA 2HTJA 1VTNC 5DD8A 4YG2F 4BHBA 4YFXF 2LKPA 2IJLA 4U7BA 2DU9A 2GA1A 1B9NA 2QM3A 3EDPA 1DPUA 2IA0A 2EV0A 4I7HA 4U7DA 2IW5A 1IXRC 2PBIA 4M9SA 1YW7A 4EGYA 1HW1A 4ZYHA 5ICCA 1KQ9A 3HRUA 3GXOA 1FBSA 2H09A 4WF2A 2M87A 2CSOA 2XHKA 4IVNA 3HSFA 2Q0OA 2RN7A 5DYMA 5D5VB 2ISZA 1G3WA 2RV8A 2JT1A 2OQGA 5KVRA 5E17F 4ZZDA 4L9TA 3TO7A 3AAFA 3ZMVA 2CG4A 3FF5A 5DCMA 3KCCA 1YG2A 3FXQA 2XASA 4BQAA 1KU7A 1B9MA 1XCVA 4A12A 1IN5A 4D0PA 4HW0A 1P6RA 4TV7A 1ULYA 4LGWA 2DPUA 5D6FA 1FY7A 1MD0A 3NRVA 3J80K 5EEHA 1QPMA 4AWXB 4N0BA 3GFIA 4MQ9F 1HKQA 2IT0A 3R0JA 5HS7A 2ESNA 1O3QA 2EFQA 1RNLA 5CVUA 1P92A 4EJUA 2O8XA 1W4MA 2RDPA 3IC7A 4KMUX 4KUMA 2FA5A
chains in the Genus database with same CATH superfamily
3F8CA 1OYWA 1MJ9A 2Q2EB 4DOZA 1U78A 3PO2J 2FD5A 2ZNYA 3HB9A 2VBXA 2LBFA 3T8TA 4ZYGA 3DQVC 1S72I 1ZYRF 4I0BA 4HF1A 3BCBA 2V4JC 4HV5A 3HOSA 2Y30A 2HXIA 4RS8A 3DPLC 4BEHB 2K85A 1FX7A 1KQ8A 5EG0B 1QZZA 4KT5C 3WTTC 2P7CB 3RIRA 1TP4A 4MO7A 2V79A 5BQTA 1BN5A 5IP6A 3KX2A 5F08A 4DW6A 2YU9J 4IQJA 3NARA 4D1QA 3F8FA 3ZMTA 3QYBA 2XAFA 3HOVJ 1Y8QB 1ZGJA 4YFNF 3RZOJ 3OSGA 3VSKA 2XB0X 4HX7A 1Z21A 3S1MJ 4BU2A 2R5YA 1LVKA 2M7AA 2BZTA 2FUG2 3KP7A 1JT0A 1ONVA 2HEOA 5JR3A 3DP7A 1B59A 2OQRA 3K1MA 2XAHA 2F5CA 5B3SH 2VN2A 3IH2A 2VJIA 2E1NA 2B7EA 3H5NA 3LL7A 1RKTA 2LD5A 5EZHA 4WK8F 1VI0A 5GPCA 2NVUB 3KPHA 4PDKA 4PGGA 4IXAA 3OIOA 3OS2A 3JRDA 5E8GA 5JFRA 3OYAA 5E1ZB 3ONQA 2ZXIA 4IO9F 4CCOA 4MNUA 1OCPA 1LFBA 1QQIA 2P5KA 3O8GA 4A3FJ 2Y9ZA 1W36D 3B6AA 3P9KA 4QPOA 3RPUD 3ZR8X 3FXKA 2A6HF 1A6QA 1D1CA 2KLOA 4XKCA 3LFKA 4CXFA 1CF7B 2DA2A 3GZ6A 2Q8KA 2K40A 3DCFA 3DFGA 3RJPA 2AQFA 2AHQA 3PO3J 4HQEA 2LTPA 2DQRA 3Q0WA 2VIXA 4AVZA 2PMZN 2YX7A 1IW7F 5TISC 4M72A 1A6IA 3GVAA 3QU6A 3OSFA 2E1CA 3CMAI 4AIDA 3NEUA 2W84A 1BOBA 4NNJA 1ZRFA 3GTKJ 2JPCA 4GGGA 1SAUA 5EYRA 1U9OA 1HLVA 1SEUA 1HOMA 2DFHA 5DM6F 3OOUA 3HOYJ 3ROUA 1BI2A 3OIPA 4N4OB 1MBJA 3WTUC 4L18B 1Z1DA 2QKLB 2OC6A 3TDUC 1YLFA 4C3JJ 3OYIA 2FNAA 2VBYA 3PQKA 4YELA 4AYBN 3VEPA 1OCZH 4HLXA 2CW0F 2VL8A 2XAQA 1X4OA 3WU0A 2EIKH 4D9JA 3KYDB 5M5WJ 3SYTA 5FO5A 3DBLB 3SFZA 4H0EA 3RDIA 3G1OA 1K83J 1MNEA 2JVHA 4HF0A 1ZREA 4BJ6C 4CICA 4ZYDA 3K7AJ 5DCFA 2PFBA 3LQRA 4HV6A 3ZXSA 2Y0MA 4OWRB 1B72A 4HEA2 1XGMA 3HXLA 4WX9A 4NB5A 1JUMA 5IT3A 1HBXG 5K1YA 2W00A 3JRHA 1W7PD 3OR2C 1R4NB 2BY3A 2WTEA 4KN4X 2L4MA 4LLLA 3WTWC 3OYCA 2P5LC 1H9GA 3BJOA 2VODA 1MBHA 5JLWA 2E60A 2PMHA 2P81A 1QRYA 3BJ6A 3F6VA 4IKFA 3RPQA 1WJCA 3OR1C 3SXYA 1WRJA 1Y39A 3M8JA 3RCOA 2YPRA 2BY2A 3R60A 1UAAA 3I59A 5GAHJ 5M5YJ 3CD6I 1FYLA 2PEXA 2PG4A 1VQOI 2IS6A 3FWEA 4Q4ZF 2HOEA 1X2NA 4A93J 5ILUA 2JMWA 1WJEA 4PUSA 2NOJB 2CUFA 3DPTA 1ZAOA 1MSFC 4P1WA 3QPHA 3MVPA 1K78B 5JHFA 2JPBA 2VE9A 4Q48A 1VQ5I 4MEXF 1SD6A 2R7XA 3ABUA 3BG6A 3AL0C 1R4MB 1D1AA 5D4RA 4WXHA 3QOPA 3CMMA 1SVOA 2ZJRF 2QQ9A 3BR1A 1VQKI 5JVTA 2MG4A 2LDUA 2O3FA 2R7OA 3HKZA 3J7YJ 3R61A 2M45A 1SD4A 2KISA 3EQLF 1EKEA 2LMDA 1GUUA 4GCVA 3ZQGA 4XKWA 1Z3YA 2KIMA 5F0FA 4B09A 3G71I 4OIPF 1P4XA 4DNCA 1LDDA 2HKXA 4B44A 2PMUA 5HLTA 3L00A 4BGDA 4BY1J 4P96A 3MAJA 2FQ4A 2DODA 2OCEA 3PNVA 2XC7A 4CSWA 4CYDA 4A3CJ 2UV1A 4C3HJ 5BOXA 3F23A 1N25A 3CCUI 2XV4S 5J3LA 1U9NA 3ZQIA 4K2EA 1TQPA 5E8IA 3I4PA 1YS7A 3U9GA 4Y17A 4BAYA 4A69C 1JKPC 3BWGA 1O3TA 4BE2A 4KNYA 1MH4A 1B8IA 2CUEA 2NVYJ 3PIOF 4NBQA 4X0GA 3CCSI 4LITA 5FKLA 1RKWA 2DXIA 1FSEA 2CYYA 3A01B 1OYYA 3IKTA 3L2UA 1IXCA 1FIPA 1LJ9A 3BPXA 5ICGA 2YS9A 5IPAA 1NTCA 4RGSA 3RKWA 2FOKA 2KT0A 5JLXA 1H89C 3ZQQA 4D5FA 1W1WE 2XGDA 3RTRA 3TW6A 5ICFA 2GIVA 3QP6A 1JTYA 5HDGA 3VPRA 3K70D 3TEDA 3VB2A 2CH0A 2Q2EA 3DLAA 1KYZA 5JHUA 2B9SA 2YR2A 5CPRB 5L3BA 1MDMA 4MEYF 2RKHA 4N9HA 1F36A 3BR3A 1U8RA 3NWSA 5LLQA 1YRNB 3F9KA 2V7FA 2W85A 3L2QA 2X9DA 3SJMA 2HS5A 5IOZA 1ZLKA 3HOXJ 2D1HA 5EG0A 4XBFA 3HDDA 4C9YA 2STWA 3F6OA 1Z91A 3CLOA 2WAQA 4PZJA 1Y0UA 1ON2A 1SFOJ 1ACIA 4A0YA 3GTQJ 4LOCA 3A4CA 1FP2A 2WB1A 2GA2A 1YW9A 1XGSA 2Z99A 3HEFA 5CVJA 3ABTA 4CHUA 3GFLA 3MKYB 3E5XA 2JRTA 2LFBA 2I10A 5IYCJ 4OAYA 3ELKA 6PAXA 3T5XA 1YS6A 3G1LA 4P5OA 2DOEA 4M3BA 3IAM2 2AXLA 4V2GA 2OTJI 2R5ZA 1EH6A 2Y69H 4A3JJ 3E6MA 4WWCA 4MTEA 4ENMA 4EGZA 5DS9A 2VONA 1IRXA 2CS3A 4LIVA 4C3IJ 4L5IA 4CYCA 2FMYA 4HG2A 5GTIC 2FE3A 4UB6C 2KIQA 4Y13A 5BPDA 4UV9A 1V54H 4NUBA 2MH2A 3K4KA 2BEOA 1CF7A 1S7AA 1V4RA 1D5YA 5IYDJ 3CP8A 4Z2YA 3EETA 1R1VA 2VXZA 1J2XA 3J7ZI 5AIQA 2DOAA 2HYGD 4B48A 4A3BJ 5LHIA 1FOKA 4AD9A 1XPXA 1ZN2A 2EPFA 1KYWA 4G6TB 4FT8A 1XG1A 4I0AA 5C3EJ 1O3SA 1YYVA 2WV1A 1YX3A 2DI3A 4XRSA 2QQBA 3E5UA 3GEZA 5ILVA 1Y6IA 4CCMA 3BROA 3KZZA 2EWNA 2ELHA 1J75A 1P4AA 2MD5A 1W36C 1IUFA 3WTXC 3T8RA 4IF4A 1W5CC 2GWRA 3L2VA 2P0WA 3CUQA 3I55I 4ABZA 1BBYA 2IBDA 1I6HJ 2P4WA 2R7DA 3LSHA 2Y48A 3A02A 4NC8A 3DV8A 4YIFA 1HC8A 4KIFA 4Y7NJ 2X6WA 1X19A 1ETYA 3HOTA 4R1HA 2L7MP 5E1XA 3E1SA 2F5EA 3ZGKA 4A6EA 2R7TA 3MKZA 2F4OB 2EA4A 2HXOA 2ADUA 2V1NA 5GTHC 1Y56A 3LSMA 2YUSA 3VWBA 3ZQLA 4CO8A 2FF4A 2OU2A 1QA6A 3JCUC 1RUOA 1UHWA 2RGVA 3CUQC 4BACA 4OIRF 2TDXA 4XRSG 5LHHA 2KDZA 3JRIA 2YX4A 3OS1A 3DBHB 1YJWI 3MD2A 2B63J 2IAIA 5FB2A 4Z6YA 3P7NA 3VODA 3DXJF 1SD7A 3UKGA 2OJED 2ZJPF 2KZVA 2K3FA 2Z3YA 3HRSA 5D5WB 3HTUA 2ZXJA 4ZYEA 2A61A 3ZN0A 2A68F 4IQ4A 3K10A 4OIQF 2ZMEB 3BC8A 2ZC2A 2F48A 3M9AA 3ABKH 4XNFA 5HLIA 3ZRGA 5LRRA 3WG9A 1QU3A 2AO9A 2HDWA 2COMA 2I5UA 4ZTJA 3CJRB 3FKJA 4EVIA 2K9MA 2VQLA 3P9IA 3R6SA 3F22A 4GO1A 4HPQA 4UVCA 2CQQA 2VKEA 2VQCA 2O9LA 2F6CA 3DU5A 2DA3A 2R7UA 3JREA 1BR1A 3D5LA 4KN7X 2N8GA 3PUBA 3W6JB 2DMUA 1K78A 1ZRDA 3HGGA 4UUVA 2LREA 1OCCH 5HS8A 4AIJA 1MKMA 1IZ1A 3LSRA 3KFWX 1Z3XA 1WHUA 3D0SA 1XD7A 2IVMA 4D7NA 5FKMA 4KFCA 1BW5A 1P7IA 2A6TA 2MA3A 5J40A 2P6SA 1MMNA 1V5EA 3E0JB 1IDZA 3BTLA 2DAOA 3VYTB 2EK5A 2XIGA 3GFMA 4MGRA 5K7HA 4C2MJ 5LEJA 4XIDA 1SVMA 4M3GA 4GYGA 3F8BA 2CUZA 3TOBA 4ASNA 1JT6A 3M3YJ 1PYVA 4IRGA 5EEAA 1G6NA 2DA6A 1IJWC 1K6OA 4EEFG 4G6DA 4Y52J 2PMZA 2G9WA 2Z5UA 2VT2A 3V8JA 1FBUA 3BQZA 4A5MA 1E3PA 3TQNA 3V8LA 2JUCA 4ZDPA 5FJ8J 1ZELA 1HKSA 2IXSA 4I09A 4ANJA 1VQPI 1DDNA 2LH9A 3GWZA 3NWTA 3MFKA 3BR2A 4A0XA 2E7WA 4MTDA 1AWCA 4M9ZA 4G7ZF 2DK5A 4AYBA 5E3MA 1U6GA 4DBRA 5CQEA 2IGOA 1D5VA 4ETSA 3O8HA 2H27A 1XMKA 1OQYA 2M0CA 1PUEE 4B43A 3VYRB 1MZBA 5GAGJ 1UG2A 3COAC 4FE7A 2X6YA 3ZPLA 3IH4A 4QIWN 1TNTA 3GTOJ 4PJJA 2VBWA 1BA5A 2JA2A 2DW4A 2OPTA 3EUAA 2XRLA 2V1UA 4M71A 1OLTA 3S2DJ 4IJAA 3ABMH 5B66C 4IHTA 1J9IA 1OPCA 4IEJA 2WAFA 4QSHA 1WJ5A 4A3DJ 2QSHX 2EFWA 4CA0A 3HSEA 1ZGAA 5F1JA 4JQFA 2ZFWA 3HOUJ 5J4VA 1AKHB 4PJLA 1FOWA 2E19A 2PJPA 4OMZA 5L3FA 1G8XA 3BZKA 2DMTA 1D8KA 2HQNA 2VKHA 3DPUA 4RDUA 1QBJA 1AA7A 2FX0A 3S1RJ 4LB5A 3EYYA 5E79C 2G7HA 1YRNA 2HZDA 3HRMA 4XLAA 2ACJA 3ZP5A 4IHYA 3U1KA 1VQ8I 2DA1A 4QLCU 2L7FP 3CDIA 3JR9A 1OR7A 1LPQA 4CZZA 1X1DA 2ECCA 4FTHA 3FBIB 2RQPA 2F5DA 1BI0A 4YIIA 5BS6A 3LA7A 1ZG1A 2K9LA 2PQ8A 4B8XA 1A35A 3VDXA 2GXGA 4XR6A 1X1PA 3O6BB 4UHTA 3KP5A 2DTZA 1RESA 1GXPA 4BH9A 4Q5SF 3H9QA 1V5FA 2LSOA 3DKWA 2M9HA 2OA4A 5J4YA 2HYJA 2VKVA 3EUHA 4M9XA 4RA2A 1U5TB 3G3ZA 2P5VA 1OR7C 1BIAA 5LEKA 2JSCA 5DV5A 5J1YA 5J1RA 5BMZA 1SFUA 3DEUA 3I54A 3K6GA 3S17J 3HM5A 2CO5A 1AHDP 3K4MA 1BOAA 2XDVA 2E2JJ 3E97A 2PI0A 4XLHA 4YEJA 2CUJA 3PSIA 2MC3A 4PK4A 4JK1X 1Y1VJ 3EUHC 5EGOB 2ZFUA 1YJ9I 2UZKA 2RNGA 2LKXA 1W5SA 1JKOC 1RZ4A 2X85A 1LDKB 1BIBA 4DYQA 5HDKA 3G73A 4IRIA 4O3MA 1MBEA 4P9UA 3CC4I 1Z67A 3U2RA 2CQ7A 2IGMA 1W5TA 2D45A 2HZTA 2X1DA 2K4BA 2W48A 4CH7A 3J7AY 1FIAA 4XL9A 1FYMA 1NK2P 3OIQA 2JUGA 3BTIA 5D8KB 2CRGA 4BQOA 2ICWG 4KDPA 1IGNA 2K5CA 2W82A 3S32A 2CJJA 3A2KA 4LG3A 3SZGA 1MMGA 4AIHA 2NVXJ 2HI3A 4BBRJ 4XQFA 3M1CA 5TJJA 5K7ZA 5LGNA 2HOSA 4A2UA 2PLYA 2QLZA 3ABLH 4F92B 1VFCA 5F04A 1O4XA 3IHUA 4I99C 1USSA 4D7MA 4F3QA 2ZNZA 4HYEA 4PJNA 5LHGA 1Z7UA 2JA5J 2CQNA 1EF4A 3TMOA 1T95A 1REPC 1STZA 4UUSA 1PUFB 4G9YA 2M4KA 3OYLA 2O7OA 2F2EA 3H35A 3WG7H 4ZDLA 1YQAA 4CGZA 1TWFJ 4RB1A 3FM3A 2NS8A 4LB6B 2Y75A 2ZBKA 1G3TA 3PIPF 3CTAA 1RETA 1GV5A 1K7AA 4AUXA 1HKTA 1EH7A 2KRCA 3K4NA 3OL4A 3F72A 2DBBA 1YX5A 3EPZA 2ID6A 1N77A 4YRVA 4Q47A 1UHSA 3FXJA 3V42A 3RYPA 1UB9A 2RAEA 3HTSB 4DBQA 5FGMA 5M3FJ 3V4GA 1FTTA 1SFEA 2DMNA 2HQAA 5E3NA 3IWZA 3BQYA 1FOYA 5CVIA 1JHFA 1Q1HA 3BDDA 1QZYA 2FEZA 3OS0A 4G12A 4BY7J 3DBRB 2VI6A 1R9TJ 1GDTA 1BI3A 3K2AA 1T6SA 5LGUA 4G8XA 3Q5FA 1R5HA 2KZGA 1X1BA 1S3JA 1R5ID 3IKVA 2VJJA 1FWZA 4GRIA 3QRFF 3PNYA 2STTA 2NS0A 3C2GA 2HQ5A 1Z6RA 3S93A 1YE9A 2E71A 1R36A 1A31A 1VQ4I 2KMUA 2OZ6A 2R0QC 3WE2A 1F4KA 2FQ3A 1VZ0A 2FRHA 2XAGA 4XMYA 1IG7A 3GTPJ 2OUMA 3WGIA 2WC2A 3L2RA 4DJAA 1C0WA 3RKYA 2ZKZA 1W7PB 3CO7C 4RM3A 2BY0A 1L0OC 2A3SA 2M0MA 2O03A 1SFKA 4BNCA 1WZ2A 2DO7A 5DUKA 3DKXA 3F8NA 2R4GA 3RZDJ 2KKOA 1NG6A 2D1VA 1XGNA 1LQ1A 2KJBA 1BR4A 2EV5A 3K4JA 2HKOA 4KIGA 2ZXHA 4QPQA 1TQIA 3AG4H 5EJCA 2W57A 3H3UA 3QU3A 1IV6A 1MMAA 2QYOA 1ORKA 3QYEA 5J8CA 2FBHA 1BJAA 2HWVA 1OMIA 3GX4X 2VPRA 1HSJA 2EFPA 2K27A 3DKYA 2DT7B 2BE5F 4KICA 3TDZC 5LD2C 2PJRA 5F1RA 3OYFA 1JJ8C 2Y2ZA 2X48A 4C30A 3MEXA 2M8GX 2NRAC 3B73A 2DDAA 3QQAA 2A05A 5M5XJ 2BXYA 2VOPA 4BQQA 3F21A 5EZGA 4DZJA 2NYXA 3JTHA 3L2CA 3I64A 1NHAA 1U0JA 2K4JA 1QHHD 4GDFA 1WFXA 4OMYA 5HNHA 1DP7P 2DFEA 2JTVA 2TRTA 5LGTA 2JVGA 3LOCA 2C6YA 4OAZA 3ZMSA 1HDDC 1E2XA 2H6BA 4IZZA 1FP1D 2IA2A 4ENKA 2HOTA 3H9GA 3NQOA 2QQAA 2QA4I 2EZHA 1I1GA 1O7FA 1HQCA 4L0YB 2JRMA 1WPKA 1DU0A 1YFHA 1PJRA 2UXNA 2B0LA 2MC4A 4LK0F 3Q0VA 3FM5A 2DPDA 3Q9VA 3GZ5A 5K5RA 4EM1A 3OYNA 2CFOA 3A1YA 3ZQFA 4ENNA 4YIRX 5DD4A 2QF7A 3AFHA 4LJZF 3LWFA 1U2WA 3S3MA 2FBKA 3HG9A 5B1BH 2FU4A 5K5QA 2BW3B 5GADJ 4IPAA 1YJNI 3TP3A 3RQIA 2JN6A 4ZH4F 3TGNA 3WHCA 1NG7A 3J81Z 1BL0A 2L9VA 2X4HA 1ZR2A 5ILSA 3HPGA 1LE8B 1DPRA 1KU9A 5HOOA 1KU3A 2E1MB 3HYIA 2R3SA 1XSXA 3CZ6A 1TL8A 2JA8J 1HW2A 4FASD 1R7JA 2LK2A 2LY2A 4LLGF 1U5TA 3KLNA 1T56A 3HIFA 5HLGA 1T0FC 1FT9A 3CJNA 3W2AA 2Y0SA 2CU7A 3OL3A 1O3RA 5DCMB 5LRSA 1PVEA 2GAUA 3W3CA 4EJVA 3CLQA 3HUGB 1ETQA 4BEHA 4RAYA 1HSTA 2QVOA 5CJ9A 4E6KG 2K9QA 2BHZA 2DK8A 4XOPA 1SC7A 3LSGA 3ASNH 1U5TC 4B4CA 5DTDA 1WKMA 3WTZA 4AVPA 3V7SA 3WGHA 3K0LA 4BYYA 5E20A 4KUMA 1RI7A 4LK1F 2OV7A 2GLOA 2Y9YA 3LMMA 1QHGA 2CGPA 2Z33A 3O2PE 2W7NA 1ZHFA 4P55A 1MBGA 2XUBA 3B02A 2XVCA 2NNYA 1DGRM 1XB4A 1D0XA 2LNBA 2CFXA 2GOMA 5H20A 3R0AA 5D5XB 3W6KB 1KA8A 3FHZA 1IN8A 3VOEA 2E5NA 4U87A 1JGSA 1NH3A 1WJFA 1TNSA 2BBYA 2VT3A 4LFUA 1XDUA 1R00A 4ESJA 4PGHA 3BG7A 2LRDA 5GAEJ 3HL2A 3Q9SA 1QNTA 4V2FA 3FXOA 3HZJA 3CF2A 5H6QA 4F52A 1LKXA 1WVRA 1XMAA 3C18A 2L02A 3SEZA 4A3KJ 4J00A 3JW4A 3N97A 1QO0D 4FISA 5GPAA 1T39A 2LBFB 3CCLI 1HA8A 5K7FA 1QVTA 4IL6C 4ZYAA 3E5QA 1S29A 2QBYB 2F5FA 1L3LA 2LP0A 3GBGA 5D6EA 1PP8F 1Y8RB 3BR0A 2R7QA 1XGOA 3BTJA 3RPUA 2DCEA 3KYCB 2K02A 3MQ0A 3QP5A 4MLOA 2EJRA 3CMEI 4EATA 3D5RC 5EDNA 2DQLA 4LG0B 2L0KA 2DJIA 2MFZA 4UVBA 1DUXC 5C44J 2AXTC 4BXXJ 2P6TA 4L5JA 4DIQA 3ZQCA 1UFMA 1ZGWA 5D5UB 4H4KC 4BL0B 1BC8C 3ERMA 2EA2A 1I6XA 1PDNC 1ERDA 3S2HJ 1WI3A 2E35A 1OKRA 4KJZA 2EILH 1SMYF 1X3ZB 2KP6A 1HF0A 4XLEA 1MW7A 4I76A 3X2QH 4RB0A 2QSFX 2VXDA 5HNFA 2LKSA 5IYBJ 3OY9A 1H9TA 3FXLA 1G4DA 1A04A 2IA1A 4W1UA 3MZYA 2G0EA 2ZJQF 2VJ4A 2VBZA 3L1PA 4XLCA 2XROA 1N75A 2FJ1A 3H9JA 3CJQB 3HSRA 4O6JA 2IS4A 4RB3C 5HODA 3FIWA 3AG3H 3PJRA 5IT9Z 4IHWA 5J1UA 2EH3A 3E6CC 1F43A 2HDDA 4XRMA 2CV1A 3WGGA 3IH3A 5JVGF 4L0ZB 4B3AA 3PM1A 4XONA 5CVRA 3KYLA 1J5YA 2IEKA 3MCZA 2K9SA 4BXFA 4CCNA 1UZCA 4OOIA 1D0ZA 3KP6A 4WXDA 4IOAF 3CCYA 2CV0A 1W7PA 3BG5A 3JSOA 3KZYA 3TO9A 4FHTA 3JRGA 4PFOA 2XRNA 2LY1A 5KNLA 5B5EC 1TT0A 1S9HA 1K6YA 3QPTA 1VQ7I 3BJAA 2UXXA 1DQUA 2MW8A 3FK7A 1I1SA 5CQGA 3GTMJ 3CUOA 4AM3A 2P8TA 1AOYA 1S8NA 3J81K 1MSEC 4F7ZA 1GT0C 5FLVA 4JYKA 4PJ0C 3SDBA 1ETOA 2IGNA 2FNPA 1Y1WJ 2R7SA 1XS9A 1V5GA 3SFIA 3V8KA 3VYSB 4I01A 1ETWA 2ME0A 1OFCX 4V19K 1KQ0A 4EM0B 3HGYA 3W2WA 4FCYA 1E3HA 1CGPA 3RYRA 4A3LJ 1HXDA 1I5ZA 2QENA 1TWCJ 2ECBA 5TRDA 1RR8C 2A6EF 3E7LA 1GHCA 2DMPA 1B72B 2ETHA 3C2BA 3K1NA 4BQNA 5ERIA 2BXZA 1JI8A 1IDYA 2VOOA 3FKIJ 2L7KA 1B1BA 5ED4A 3IRRA 3K4LA 3B6CA 4UB8C 1JXSA 3BOQA 4N9IA 3ZMZA 5E3OA 3REOA 1J09A 1G3YA 1M1EB 2Y31A 3WTSC 3IP4B 1T08B 3OYMA 3CC2I 4RGRA 5DEQA 1IN4A 2ZSHB 4ON0A 2EIJH 4ESBA 1FLIA 3RKXA 1KU2A 1QZEA 5A2QK 4J01A 1XMXA 4CCLA 1JUPA 3I59B 3V7CA 2D5VA 4Y15A 3BG3A 3R4KA 2KHMA 3V7RA 4WCGA 1FPQA 1Z0XA 1FNNA 4NHJA 3U1DA 3LAJA 3MWMA 2L2OA 4FX0A 4BS9A 5FKNA 3WU1B 2V26A 3CESA 4OU0A 2HGCA 3A01A 1IRGA 4R8HA 3I3LA 2CW7A 5F27A 2V9KA 5FKKA 2QWWA 2BHYA 1YIOA 4RLFA 5FD5A 1G3SA 1LB2A 1WSUA 2AS5F 4M3FA 1FYKA 2CMPA 1FSHA 1R49A 2HDCA 2BY1A 4LLNA 1LE8A 4HF2A 3N4MA 2FSWA 3E6DA 5D4SA 1OCOH 3LAPA 3I56I 2H6CA 2BYVE 1ZQ3P 2KRFA 1MJBA 3OOPA 3PNTA 4F55A 1TLHB 1JKQC 5CLSA 2MLGA 2XF7A 3M8EA 3PQJA 3FX3A 5IY5H 4XLPF 2V1DA 3FBNB 2R92J 3K1PA 4HZFA 3H3ZA 1Z9CA 3KETA 1UHMA 3G6EI 1XDSA 3BP8A 4E70A 3HUGA 4ZDOA 1KGSA 1HDPA 4HOBA 4E4HA 4OINF 2E1MC 2I8DA 3HPHA 3TP0A 4A6DA 3SZTA 4BKXA 3D1NI 2L7ZA 1FEXA 3EUKL 1XSVA 2PX9A 5DDGA 1J7KA 3GYHX 2V6EA 3ZQ7A 2DJNA 2L5QA 2VB6A 1E3OC 5F64A 4MQVA 1WGXA 2XKOA 1O57A 5EEGA 3TKYA 1W0TA 2O6GE 5H6RA 4F93B 2A07F 1D8JA 1D3YA 2JSPA 5AONA 2CQKA 3QPSA 1U3EM 1K4TA 2K9NA 2X6OA 1WCMJ 2A5WA 3Q3SA 4AC0A 3CP2A 3GMEA 3JAMZ 1LFPA 1IV8A 2HTSA 1WH7A 3K70C 3ZOBA 1B8IB 5J8FA 2IGKA 3BZ6A 4GYIA 5AIPA 4X1EA 1KZHA 3SZPA 3ESWB 4XLFA 2DN0A 2EZLA 1YHQI 1X3UA 1ITYA 4IHSA 1DU6A 4KITB 3LSIA 3EYIA 3IAS2 4BE1A 3S3NA 2W24A 2O0YA 3WU2C 5IT9K 2XAUA 4XOTA 3BTCA 1S7OA 1LEAA 2ZJ2A 2IS1A 1ZH5A 2H1LA 1P7JA 2RVCA 1X1AA 1R22A 1ZG3A 2XKPA 3FDYA 2EFOA 5IP9J 3GTGJ 4HLYA 3PFYA 4KT6A 1MNDA 4RB2C 1ENHA 1GV2A 1X4PA 3OYKA 3TBIA 3JSPA 1R1UA 3KIOA 3RQ4A 4N4NB 2PN6A 1K4SA 1ON1A 2YU3A 2DT5A 4HX4A 3BCAA 3ECHA 2LC2A 3M8FA 1RRJA 5CYVA 1N78A 2X1CA 3MZ8A 4RGXA 2XSJC 1MDMB 4Y3OA 4ZZLA 1XN7A 2QBYA 3GLLA 3GF2A 1ZK8A 1QPIA 1LVAA 1JJ6C 2KQRA 3LSTA 2H94A 2OZUA 3CCRI 3G1MA 2X1EA 1MJAA 1USTA 2DDBA 3OV8A 3GTJJ 5DUIA 1XSDA 4LG0A 3DF8A 4BHPA 1TW3A 4XN3A 2QCOA 2OCCH 4BE0A 3I53A 1VQMI 5FFXA 2E7XA 2QZ8A 5L3CA 4XLNF 1VQ6I 5E1WA 3VSLA 2GZWA 1HW5A 1MBKA 2LG4A 4YFKF 2RNJA 5ICEA 1W0UA 2G7UA 2ZXWH 2WBMA 2KL4A 1MMDA 2E34A 5BNGA 3LA3A 2Z2SB 3FHNA 4KA4A 3VYUB 4U0YA 1T38A 1H0MA 3LQQA 3U21A 3AG1H 1E0EA 3JTGA 1X58A 2RQQA 2R5ZB 4FETA 4R79A 5L3EA 5TGTA 1WQ2A 1YOVB 5L3DA 3HC7A 2E2HJ 3HHGA 4HNUA 3IL2A 1WH5A 1DP3A 2ZSIB 2VC1A 4FE4A 1TWHJ 4Y4RA 4CYCB 3I0TA 1ZKGA 4A3GJ 4IRHA 1G59A 2V1XA 1ZLJA 2M2EA 1MBFA 5C4JJ 2JWTA 4HBLA 4XSZF 2DYRH 5FROA 1VQ9I 9ANTA 1ODDA 2D2WA 3BPVA 3SHFA 1WI9A 3CC7I 2L54A 3QYFA 3TOAA 4S05A 1IN6A 1U8BA 4IOCF 2X0LA 1ETXA 2ZMEA 5L3GA 1K61A 1J59A 3S1QJ 3FMSA 5IP7J 5K5OA 4L9JA 4MFEA 3GUDA 3SDGA 2ID3A 1X1CA 3KEOA 2A69F 2ISYA 5FD6A 3MZHA 5FRNA 2WY8Q 3DEWA 2BOLA 1IRZA 2VE8A 2XF6A 4LMYA 4M73A 4XKBA 1R5GA 2OAZA 3P5JA 1EA3A 4ZTFA 4X6AJ 4GXOA 2RREA 1JGGA 1X2MA 2ZMEC 2BV6A 2A5YB 3CUQB 3MKLA 3ZN1A 2EINH 1R6RA 1D1BA 5F6FA 3LSPA 4KYWA 2LF8A 2L4AA 2JQ7A 3A0HC 3L9FA 2IS2A 4RLQA 4A0ZA 3S2WA 4JX6A 3CJTB 1YW8A 3IUOA 2ZCWA 3S14J 1BC7C 1B6AA 2KIUA 2BVMA 1ZR4A 1IAWA 4I2OA 4NC7A 1BI1A 5KK1A 2DFFA 3DLLF 4LIUA 3M7GA 4BHCA 2ZB9A 4I02A 4CCKA 2RC4A 2NVTJ 3GCMA 4PCQA 1TT5B 2JA7J 3C3WA 4DZPA 4ITVA 2M1BA 3KP3A 3BR6A 2FXAA 2R7RA 2HR3A 3N05A 3BG9A 4S0HB 3PL8A 2VJ5A 3ML6A 2MSYA 4G6QA 5FRMA 2CQXA 1VQLI 1TZLA 2FMLA 3GZNB 3T0YA 4HDVA 3WTVC 3I5UA 3JAMK 1OYIA 1WWXA 1D0YA 2DA7A 2EV6A 4CDGA 4EMSA 1ZTRA 1TQMA 1IF1A 1RC9A 1NK3P 3ZMUA 4KIBA 2M8EA 5HVQC 3QWLA 2VLAA 3BZCA 3IV5A 3E3VA 1FBQA 1LDJA 4JBAA 4XN0A 3S8PA 3I4MJ 1VF9A 2QUFA 3BLYA 4NQWB 3ECOA 4XKVA 2R7VA 4HA8A 3KP2A 4M3EA 1Z6TA 2OF7A 2NOGA 3K2ZA 1A36A 1FMWA 2NVQJ 2KPMA 1EV7A 4ZC3A 2DLLA 3BT9A 4BDYA 3CF5F 2F4MB 2WA0A 1ZG5A 4U88A 2XGCA 2ME6A 4XICA 4B47A 2M30A 2MLKA 1XCBA 2LYCA 4MHGA 1AKHA 2MBFA 1F5TA 4G94A 2VQHA 1Z05A 3CDHA 2QGUA 5LFAA 1SVLA 1I27A 4MIMA 4XM3A 3RKQA 5BPIA 3S15J 2BVLA 5HLHA 5CVVA 2EIMH 2VC0A 1OCTC 3CCVI 1YITI 1FMVA 4XK4A 1LFUP 4RMNA 4L9NA 1I3AA 1OCRH 3K69A 2ZO4A 2ELJA 1RUNA 3L09A 4AU7A 2DA4A 4EJTA 3RI4A 1F1ZA 1VNDA 3RSNA 3MMYB 3LSJA 2OBPA 1RIOH 1FOXA 1SMTA 4O5VA 3UNGC 4KMFA 1T0FA 4HQMA 4UY8I 3ERED 2R7FA 2ESHA 3CO6C 2XGXA 3FXMA 5FLXZ 4C2UA 4A3EJ 2VUMJ 5FFZA 4RAGA 1ZRCA 3M1EA 2AQEA 3L7WA 2EQRA 1E17A 2O61A 3OYHA 2X6XA 4BUPA 3C7JA 3BY6A 1UMQA 2XPVA 1MGTA 3GO5A 2H8WA 3FMRA 3FISA 3W6VA 3UR3C 1SFXA 2M34A 3OYGA 2W1OA 4B1RA 1SAXA 1X3WB 1RPWA 2LF7A 2MYSA 3F3XA 4FQGA 4HNTA 4ENJA 3C2HA 2VKDA 2CWEA 1MH3A 2HPIA 4M6YA 2HVRA 1KONA 3H36A 4RGUA 5D8LB 3QODA 4E7ZA 2XPWA 4UXNA 4E7HA 1R23A 3OYEA 4EQQA 2EB7A 1YO5C 3K9TA 3K4CA 1XC5A 5EGOA 1UJ8A 5LBQA 1YIJI 1T2KA 3S16J 1ZARA 2LLKA 3WODF 3H0DA 3H92A 4M6VA 2KRHA 2M7BA 2K3PA 3HRTA 2KJCA 3PFIA 4U0VA 4QWQA 1S6LA 3HHHA 3DTIA 2GXAA 4EM2A 2UWMA 1XTAA 1JE8A 1IUYA 2MH9A 5A2QZ 3CCMI 4IHXA 2COBA 5IOYA 4UVAA 3FZVA 4E7KA 3D5SC 2Z9OA 1UCRA 1CQTA 5F0HA 1GXQA 2QEXI 3C1DA 4KISA 1BW6A 1F9NA 2UUZA 1JHHA 3I71A 3KEQA 2F5VA 4L5EA 3TO6A 2OD5A 3GW2A 1APLC 1BJZA 3VFZA 3I58A 3K4BA 3ISPA 1TBXA 3FXRA 1IRFA 4JP0A 4ESFA 3QAHA 4PJMA 4MFDA 2FOWA 4XRFA 4XORA 2KIFA 5GP9A 3QPLA 1S7EA 3QOEA 4C2TA 1EH8A 4M6XA 3WHBA 2CV2A 1T98A 3CQZJ 2VPLA 2EBIA 2LVSA 4HRIA 2M5WA 2V6CA 3LNQA 1PUFA 3HOZJ 3O3KA 4HNVA 4A3MJ 1O7LA 3NAUA 5C4XJ 4XSXF 2X51A 4DYCA 1LNWA 3H1CA 4CZCA 2VASA 2DTRA 1IXSB 1BM9A 3P9CA 2DT6A 2HQRA 3SQNA 2QQ8A 4G7HF 2WV0A 2HFHA 1Z77A 3GTLJ 4JOMA 1QGPA 2NNNA 3CMYA 1EJ9A 3CCEI 3H0GJ 4RM2A 3CCJI 1FZPB 3WTYC 3J7AO 1OJLA 2L01A 5JI6A 1TW2A 3ULQB 1WJBA 1P9QC 2YSRA 4A5NA 1GLNA 3IWFA 4EJOA 3FXUA 4W97A 3ASOH 1J0RA 4OIOF 2K86A 5J6XA 1JUSA 2P7VB 2NAZA 2XPUA 3H3VK 5B1AH 2QSGX 1LUJB 4BXUA 5J47A 1PP7U 4AIKA 2XAJA 2W25A 2R5YB 1XX5A 3CCQI 4HDUA 2OTLI 4G7OF 1LEBA 4EJWA 3F8MA 3CDLA 3J80Z 2R93J 4M74A 2HOAA 4IHVA 5F0CA 2FBIA 4U0WA 5EF6A 1B4AA 5E3LA 1R1TA 3JRBA 2J5PA 2H8RA 2GM4A 1GVDA 2GQQA 4FX4A 2L9NA 5KCMA 4CUGA 4E7JA 2J5OA 3DTKA 2NXNB 5KAFC 4HAMA 4S04A 2V9PA 1WJDA 5M3MJ 4NDLA 2IRFG 2W4SA 5FLMJ 1FJLA 4D5CA 2EZIA 2EFNA 1FTZA 4UUSB 4UNOA 2JK3A 2H1KA 2WADA 3H5RA 2DMQA 3M07A 2R7ZJ 3T1BA 1YTYA 1IN7A 3KP4A 2HPMA 1TTYA 3HKZN 3SEQA 2JJ7A 4RAZA 4LD5A 1MNMC 1V55H 4BJ5C 2KDOA 4QTRA 2MD0A 5E18F 1MMSA 4P9FA 3AKZA 5HS9A 1JTXA 1I3QJ 2L9SA 1SD5A 3KEYA 2DFIA 4E7IA 3W2VA 1R58A 4RBOA 2V9VA 2M4GA 3F0CA 2L3DA 2E2IJ 1T33A 2IPQX 4Y33A 5FLXK 4HX8A 1T8IA 4ZJZA 3WE3A 3TW7A 2IP2A 2L9RA 4UUTA 1I39A 2JZYA 2XSDC 4EV0A 4II2A 2K7LA 1P4WA 4DQ2A 4IX7A 3JRFA 1V3FA 5DM7F 2NS7A 4JX4A 1GVJA 4J19A 3LA2A 4M3DA 3IRQA 1JKRC 3H5AA 2HYFA 4E7LA 4UV8A 5CKTA 2MGQA 3FMQA 3GLXA 4NQWA 4HSRA 1P2FA 2BGCA 3KE2A 2XB5A 2O8KA 2GXBA 4I98B 4L9VA 1K79A 2E1OA 4WXCA 5HDNA 1FC3A 2WAEA 3DWLE 2WWYA 3KLOA 3ZMDA 3GFJA 3E6BA 2HTJA 1VTNC 4BBSJ 5DD8A 4YG2F 4BHBA 1SANA 3PSFA 4YFXF 2LKPA 2IJLA 1H8AC 2DU9A 2GA1A 2QM3A 1B9NA 3EDPA 2HNHA 4U7BA 2TCTA 3JRAA 1Y0NA 2M3AA 1IC8A 2IA0A 1DPUA 2EV0A 2Y0SN 1QVUA 4HSTA 4I7HA 4I6ZA 4U7DA 1TC3C 1POGA 2IW5A 3OWTA 2R7WA 2E5ZA 3Q0UA 2Q1ZB 2DA5A 1WJAA 1IXRC 2PBIA 4M9SA 3OMYA 3I9V2 1ETVA 1YW7A 4EGYA 1HW1A 2HU9A 4ZYHA 3AL0B 3M4OJ 5ICCA 2WAQN 4PSXA 1KQ9A 3OYDA 3HRUA 1I50J 3GXOA 1FBSA 2H09A 4B3XA 4PFPA 1UELB 1OISA 2WB1N 3G2BA 2BW3A 3A03A 4WF2A 2M87A 3DU6A 2CSOA 2XHKA 3A0BC 3ZQHA 3BR5A 2CW8A 4IVNA 2MABA 3HSFA 1TWAJ 2Q0OA 2RN7A 3LFUA 2GBYA 5DYMA 5D5VB 2ISZA 3TL4X 1MIJA 2PJRB 1G3WA 2RV8A 4DYRA 2JT1A 5KAIC 2OQGA 1HCRA 4RAFA 4PSWA 2O5RA 5KVRA 5E17F 4ZZDA 3HJEA 4L9TA 3AG2H 3TO7A 1R71A 3AAFA 1TWGJ 2Z16A 3ZMVA 1RR7A 2CG4A 2F4IA 1Z7LA 3FF5A 3DTEA 5DCMA 3OYJA 3KCCA 1YG2A 4CCJA 2HVQA 1Q1VA 4GFBA 3FXQA 2WY7Q 2XASA 2LR8A 4A3IJ 3S1NJ 4BQAA 2KFDA 1KU7A 4BDZA 3I4NJ 2DYSH 3MKWB 2GOXB 1B9MA 1VQNI 1XCVA 4JX5A 4A12A 1IN5A 4D0PA 4HW0A 3JRCA 4DGWB 1AU7A 1P6RA 3HOWJ 2DOFA 2LY9A 4TV7A 5FKOA 1ULYA 4LGWA 2DPUA 2VQGA 4II3A 5D6FA 1FY7A 5KHDA 2XGEA 2LOOA 3G4SI 2E36A 1ETKA 1DGWY 3DEEA 1MD0A 3L2WA 3S3OA 3NRVA 1H88C 3J80K 1A5JA 3HBLA 5EEHA 5H2FC 4F91B 1QPMA 3KZIC 4AWXB 4N0BA 3MN2A 3OYBA 3GFIA 4MQ9F 4E7SA 1HKQA 3LSKA 2IT0A 3R0JA 3FK6A 5HS7A 2ESNA 1O3QA 1G2HA 2QKMB 2EZKA 2EFQA 1RNLA 1S5LC 1BR2A 2Z1DA 2XF5A 5CVUA 2JA6J 1P92A 1UG0A 4EJUA 3ZCOA 4NC6A 1IO2A 2O8XA 1W4MA 4BJTA 1YI2I 2RDPA 3IC7A 3PUFA 4KMUX 2HVSA 2GIZA 2ELKA 2FA5A
chains in the Genus database with same CATH topology
3F8CA 1OYWA 1MJ9A 1U78A 2ZNYA 3T8TA 4ZYGA 2VBXA 3DQVC 1ZYRF 4I0BA 4HF1A 3HOSA 4HV5A 4RS8A 3DPLC 1FX7A 1KQ8A 1QZZA 4KT5C 3WTTC 2P7CB 3RIRA 5BQTA 2V79A 1BN5A 3F8FA 3ZMTA 2XAFA 1ZGJA 4YFNF 4HX7A 3KP7A 1ONVA 2HEOA 5JR3A 3DP7A 1B59A 2OQRA 3K1MA 2XAHA 2F5CA 2VN2A 2E1NA 4WK8F 4PDKA 4PGGA 4IXAA 5E8GA 5JFRA 5E1ZB 4MNUA 1QQIA 2P5KA 3P9KA 2A6HF 3LFKA 4CXFA 1CF7B 3GZ6A 2Q8KA 3DFGA 3RJPA 4HQEA 2DQRA 2YX7A 1IW7F 4M72A 3GVAA 3QU6A 2E1CA 3NEUA 2W84A 1ZRFA 2JPCA 4GGGA 3ROUA 1BI2A 3WTUC 4L18B 1Z1DA 3TDUC 1YLFA 2FNAA 2VBYA 3PQKA 3VEPA 4HLXA 2CW0F 2XAQA 3WU0A 5FO5A 3SFZA 4H0EA 3RDIA 1ZREA 4HF0A 4CICA 4ZYDA 5DCFA 2PFBA 3LQRA 4HV6A 2Y0MA 1XGMA 4WX9A 4NB5A 5IT3A 1HBXG 5K1YA 1W7PD 2WTEA 4KN4X 2L4MA 4LLLA 3WTWC 2P5LC 1H9GA 3BJOA 2VODA 2PMHA 3BJ6A 3F6VA 3RPQA 3SXYA 1WRJA 2YPRA 3R60A 3I59A 1FYLA 2PEXA 2PG4A 3FWEA 4Q4ZF 2HOEA 5ILUA 3DPTA 1ZAOA 3QPHA 1K78B 2VE9A 2JPBA 4Q48A 4MEXF 1SD6A 3ABUA 5D4RA 4WXHA 3QOPA 2QQ9A 5JVTA 2LDUA 2O3FA 3R61A 2M45A 1SD4A 3EQLF 4GCVA 2KIMA 4B09A 4OIPF 1P4XA 4DNCA 1LDDA 2HKXA 2PMUA 3L00A 4P96A 3MAJA 4CYDA 5BOXA 3F23A 2XV4S 4K2EA 1TQPA 5E8IA 3I4PA 1YS7A 3U9GA 4Y17A 4BAYA 3BWGA 1O3TA 4KNYA 1FSEA 2CYYA 1OYYA 3IKTA 1IXCA 1LJ9A 3BPXA 5ICGA 4RGSA 3RKWA 2FOKA 3RTRA 5ICFA 2GIVA 3QP6A 5HDGA 3VB2A 2Q2EA 1KYZA 5JHUA 2YR2A 5L3BA 1MDMA 4MEYF 2RKHA 4N9HA 1U8RA 5LLQA 2W85A 2HS5A 1ZLKA 2D1HA 4XBFA 2STWA 3F6OA 1Z91A 3CLOA 4PZJA 1Y0UA 1ON2A 4A0YA 1FP2A 2GA2A 1YW9A 1XGSA 2Z99A 5CVJA 3ABTA 4CHUA 3GFLA 3E5XA 2JRTA 3ELKA 6PAXA 3T5XA 1YS6A 4P5OA 2AXLA 1EH6A 3E6MA 4WWCA 4MTEA 4ENMA 4EGZA 2VONA 4L5IA 2FMYA 2FE3A 4Y13A 5BPDA 4UV9A 2MH2A 2BEOA 1CF7A 1S7AA 1V4RA 4Z2YA 3EETA 1R1VA 2VXZA 1J2XA 5AIQA 2HYGD 5LHIA 1FOKA 4AD9A 1ZN2A 1KYWA 4FT8A 4I0AA 1O3SA 1YYVA 2DI3A 2QQBA 3E5UA 3GEZA 5ILVA 3BROA 3KZZA 2EWNA 2ELHA 1J75A 1P4AA 2MD5A 3WTXC 3T8RA 4IF4A 2GWRA 3CUQA 1BBYA 2P4WA 2R7DA 2Y48A 4YIFA 3DV8A 4KIFA 3HOTA 4R1HA 5E1XA 2F5EA 4A6EA 2EA4A 2ADUA 4CO8A 2FF4A 2OU2A 1RUOA 1UHWA 2RGVA 3CUQC 4OIRF 2TDXA 5LHHA 2YX4A 5FB2A 3VODA 3P7NA 3DXJF 1SD7A 2Z3YA 5D5WB 3HRSA 3HTUA 2ZXJA 4ZYEA 2A61A 3ZN0A 2A68F 4OIQF 2ZMEB 3M9AA 5HLIA 5LRRA 3WG9A 2COMA 4EVIA 3P9IA 3R6SA 3F22A 4GO1A 4UVCA 3D5LA 4KN7X 3W6JB 1K78A 1ZRDA 4UUVA 5HS8A 4AIJA 1MKMA 1IZ1A 3KFWX 3D0SA 1XD7A 2IVMA 4KFCA 2MA3A 2P6SA 2DAOA 2EK5A 2XIGA 3GFMA 4MGRA 5LEJA 4GYGA 3F8BA 3TOBA 4ASNA 4IRGA 1G6NA 1K6OA 4G6DA 2G9WA 2Z5UA 2VT2A 3V8JA 1FBUA 4A5MA 3TQNA 3V8LA 1HKSA 4I09A 1DDNA 3GWZA 3MFKA 4A0XA 4MTDA 2E7WA 1AWCA 4M9ZA 4G7ZF 2DK5A 1U6GA 1D5VA 4ETSA 2H27A 1XMKA 1PUEE 1MZBA 3COAC 3ZPLA 1TNTA 2VBWA 2DW4A 2V1UA 4M71A 4IJAA 4IHTA 1J9IA 1OPCA 2EFWA 3HSEA 1ZGAA 4JQFA 2ZFWA 2PJPA 4OMZA 5L3FA 1D8KA 2HQNA 1QBJA 4LB5A 3EYYA 2G7HA 3HRMA 2ACJA 3ZP5A 4QLCU 1OR7A 4CZZA 2RQPA 2F5DA 1BI0A 4YIIA 5BS6A 3LA7A 1ZG1A 4B8XA 2PQ8A 2GXGA 3O6BB 4UHTA 3KP5A 4Q5SF 1GXPA 4BH9A 2LSOA 3DKWA 2OA4A 3EUHA 4M9XA 1U5TB 3G3ZA 2P5VA 1BIAA 5LEKA 2JSCA 5DV5A 5BMZA 1SFUA 3DEUA 3I54A 2CO5A 1BOAA 3E97A 2PI0A 2MC3A 4JK1X 2UZKA 1W5SA 1RZ4A 1LDKB 1BIBA 5HDKA 3G73A 4IRIA 4O3MA 4P9UA 3U2RA 2D45A 1W5TA 2HZTA 2K4BA 1FYMA 5D8KB 4KDPA 4AIHA 5TJJA 5LGNA 4A2UA 2PLYA 2QLZA 3IHUA 1USSA 2ZNZA 4HYEA 5LHGA 1Z7UA 1REPC 1STZA 4G9YA 2F2EA 1YQAA 4CGZA 4RB1A 3FM3A 4LB6B 2Y75A 2ZBKA 1G3TA 3CTAA 1HKTA 1K7AA 1EH7A 3F72A 2DBBA 4Q47A 3RYPA 1UB9A 3HTSB 5FGMA 3V4GA 1SFEA 3IWZA 5CVIA 1JHFA 1Q1HA 3BDDA 1QZYA 2FEZA 1BI3A 1T6SA 5LGUA 4G8XA 3Q5FA 1R5HA 1S3JA 3IKVA 1FWZA 3QRFF 2STTA 2NS0A 1Z6RA 1R36A 2OZ6A 3WE2A 1F4KA 2FQ3A 2FRHA 2XAGA 3WGIA 2WC2A 1C0WA 3RKYA 2ZKZA 1W7PB 3CO7C 1L0OC 2A3SA 2O03A 4BNCA 2DO7A 5DUKA 3F8NA 2KKOA 2D1VA 1XGNA 1LQ1A 2KJBA 2EV5A 2HKOA 4KIGA 1TQIA 2W57A 3H3UA 3QU3A 2QYOA 5J8CA 2FBHA 1BJAA 2HWVA 3GX4X 1OMIA 1HSJA 2EFPA 2K27A 2BE5F 4KICA 3TDZC 5F1RA 3MEXA 2NRAC 3B73A 2VOPA 3F21A 3L2CA 2NYXA 3JTHA 3I64A 1NHAA 2K4JA 4OMYA 1DP7P 2JTVA 5LGTA 2C6YA 3ZMSA 1E2XA 2H6BA 1FP1D 2IA2A 4ENKA 3NQOA 2QQAA 1I1GA 1O7FA 1HQCA 4L0YB 1YFHA 2UXNA 2B0LA 4LK0F 3FM5A 2DPDA 3Q9VA 3GZ5A 5K5RA 4EM1A 4ENNA 5DD4A 4LJZF 3LWFA 1U2WA 2FBKA 2FU4A 5K5QA 4IPAA 4ZH4F 3TGNA 3J81Z 2X4HA 5ILSA 1DPRA 1KU9A 5HOOA 1KU3A 3HYIA 2R3SA 1XSXA 1HW2A 1R7JA 4LLGF 1U5TA 3KLNA 3HIFA 5HLGA 1FT9A 3CJNA 1O3RA 5DCMB 5LRSA 2GAUA 4EJVA 4RAYA 1HSTA 2QVOA 5CJ9A 2DK8A 1U5TC 1WKMA 3WTZA 4AVPA 3V7SA 3WGHA 3K0LA 4BYYA 5E20A 1RI7A 4LK1F 2CGPA 2Z33A 3O2PE 1ZHFA 4P55A 2XUBA 3B02A 2XVCA 2NNYA 1XB4A 2LNBA 2CFXA 5H20A 3R0AA 5D5XB 3W6KB 1KA8A 3FHZA 1IN8A 3VOEA 1JGSA 1TNSA 2BBYA 2VT3A 4LFUA 1XDUA 1R00A 4ESJA 4PGHA 3Q9SA 1QNTA 5H6QA 1XMAA 3C18A 2L02A 3JW4A 3N97A 1QO0D 1T39A 3E5QA 1S29A 2QBYB 2F5FA 1L3LA 5D6EA 1PP8F 1XGOA 3RPUA 2K02A 3MQ0A 3QP5A 2EJRA 2DQLA 4LG0B 4UVBA 1DUXC 2P6TA 4L5JA 1UFMA 5D5UB 1BC8C 2EA2A 1I6XA 1PDNC 1OKRA 1SMYF 4RB0A 1H9TA 1G4DA 1A04A 2IA1A 3MZYA 2VBZA 2XROA 3HSRA 4O6JA 4RB3C 5IT9Z 3E6CC 3WGGA 4L0ZB 5CVRA 1J5YA 3MCZA 4OOIA 3KP6A 4WXDA 1W7PA 3JSOA 3KZYA 3TO9A 4FHTA 2XRNA 3QPTA 3BJAA 2UXXA 1I1SA 3CUOA 2P8TA 1AOYA 1S8NA 3J81K 4F7ZA 2FNPA 3V8KA 4I01A 1KQ0A 4EM0B 1CGPA 3RYRA 1HXDA 1I5ZA 2QENA 5TRDA 2A6EF 1GHCA 2ETHA 3K1NA 5ERIA 2VOOA 1B1BA 5ED4A 3IRRA 1JXSA 3BOQA 4N9IA 3ZMZA 3REOA 1G3YA 3WTSC 4RGRA 5DEQA 1IN4A 4ON0A 4ESBA 1FLIA 3RKXA 1KU2A 5A2QK 3I59B 3V7CA 4Y15A 3R4KA 4WCGA 3V7RA 1FPQA 1FNNA 4NHJA 3U1DA 3LAJA 3MWMA 4FX0A 3WU1B 4OU0A 2HGCA 1IRGA 4R8HA 2QWWA 1YIOA 5FD5A 1G3SA 1LB2A 1WSUA 2AS5F 1FSHA 1FYKA 2HDCA 4LLNA 4HF2A 3N4MA 2FSWA 3E6DA 5D4SA 3LAPA 2H6CA 2BYVE 2KRFA 1MJBA 3OOPA 1TLHB 5CLSA 2MLGA 3M8EA 3PQJA 4XLPF 3FX3A 2V1DA 3K1PA 4HZFA 3H3ZA 1Z9CA 3KETA 1UHMA 1XDSA 3BP8A 4E70A 3HUGA 1KGSA 4HOBA 4OINF 4A6DA 3SZTA 1XSVA 5DDGA 1J7KA 3GYHX 3ZQ7A 5F64A 4MQVA 2XKOA 1O57A 5EEGA 3TKYA 2O6GE 5H6RA 2A07F 1D8JA 1D3YA 5AONA 2CQKA 1U3EM 3JAMZ 2HTSA 5J8FA 3BZ6A 5AIPA 4GYIA 3SZPA 1X3UA 4IHSA 3EYIA 2W24A 2O0YA 5IT9K 1S7OA 1LEAA 2ZJ2A 1ZH5A 2RVCA 1R22A 1ZG3A 2XKPA 2EFOA 4HLYA 4RB2C 3JSPA 1R1UA 2PN6A 1ON1A 2YU3A 2DT5A 4HX4A 3ECHA 3M8FA 5CYVA 4RGXA 1MDMB 4ZZLA 1XN7A 2QBYA 3GF2A 1LVAA 3LSTA 2H94A 2OZUA 1USTA 1MJAA 3OV8A 1XSDA 5DUIA 4LG0A 3DF8A 4BHPA 1TW3A 3I53A 5FFXA 2E7XA 2QZ8A 5L3CA 4XLNF 5E1WA 2GZWA 1HW5A 4YFKF 2RNJA 5ICEA 2G7UA 3LA3A 4KA4A 4U0YA 1T38A 1H0MA 3LQQA 3JTGA 4R79A 5L3EA 1WQ2A 5L3DA 3HHGA 3IL2A 2VC1A 3I0TA 4IRHA 2V1XA 1ZLJA 4HBLA 4XSZF 1ODDA 2D2WA 3BPVA 3SHFA 1WI9A 2L54A 3TOAA 4S05A 1IN6A 2X0LA 2ZMEA 5L3GA 1J59A 3FMSA 5K5OA 4L9JA 3GUDA 3KEOA 2A69F 2ISYA 5FD6A 3MZHA 2VE8A 4LMYA 4M73A 1R5GA 2OAZA 4GXOA 2BV6A 2A5YB 3CUQB 3ZN1A 5F6FA 4KYWA 2LF8A 2L4AA 3L9FA 4A0ZA 3S2WA 1YW8A 2ZCWA 1BC7C 1B6AA 2KIUA 1IAWA 4I2OA 1BI1A 5KK1A 3M7GA 4BHCA 4I02A 2RC4A 4PCQA 3C3WA 2M1BA 3KP3A 2FXAA 2HR3A 3ML6A 4G6QA 2FMLA 4HDVA 3T0YA 3WTVC 3I5UA 3JAMK 1OYIA 1WWXA 2EV6A 4CDGA 4EMSA 1TQMA 1IF1A 3ZMUA 4KIBA 2M8EA 5HVQC 3E3VA 1FBQA 1LDJA 4JBAA 2QUFA 3ECOA 4HA8A 3KP2A 1Z6TA 3K2ZA 1EV7A 2DLLA 1ZG5A 4U88A 2M30A 2MLKA 1XCBA 4MHGA 2MBFA 1F5TA 4G94A 1Z05A 3CDHA 1I27A 5BPIA 5HLHA 5CVVA 2VC0A 4L9NA 3K69A 2ZO4A 1RUNA 3L09A 4EJTA 3RI4A 1F1ZA 2OBPA 1RIOH 1SMTA 4O5VA 4KMFA 1T0FA 4HQMA 3ERED 2R7FA 2ESHA 3CO6C 2XGXA 5FLXZ 5FFZA 1ZRCA 3M1EA 3L7WA 1E17A 2O61A 3C7JA 3BY6A 1MGTA 3GO5A 3FMRA 1SFXA 1SAXA 2LF7A 3F3XA 4ENJA 2CWEA 4M6YA 4RGUA 5D8LB 4UXNA 1R23A 4EQQA 2EB7A 1YO5C 3K9TA 5LBQA 1T2KA 1ZARA 3WODF 3H92A 3HRTA 2KJCA 3PFIA 4U0VA 4QWQA 1S6LA 3HHHA 4EM2A 2UWMA 1JE8A 1IUYA 2MH9A 5A2QZ 2Z9OA 4UVAA 3FZVA 1UCRA 1GXQA 3C1DA 1F9NA 1JHHA 3I71A 3KEQA 3TO6A 2OD5A 3GW2A 3VFZA 3I58A 3ISPA 1TBXA 3FXRA 1IRFA 4ESFA 3QAHA 4XRFA 2KIFA 1EH8A 4M6XA 1T98A 2M5WA 2V6CA 3O3KA 1O7LA 4XSXF 1LNWA 2DTRA 1IXSB 1BM9A 3P9CA 2HQRA 3SQNA 4G7HF 2WV0A 2HFHA 1QGPA 2NNNA 1FZPB 3WTYC 3J7AO 2L01A 5JI6A 1TW2A 3ULQB 2YSRA 4A5NA 3IWFA 4EJOA 3FXUA 4OIOF 1J0RA 2K86A 5J6XA 2P7VB 2NAZA 4BXUA 1PP7U 4AIKA 2XAJA 2W25A 4HDUA 1LEBA 4G7OF 4EJWA 3F8MA 3J80Z 4M74A 2FBIA 4U0WA 1B4AA 1R1TA 2J5PA 2GQQA 4FX4A 2J5OA 4HAMA 4S04A 2IRFG 2EFNA 4UNOA 3T1BA 1YTYA 1IN7A 3KP4A 1TTYA 4RAZA 4LD5A 5E18F 4P9FA 5HS9A 1SD5A 2DFIA 1R58A 2V9VA 2L3DA 2IPQX 5FLXK 4HX8A 3WE3A 2IP2A 2JZYA 4EV0A 2K7LA 1P4WA 4DQ2A 1V3FA 1GVJA 3LA2A 3IRQA 2HYFA 4UV8A 3FMQA 3GLXA 4NQWA 1P2FA 2BGCA 3KE2A 2GXBA 4I98B 4L9VA 1K79A 4WXCA 5HDNA 1FC3A 2WWYA 3KLOA 3ZMDA 3GFJA 3E6BA 2HTJA 1VTNC 5DD8A 4YG2F 4BHBA 4YFXF 2LKPA 2IJLA 4U7BA 2DU9A 2GA1A 1B9NA 2QM3A 3EDPA 1DPUA 2IA0A 2EV0A 4I7HA 4U7DA 2IW5A 1IXRC 2PBIA 4M9SA 1YW7A 4EGYA 1HW1A 4ZYHA 5ICCA 1KQ9A 3HRUA 3GXOA 1FBSA 2H09A 4WF2A 2M87A 2CSOA 2XHKA 4IVNA 3HSFA 2Q0OA 2RN7A 5DYMA 5D5VB 2ISZA 1G3WA 2RV8A 2JT1A 2OQGA 5KVRA 5E17F 4ZZDA 4L9TA 3TO7A 3AAFA 3ZMVA 2CG4A 3FF5A 5DCMA 3KCCA 1YG2A 3FXQA 2XASA 4BQAA 1KU7A 1B9MA 1XCVA 4A12A 1IN5A 4D0PA 4HW0A 1P6RA 4TV7A 1ULYA 4LGWA 2DPUA 5D6FA 1FY7A 1MD0A 3NRVA 3J80K 5EEHA 1QPMA 4AWXB 4N0BA 3GFIA 4MQ9F 1HKQA 2IT0A 3R0JA 5HS7A 2ESNA 1O3QA 2EFQA 1RNLA 5CVUA 1P92A 4EJUA 2O8XA 1W4MA 2RDPA 3IC7A 4KMUX 4KUMA 2FA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8C A;  1OYW A;  1MJ9 A;  1U78 A;  2ZNY A;  3T8T A;  4ZYG A;  2VBX A;  3DQV C;  1ZYR F;  4I0B A;  4HF1 A;  3HOS A;  4HV5 A;  4RS8 A;  3DPL C;  1FX7 A;  1KQ8 A;  1QZZ A;  4KT5 C;  3WTT C;  2P7C B;  3RIR A;  5BQT A;  2V79 A;  1BN5 A;  3F8F A;  3ZMT A;  2XAF A;  1ZGJ A;  4YFN F;  4HX7 A;  3KP7 A;  1ONV A;  2HEO A;  5JR3 A;  3DP7 A;  1B59 A;  2OQR A;  3K1M A;  2XAH A;  2F5C A;  2VN2 A;  2E1N A;  4WK8 F;  4PDK A;  4PGG A;  4IXA A;  5E8G A;  5JFR A;  5E1Z B;  4MNU A;  1QQI A;  2P5K A;  3P9K A;  2A6H F;  3LFK A;  4CXF A;  1CF7 B;  3GZ6 A;  2Q8K A;  3DFG A;  3RJP A;  4HQE A;  2DQR A;  2YX7 A;  1IW7 F;  4M72 A;  3GVA A;  3QU6 A;  2E1C A;  3NEU A;  2W84 A;  1ZRF A;  2JPC A;  4GGG A;  3ROU A;  1BI2 A;  3WTU C;  4L18 B;  1Z1D A;  3TDU C;  1YLF A;  2FNA A;  2VBY A;  3PQK A;  3VEP A;  4HLX A;  2CW0 F;  2XAQ A;  3WU0 A;  5FO5 A;  3SFZ A;  4H0E A;  3RDI A;  1ZRE A;  4HF0 A;  4CIC A;  4ZYD A;  5DCF A;  2PFB A;  3LQR A;  4HV6 A;  2Y0M A;  1XGM A;  4WX9 A;  4NB5 A;  5IT3 A;  1HBX G;  5K1Y A;  1W7P D;  2WTE A;  4KN4 X;  2L4M A;  4LLL A;  3WTW C;  2P5L C;  1H9G A;  3BJO A;  2VOD A;  2PMH A;  3BJ6 A;  3F6V A;  3RPQ A;  3SXY A;  1WRJ A;  2YPR A;  3R60 A;  3I59 A;  1FYL A;  2PEX A;  2PG4 A;  3FWE A;  4Q4Z F;  2HOE A;  5ILU A;  3DPT A;  1ZAO A;  3QPH A;  1K78 B;  2VE9 A;  2JPB A;  4Q48 A;  4MEX F;  1SD6 A;  3ABU A;  5D4R A;  4WXH A;  3QOP A;  2QQ9 A;  5JVT A;  2LDU A;  2O3F A;  3R61 A;  2M45 A;  1SD4 A;  3EQL F;  4GCV A;  2KIM A;  4B09 A;  4OIP F;  1P4X A;  4DNC A;  1LDD A;  2HKX A;  2PMU A;  3L00 A;  4P96 A;  3MAJ A;  4CYD A;  5BOX A;  3F23 A;  2XV4 S;  4K2E A;  1TQP A;  5E8I A;  3I4P A;  1YS7 A;  3U9G A;  4Y17 A;  4BAY A;  3BWG A;  1O3T A;  4KNY A;  1FSE A;  2CYY A;  1OYY A;  3IKT A;  1IXC A;  1LJ9 A;  3BPX A;  5ICG A;  4RGS A;  3RKW A;  2FOK A;  3RTR A;  5ICF A;  2GIV A;  3QP6 A;  5HDG A;  3VB2 A;  2Q2E A;  1KYZ A;  5JHU A;  2YR2 A;  5L3B A;  1MDM A;  4MEY F;  2RKH A;  4N9H A;  1U8R A;  5LLQ A;  2W85 A;  2HS5 A;  1ZLK A;  2D1H A;  4XBF A;  2STW A;  3F6O A;  1Z91 A;  3CLO A;  4PZJ A;  1Y0U A;  1ON2 A;  4A0Y A;  1FP2 A;  2GA2 A;  1YW9 A;  1XGS A;  2Z99 A;  5CVJ A;  3ABT A;  4CHU A;  3GFL A;  3E5X A;  2JRT A;  3ELK A;  6PAX A;  3T5X A;  1YS6 A;  4P5O A;  2AXL A;  1EH6 A;  3E6M A;  4WWC A;  4MTE A;  4ENM A;  4EGZ A;  2VON A;  4L5I A;  2FMY A;  2FE3 A;  4Y13 A;  5BPD A;  4UV9 A;  2MH2 A;  2BEO A;  1CF7 A;  1S7A A;  1V4R A;  4Z2Y A;  3EET A;  1R1V A;  2VXZ A;  1J2X A;  5AIQ A;  2HYG D;  5LHI A;  1FOK A;  4AD9 A;  1ZN2 A;  1KYW A;  4FT8 A;  4I0A A;  1O3S A;  1YYV A;  2DI3 A;  2QQB A;  3E5U A;  3GEZ A;  5ILV A;  3BRO A;  3KZZ A;  2EWN A;  2ELH A;  1J75 A;  1P4A A;  2MD5 A;  3WTX C;  3T8R A;  4IF4 A;  2GWR A;  3CUQ A;  1BBY A;  2P4W A;  2R7D A;  2Y48 A;  4YIF A;  3DV8 A;  4KIF A;  3HOT A;  4R1H A;  5E1X A;  2F5E A;  4A6E A;  2EA4 A;  2ADU A;  4CO8 A;  2FF4 A;  2OU2 A;  1RUO A;  1UHW A;  2RGV A;  3CUQ C;  4OIR F;  2TDX A;  5LHH A;  2YX4 A;  5FB2 A;  3VOD A;  3P7N A;  3DXJ F;  1SD7 A;  2Z3Y A;  5D5W B;  3HRS A;  3HTU A;  2ZXJ A;  4ZYE A;  2A61 A;  3ZN0 A;  2A68 F;  4OIQ F;  2ZME B;  3M9A A;  5HLI A;  5LRR A;  3WG9 A;  2COM A;  4EVI A;  3P9I A;  3R6S A;  3F22 A;  4GO1 A;  4UVC A;  3D5L A;  4KN7 X;  3W6J B;  1K78 A;  1ZRD A;  4UUV A;  5HS8 A;  4AIJ A;  1MKM A;  1IZ1 A;  3KFW X;  3D0S A;  1XD7 A;  2IVM A;  4KFC A;  2MA3 A;  2P6S A;  2DAO A;  2EK5 A;  2XIG A;  3GFM A;  4MGR A;  5LEJ A;  4GYG A;  3F8B A;  3TOB A;  4ASN A;  4IRG A;  1G6N A;  1K6O A;  4G6D A;  2G9W A;  2Z5U A;  2VT2 A;  3V8J A;  1FBU A;  4A5M A;  3TQN A;  3V8L A;  1HKS A;  4I09 A;  1DDN A;  3GWZ A;  3MFK A;  4A0X A;  4MTD A;  2E7W A;  1AWC A;  4M9Z A;  4G7Z F;  2DK5 A;  1U6G A;  1D5V A;  4ETS A;  2H27 A;  1XMK A;  1PUE E;  1MZB A;  3COA C;  3ZPL A;  1TNT A;  2VBW A;  2DW4 A;  2V1U A;  4M71 A;  4IJA A;  4IHT A;  1J9I A;  1OPC A;  2EFW A;  3HSE A;  1ZGA A;  4JQF A;  2ZFW A;  2PJP A;  4OMZ A;  5L3F A;  1D8K A;  2HQN A;  1QBJ A;  4LB5 A;  3EYY A;  2G7H A;  3HRM A;  2ACJ A;  3ZP5 A;  4QLC U;  1OR7 A;  4CZZ A;  2RQP A;  2F5D A;  1BI0 A;  4YII A;  5BS6 A;  3LA7 A;  1ZG1 A;  4B8X A;  2PQ8 A;  2GXG A;  3O6B B;  4UHT A;  3KP5 A;  4Q5S F;  1GXP A;  4BH9 A;  2LSO A;  3DKW A;  2OA4 A;  3EUH A;  4M9X A;  1U5T B;  3G3Z A;  2P5V A;  1BIA A;  5LEK A;  2JSC A;  5DV5 A;  5BMZ A;  1SFU A;  3DEU A;  3I54 A;  2CO5 A;  1BOA A;  3E97 A;  2PI0 A;  2MC3 A;  4JK1 X;  2UZK A;  1W5S A;  1RZ4 A;  1LDK B;  1BIB A;  5HDK A;  3G73 A;  4IRI A;  4O3M A;  4P9U A;  3U2R A;  2D45 A;  1W5T A;  2HZT A;  2K4B A;  1FYM A;  5D8K B;  4KDP A;  4AIH A;  5TJJ A;  5LGN A;  4A2U A;  2PLY A;  2QLZ A;  3IHU A;  1USS A;  2ZNZ A;  4HYE A;  5LHG A;  1Z7U A;  1REP C;  1STZ A;  4G9Y A;  2F2E A;  1YQA A;  4CGZ A;  4RB1 A;  3FM3 A;  4LB6 B;  2Y75 A;  2ZBK A;  1G3T A;  3CTA A;  1HKT A;  1K7A A;  1EH7 A;  3F72 A;  2DBB A;  4Q47 A;  3RYP A;  1UB9 A;  3HTS B;  5FGM A;  3V4G A;  1SFE A;  3IWZ A;  5CVI A;  1JHF A;  1Q1H A;  3BDD A;  1QZY A;  2FEZ A;  1BI3 A;  1T6S A;  5LGU A;  4G8X A;  3Q5F A;  1R5H A;  1S3J A;  3IKV A;  1FWZ A;  3QRF F;  2STT A;  2NS0 A;  1Z6R A;  1R36 A;  2OZ6 A;  3WE2 A;  1F4K A;  2FQ3 A;  2FRH A;  2XAG A;  3WGI A;  2WC2 A;  1C0W A;  3RKY A;  2ZKZ A;  1W7P B;  3CO7 C;  1L0O C;  2A3S A;  2O03 A;  4BNC A;  2DO7 A;  5DUK A;  3F8N A;  2KKO A;  2D1V A;  1XGN A;  1LQ1 A;  2KJB A;  2EV5 A;  2HKO A;  4KIG A;  1TQI A;  2W57 A;  3H3U A;  3QU3 A;  2QYO A;  5J8C A;  2FBH A;  1BJA A;  2HWV A;  3GX4 X;  1OMI A;  1HSJ A;  2EFP A;  2K27 A;  2BE5 F;  4KIC A;  3TDZ C;  5F1R A;  3MEX A;  2NRA C;  3B73 A;  2VOP A;  3F21 A;  3L2C A;  2NYX A;  3JTH A;  3I64 A;  1NHA A;  2K4J A;  4OMY A;  1DP7 P;  2JTV A;  5LGT A;  2C6Y A;  3ZMS A;  1E2X A;  2H6B A;  1FP1 D;  2IA2 A;  4ENK A;  3NQO A;  2QQA A;  1I1G A;  1O7F A;  1HQC A;  4L0Y B;  1YFH A;  2UXN A;  2B0L A;  4LK0 F;  3FM5 A;  2DPD A;  3Q9V A;  3GZ5 A;  5K5R A;  4EM1 A;  4ENN A;  5DD4 A;  4LJZ F;  3LWF A;  1U2W A;  2FBK A;  2FU4 A;  5K5Q A;  4IPA A;  4ZH4 F;  3TGN A;  3J81 Z;  2X4H A;  5ILS A;  1DPR A;  1KU9 A;  5HOO A;  1KU3 A;  3HYI A;  2R3S A;  1XSX A;  1HW2 A;  1R7J A;  4LLG F;  1U5T A;  3KLN A;  3HIF A;  5HLG A;  1FT9 A;  3CJN A;  1O3R A;  5DCM B;  5LRS A;  2GAU A;  4EJV A;  4RAY A;  1HST A;  2QVO A;  5CJ9 A;  2DK8 A;  1U5T C;  1WKM A;  3WTZ A;  4AVP A;  3V7S A;  3WGH A;  3K0L A;  4BYY A;  5E20 A;  1RI7 A;  4LK1 F;  2CGP A;  2Z33 A;  3O2P E;  1ZHF A;  4P55 A;  2XUB A;  3B02 A;  2XVC A;  2NNY A;  1XB4 A;  2LNB A;  2CFX A;  5H20 A;  3R0A A;  5D5X B;  3W6K B;  1KA8 A;  3FHZ A;  1IN8 A;  3VOE A;  1JGS A;  1TNS A;  2BBY A;  2VT3 A;  4LFU A;  1XDU A;  1R00 A;  4ESJ A;  4PGH A;  3Q9S A;  1QNT A;  5H6Q A;  1XMA A;  3C18 A;  2L02 A;  3JW4 A;  3N97 A;  1QO0 D;  1T39 A;  3E5Q A;  1S29 A;  2QBY B;  2F5F A;  1L3L A;  5D6E A;  1PP8 F;  1XGO A;  3RPU A;  2K02 A;  3MQ0 A;  3QP5 A;  2EJR A;  2DQL A;  4LG0 B;  4UVB A;  1DUX C;  2P6T A;  4L5J A;  1UFM A;  5D5U B;  1BC8 C;  2EA2 A;  1I6X A;  1PDN C;  1OKR A;  1SMY F;  4RB0 A;  1H9T A;  1G4D A;  1A04 A;  2IA1 A;  3MZY A;  2VBZ A;  2XRO A;  3HSR A;  4O6J A;  4RB3 C;  5IT9 Z;  3E6C C;  3WGG A;  4L0Z B;  5CVR A;  1J5Y A;  3MCZ A;  4OOI A;  3KP6 A;  4WXD A;  1W7P A;  3JSO A;  3KZY A;  3TO9 A;  4FHT A;  2XRN A;  3QPT A;  3BJA A;  2UXX A;  1I1S A;  3CUO A;  2P8T A;  1AOY A;  1S8N A;  3J81 K;  4F7Z A;  2FNP A;  3V8K A;  4I01 A;  1KQ0 A;  4EM0 B;  1CGP A;  3RYR A;  1HXD A;  1I5Z A;  2QEN A;  5TRD A;  2A6E F;  1GHC A;  2ETH A;  3K1N A;  5ERI A;  2VOO A;  1B1B A;  5ED4 A;  3IRR A;  1JXS A;  3BOQ A;  4N9I A;  3ZMZ A;  3REO A;  1G3Y A;  3WTS C;  4RGR A;  5DEQ A;  1IN4 A;  4ON0 A;  4ESB A;  1FLI A;  3RKX A;  1KU2 A;  5A2Q K;  3I59 B;  3V7C A;  4Y15 A;  3R4K A;  4WCG A;  3V7R A;  1FPQ A;  1FNN A;  4NHJ A;  3U1D A;  3LAJ A;  3MWM A;  4FX0 A;  3WU1 B;  4OU0 A;  2HGC A;  1IRG A;  4R8H A;  2QWW A;  1YIO A;  5FD5 A;  1G3S A;  1LB2 A;  1WSU A;  2AS5 F;  1FSH A;  1FYK A;  2HDC A;  4LLN A;  4HF2 A;  3N4M A;  2FSW A;  3E6D A;  5D4S A;  3LAP A;  2H6C A;  2BYV E;  2KRF A;  1MJB A;  3OOP A;  1TLH B;  5CLS A;  2MLG A;  3M8E A;  3PQJ A;  4XLP F;  3FX3 A;  2V1D A;  3K1P A;  4HZF A;  3H3Z A;  1Z9C A;  3KET A;  1UHM A;  1XDS A;  3BP8 A;  4E70 A;  3HUG A;  1KGS A;  4HOB A;  4OIN F;  4A6D A;  3SZT A;  1XSV A;  5DDG A;  1J7K A;  3GYH X;  3ZQ7 A;  5F64 A;  4MQV A;  2XKO A;  1O57 A;  5EEG A;  3TKY A;  2O6G E;  5H6R A;  2A07 F;  1D8J A;  1D3Y A;  5AON A;  2CQK A;  1U3E M;  3JAM Z;  2HTS A;  5J8F A;  3BZ6 A;  5AIP A;  4GYI A;  3SZP A;  1X3U A;  4IHS A;  3EYI A;  2W24 A;  2O0Y A;  5IT9 K;  1S7O A;  1LEA A;  2ZJ2 A;  1ZH5 A;  2RVC A;  1R22 A;  1ZG3 A;  2XKP A;  2EFO A;  4HLY A;  4RB2 C;  3JSP A;  1R1U A;  2PN6 A;  1ON1 A;  2YU3 A;  2DT5 A;  4HX4 A;  3ECH A;  3M8F A;  5CYV A;  4RGX A;  1MDM B;  4ZZL A;  1XN7 A;  2QBY A;  3GF2 A;  1LVA A;  3LST A;  2H94 A;  2OZU A;  1UST A;  1MJA A;  3OV8 A;  1XSD A;  5DUI A;  4LG0 A;  3DF8 A;  4BHP A;  1TW3 A;  3I53 A;  5FFX A;  2E7X A;  2QZ8 A;  5L3C A;  4XLN F;  5E1W A;  2GZW A;  1HW5 A;  4YFK F;  2RNJ A;  5ICE A;  2G7U A;  3LA3 A;  4KA4 A;  4U0Y A;  1T38 A;  1H0M A;  3LQQ A;  3JTG A;  4R79 A;  5L3E A;  1WQ2 A;  5L3D A;  3HHG A;  3IL2 A;  2VC1 A;  3I0T A;  4IRH A;  2V1X A;  1ZLJ A;  4HBL A;  4XSZ F;  1ODD A;  2D2W A;  3BPV A;  3SHF A;  1WI9 A;  2L54 A;  3TOA A;  4S05 A;  1IN6 A;  2X0L A;  2ZME A;  5L3G A;  1J59 A;  3FMS A;  5K5O A;  4L9J A;  3GUD A;  3KEO A;  2A69 F;  2ISY A;  5FD6 A;  3MZH A;  2VE8 A;  4LMY A;  4M73 A;  1R5G A;  2OAZ A;  4GXO A;  2BV6 A;  2A5Y B;  3CUQ B;  3ZN1 A;  5F6F A;  4KYW A;  2LF8 A;  2L4A A;  3L9F A;  4A0Z A;  3S2W A;  1YW8 A;  2ZCW A;  1BC7 C;  1B6A A;  2KIU A;  1IAW A;  4I2O A;  1BI1 A;  5KK1 A;  3M7G A;  4BHC A;  4I02 A;  2RC4 A;  4PCQ A;  3C3W A;  2M1B A;  3KP3 A;  2FXA A;  2HR3 A;  3ML6 A;  4G6Q A;  2FML A;  4HDV A;  3T0Y A;  3WTV C;  3I5U A;  3JAM K;  1OYI A;  1WWX A;  2EV6 A;  4CDG A;  4EMS A;  1TQM A;  1IF1 A;  3ZMU A;  4KIB A;  2M8E A;  5HVQ C;  3E3V A;  1FBQ A;  1LDJ A;  4JBA A;  2QUF A;  3ECO A;  4HA8 A;  3KP2 A;  1Z6T A;  3K2Z A;  1EV7 A;  2DLL A;  1ZG5 A;  4U88 A;  2M30 A;  2MLK A;  1XCB A;  4MHG A;  2MBF A;  1F5T A;  4G94 A;  1Z05 A;  3CDH A;  1I27 A;  5BPI A;  5HLH A;  5CVV A;  2VC0 A;  4L9N A;  3K69 A;  2ZO4 A;  1RUN A;  3L09 A;  4EJT A;  3RI4 A;  1F1Z A;  2OBP A;  1RIO H;  1SMT A;  4O5V A;  4KMF A;  1T0F A;  4HQM A;  3ERE D;  2R7F A;  2ESH A;  3CO6 C;  2XGX A;  5FLX Z;  5FFZ A;  1ZRC A;  3M1E A;  3L7W A;  1E17 A;  2O61 A;  3C7J A;  3BY6 A;  1MGT A;  3GO5 A;  3FMR A;  1SFX A;  1SAX A;  2LF7 A;  3F3X A;  4ENJ A;  2CWE A;  4M6Y A;  4RGU A;  5D8L B;  4UXN A;  1R23 A;  4EQQ A;  2EB7 A;  1YO5 C;  3K9T A;  5LBQ A;  1T2K A;  1ZAR A;  3WOD F;  3H92 A;  3HRT A;  2KJC A;  3PFI A;  4U0V A;  4QWQ A;  1S6L A;  3HHH A;  4EM2 A;  2UWM A;  1JE8 A;  1IUY A;  2MH9 A;  5A2Q Z;  2Z9O A;  4UVA A;  3FZV A;  1UCR A;  1GXQ A;  3C1D A;  1F9N A;  1JHH A;  3I71 A;  3KEQ A;  3TO6 A;  2OD5 A;  3GW2 A;  3VFZ A;  3I58 A;  3ISP A;  1TBX A;  3FXR A;  1IRF A;  4ESF A;  3QAH A;  4XRF A;  2KIF A;  1EH8 A;  4M6X A;  1T98 A;  2M5W A;  2V6C A;  3O3K A;  1O7L A;  4XSX F;  1LNW A;  2DTR A;  1IXS B;  1BM9 A;  3P9C A;  2HQR A;  3SQN A;  4G7H F;  2WV0 A;  2HFH A;  1QGP A;  2NNN A;  1FZP B;  3WTY C;  3J7A O;  2L01 A;  5JI6 A;  1TW2 A;  3ULQ B;  2YSR A;  4A5N A;  3IWF A;  4EJO A;  3FXU A;  4OIO F;  1J0R A;  2K86 A;  5J6X A;  2P7V B;  2NAZ A;  4BXU A;  1PP7 U;  4AIK A;  2XAJ A;  2W25 A;  4HDU A;  1LEB A;  4G7O F;  4EJW A;  3F8M A;  3J80 Z;  4M74 A;  2FBI A;  4U0W A;  1B4A A;  1R1T A;  2J5P A;  2GQQ A;  4FX4 A;  2J5O A;  4HAM A;  4S04 A;  2IRF G;  2EFN A;  4UNO A;  3T1B A;  1YTY A;  1IN7 A;  3KP4 A;  1TTY A;  4RAZ A;  4LD5 A;  5E18 F;  4P9F A;  5HS9 A;  1SD5 A;  2DFI A;  1R58 A;  2V9V A;  2L3D A;  2IPQ X;  5FLX K;  4HX8 A;  3WE3 A;  2IP2 A;  2JZY A;  4EV0 A;  2K7L A;  1P4W A;  4DQ2 A;  1V3F A;  1GVJ A;  3LA2 A;  3IRQ A;  2HYF A;  4UV8 A;  3FMQ A;  3GLX A;  4NQW A;  1P2F A;  2BGC A;  3KE2 A;  2GXB A;  4I98 B;  4L9V A;  1K79 A;  4WXC A;  5HDN A;  1FC3 A;  2WWY A;  3KLO A;  3ZMD A;  3GFJ A;  3E6B A;  2HTJ A;  1VTN C;  5DD8 A;  4YG2 F;  4BHB A;  4YFX F;  2LKP A;  2IJL A;  4U7B A;  2DU9 A;  2GA1 A;  1B9N A;  2QM3 A;  3EDP A;  1DPU A;  2IA0 A;  2EV0 A;  4I7H A;  4U7D A;  2IW5 A;  1IXR C;  2PBI A;  4M9S A;  1YW7 A;  4EGY A;  1HW1 A;  4ZYH A;  5ICC A;  1KQ9 A;  3HRU A;  3GXO A;  1FBS A;  2H09 A;  4WF2 A;  2M87 A;  2CSO A;  2XHK A;  4IVN A;  3HSF A;  2Q0O A;  2RN7 A;  5DYM A;  5D5V B;  2ISZ A;  1G3W A;  2RV8 A;  2JT1 A;  2OQG A;  5KVR A;  5E17 F;  4ZZD A;  4L9T A;  3TO7 A;  3AAF A;  3ZMV A;  2CG4 A;  3FF5 A;  5DCM A;  3KCC A;  1YG2 A;  3FXQ A;  2XAS A;  4BQA A;  1KU7 A;  1B9M A;  1XCV A;  4A12 A;  1IN5 A;  4D0P A;  4HW0 A;  1P6R A;  4TV7 A;  1ULY A;  4LGW A;  2DPU A;  5D6F A;  1FY7 A;  1MD0 A;  3NRV A;  3J80 K;  5EEH A;  1QPM A;  4AWX B;  4N0B A;  3GFI A;  4MQ9 F;  1HKQ A;  2IT0 A;  3R0J A;  5HS7 A;  2ESN A;  1O3Q A;  2EFQ A;  1RNL A;  5CVU A;  1P92 A;  4EJU A;  2O8X A;  1W4M A;  2RDP A;  3IC7 A;  4KMU X;  4KUM A;  2FA5 A; 
#chains in the Genus database with same CATH topology
 3F8C A;  1OYW A;  1MJ9 A;  2Q2E B;  4DOZ A;  1U78 A;  3PO2 J;  2FD5 A;  2ZNY A;  3HB9 A;  2VBX A;  2LBF A;  3T8T A;  4ZYG A;  3DQV C;  1S72 I;  1ZYR F;  4I0B A;  4HF1 A;  3BCB A;  2V4J C;  4HV5 A;  3HOS A;  2Y30 A;  2HXI A;  4RS8 A;  3DPL C;  4BEH B;  2K85 A;  1FX7 A;  1KQ8 A;  5EG0 B;  1QZZ A;  4KT5 C;  3WTT C;  2P7C B;  3RIR A;  1TP4 A;  4MO7 A;  2V79 A;  5BQT A;  1BN5 A;  5IP6 A;  3KX2 A;  5F08 A;  4DW6 A;  2YU9 J;  4IQJ A;  3NAR A;  4D1Q A;  3F8F A;  3ZMT A;  3QYB A;  2XAF A;  3HOV J;  1Y8Q B;  1ZGJ A;  4YFN F;  3RZO J;  3OSG A;  3VSK A;  2XB0 X;  4HX7 A;  1Z21 A;  3S1M J;  4BU2 A;  2R5Y A;  1LVK A;  2M7A A;  2BZT A;  2FUG 2;  3KP7 A;  1JT0 A;  1ONV A;  2HEO A;  5JR3 A;  3DP7 A;  1B59 A;  2OQR A;  3K1M A;  2XAH A;  2F5C A;  5B3S H;  2VN2 A;  3IH2 A;  2VJI A;  2E1N A;  2B7E A;  3H5N A;  3LL7 A;  1RKT A;  2LD5 A;  5EZH A;  4WK8 F;  1VI0 A;  5GPC A;  2NVU B;  3KPH A;  4PDK A;  4PGG A;  4IXA A;  3OIO A;  3OS2 A;  3JRD A;  5E8G A;  5JFR A;  3OYA A;  5E1Z B;  3ONQ A;  2ZXI A;  4IO9 F;  4CCO A;  4MNU A;  1OCP A;  1LFB A;  1QQI A;  2P5K A;  3O8G A;  4A3F J;  2Y9Z A;  1W36 D;  3B6A A;  3P9K A;  4QPO A;  3RPU D;  3ZR8 X;  3FXK A;  2A6H F;  1A6Q A;  1D1C A;  2KLO A;  4XKC A;  3LFK A;  4CXF A;  1CF7 B;  2DA2 A;  3GZ6 A;  2Q8K A;  2K40 A;  3DCF A;  3DFG A;  3RJP A;  2AQF A;  2AHQ A;  3PO3 J;  4HQE A;  2LTP A;  2DQR A;  3Q0W A;  2VIX A;  4AVZ A;  2PMZ N;  2YX7 A;  1IW7 F;  5TIS C;  4M72 A;  1A6I A;  3GVA A;  3QU6 A;  3OSF A;  2E1C A;  3CMA I;  4AID A;  3NEU A;  2W84 A;  1BOB A;  4NNJ A;  1ZRF A;  3GTK J;  2JPC A;  4GGG A;  1SAU A;  5EYR A;  1U9O A;  1HLV A;  1SEU A;  1HOM A;  2DFH A;  5DM6 F;  3OOU A;  3HOY J;  3ROU A;  1BI2 A;  3OIP A;  4N4O B;  1MBJ A;  3WTU C;  4L18 B;  1Z1D A;  2QKL B;  2OC6 A;  3TDU C;  1YLF A;  4C3J J;  3OYI A;  2FNA A;  2VBY A;  3PQK A;  4YEL A;  4AYB N;  3VEP A;  1OCZ H;  4HLX A;  2CW0 F;  2VL8 A;  2XAQ A;  1X4O A;  3WU0 A;  2EIK H;  4D9J A;  3KYD B;  5M5W J;  3SYT A;  5FO5 A;  3DBL B;  3SFZ A;  4H0E A;  3RDI A;  3G1O A;  1K83 J;  1MNE A;  2JVH A;  4HF0 A;  1ZRE A;  4BJ6 C;  4CIC A;  4ZYD A;  3K7A J;  5DCF A;  2PFB A;  3LQR A;  4HV6 A;  3ZXS A;  2Y0M A;  4OWR B;  1B72 A;  4HEA 2;  1XGM A;  3HXL A;  4WX9 A;  4NB5 A;  1JUM A;  5IT3 A;  1HBX G;  5K1Y A;  2W00 A;  3JRH A;  1W7P D;  3OR2 C;  1R4N B;  2BY3 A;  2WTE A;  4KN4 X;  2L4M A;  4LLL A;  3WTW C;  3OYC A;  2P5L C;  1H9G A;  3BJO A;  2VOD A;  1MBH A;  5JLW A;  2E60 A;  2PMH A;  2P81 A;  1QRY A;  3BJ6 A;  3F6V A;  4IKF A;  3RPQ A;  1WJC A;  3OR1 C;  3SXY A;  1WRJ A;  1Y39 A;  3M8J A;  3RCO A;  2YPR A;  2BY2 A;  3R60 A;  1UAA A;  3I59 A;  5GAH J;  5M5Y J;  3CD6 I;  1FYL A;  2PEX A;  2PG4 A;  1VQO I;  2IS6 A;  3FWE A;  4Q4Z F;  2HOE A;  1X2N A;  4A93 J;  5ILU A;  2JMW A;  1WJE A;  4PUS A;  2NOJ B;  2CUF A;  3DPT A;  1ZAO A;  1MSF C;  4P1W A;  3QPH A;  3MVP A;  1K78 B;  5JHF A;  2JPB A;  2VE9 A;  4Q48 A;  1VQ5 I;  4MEX F;  1SD6 A;  2R7X A;  3ABU A;  3BG6 A;  3AL0 C;  1R4M B;  1D1A A;  5D4R A;  4WXH A;  3QOP A;  3CMM A;  1SVO A;  2ZJR F;  2QQ9 A;  3BR1 A;  1VQK I;  5JVT A;  2MG4 A;  2LDU A;  2O3F A;  2R7O A;  3HKZ A;  3J7Y J;  3R61 A;  2M45 A;  1SD4 A;  2KIS A;  3EQL F;  1EKE A;  2LMD A;  1GUU A;  4GCV A;  3ZQG A;  4XKW A;  1Z3Y A;  2KIM A;  5F0F A;  4B09 A;  3G71 I;  4OIP F;  1P4X A;  4DNC A;  1LDD A;  2HKX A;  4B44 A;  2PMU A;  5HLT A;  3L00 A;  4BGD A;  4BY1 J;  4P96 A;  3MAJ A;  2FQ4 A;  2DOD A;  2OCE A;  3PNV A;  2XC7 A;  4CSW A;  4CYD A;  4A3C J;  2UV1 A;  4C3H J;  5BOX A;  3F23 A;  1N25 A;  3CCU I;  2XV4 S;  5J3L A;  1U9N A;  3ZQI A;  4K2E A;  1TQP A;  5E8I A;  3I4P A;  1YS7 A;  3U9G A;  4Y17 A;  4BAY A;  4A69 C;  1JKP C;  3BWG A;  1O3T A;  4BE2 A;  4KNY A;  1MH4 A;  1B8I A;  2CUE A;  2NVY J;  3PIO F;  4NBQ A;  4X0G A;  3CCS I;  4LIT A;  5FKL A;  1RKW A;  2DXI A;  1FSE A;  2CYY A;  3A01 B;  1OYY A;  3IKT A;  3L2U A;  1IXC A;  1FIP A;  1LJ9 A;  3BPX A;  5ICG A;  2YS9 A;  5IPA A;  1NTC A;  4RGS A;  3RKW A;  2FOK A;  2KT0 A;  5JLX A;  1H89 C;  3ZQQ A;  4D5F A;  1W1W E;  2XGD A;  3RTR A;  3TW6 A;  5ICF A;  2GIV A;  3QP6 A;  1JTY A;  5HDG A;  3VPR A;  3K70 D;  3TED A;  3VB2 A;  2CH0 A;  2Q2E A;  3DLA A;  1KYZ A;  5JHU A;  2B9S A;  2YR2 A;  5CPR B;  5L3B A;  1MDM A;  4MEY F;  2RKH A;  4N9H A;  1F36 A;  3BR3 A;  1U8R A;  3NWS A;  5LLQ A;  1YRN B;  3F9K A;  2V7F A;  2W85 A;  3L2Q A;  2X9D A;  3SJM A;  2HS5 A;  5IOZ A;  1ZLK A;  3HOX J;  2D1H A;  5EG0 A;  4XBF A;  3HDD A;  4C9Y A;  2STW A;  3F6O A;  1Z91 A;  3CLO A;  2WAQ A;  4PZJ A;  1Y0U A;  1ON2 A;  1SFO J;  1ACI A;  4A0Y A;  3GTQ J;  4LOC A;  3A4C A;  1FP2 A;  2WB1 A;  2GA2 A;  1YW9 A;  1XGS A;  2Z99 A;  3HEF A;  5CVJ A;  3ABT A;  4CHU A;  3GFL A;  3MKY B;  3E5X A;  2JRT A;  2LFB A;  2I10 A;  5IYC J;  4OAY A;  3ELK A;  6PAX A;  3T5X A;  1YS6 A;  3G1L A;  4P5O A;  2DOE A;  4M3B A;  3IAM 2;  2AXL A;  4V2G A;  2OTJ I;  2R5Z A;  1EH6 A;  2Y69 H;  4A3J J;  3E6M A;  4WWC A;  4MTE A;  4ENM A;  4EGZ A;  5DS9 A;  2VON A;  1IRX A;  2CS3 A;  4LIV A;  4C3I J;  4L5I A;  4CYC A;  2FMY A;  4HG2 A;  5GTI C;  2FE3 A;  4UB6 C;  2KIQ A;  4Y13 A;  5BPD A;  4UV9 A;  1V54 H;  4NUB A;  2MH2 A;  3K4K A;  2BEO A;  1CF7 A;  1S7A A;  1V4R A;  1D5Y A;  5IYD J;  3CP8 A;  4Z2Y A;  3EET A;  1R1V A;  2VXZ A;  1J2X A;  3J7Z I;  5AIQ A;  2DOA A;  2HYG D;  4B48 A;  4A3B J;  5LHI A;  1FOK A;  4AD9 A;  1XPX A;  1ZN2 A;  2EPF A;  1KYW A;  4G6T B;  4FT8 A;  1XG1 A;  4I0A A;  5C3E J;  1O3S A;  1YYV A;  2WV1 A;  1YX3 A;  2DI3 A;  4XRS A;  2QQB A;  3E5U A;  3GEZ A;  5ILV A;  1Y6I A;  4CCM A;  3BRO A;  3KZZ A;  2EWN A;  2ELH A;  1J75 A;  1P4A A;  2MD5 A;  1W36 C;  1IUF A;  3WTX C;  3T8R A;  4IF4 A;  1W5C C;  2GWR A;  3L2V A;  2P0W A;  3CUQ A;  3I55 I;  4ABZ A;  1BBY A;  2IBD A;  1I6H J;  2P4W A;  2R7D A;  3LSH A;  2Y48 A;  3A02 A;  4NC8 A;  3DV8 A;  4YIF A;  1HC8 A;  4KIF A;  4Y7N J;  2X6W A;  1X19 A;  1ETY A;  3HOT A;  4R1H A;  2L7M P;  5E1X A;  3E1S A;  2F5E A;  3ZGK A;  4A6E A;  2R7T A;  3MKZ A;  2F4O B;  2EA4 A;  2HXO A;  2ADU A;  2V1N A;  5GTH C;  1Y56 A;  3LSM A;  2YUS A;  3VWB A;  3ZQL A;  4CO8 A;  2FF4 A;  2OU2 A;  1QA6 A;  3JCU C;  1RUO A;  1UHW A;  2RGV A;  3CUQ C;  4BAC A;  4OIR F;  2TDX A;  4XRS G;  5LHH A;  2KDZ A;  3JRI A;  2YX4 A;  3OS1 A;  3DBH B;  1YJW I;  3MD2 A;  2B63 J;  2IAI A;  5FB2 A;  4Z6Y A;  3P7N A;  3VOD A;  3DXJ F;  1SD7 A;  3UKG A;  2OJE D;  2ZJP F;  2KZV A;  2K3F A;  2Z3Y A;  3HRS A;  5D5W B;  3HTU A;  2ZXJ A;  4ZYE A;  2A61 A;  3ZN0 A;  2A68 F;  4IQ4 A;  3K10 A;  4OIQ F;  2ZME B;  3BC8 A;  2ZC2 A;  2F48 A;  3M9A A;  3ABK H;  4XNF A;  5HLI A;  3ZRG A;  5LRR A;  3WG9 A;  1QU3 A;  2AO9 A;  2HDW A;  2COM A;  2I5U A;  4ZTJ A;  3CJR B;  3FKJ A;  4EVI A;  2K9M A;  2VQL A;  3P9I A;  3R6S A;  3F22 A;  4GO1 A;  4HPQ A;  4UVC A;  2CQQ A;  2VKE A;  2VQC A;  2O9L A;  2F6C A;  3DU5 A;  2DA3 A;  2R7U A;  3JRE A;  1BR1 A;  3D5L A;  4KN7 X;  2N8G A;  3PUB A;  3W6J B;  2DMU A;  1K78 A;  1ZRD A;  3HGG A;  4UUV A;  2LRE A;  1OCC H;  5HS8 A;  4AIJ A;  1MKM A;  1IZ1 A;  3LSR A;  3KFW X;  1Z3X A;  1WHU A;  3D0S A;  1XD7 A;  2IVM A;  4D7N A;  5FKM A;  4KFC A;  1BW5 A;  1P7I A;  2A6T A;  2MA3 A;  5J40 A;  2P6S A;  1MMN A;  1V5E A;  3E0J B;  1IDZ A;  3BTL A;  2DAO A;  3VYT B;  2EK5 A;  2XIG A;  3GFM A;  4MGR A;  5K7H A;  4C2M J;  5LEJ A;  4XID A;  1SVM A;  4M3G A;  4GYG A;  3F8B A;  2CUZ A;  3TOB A;  4ASN A;  1JT6 A;  3M3Y J;  1PYV A;  4IRG A;  5EEA A;  1G6N A;  2DA6 A;  1IJW C;  1K6O A;  4EEF G;  4G6D A;  4Y52 J;  2PMZ A;  2G9W A;  2Z5U A;  2VT2 A;  3V8J A;  1FBU A;  3BQZ A;  4A5M A;  1E3P A;  3TQN A;  3V8L A;  2JUC A;  4ZDP A;  5FJ8 J;  1ZEL A;  1HKS A;  2IXS A;  4I09 A;  4ANJ A;  1VQP I;  1DDN A;  2LH9 A;  3GWZ A;  3NWT A;  3MFK A;  3BR2 A;  4A0X A;  2E7W A;  4MTD A;  1AWC A;  4M9Z A;  4G7Z F;  2DK5 A;  4AYB A;  5E3M A;  1U6G A;  4DBR A;  5CQE A;  2IGO A;  1D5V A;  4ETS A;  3O8H A;  2H27 A;  1XMK A;  1OQY A;  2M0C A;  1PUE E;  4B43 A;  3VYR B;  1MZB A;  5GAG J;  1UG2 A;  3COA C;  4FE7 A;  2X6Y A;  3ZPL A;  3IH4 A;  4QIW N;  1TNT A;  3GTO J;  4PJJ A;  2VBW A;  1BA5 A;  2JA2 A;  2DW4 A;  2OPT A;  3EUA A;  2XRL A;  2V1U A;  4M71 A;  1OLT A;  3S2D J;  4IJA A;  3ABM H;  5B66 C;  4IHT A;  1J9I A;  1OPC A;  4IEJ A;  2WAF A;  4QSH A;  1WJ5 A;  4A3D J;  2QSH X;  2EFW A;  4CA0 A;  3HSE A;  1ZGA A;  5F1J A;  4JQF A;  2ZFW A;  3HOU J;  5J4V A;  1AKH B;  4PJL A;  1FOW A;  2E19 A;  2PJP A;  4OMZ A;  5L3F A;  1G8X A;  3BZK A;  2DMT A;  1D8K A;  2HQN A;  2VKH A;  3DPU A;  4RDU A;  1QBJ A;  1AA7 A;  2FX0 A;  3S1R J;  4LB5 A;  3EYY A;  5E79 C;  2G7H A;  1YRN A;  2HZD A;  3HRM A;  4XLA A;  2ACJ A;  3ZP5 A;  4IHY A;  3U1K A;  1VQ8 I;  2DA1 A;  4QLC U;  2L7F P;  3CDI A;  3JR9 A;  1OR7 A;  1LPQ A;  4CZZ A;  1X1D A;  2ECC A;  4FTH A;  3FBI B;  2RQP A;  2F5D A;  1BI0 A;  4YII A;  5BS6 A;  3LA7 A;  1ZG1 A;  2K9L A;  2PQ8 A;  4B8X A;  1A35 A;  3VDX A;  2GXG A;  4XR6 A;  1X1P A;  3O6B B;  4UHT A;  3KP5 A;  2DTZ A;  1RES A;  1GXP A;  4BH9 A;  4Q5S F;  3H9Q A;  1V5F A;  2LSO A;  3DKW A;  2M9H A;  2OA4 A;  5J4Y A;  2HYJ A;  2VKV A;  3EUH A;  4M9X A;  4RA2 A;  1U5T B;  3G3Z A;  2P5V A;  1OR7 C;  1BIA A;  5LEK A;  2JSC A;  5DV5 A;  5J1Y A;  5J1R A;  5BMZ A;  1SFU A;  3DEU A;  3I54 A;  3K6G A;  3S17 J;  3HM5 A;  2CO5 A;  1AHD P;  3K4M A;  1BOA A;  2XDV A;  2E2J J;  3E97 A;  2PI0 A;  4XLH A;  4YEJ A;  2CUJ A;  3PSI A;  2MC3 A;  4PK4 A;  4JK1 X;  1Y1V J;  3EUH C;  5EGO B;  2ZFU A;  1YJ9 I;  2UZK A;  2RNG A;  2LKX A;  1W5S A;  1JKO C;  1RZ4 A;  2X85 A;  1LDK B;  1BIB A;  4DYQ A;  5HDK A;  3G73 A;  4IRI A;  4O3M A;  1MBE A;  4P9U A;  3CC4 I;  1Z67 A;  3U2R A;  2CQ7 A;  2IGM A;  1W5T A;  2D45 A;  2HZT A;  2X1D A;  2K4B A;  2W48 A;  4CH7 A;  3J7A Y;  1FIA A;  4XL9 A;  1FYM A;  1NK2 P;  3OIQ A;  2JUG A;  3BTI A;  5D8K B;  2CRG A;  4BQO A;  2ICW G;  4KDP A;  1IGN A;  2K5C A;  2W82 A;  3S32 A;  2CJJ A;  3A2K A;  4LG3 A;  3SZG A;  1MMG A;  4AIH A;  2NVX J;  2HI3 A;  4BBR J;  4XQF A;  3M1C A;  5TJJ A;  5K7Z A;  5LGN A;  2HOS A;  4A2U A;  2PLY A;  2QLZ A;  3ABL H;  4F92 B;  1VFC A;  5F04 A;  1O4X A;  3IHU A;  4I99 C;  1USS A;  4D7M A;  4F3Q A;  2ZNZ A;  4HYE A;  4PJN A;  5LHG A;  1Z7U A;  2JA5 J;  2CQN A;  1EF4 A;  3TMO A;  1T95 A;  1REP C;  1STZ A;  4UUS A;  1PUF B;  4G9Y A;  2M4K A;  3OYL A;  2O7O A;  2F2E A;  3H35 A;  3WG7 H;  4ZDL A;  1YQA A;  4CGZ A;  1TWF J;  4RB1 A;  3FM3 A;  2NS8 A;  4LB6 B;  2Y75 A;  2ZBK A;  1G3T A;  3PIP F;  3CTA A;  1RET A;  1GV5 A;  1K7A A;  4AUX A;  1HKT A;  1EH7 A;  2KRC A;  3K4N A;  3OL4 A;  3F72 A;  2DBB A;  1YX5 A;  3EPZ A;  2ID6 A;  1N77 A;  4YRV A;  4Q47 A;  1UHS A;  3FXJ A;  3V42 A;  3RYP A;  1UB9 A;  2RAE A;  3HTS B;  4DBQ A;  5FGM A;  5M3F J;  3V4G A;  1FTT A;  1SFE A;  2DMN A;  2HQA A;  5E3N A;  3IWZ A;  3BQY A;  1FOY A;  5CVI A;  1JHF A;  1Q1H A;  3BDD A;  1QZY A;  2FEZ A;  3OS0 A;  4G12 A;  4BY7 J;  3DBR B;  2VI6 A;  1R9T J;  1GDT A;  1BI3 A;  3K2A A;  1T6S A;  5LGU A;  4G8X A;  3Q5F A;  1R5H A;  2KZG A;  1X1B A;  1S3J A;  1R5I D;  3IKV A;  2VJJ A;  1FWZ A;  4GRI A;  3QRF F;  3PNY A;  2STT A;  2NS0 A;  3C2G A;  2HQ5 A;  1Z6R A;  3S93 A;  1YE9 A;  2E71 A;  1R36 A;  1A31 A;  1VQ4 I;  2KMU A;  2OZ6 A;  2R0Q C;  3WE2 A;  1F4K A;  2FQ3 A;  1VZ0 A;  2FRH A;  2XAG A;  4XMY A;  1IG7 A;  3GTP J;  2OUM A;  3WGI A;  2WC2 A;  3L2R A;  4DJA A;  1C0W A;  3RKY A;  2ZKZ A;  1W7P B;  3CO7 C;  4RM3 A;  2BY0 A;  1L0O C;  2A3S A;  2M0M A;  2O03 A;  1SFK A;  4BNC A;  1WZ2 A;  2DO7 A;  5DUK A;  3DKX A;  3F8N A;  2R4G A;  3RZD J;  2KKO A;  1NG6 A;  2D1V A;  1XGN A;  1LQ1 A;  2KJB A;  1BR4 A;  2EV5 A;  3K4J A;  2HKO A;  4KIG A;  2ZXH A;  4QPQ A;  1TQI A;  3AG4 H;  5EJC A;  2W57 A;  3H3U A;  3QU3 A;  1IV6 A;  1MMA A;  2QYO A;  1ORK A;  3QYE A;  5J8C A;  2FBH A;  1BJA A;  2HWV A;  1OMI A;  3GX4 X;  2VPR A;  1HSJ A;  2EFP A;  2K27 A;  3DKY A;  2DT7 B;  2BE5 F;  4KIC A;  3TDZ C;  5LD2 C;  2PJR A;  5F1R A;  3OYF A;  1JJ8 C;  2Y2Z A;  2X48 A;  4C30 A;  3MEX A;  2M8G X;  2NRA C;  3B73 A;  2DDA A;  3QQA A;  2A05 A;  5M5X J;  2BXY A;  2VOP A;  4BQQ A;  3F21 A;  5EZG A;  4DZJ A;  2NYX A;  3JTH A;  3L2C A;  3I64 A;  1NHA A;  1U0J A;  2K4J A;  1QHH D;  4GDF A;  1WFX A;  4OMY A;  5HNH A;  1DP7 P;  2DFE A;  2JTV A;  2TRT A;  5LGT A;  2JVG A;  3LOC A;  2C6Y A;  4OAZ A;  3ZMS A;  1HDD C;  1E2X A;  2H6B A;  4IZZ A;  1FP1 D;  2IA2 A;  4ENK A;  2HOT A;  3H9G A;  3NQO A;  2QQA A;  2QA4 I;  2EZH A;  1I1G A;  1O7F A;  1HQC A;  4L0Y B;  2JRM A;  1WPK A;  1DU0 A;  1YFH A;  1PJR A;  2UXN A;  2B0L A;  2MC4 A;  4LK0 F;  3Q0V A;  3FM5 A;  2DPD A;  3Q9V A;  3GZ5 A;  5K5R A;  4EM1 A;  3OYN A;  2CFO A;  3A1Y A;  3ZQF A;  4ENN A;  4YIR X;  5DD4 A;  2QF7 A;  3AFH A;  4LJZ F;  3LWF A;  1U2W A;  3S3M A;  2FBK A;  3HG9 A;  5B1B H;  2FU4 A;  5K5Q A;  2BW3 B;  5GAD J;  4IPA A;  1YJN I;  3TP3 A;  3RQI A;  2JN6 A;  4ZH4 F;  3TGN A;  3WHC A;  1NG7 A;  3J81 Z;  1BL0 A;  2L9V A;  2X4H A;  1ZR2 A;  5ILS A;  3HPG A;  1LE8 B;  1DPR A;  1KU9 A;  5HOO A;  1KU3 A;  2E1M B;  3HYI A;  2R3S A;  1XSX A;  3CZ6 A;  1TL8 A;  2JA8 J;  1HW2 A;  4FAS D;  1R7J A;  2LK2 A;  2LY2 A;  4LLG F;  1U5T A;  3KLN A;  1T56 A;  3HIF A;  5HLG A;  1T0F C;  1FT9 A;  3CJN A;  3W2A A;  2Y0S A;  2CU7 A;  3OL3 A;  1O3R A;  5DCM B;  5LRS A;  1PVE A;  2GAU A;  3W3C A;  4EJV A;  3CLQ A;  3HUG B;  1ETQ A;  4BEH A;  4RAY A;  1HST A;  2QVO A;  5CJ9 A;  4E6K G;  2K9Q A;  2BHZ A;  2DK8 A;  4XOP A;  1SC7 A;  3LSG A;  3ASN H;  1U5T C;  4B4C A;  5DTD A;  1WKM A;  3WTZ A;  4AVP A;  3V7S A;  3WGH A;  3K0L A;  4BYY A;  5E20 A;  4KUM A;  1RI7 A;  4LK1 F;  2OV7 A;  2GLO A;  2Y9Y A;  3LMM A;  1QHG A;  2CGP A;  2Z33 A;  3O2P E;  2W7N A;  1ZHF A;  4P55 A;  1MBG A;  2XUB A;  3B02 A;  2XVC A;  2NNY A;  1DGR M;  1XB4 A;  1D0X A;  2LNB A;  2CFX A;  2GOM A;  5H20 A;  3R0A A;  5D5X B;  3W6K B;  1KA8 A;  3FHZ A;  1IN8 A;  3VOE A;  2E5N A;  4U87 A;  1JGS A;  1NH3 A;  1WJF A;  1TNS A;  2BBY A;  2VT3 A;  4LFU A;  1XDU A;  1R00 A;  4ESJ A;  4PGH A;  3BG7 A;  2LRD A;  5GAE J;  3HL2 A;  3Q9S A;  1QNT A;  4V2F A;  3FXO A;  3HZJ A;  3CF2 A;  5H6Q A;  4F52 A;  1LKX A;  1WVR A;  1XMA A;  3C18 A;  2L02 A;  3SEZ A;  4A3K J;  4J00 A;  3JW4 A;  3N97 A;  1QO0 D;  4FIS A;  5GPA A;  1T39 A;  2LBF B;  3CCL I;  1HA8 A;  5K7F A;  1QVT A;  4IL6 C;  4ZYA A;  3E5Q A;  1S29 A;  2QBY B;  2F5F A;  1L3L A;  2LP0 A;  3GBG A;  5D6E A;  1PP8 F;  1Y8R B;  3BR0 A;  2R7Q A;  1XGO A;  3BTJ A;  3RPU A;  2DCE A;  3KYC B;  2K02 A;  3MQ0 A;  3QP5 A;  4MLO A;  2EJR A;  3CME I;  4EAT A;  3D5R C;  5EDN A;  2DQL A;  4LG0 B;  2L0K A;  2DJI A;  2MFZ A;  4UVB A;  1DUX C;  5C44 J;  2AXT C;  4BXX J;  2P6T A;  4L5J A;  4DIQ A;  3ZQC A;  1UFM A;  1ZGW A;  5D5U B;  4H4K C;  4BL0 B;  1BC8 C;  3ERM A;  2EA2 A;  1I6X A;  1PDN C;  1ERD A;  3S2H J;  1WI3 A;  2E35 A;  1OKR A;  4KJZ A;  2EIL H;  1SMY F;  1X3Z B;  2KP6 A;  1HF0 A;  4XLE A;  1MW7 A;  4I76 A;  3X2Q H;  4RB0 A;  2QSF X;  2VXD A;  5HNF A;  2LKS A;  5IYB J;  3OY9 A;  1H9T A;  3FXL A;  1G4D A;  1A04 A;  2IA1 A;  4W1U A;  3MZY A;  2G0E A;  2ZJQ F;  2VJ4 A;  2VBZ A;  3L1P A;  4XLC A;  2XRO A;  1N75 A;  2FJ1 A;  3H9J A;  3CJQ B;  3HSR A;  4O6J A;  2IS4 A;  4RB3 C;  5HOD A;  3FIW A;  3AG3 H;  3PJR A;  5IT9 Z;  4IHW A;  5J1U A;  2EH3 A;  3E6C C;  1F43 A;  2HDD A;  4XRM A;  2CV1 A;  3WGG A;  3IH3 A;  5JVG F;  4L0Z B;  4B3A A;  3PM1 A;  4XON A;  5CVR A;  3KYL A;  1J5Y A;  2IEK A;  3MCZ A;  2K9S A;  4BXF A;  4CCN A;  1UZC A;  4OOI A;  1D0Z A;  3KP6 A;  4WXD A;  4IOA F;  3CCY A;  2CV0 A;  1W7P A;  3BG5 A;  3JSO A;  3KZY A;  3TO9 A;  4FHT A;  3JRG A;  4PFO A;  2XRN A;  2LY1 A;  5KNL A;  5B5E C;  1TT0 A;  1S9H A;  1K6Y A;  3QPT A;  1VQ7 I;  3BJA A;  2UXX A;  1DQU A;  2MW8 A;  3FK7 A;  1I1S A;  5CQG A;  3GTM J;  3CUO A;  4AM3 A;  2P8T A;  1AOY A;  1S8N A;  3J81 K;  1MSE C;  4F7Z A;  1GT0 C;  5FLV A;  4JYK A;  4PJ0 C;  3SDB A;  1ETO A;  2IGN A;  2FNP A;  1Y1W J;  2R7S A;  1XS9 A;  1V5G A;  3SFI A;  3V8K A;  3VYS B;  4I01 A;  1ETW A;  2ME0 A;  1OFC X;  4V19 K;  1KQ0 A;  4EM0 B;  3HGY A;  3W2W A;  4FCY A;  1E3H A;  1CGP A;  3RYR A;  4A3L J;  1HXD A;  1I5Z A;  2QEN A;  1TWC J;  2ECB A;  5TRD A;  1RR8 C;  2A6E F;  3E7L A;  1GHC A;  2DMP A;  1B72 B;  2ETH A;  3C2B A;  3K1N A;  4BQN A;  5ERI A;  2BXZ A;  1JI8 A;  1IDY A;  2VOO A;  3FKI J;  2L7K A;  1B1B A;  5ED4 A;  3IRR A;  3K4L A;  3B6C A;  4UB8 C;  1JXS A;  3BOQ A;  4N9I A;  3ZMZ A;  5E3O A;  3REO A;  1J09 A;  1G3Y A;  1M1E B;  2Y31 A;  3WTS C;  3IP4 B;  1T08 B;  3OYM A;  3CC2 I;  4RGR A;  5DEQ A;  1IN4 A;  2ZSH B;  4ON0 A;  2EIJ H;  4ESB A;  1FLI A;  3RKX A;  1KU2 A;  1QZE A;  5A2Q K;  4J01 A;  1XMX A;  4CCL A;  1JUP A;  3I59 B;  3V7C A;  2D5V A;  4Y15 A;  3BG3 A;  3R4K A;  2KHM A;  3V7R A;  4WCG A;  1FPQ A;  1Z0X A;  1FNN A;  4NHJ A;  3U1D A;  3LAJ A;  3MWM A;  2L2O A;  4FX0 A;  4BS9 A;  5FKN A;  3WU1 B;  2V26 A;  3CES A;  4OU0 A;  2HGC A;  3A01 A;  1IRG A;  4R8H A;  3I3L A;  2CW7 A;  5F27 A;  2V9K A;  5FKK A;  2QWW A;  2BHY A;  1YIO A;  4RLF A;  5FD5 A;  1G3S A;  1LB2 A;  1WSU A;  2AS5 F;  4M3F A;  1FYK A;  2CMP A;  1FSH A;  1R49 A;  2HDC A;  2BY1 A;  4LLN A;  1LE8 A;  4HF2 A;  3N4M A;  2FSW A;  3E6D A;  5D4S A;  1OCO H;  3LAP A;  3I56 I;  2H6C A;  2BYV E;  1ZQ3 P;  2KRF A;  1MJB A;  3OOP A;  3PNT A;  4F55 A;  1TLH B;  1JKQ C;  5CLS A;  2MLG A;  2XF7 A;  3M8E A;  3PQJ A;  3FX3 A;  5IY5 H;  4XLP F;  2V1D A;  3FBN B;  2R92 J;  3K1P A;  4HZF A;  3H3Z A;  1Z9C A;  3KET A;  1UHM A;  3G6E I;  1XDS A;  3BP8 A;  4E70 A;  3HUG A;  4ZDO A;  1KGS A;  1HDP A;  4HOB A;  4E4H A;  4OIN F;  2E1M C;  2I8D A;  3HPH A;  3TP0 A;  4A6D A;  3SZT A;  4BKX A;  3D1N I;  2L7Z A;  1FEX A;  3EUK L;  1XSV A;  2PX9 A;  5DDG A;  1J7K A;  3GYH X;  2V6E A;  3ZQ7 A;  2DJN A;  2L5Q A;  2VB6 A;  1E3O C;  5F64 A;  4MQV A;  1WGX A;  2XKO A;  1O57 A;  5EEG A;  3TKY A;  1W0T A;  2O6G E;  5H6R A;  4F93 B;  2A07 F;  1D8J A;  1D3Y A;  2JSP A;  5AON A;  2CQK A;  3QPS A;  1U3E M;  1K4T A;  2K9N A;  2X6O A;  1WCM J;  2A5W A;  3Q3S A;  4AC0 A;  3CP2 A;  3GME A;  3JAM Z;  1LFP A;  1IV8 A;  2HTS A;  1WH7 A;  3K70 C;  3ZOB A;  1B8I B;  5J8F A;  2IGK A;  3BZ6 A;  4GYI A;  5AIP A;  4X1E A;  1KZH A;  3SZP A;  3ESW B;  4XLF A;  2DN0 A;  2EZL A;  1YHQ I;  1X3U A;  1ITY A;  4IHS A;  1DU6 A;  4KIT B;  3LSI A;  3EYI A;  3IAS 2;  4BE1 A;  3S3N A;  2W24 A;  2O0Y A;  3WU2 C;  5IT9 K;  2XAU A;  4XOT A;  3BTC A;  1S7O A;  1LEA A;  2ZJ2 A;  2IS1 A;  1ZH5 A;  2H1L A;  1P7J A;  2RVC A;  1X1A A;  1R22 A;  1ZG3 A;  2XKP A;  3FDY A;  2EFO A;  5IP9 J;  3GTG J;  4HLY A;  3PFY A;  4KT6 A;  1MND A;  4RB2 C;  1ENH A;  1GV2 A;  1X4P A;  3OYK A;  3TBI A;  3JSP A;  1R1U A;  3KIO A;  3RQ4 A;  4N4N B;  2PN6 A;  1K4S A;  1ON1 A;  2YU3 A;  2DT5 A;  4HX4 A;  3BCA A;  3ECH A;  2LC2 A;  3M8F A;  1RRJ A;  5CYV A;  1N78 A;  2X1C A;  3MZ8 A;  4RGX A;  2XSJ C;  1MDM B;  4Y3O A;  4ZZL A;  1XN7 A;  2QBY A;  3GLL A;  3GF2 A;  1ZK8 A;  1QPI A;  1LVA A;  1JJ6 C;  2KQR A;  3LST A;  2H94 A;  2OZU A;  3CCR I;  3G1M A;  2X1E A;  1MJA A;  1UST A;  2DDB A;  3OV8 A;  3GTJ J;  5DUI A;  1XSD A;  4LG0 A;  3DF8 A;  4BHP A;  1TW3 A;  4XN3 A;  2QCO A;  2OCC H;  4BE0 A;  3I53 A;  1VQM I;  5FFX A;  2E7X A;  2QZ8 A;  5L3C A;  4XLN F;  1VQ6 I;  5E1W A;  3VSL A;  2GZW A;  1HW5 A;  1MBK A;  2LG4 A;  4YFK F;  2RNJ A;  5ICE A;  1W0U A;  2G7U A;  2ZXW H;  2WBM A;  2KL4 A;  1MMD A;  2E34 A;  5BNG A;  3LA3 A;  2Z2S B;  3FHN A;  4KA4 A;  3VYU B;  4U0Y A;  1T38 A;  1H0M A;  3LQQ A;  3U21 A;  3AG1 H;  1E0E A;  3JTG A;  1X58 A;  2RQQ A;  2R5Z B;  4FET A;  4R79 A;  5L3E A;  5TGT A;  1WQ2 A;  1YOV B;  5L3D A;  3HC7 A;  2E2H J;  3HHG A;  4HNU A;  3IL2 A;  1WH5 A;  1DP3 A;  2ZSI B;  2VC1 A;  4FE4 A;  1TWH J;  4Y4R A;  4CYC B;  3I0T A;  1ZKG A;  4A3G J;  4IRH A;  1G59 A;  2V1X A;  1ZLJ A;  2M2E A;  1MBF A;  5C4J J;  2JWT A;  4HBL A;  4XSZ F;  2DYR H;  5FRO A;  1VQ9 I;  9ANT A;  1ODD A;  2D2W A;  3BPV A;  3SHF A;  1WI9 A;  3CC7 I;  2L54 A;  3QYF A;  3TOA A;  4S05 A;  1IN6 A;  1U8B A;  4IOC F;  2X0L A;  1ETX A;  2ZME A;  5L3G A;  1K61 A;  1J59 A;  3S1Q J;  3FMS A;  5IP7 J;  5K5O A;  4L9J A;  4MFE A;  3GUD A;  3SDG A;  2ID3 A;  1X1C A;  3KEO A;  2A69 F;  2ISY A;  5FD6 A;  3MZH A;  5FRN A;  2WY8 Q;  3DEW A;  2BOL A;  1IRZ A;  2VE8 A;  2XF6 A;  4LMY A;  4M73 A;  4XKB A;  1R5G A;  2OAZ A;  3P5J A;  1EA3 A;  4ZTF A;  4X6A J;  4GXO A;  2RRE A;  1JGG A;  1X2M A;  2ZME C;  2BV6 A;  2A5Y B;  3CUQ B;  3MKL A;  3ZN1 A;  2EIN H;  1R6R A;  1D1B A;  5F6F A;  3LSP A;  4KYW A;  2LF8 A;  2L4A A;  2JQ7 A;  3A0H C;  3L9F A;  2IS2 A;  4RLQ A;  4A0Z A;  3S2W A;  4JX6 A;  3CJT B;  1YW8 A;  3IUO A;  2ZCW A;  3S14 J;  1BC7 C;  1B6A A;  2KIU A;  2BVM A;  1ZR4 A;  1IAW A;  4I2O A;  4NC7 A;  1BI1 A;  5KK1 A;  2DFF A;  3DLL F;  4LIU A;  3M7G A;  4BHC A;  2ZB9 A;  4I02 A;  4CCK A;  2RC4 A;  2NVT J;  3GCM A;  4PCQ A;  1TT5 B;  2JA7 J;  3C3W A;  4DZP A;  4ITV A;  2M1B A;  3KP3 A;  3BR6 A;  2FXA A;  2R7R A;  2HR3 A;  3N05 A;  3BG9 A;  4S0H B;  3PL8 A;  2VJ5 A;  3ML6 A;  2MSY A;  4G6Q A;  5FRM A;  2CQX A;  1VQL I;  1TZL A;  2FML A;  3GZN B;  3T0Y A;  4HDV A;  3WTV C;  3I5U A;  3JAM K;  1OYI A;  1WWX A;  1D0Y A;  2DA7 A;  2EV6 A;  4CDG A;  4EMS A;  1ZTR A;  1TQM A;  1IF1 A;  1RC9 A;  1NK3 P;  3ZMU A;  4KIB A;  2M8E A;  5HVQ C;  3QWL A;  2VLA A;  3BZC A;  3IV5 A;  3E3V A;  1FBQ A;  1LDJ A;  4JBA A;  4XN0 A;  3S8P A;  3I4M J;  1VF9 A;  2QUF A;  3BLY A;  4NQW B;  3ECO A;  4XKV A;  2R7V A;  4HA8 A;  3KP2 A;  4M3E A;  1Z6T A;  2OF7 A;  2NOG A;  3K2Z A;  1A36 A;  1FMW A;  2NVQ J;  2KPM A;  1EV7 A;  4ZC3 A;  2DLL A;  3BT9 A;  4BDY A;  3CF5 F;  2F4M B;  2WA0 A;  1ZG5 A;  4U88 A;  2XGC A;  2ME6 A;  4XIC A;  4B47 A;  2M30 A;  2MLK A;  1XCB A;  2LYC A;  4MHG A;  1AKH A;  2MBF A;  1F5T A;  4G94 A;  2VQH A;  1Z05 A;  3CDH A;  2QGU A;  5LFA A;  1SVL A;  1I27 A;  4MIM A;  4XM3 A;  3RKQ A;  5BPI A;  3S15 J;  2BVL A;  5HLH A;  5CVV A;  2EIM H;  2VC0 A;  1OCT C;  3CCV I;  1YIT I;  1FMV A;  4XK4 A;  1LFU P;  4RMN A;  4L9N A;  1I3A A;  1OCR H;  3K69 A;  2ZO4 A;  2ELJ A;  1RUN A;  3L09 A;  4AU7 A;  2DA4 A;  4EJT A;  3RI4 A;  1F1Z A;  1VND A;  3RSN A;  3MMY B;  3LSJ A;  2OBP A;  1RIO H;  1FOX A;  1SMT A;  4O5V A;  3UNG C;  4KMF A;  1T0F A;  4HQM A;  4UY8 I;  3ERE D;  2R7F A;  2ESH A;  3CO6 C;  2XGX A;  3FXM A;  5FLX Z;  4C2U A;  4A3E J;  2VUM J;  5FFZ A;  4RAG A;  1ZRC A;  3M1E A;  2AQE A;  3L7W A;  2EQR A;  1E17 A;  2O61 A;  3OYH A;  2X6X A;  4BUP A;  3C7J A;  3BY6 A;  1UMQ A;  2XPV A;  1MGT A;  3GO5 A;  2H8W A;  3FMR A;  3FIS A;  3W6V A;  3UR3 C;  1SFX A;  2M34 A;  3OYG A;  2W1O A;  4B1R A;  1SAX A;  1X3W B;  1RPW A;  2LF7 A;  2MYS A;  3F3X A;  4FQG A;  4HNT A;  4ENJ A;  3C2H A;  2VKD A;  2CWE A;  1MH3 A;  2HPI A;  4M6Y A;  2HVR A;  1KON A;  3H36 A;  4RGU A;  5D8L B;  3QOD A;  4E7Z A;  2XPW A;  4UXN A;  4E7H A;  1R23 A;  3OYE A;  4EQQ A;  2EB7 A;  1YO5 C;  3K9T A;  3K4C A;  1XC5 A;  5EGO A;  1UJ8 A;  5LBQ A;  1YIJ I;  1T2K A;  3S16 J;  1ZAR A;  2LLK A;  3WOD F;  3H0D A;  3H92 A;  4M6V A;  2KRH A;  2M7B A;  2K3P A;  3HRT A;  2KJC A;  3PFI A;  4U0V A;  4QWQ A;  1S6L A;  3HHH A;  3DTI A;  2GXA A;  4EM2 A;  2UWM A;  1XTA A;  1JE8 A;  1IUY A;  2MH9 A;  5A2Q Z;  3CCM I;  4IHX A;  2COB A;  5IOY A;  4UVA A;  3FZV A;  4E7K A;  3D5S C;  2Z9O A;  1UCR A;  1CQT A;  5F0H A;  1GXQ A;  2QEX I;  3C1D A;  4KIS A;  1BW6 A;  1F9N A;  2UUZ A;  1JHH A;  3I71 A;  3KEQ A;  2F5V A;  4L5E A;  3TO6 A;  2OD5 A;  3GW2 A;  1APL C;  1BJZ A;  3VFZ A;  3I58 A;  3K4B A;  3ISP A;  1TBX A;  3FXR A;  1IRF A;  4JP0 A;  4ESF A;  3QAH A;  4PJM A;  4MFD A;  2FOW A;  4XRF A;  4XOR A;  2KIF A;  5GP9 A;  3QPL A;  1S7E A;  3QOE A;  4C2T A;  1EH8 A;  4M6X A;  3WHB A;  2CV2 A;  1T98 A;  3CQZ J;  2VPL A;  2EBI A;  2LVS A;  4HRI A;  2M5W A;  2V6C A;  3LNQ A;  1PUF A;  3HOZ J;  3O3K A;  4HNV A;  4A3M J;  1O7L A;  3NAU A;  5C4X J;  4XSX F;  2X51 A;  4DYC A;  1LNW A;  3H1C A;  4CZC A;  2VAS A;  2DTR A;  1IXS B;  1BM9 A;  3P9C A;  2DT6 A;  2HQR A;  3SQN A;  2QQ8 A;  4G7H F;  2WV0 A;  2HFH A;  1Z77 A;  3GTL J;  4JOM A;  1QGP A;  2NNN A;  3CMY A;  1EJ9 A;  3CCE I;  3H0G J;  4RM2 A;  3CCJ I;  1FZP B;  3WTY C;  3J7A O;  1OJL A;  2L01 A;  5JI6 A;  1TW2 A;  3ULQ B;  1WJB A;  1P9Q C;  2YSR A;  4A5N A;  1GLN A;  3IWF A;  4EJO A;  3FXU A;  4W97 A;  3ASO H;  1J0R A;  4OIO F;  2K86 A;  5J6X A;  1JUS A;  2P7V B;  2NAZ A;  2XPU A;  3H3V K;  5B1A H;  2QSG X;  1LUJ B;  4BXU A;  5J47 A;  1PP7 U;  4AIK A;  2XAJ A;  2W25 A;  2R5Y B;  1XX5 A;  3CCQ I;  4HDU A;  2OTL I;  4G7O F;  1LEB A;  4EJW A;  3F8M A;  3CDL A;  3J80 Z;  2R93 J;  4M74 A;  2HOA A;  4IHV A;  5F0C A;  2FBI A;  4U0W A;  5EF6 A;  1B4A A;  5E3L A;  1R1T A;  3JRB A;  2J5P A;  2H8R A;  2GM4 A;  1GVD A;  2GQQ A;  4FX4 A;  2L9N A;  5KCM A;  4CUG A;  4E7J A;  2J5O A;  3DTK A;  2NXN B;  5KAF C;  4HAM A;  4S04 A;  2V9P A;  1WJD A;  5M3M J;  4NDL A;  2IRF G;  2W4S A;  5FLM J;  1FJL A;  4D5C A;  2EZI A;  2EFN A;  1FTZ A;  4UUS B;  4UNO A;  2JK3 A;  2H1K A;  2WAD A;  3H5R A;  2DMQ A;  3M07 A;  2R7Z J;  3T1B A;  1YTY A;  1IN7 A;  3KP4 A;  2HPM A;  1TTY A;  3HKZ N;  3SEQ A;  2JJ7 A;  4RAZ A;  4LD5 A;  1MNM C;  1V55 H;  4BJ5 C;  2KDO A;  4QTR A;  2MD0 A;  5E18 F;  1MMS A;  4P9F A;  3AKZ A;  5HS9 A;  1JTX A;  1I3Q J;  2L9S A;  1SD5 A;  3KEY A;  2DFI A;  4E7I A;  3W2V A;  1R58 A;  4RBO A;  2V9V A;  2M4G A;  3F0C A;  2L3D A;  2E2I J;  1T33 A;  2IPQ X;  4Y33 A;  5FLX K;  4HX8 A;  1T8I A;  4ZJZ A;  3WE3 A;  3TW7 A;  2IP2 A;  2L9R A;  4UUT A;  1I39 A;  2JZY A;  2XSD C;  4EV0 A;  4II2 A;  2K7L A;  1P4W A;  4DQ2 A;  4IX7 A;  3JRF A;  1V3F A;  5DM7 F;  2NS7 A;  4JX4 A;  1GVJ A;  4J19 A;  3LA2 A;  4M3D A;  3IRQ A;  1JKR C;  3H5A A;  2HYF A;  4E7L A;  4UV8 A;  5CKT A;  2MGQ A;  3FMQ A;  3GLX A;  4NQW A;  4HSR A;  1P2F A;  2BGC A;  3KE2 A;  2XB5 A;  2O8K A;  2GXB A;  4I98 B;  4L9V A;  1K79 A;  2E1O A;  4WXC A;  5HDN A;  1FC3 A;  2WAE A;  3DWL E;  2WWY A;  3KLO A;  3ZMD A;  3GFJ A;  3E6B A;  2HTJ A;  1VTN C;  4BBS J;  5DD8 A;  4YG2 F;  4BHB A;  1SAN A;  3PSF A;  4YFX F;  2LKP A;  2IJL A;  1H8A C;  2DU9 A;  2GA1 A;  2QM3 A;  1B9N A;  3EDP A;  2HNH A;  4U7B A;  2TCT A;  3JRA A;  1Y0N A;  2M3A A;  1IC8 A;  2IA0 A;  1DPU A;  2EV0 A;  2Y0S N;  1QVU A;  4HST A;  4I7H A;  4I6Z A;  4U7D A;  1TC3 C;  1POG A;  2IW5 A;  3OWT A;  2R7W A;  2E5Z A;  3Q0U A;  2Q1Z B;  2DA5 A;  1WJA A;  1IXR C;  2PBI A;  4M9S A;  3OMY A;  3I9V 2;  1ETV A;  1YW7 A;  4EGY A;  1HW1 A;  2HU9 A;  4ZYH A;  3AL0 B;  3M4O J;  5ICC A;  2WAQ N;  4PSX A;  1KQ9 A;  3OYD A;  3HRU A;  1I50 J;  3GXO A;  1FBS A;  2H09 A;  4B3X A;  4PFP A;  1UEL B;  1OIS A;  2WB1 N;  3G2B A;  2BW3 A;  3A03 A;  4WF2 A;  2M87 A;  3DU6 A;  2CSO A;  2XHK A;  3A0B C;  3ZQH A;  3BR5 A;  2CW8 A;  4IVN A;  2MAB A;  3HSF A;  1TWA J;  2Q0O A;  2RN7 A;  3LFU A;  2GBY A;  5DYM A;  5D5V B;  2ISZ A;  3TL4 X;  1MIJ A;  2PJR B;  1G3W A;  2RV8 A;  4DYR A;  2JT1 A;  5KAI C;  2OQG A;  1HCR A;  4RAF A;  4PSW A;  2O5R A;  5KVR A;  5E17 F;  4ZZD A;  3HJE A;  4L9T A;  3AG2 H;  3TO7 A;  1R71 A;  3AAF A;  1TWG J;  2Z16 A;  3ZMV A;  1RR7 A;  2CG4 A;  2F4I A;  1Z7L A;  3FF5 A;  3DTE A;  5DCM A;  3OYJ A;  3KCC A;  1YG2 A;  4CCJ A;  2HVQ A;  1Q1V A;  4GFB A;  3FXQ A;  2WY7 Q;  2XAS A;  2LR8 A;  4A3I J;  3S1N J;  4BQA A;  2KFD A;  1KU7 A;  4BDZ A;  3I4N J;  2DYS H;  3MKW B;  2GOX B;  1B9M A;  1VQN I;  1XCV A;  4JX5 A;  4A12 A;  1IN5 A;  4D0P A;  4HW0 A;  3JRC A;  4DGW B;  1AU7 A;  1P6R A;  3HOW J;  2DOF A;  2LY9 A;  4TV7 A;  5FKO A;  1ULY A;  4LGW A;  2DPU A;  2VQG A;  4II3 A;  5D6F A;  1FY7 A;  5KHD A;  2XGE A;  2LOO A;  3G4S I;  2E36 A;  1ETK A;  1DGW Y;  3DEE A;  1MD0 A;  3L2W A;  3S3O A;  3NRV A;  1H88 C;  3J80 K;  1A5J A;  3HBL A;  5EEH A;  5H2F C;  4F91 B;  1QPM A;  3KZI C;  4AWX B;  4N0B A;  3MN2 A;  3OYB A;  3GFI A;  4MQ9 F;  4E7S A;  1HKQ A;  3LSK A;  2IT0 A;  3R0J A;  3FK6 A;  5HS7 A;  2ESN A;  1O3Q A;  1G2H A;  2QKM B;  2EZK A;  2EFQ A;  1RNL A;  1S5L C;  1BR2 A;  2Z1D A;  2XF5 A;  5CVU A;  2JA6 J;  1P92 A;  1UG0 A;  4EJU A;  3ZCO A;  4NC6 A;  1IO2 A;  2O8X A;  1W4M A;  4BJT A;  1YI2 I;  2RDP A;  3IC7 A;  3PUF A;  4KMU X;  2HVS A;  2GIZ A;  2ELK A;  2FA5 A; 
#chains in the Genus database with same CATH homology
 3F8C A;  1OYW A;  1MJ9 A;  1U78 A;  2ZNY A;  3T8T A;  4ZYG A;  2VBX A;  3DQV C;  1ZYR F;  4I0B A;  4HF1 A;  3HOS A;  4HV5 A;  4RS8 A;  3DPL C;  1FX7 A;  1KQ8 A;  1QZZ A;  4KT5 C;  3WTT C;  2P7C B;  3RIR A;  5BQT A;  2V79 A;  1BN5 A;  3F8F A;  3ZMT A;  2XAF A;  1ZGJ A;  4YFN F;  4HX7 A;  3KP7 A;  1ONV A;  2HEO A;  5JR3 A;  3DP7 A;  1B59 A;  2OQR A;  3K1M A;  2XAH A;  2F5C A;  2VN2 A;  2E1N A;  4WK8 F;  4PDK A;  4PGG A;  4IXA A;  5E8G A;  5JFR A;  5E1Z B;  4MNU A;  1QQI A;  2P5K A;  3P9K A;  2A6H F;  3LFK A;  4CXF A;  1CF7 B;  3GZ6 A;  2Q8K A;  3DFG A;  3RJP A;  4HQE A;  2DQR A;  2YX7 A;  1IW7 F;  4M72 A;  3GVA A;  3QU6 A;  2E1C A;  3NEU A;  2W84 A;  1ZRF A;  2JPC A;  4GGG A;  3ROU A;  1BI2 A;  3WTU C;  4L18 B;  1Z1D A;  3TDU C;  1YLF A;  2FNA A;  2VBY A;  3PQK A;  3VEP A;  4HLX A;  2CW0 F;  2XAQ A;  3WU0 A;  5FO5 A;  3SFZ A;  4H0E A;  3RDI A;  1ZRE A;  4HF0 A;  4CIC A;  4ZYD A;  5DCF A;  2PFB A;  3LQR A;  4HV6 A;  2Y0M A;  1XGM A;  4WX9 A;  4NB5 A;  5IT3 A;  1HBX G;  5K1Y A;  1W7P D;  2WTE A;  4KN4 X;  2L4M A;  4LLL A;  3WTW C;  2P5L C;  1H9G A;  3BJO A;  2VOD A;  2PMH A;  3BJ6 A;  3F6V A;  3RPQ A;  3SXY A;  1WRJ A;  2YPR A;  3R60 A;  3I59 A;  1FYL A;  2PEX A;  2PG4 A;  3FWE A;  4Q4Z F;  2HOE A;  5ILU A;  3DPT A;  1ZAO A;  3QPH A;  1K78 B;  2VE9 A;  2JPB A;  4Q48 A;  4MEX F;  1SD6 A;  3ABU A;  5D4R A;  4WXH A;  3QOP A;  2QQ9 A;  5JVT A;  2LDU A;  2O3F A;  3R61 A;  2M45 A;  1SD4 A;  3EQL F;  4GCV A;  2KIM A;  4B09 A;  4OIP F;  1P4X A;  4DNC A;  1LDD A;  2HKX A;  2PMU A;  3L00 A;  4P96 A;  3MAJ A;  4CYD A;  5BOX A;  3F23 A;  2XV4 S;  4K2E A;  1TQP A;  5E8I A;  3I4P A;  1YS7 A;  3U9G A;  4Y17 A;  4BAY A;  3BWG A;  1O3T A;  4KNY A;  1FSE A;  2CYY A;  1OYY A;  3IKT A;  1IXC A;  1LJ9 A;  3BPX A;  5ICG A;  4RGS A;  3RKW A;  2FOK A;  3RTR A;  5ICF A;  2GIV A;  3QP6 A;  5HDG A;  3VB2 A;  2Q2E A;  1KYZ A;  5JHU A;  2YR2 A;  5L3B A;  1MDM A;  4MEY F;  2RKH A;  4N9H A;  1U8R A;  5LLQ A;  2W85 A;  2HS5 A;  1ZLK A;  2D1H A;  4XBF A;  2STW A;  3F6O A;  1Z91 A;  3CLO A;  4PZJ A;  1Y0U A;  1ON2 A;  4A0Y A;  1FP2 A;  2GA2 A;  1YW9 A;  1XGS A;  2Z99 A;  5CVJ A;  3ABT A;  4CHU A;  3GFL A;  3E5X A;  2JRT A;  3ELK A;  6PAX A;  3T5X A;  1YS6 A;  4P5O A;  2AXL A;  1EH6 A;  3E6M A;  4WWC A;  4MTE A;  4ENM A;  4EGZ A;  2VON A;  4L5I A;  2FMY A;  2FE3 A;  4Y13 A;  5BPD A;  4UV9 A;  2MH2 A;  2BEO A;  1CF7 A;  1S7A A;  1V4R A;  4Z2Y A;  3EET A;  1R1V A;  2VXZ A;  1J2X A;  5AIQ A;  2HYG D;  5LHI A;  1FOK A;  4AD9 A;  1ZN2 A;  1KYW A;  4FT8 A;  4I0A A;  1O3S A;  1YYV A;  2DI3 A;  2QQB A;  3E5U A;  3GEZ A;  5ILV A;  3BRO A;  3KZZ A;  2EWN A;  2ELH A;  1J75 A;  1P4A A;  2MD5 A;  3WTX C;  3T8R A;  4IF4 A;  2GWR A;  3CUQ A;  1BBY A;  2P4W A;  2R7D A;  2Y48 A;  4YIF A;  3DV8 A;  4KIF A;  3HOT A;  4R1H A;  5E1X A;  2F5E A;  4A6E A;  2EA4 A;  2ADU A;  4CO8 A;  2FF4 A;  2OU2 A;  1RUO A;  1UHW A;  2RGV A;  3CUQ C;  4OIR F;  2TDX A;  5LHH A;  2YX4 A;  5FB2 A;  3VOD A;  3P7N A;  3DXJ F;  1SD7 A;  2Z3Y A;  5D5W B;  3HRS A;  3HTU A;  2ZXJ A;  4ZYE A;  2A61 A;  3ZN0 A;  2A68 F;  4OIQ F;  2ZME B;  3M9A A;  5HLI A;  5LRR A;  3WG9 A;  2COM A;  4EVI A;  3P9I A;  3R6S A;  3F22 A;  4GO1 A;  4UVC A;  3D5L A;  4KN7 X;  3W6J B;  1K78 A;  1ZRD A;  4UUV A;  5HS8 A;  4AIJ A;  1MKM A;  1IZ1 A;  3KFW X;  3D0S A;  1XD7 A;  2IVM A;  4KFC A;  2MA3 A;  2P6S A;  2DAO A;  2EK5 A;  2XIG A;  3GFM A;  4MGR A;  5LEJ A;  4GYG A;  3F8B A;  3TOB A;  4ASN A;  4IRG A;  1G6N A;  1K6O A;  4G6D A;  2G9W A;  2Z5U A;  2VT2 A;  3V8J A;  1FBU A;  4A5M A;  3TQN A;  3V8L A;  1HKS A;  4I09 A;  1DDN A;  3GWZ A;  3MFK A;  4A0X A;  4MTD A;  2E7W A;  1AWC A;  4M9Z A;  4G7Z F;  2DK5 A;  1U6G A;  1D5V A;  4ETS A;  2H27 A;  1XMK A;  1PUE E;  1MZB A;  3COA C;  3ZPL A;  1TNT A;  2VBW A;  2DW4 A;  2V1U A;  4M71 A;  4IJA A;  4IHT A;  1J9I A;  1OPC A;  2EFW A;  3HSE A;  1ZGA A;  4JQF A;  2ZFW A;  2PJP A;  4OMZ A;  5L3F A;  1D8K A;  2HQN A;  1QBJ A;  4LB5 A;  3EYY A;  2G7H A;  3HRM A;  2ACJ A;  3ZP5 A;  4QLC U;  1OR7 A;  4CZZ A;  2RQP A;  2F5D A;  1BI0 A;  4YII A;  5BS6 A;  3LA7 A;  1ZG1 A;  4B8X A;  2PQ8 A;  2GXG A;  3O6B B;  4UHT A;  3KP5 A;  4Q5S F;  1GXP A;  4BH9 A;  2LSO A;  3DKW A;  2OA4 A;  3EUH A;  4M9X A;  1U5T B;  3G3Z A;  2P5V A;  1BIA A;  5LEK A;  2JSC A;  5DV5 A;  5BMZ A;  1SFU A;  3DEU A;  3I54 A;  2CO5 A;  1BOA A;  3E97 A;  2PI0 A;  2MC3 A;  4JK1 X;  2UZK A;  1W5S A;  1RZ4 A;  1LDK B;  1BIB A;  5HDK A;  3G73 A;  4IRI A;  4O3M A;  4P9U A;  3U2R A;  2D45 A;  1W5T A;  2HZT A;  2K4B A;  1FYM A;  5D8K B;  4KDP A;  4AIH A;  5TJJ A;  5LGN A;  4A2U A;  2PLY A;  2QLZ A;  3IHU A;  1USS A;  2ZNZ A;  4HYE A;  5LHG A;  1Z7U A;  1REP C;  1STZ A;  4G9Y A;  2F2E A;  1YQA A;  4CGZ A;  4RB1 A;  3FM3 A;  4LB6 B;  2Y75 A;  2ZBK A;  1G3T A;  3CTA A;  1HKT A;  1K7A A;  1EH7 A;  3F72 A;  2DBB A;  4Q47 A;  3RYP A;  1UB9 A;  3HTS B;  5FGM A;  3V4G A;  1SFE A;  3IWZ A;  5CVI A;  1JHF A;  1Q1H A;  3BDD A;  1QZY A;  2FEZ A;  1BI3 A;  1T6S A;  5LGU A;  4G8X A;  3Q5F A;  1R5H A;  1S3J A;  3IKV A;  1FWZ A;  3QRF F;  2STT A;  2NS0 A;  1Z6R A;  1R36 A;  2OZ6 A;  3WE2 A;  1F4K A;  2FQ3 A;  2FRH A;  2XAG A;  3WGI A;  2WC2 A;  1C0W A;  3RKY A;  2ZKZ A;  1W7P B;  3CO7 C;  1L0O C;  2A3S A;  2O03 A;  4BNC A;  2DO7 A;  5DUK A;  3F8N A;  2KKO A;  2D1V A;  1XGN A;  1LQ1 A;  2KJB A;  2EV5 A;  2HKO A;  4KIG A;  1TQI A;  2W57 A;  3H3U A;  3QU3 A;  2QYO A;  5J8C A;  2FBH A;  1BJA A;  2HWV A;  3GX4 X;  1OMI A;  1HSJ A;  2EFP A;  2K27 A;  2BE5 F;  4KIC A;  3TDZ C;  5F1R A;  3MEX A;  2NRA C;  3B73 A;  2VOP A;  3F21 A;  3L2C A;  2NYX A;  3JTH A;  3I64 A;  1NHA A;  2K4J A;  4OMY A;  1DP7 P;  2JTV A;  5LGT A;  2C6Y A;  3ZMS A;  1E2X A;  2H6B A;  1FP1 D;  2IA2 A;  4ENK A;  3NQO A;  2QQA A;  1I1G A;  1O7F A;  1HQC A;  4L0Y B;  1YFH A;  2UXN A;  2B0L A;  4LK0 F;  3FM5 A;  2DPD A;  3Q9V A;  3GZ5 A;  5K5R A;  4EM1 A;  4ENN A;  5DD4 A;  4LJZ F;  3LWF A;  1U2W A;  2FBK A;  2FU4 A;  5K5Q A;  4IPA A;  4ZH4 F;  3TGN A;  3J81 Z;  2X4H A;  5ILS A;  1DPR A;  1KU9 A;  5HOO A;  1KU3 A;  3HYI A;  2R3S A;  1XSX A;  1HW2 A;  1R7J A;  4LLG F;  1U5T A;  3KLN A;  3HIF A;  5HLG A;  1FT9 A;  3CJN A;  1O3R A;  5DCM B;  5LRS A;  2GAU A;  4EJV A;  4RAY A;  1HST A;  2QVO A;  5CJ9 A;  2DK8 A;  1U5T C;  1WKM A;  3WTZ A;  4AVP A;  3V7S A;  3WGH A;  3K0L A;  4BYY A;  5E20 A;  1RI7 A;  4LK1 F;  2CGP A;  2Z33 A;  3O2P E;  1ZHF A;  4P55 A;  2XUB A;  3B02 A;  2XVC A;  2NNY A;  1XB4 A;  2LNB A;  2CFX A;  5H20 A;  3R0A A;  5D5X B;  3W6K B;  1KA8 A;  3FHZ A;  1IN8 A;  3VOE A;  1JGS A;  1TNS A;  2BBY A;  2VT3 A;  4LFU A;  1XDU A;  1R00 A;  4ESJ A;  4PGH A;  3Q9S A;  1QNT A;  5H6Q A;  1XMA A;  3C18 A;  2L02 A;  3JW4 A;  3N97 A;  1QO0 D;  1T39 A;  3E5Q A;  1S29 A;  2QBY B;  2F5F A;  1L3L A;  5D6E A;  1PP8 F;  1XGO A;  3RPU A;  2K02 A;  3MQ0 A;  3QP5 A;  2EJR A;  2DQL A;  4LG0 B;  4UVB A;  1DUX C;  2P6T A;  4L5J A;  1UFM A;  5D5U B;  1BC8 C;  2EA2 A;  1I6X A;  1PDN C;  1OKR A;  1SMY F;  4RB0 A;  1H9T A;  1G4D A;  1A04 A;  2IA1 A;  3MZY A;  2VBZ A;  2XRO A;  3HSR A;  4O6J A;  4RB3 C;  5IT9 Z;  3E6C C;  3WGG A;  4L0Z B;  5CVR A;  1J5Y A;  3MCZ A;  4OOI A;  3KP6 A;  4WXD A;  1W7P A;  3JSO A;  3KZY A;  3TO9 A;  4FHT A;  2XRN A;  3QPT A;  3BJA A;  2UXX A;  1I1S A;  3CUO A;  2P8T A;  1AOY A;  1S8N A;  3J81 K;  4F7Z A;  2FNP A;  3V8K A;  4I01 A;  1KQ0 A;  4EM0 B;  1CGP A;  3RYR A;  1HXD A;  1I5Z A;  2QEN A;  5TRD A;  2A6E F;  1GHC A;  2ETH A;  3K1N A;  5ERI A;  2VOO A;  1B1B A;  5ED4 A;  3IRR A;  1JXS A;  3BOQ A;  4N9I A;  3ZMZ A;  3REO A;  1G3Y A;  3WTS C;  4RGR A;  5DEQ A;  1IN4 A;  4ON0 A;  4ESB A;  1FLI A;  3RKX A;  1KU2 A;  5A2Q K;  3I59 B;  3V7C A;  4Y15 A;  3R4K A;  4WCG A;  3V7R A;  1FPQ A;  1FNN A;  4NHJ A;  3U1D A;  3LAJ A;  3MWM A;  4FX0 A;  3WU1 B;  4OU0 A;  2HGC A;  1IRG A;  4R8H A;  2QWW A;  1YIO A;  5FD5 A;  1G3S A;  1LB2 A;  1WSU A;  2AS5 F;  1FSH A;  1FYK A;  2HDC A;  4LLN A;  4HF2 A;  3N4M A;  2FSW A;  3E6D A;  5D4S A;  3LAP A;  2H6C A;  2BYV E;  2KRF A;  1MJB A;  3OOP A;  1TLH B;  5CLS A;  2MLG A;  3M8E A;  3PQJ A;  4XLP F;  3FX3 A;  2V1D A;  3K1P A;  4HZF A;  3H3Z A;  1Z9C A;  3KET A;  1UHM A;  1XDS A;  3BP8 A;  4E70 A;  3HUG A;  1KGS A;  4HOB A;  4OIN F;  4A6D A;  3SZT A;  1XSV A;  5DDG A;  1J7K A;  3GYH X;  3ZQ7 A;  5F64 A;  4MQV A;  2XKO A;  1O57 A;  5EEG A;  3TKY A;  2O6G E;  5H6R A;  2A07 F;  1D8J A;  1D3Y A;  5AON A;  2CQK A;  1U3E M;  3JAM Z;  2HTS A;  5J8F A;  3BZ6 A;  5AIP A;  4GYI A;  3SZP A;  1X3U A;  4IHS A;  3EYI A;  2W24 A;  2O0Y A;  5IT9 K;  1S7O A;  1LEA A;  2ZJ2 A;  1ZH5 A;  2RVC A;  1R22 A;  1ZG3 A;  2XKP A;  2EFO A;  4HLY A;  4RB2 C;  3JSP A;  1R1U A;  2PN6 A;  1ON1 A;  2YU3 A;  2DT5 A;  4HX4 A;  3ECH A;  3M8F A;  5CYV A;  4RGX A;  1MDM B;  4ZZL A;  1XN7 A;  2QBY A;  3GF2 A;  1LVA A;  3LST A;  2H94 A;  2OZU A;  1UST A;  1MJA A;  3OV8 A;  1XSD A;  5DUI A;  4LG0 A;  3DF8 A;  4BHP A;  1TW3 A;  3I53 A;  5FFX A;  2E7X A;  2QZ8 A;  5L3C A;  4XLN F;  5E1W A;  2GZW A;  1HW5 A;  4YFK F;  2RNJ A;  5ICE A;  2G7U A;  3LA3 A;  4KA4 A;  4U0Y A;  1T38 A;  1H0M A;  3LQQ A;  3JTG A;  4R79 A;  5L3E A;  1WQ2 A;  5L3D A;  3HHG A;  3IL2 A;  2VC1 A;  3I0T A;  4IRH A;  2V1X A;  1ZLJ A;  4HBL A;  4XSZ F;  1ODD A;  2D2W A;  3BPV A;  3SHF A;  1WI9 A;  2L54 A;  3TOA A;  4S05 A;  1IN6 A;  2X0L A;  2ZME A;  5L3G A;  1J59 A;  3FMS A;  5K5O A;  4L9J A;  3GUD A;  3KEO A;  2A69 F;  2ISY A;  5FD6 A;  3MZH A;  2VE8 A;  4LMY A;  4M73 A;  1R5G A;  2OAZ A;  4GXO A;  2BV6 A;  2A5Y B;  3CUQ B;  3ZN1 A;  5F6F A;  4KYW A;  2LF8 A;  2L4A A;  3L9F A;  4A0Z A;  3S2W A;  1YW8 A;  2ZCW A;  1BC7 C;  1B6A A;  2KIU A;  1IAW A;  4I2O A;  1BI1 A;  5KK1 A;  3M7G A;  4BHC A;  4I02 A;  2RC4 A;  4PCQ A;  3C3W A;  2M1B A;  3KP3 A;  2FXA A;  2HR3 A;  3ML6 A;  4G6Q A;  2FML A;  4HDV A;  3T0Y A;  3WTV C;  3I5U A;  3JAM K;  1OYI A;  1WWX A;  2EV6 A;  4CDG A;  4EMS A;  1TQM A;  1IF1 A;  3ZMU A;  4KIB A;  2M8E A;  5HVQ C;  3E3V A;  1FBQ A;  1LDJ A;  4JBA A;  2QUF A;  3ECO A;  4HA8 A;  3KP2 A;  1Z6T A;  3K2Z A;  1EV7 A;  2DLL A;  1ZG5 A;  4U88 A;  2M30 A;  2MLK A;  1XCB A;  4MHG A;  2MBF A;  1F5T A;  4G94 A;  1Z05 A;  3CDH A;  1I27 A;  5BPI A;  5HLH A;  5CVV A;  2VC0 A;  4L9N A;  3K69 A;  2ZO4 A;  1RUN A;  3L09 A;  4EJT A;  3RI4 A;  1F1Z A;  2OBP A;  1RIO H;  1SMT A;  4O5V A;  4KMF A;  1T0F A;  4HQM A;  3ERE D;  2R7F A;  2ESH A;  3CO6 C;  2XGX A;  5FLX Z;  5FFZ A;  1ZRC A;  3M1E A;  3L7W A;  1E17 A;  2O61 A;  3C7J A;  3BY6 A;  1MGT A;  3GO5 A;  3FMR A;  1SFX A;  1SAX A;  2LF7 A;  3F3X A;  4ENJ A;  2CWE A;  4M6Y A;  4RGU A;  5D8L B;  4UXN A;  1R23 A;  4EQQ A;  2EB7 A;  1YO5 C;  3K9T A;  5LBQ A;  1T2K A;  1ZAR A;  3WOD F;  3H92 A;  3HRT A;  2KJC A;  3PFI A;  4U0V A;  4QWQ A;  1S6L A;  3HHH A;  4EM2 A;  2UWM A;  1JE8 A;  1IUY A;  2MH9 A;  5A2Q Z;  2Z9O A;  4UVA A;  3FZV A;  1UCR A;  1GXQ A;  3C1D A;  1F9N A;  1JHH A;  3I71 A;  3KEQ A;  3TO6 A;  2OD5 A;  3GW2 A;  3VFZ A;  3I58 A;  3ISP A;  1TBX A;  3FXR A;  1IRF A;  4ESF A;  3QAH A;  4XRF A;  2KIF A;  1EH8 A;  4M6X A;  1T98 A;  2M5W A;  2V6C A;  3O3K A;  1O7L A;  4XSX F;  1LNW A;  2DTR A;  1IXS B;  1BM9 A;  3P9C A;  2HQR A;  3SQN A;  4G7H F;  2WV0 A;  2HFH A;  1QGP A;  2NNN A;  1FZP B;  3WTY C;  3J7A O;  2L01 A;  5JI6 A;  1TW2 A;  3ULQ B;  2YSR A;  4A5N A;  3IWF A;  4EJO A;  3FXU A;  4OIO F;  1J0R A;  2K86 A;  5J6X A;  2P7V B;  2NAZ A;  4BXU A;  1PP7 U;  4AIK A;  2XAJ A;  2W25 A;  4HDU A;  1LEB A;  4G7O F;  4EJW A;  3F8M A;  3J80 Z;  4M74 A;  2FBI A;  4U0W A;  1B4A A;  1R1T A;  2J5P A;  2GQQ A;  4FX4 A;  2J5O A;  4HAM A;  4S04 A;  2IRF G;  2EFN A;  4UNO A;  3T1B A;  1YTY A;  1IN7 A;  3KP4 A;  1TTY A;  4RAZ A;  4LD5 A;  5E18 F;  4P9F A;  5HS9 A;  1SD5 A;  2DFI A;  1R58 A;  2V9V A;  2L3D A;  2IPQ X;  5FLX K;  4HX8 A;  3WE3 A;  2IP2 A;  2JZY A;  4EV0 A;  2K7L A;  1P4W A;  4DQ2 A;  1V3F A;  1GVJ A;  3LA2 A;  3IRQ A;  2HYF A;  4UV8 A;  3FMQ A;  3GLX A;  4NQW A;  1P2F A;  2BGC A;  3KE2 A;  2GXB A;  4I98 B;  4L9V A;  1K79 A;  4WXC A;  5HDN A;  1FC3 A;  2WWY A;  3KLO A;  3ZMD A;  3GFJ A;  3E6B A;  2HTJ A;  1VTN C;  5DD8 A;  4YG2 F;  4BHB A;  4YFX F;  2LKP A;  2IJL A;  4U7B A;  2DU9 A;  2GA1 A;  1B9N A;  2QM3 A;  3EDP A;  1DPU A;  2IA0 A;  2EV0 A;  4I7H A;  4U7D A;  2IW5 A;  1IXR C;  2PBI A;  4M9S A;  1YW7 A;  4EGY A;  1HW1 A;  4ZYH A;  5ICC A;  1KQ9 A;  3HRU A;  3GXO A;  1FBS A;  2H09 A;  4WF2 A;  2M87 A;  2CSO A;  2XHK A;  4IVN A;  3HSF A;  2Q0O A;  2RN7 A;  5DYM A;  5D5V B;  2ISZ A;  1G3W A;  2RV8 A;  2JT1 A;  2OQG A;  5KVR A;  5E17 F;  4ZZD A;  4L9T A;  3TO7 A;  3AAF A;  3ZMV A;  2CG4 A;  3FF5 A;  5DCM A;  3KCC A;  1YG2 A;  3FXQ A;  2XAS A;  4BQA A;  1KU7 A;  1B9M A;  1XCV A;  4A12 A;  1IN5 A;  4D0P A;  4HW0 A;  1P6R A;  4TV7 A;  1ULY A;  4LGW A;  2DPU A;  5D6F A;  1FY7 A;  1MD0 A;  3NRV A;  3J80 K;  5EEH A;  1QPM A;  4AWX B;  4N0B A;  3GFI A;  4MQ9 F;  1HKQ A;  2IT0 A;  3R0J A;  5HS7 A;  2ESN A;  1O3Q A;  2EFQ A;  1RNL A;  5CVU A;  1P92 A;  4EJU A;  2O8X A;  1W4M A;  2RDP A;  3IC7 A;  4KMU X;  4KUM A;  2FA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...