4MHNA

Crystal structure of a glutaminyl cyclase from ixodes scapularis
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
326
structure length
326
Chain Sequence
LKWPRDLRPLAHHDLLYMGQISEEDRGDFNATLRNFLVPRVVGSQKHREVREFIVRSLKDLDWDVEEDCFDGQTPHGIKPFCNVIATLNPSACHRLVLACHYDSLLHKEGTFIGATDSAVPCAQLLYLARSLNGKLQNQKTRGDGLTLQLVFFDGEEAFERWSSHDSLYGSRHLAQKWHEDRTSAERLESCLERSEIANQIDRMEVMVLLDLLGAENPRFYSYFGETQPVYRRLVNIESRLNDAGLMELPRRRRRTNYFSNSSTVGFIEDDHIPFLKRSVPIVHIIPSPFPDVWHTLDDNEQNLHHPTISNLNKIFKAFVSEYLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl cyclase, putative
publication title Structural and functional analyses of a glutaminyl cyclase from Ixodes scapularis reveal metal-independent catalysis and inhibitor binding.
pubmed doi rcsb
source organism Ixodes scapularis
molecule tags Transferase
total genus 110
structure length 326
sequence length 326
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mhnA00
4NGMA 2ZEPA 3PEIA 4F8ZA 4G1PA 2ZOFA 1IY7A 3SJGA 3V7ZA 2ZOGA 2F8HA 2PJAA 4OC1A 2JBJA 3KHXA 3TC8A 4PPZA 2WZNA 2AFMA 1TF9A 2JEWA 4MCRA 4YU9A 2I3CA 4MCQA 4FBEA 1HDQA 3NH4A 4RUHA 4P4FA 3H8FA 1JQGA 2PJ8A 3NFZA 4PXBA 1XFOA 1ZG8A 2G9DA 1HDUA 2PJ3A 2XEGA 1Z8LA 1FNOA 5D8NA 2PJ7A 1LAPA 4P4EA 1DE4C 1TF8A 3KR4A 3PFEA 1ZLIA 2CF4A 5HVGA 2Q4ZA 4A39A 3NA6A 4PXDA 3BXMA 2V8HA 2PJ2A 1EE3P 4TNUA 4K3NA 3MRUA 2XEFA 4OC5A 3GLJA 3PBBA 4F9VA 1CBXA 4F9UA 5K8PA 2ZEDA 1LFWA 3KR5A 4IHMA 4UEZA 3FECA 4ZY1A 5I4MA 2IJZA 1F2OA 2PCUA 2PJ9A 1CPSA 1F57A 2PJCA 4FAIA 1VGYA 2V8VA 4WJBA 2PJ6A 4OKOA 4NJQA 4OC3A 4FWUA 2NYQA 5D29A 4A94A 4IK2A 3VH9A 4ZX9A 4OP4A 4X2TA 3RBUA 4ZX8A 2XEJA 5HXDA 1YSJA 3BI0A 3RZAA 2HC9A 4P45A 3KGQA 4PXCA 1OBRA 3KQXA 1KWMA 4P4DA 3CPXA 2PJ5A 4X3RA 5IB9A 2EK9A 2PJBA 1VHOA 3ISXA 3CDXA 3D7GA 3FVLA 1BPMA 2CTCA 2ZEEA 3NH5A 1TKFA 3SJEA 4UEEA 2NSMA 2PIYA 3KHZA 4PQAA 5HVFA 4Q7AA 3T8WA 3H8EA 1ARMA 1ELLP 5JGFA 5K8OA 3SJXA 3SI2A 3FH4A 5LRGA 3PFOA 5CPAA 3PB6X 2PVWA 4MHPA 1XBUA 3B3SA 3DLJA 3QNVA 2AFUA 3KL9A 4YWYA 4OIWA 4NGTA 3JRUA 2AFWA 2BO9A 1M4LA 1R43A 1CX8A 3WC7A 3PBEA 5F09A 4NGSA 1XMBA 3BHXA 2QYVA 3B3TA 3D68A 3FJUA 3DGVA 4WWVA 2ZEOA 3N5FA 2XEIA 5ELYA 1LOKA 2GREA 1VHEA 3IO1A 4P4JA 2BCOA 4UIAA 1QQ9A 4P44A 3KZWA 3SJFA 2WYRA 4H2KA 4P10A 4OC2A 3S9LA 3GB0A 1UWYA 2ZEHA 4OMEA 2PJ1A 5HVHA 3PB7X 1DTDA 4MXUA 3WABA 3B35A 1ZG7A 1Z2LA 2Q51A 3D67A 3FX6A 3IWWA 4OIDA 5LRJA 2GU2A 3PB4X 4B6ZA 4JYWA 5DS0A 4JZ0A 1VIXA 5LYIA 2C6PA 3WT4A 1CG2A 3S9MA 1F2PA 4CPAA 4PXEA 4R8FA 1QMUA 4UF4A 4A38A 2Q43A 1XRYA 3B3CA 4KSIA 8CPAA 3B7IA 2AFZA 2ZENA 1Z5RA 3L2NA 6CPAA 3PRTA 5LYDA 1YW6A 1Y7EA 5THWA 5K8NA 3PB8X 5JM6A 4MRIA 4MMOA 1LCPA 3IEHA 2QJ8A 4MHZA 4LQGA 2FVGA 2BOAA 2V8DA 4ZI6A 4NFRA 1YMEA 2QVPA 4X8IA 3FEEA 3K9TA 2ZEMA 4EWTA 3ISZA 4DJLA 2HB6A 3GUXA 3PB9X 4A37A 3IIBA 1TKJA 1ARLA 3FF3A 1CP7A 3H8GA 4NGNA 4R7MA 2F7VA 2OOTA 4BD9A 2JBKA 3CT9A 3NH8A 2PIZA 4NGRA 4IAVA 2PJ4A 2RFHA 4O23A 2O53A 4NJRA 2AFXA 1CPXA 2ABZA 4EMEA 2PE3A 5JH9A 1Y0YA 2VL1A 1NSAA 3VATA 4Z65A 3CPAA 5LRKA 4UIBA 3D4UA 2C6CA 3IC1A 3B3VA 1BPNA 3HLPA 4MHYA 2AFSA 3V38A 3HUVA 1Y0RA 2GLJA 3D7HA 2IQ6A 2OR4A 2GLFA 3VARA 2POKA 4MCSA 3LWUA 1H8LA 1FT7A 4P4IA 1AMPA 1ZLHA 2DEAA 2C6GA 3TX8A 4NGQA 2AFOA 3WC5A 3B2YA 4UEFA 5LYLA 2O4HA 4ONWA 4DYOA 3B3WA 1CP6A 1HEEA 1ELMP 1TXRA 4DUKA 3D7DA 3SI1A 1LANA 2EWBA 2ANPA 3IFEA 3BI1A 2CTBA 4R6TA 5LYFA 3I1UA 2C1CA 3D66A 2RB7A 3LMSA 3KASA 4ZYQA 4OC4A 2CIJA 4ZY0A 4P6YA 3FMCA 4TWEA 5K8MA 4AXVA 4MHNA 1Q7LA 1GYTA 1RTQA 1YW4A 3D7FA 3MN8A 1LAMA 4GM5A 3RAMA 2J9AA 4R76A 2ZELA 2ZEFA 2PRQA 4ZY2A 2PJ0A 1TKHA 5CBMA 3FEDA 1PYTB 1ZG9A 3KI9A 7CPAA 3IJ3A 3SI0A 1BLLE 1IGBA 4NGPA 1AYEA 2EK8A 2PVVA 4W9YA 3S9NA 4MCPA 1R3NA 2ZEGA 1XJOA 1PCAA 4EFDA 1BAVA 2V77A 4FUUA 2IMOA 3K2KA 4P4BA 5J1QA 3KQZA 3WC6A 4OC0A 1YLOA 2V8GA
chains in the Genus database with same CATH superfamily
4NGMA 2ZEPA 3PEIA 2P6EA 3VWDA 3EFAA 4XPKA 4F8ZA 4MFZA 4G1PA 2ZOFA 3TO9A 1IY7A 2Z11A 1YREA 3R9EA 3SJGA 3V7ZA 2EVNA 2ZOGA 4L8AA 4PK3A 3V8IA 2G3AA 1MJAA 2F8HA 4QB9A 3TT2A 5IB0A 2PJAA 4OC1A 2JBJA 4C68A 4CRYB 3KHXA 1S7KA 3TC8A 4PPZA 2R8VA 2WZNA 2AFMA 1TF9A 1K4JA 1YVOA 2JEWA 4MCRA 4YU9A 2I3CA 4MCQA 4FBEA 4KLWA 1HDQA 1MJ9A 3NH4A 4P4FA 3H8FA 4RUHA 4UCNA 3RYOA 1JQGA 2FT0A 2Z3NA 2PJ8A 3NFZA 4OLLA 4UFXA 2YNEA 1S7LA 4PXBA 4UWJA 1XFOA 1ZG8A 1X12A 2G9DA 1HDUA 5G20A 4JD6A 2PJ3A 2XEGA 1Z8LA 1FNOA 3IU2A 5D8NA 5J8CA 1JWQA 2ODFA 1MJBA 2B3VA 2VQYA 1TIQA 2PJ7A 1LAPA 3LD2A 4P4EA 1AUGA 1DE4C 1TF8A 1V0CA 3G8WA 3A9LA 3KR4A 3PFEA 2DF5A 4FD4A 4FD7A 4MFKA 1ZLIA 2CF4A 3MGDA 5HVGA 2REEA 2Q4ZA 2P0WA 2GANA 4C2YA 4A39A 4C7HA 1UFHA 3B8GA 3NA6A 2CY2A 4MFJA 4PXDA 3BXMA 3N7ZA 4MJ8A 4PSWA 2ZPAA 2Z3PA 2V8HA 2R7HA 4R3KA 2PJ2A 4IUSA 1EE3P 4CYOA 3P2HA 4JJXA 3K9UA 1IYLA 4TNUA 4K3NA 3MRUA 4KOSA 2XEFA 4B10A 4OC5A 3OWCA 3GLJA 3PBBA 4F9VA 2C27A 1R57A 3JTKA 4E8OA 1CBXA 2WPXA 3EO4A 4MI4A 4F9UA 5K8PA 2ZEDA 5AG7A 1LFWA 3KR5A 4IHMA 4UEZA 2QIRA 3FECA 4ZY1A 4Y49B 4FD5A 3FYNA 2IJZA 5I4MA 2B58A 2I00A 4PK2A 1F2OA 2PCUA 1NE9A 3W91A 2PJ9A 2OH1A 1KUXA 1CPSA 2B4DB 1F57A 2PJCA 4CGNA 1VGYA 2V8VA 4FAIA 4MFQA 2PJ6A 4OKOA 1Q2YA 4WJBA 4NJQA 4OC3A 4UFWA 3T90A 5J8FA 4FWUA 5DWNA 2NYQA 2GIVA 3G3SA 1YGHA 3D8PA 2WPWA 5D29A 5G21A 3P2FA 1FY7A 3GIUA 5AG4A 4A94A 4IK2A 4KUBA 4CGOA 3VH9A 4ZX9A 3IWGA 3JUWA 3D3SA 4OP4A 2Q44A 5F49A 4X2TA 3RBUA 2B4DA 4ZX8A 2XEJA 5EMIA 3LACA 5HXDA 3FNCA 1YSJA 3BI0A 3RZAA 2HC9A 2G3TA 2ZW4A 3NE8A 4H6ZA 4HPSA 4P45A 3KGQA 4B5PA 1M4DA 2P6GA 1U6MA 5F47A 4PXCA 1OBRA 3KQXA 1KWMA 3QB8A 4P4DA 4XPDC 3CPXA 2PJ5A 4AVCA 4X3RA 3FRMA 5IB9A 2ZW6A 4PSXA 4JLYA 4LUAA 2Q7SA 3S6GA 2EK9A 2PJBA 1IB1E 3I9SA 1VHOA 3ISXA 4MHDA 1ZO0A 3CDXA 1QSRA 3D7GA 4KLVA 2NMTA 3BJ8A 4QBJA 3FVLA 4MBUA 1BPMA 2CTCA 4RN7A 2FE7A 4CRZB 1YX0A 2ZEEA 2WSAA 3NH5A 1TKFA 4L89A 4F0YA 5KTDA 3SJEA 3EC4A 4UEEA 1BOBA 2NSMA 2PIYA 3TOAA 5AG6A 2A4NA 3IU1A 3EXNA 3KHZA 4NEXA 4PQAA 5HVFA 4QC6A 1IIDA 4Q7AA 5IX3A 4KOWA 5G22A 2Y0MA 3T8WA 1NSLA 4X5KA 1QSMA 4AVBA 4BINA 1XF8A 2ZW7A 3H8EA 1ARMA 1ELLP 4KOXA 5JGFA 1Z9UA 2HQYA 4U9ZA 3SI2A 3SJXA 3FH4A 1P0HA 1YQEA 5LRGA 1LRZA 3PFOA 5CPAA 4K30A 1YVKA 3PB6X 4KSFA 1KUYA 2PVWA 4KS9A 4MHPA 4CAWA 1XBUA 4B12A 3B3SA 4A95A 3DLJA 5AGEA 3QNVA 2AFUA 3KL9A 3E0KA 4YWYA 4DNCA 3DR8A 4NGTA 4OIWA 3EY5A 5H86A 3FB3A 4J3GA 3S6HA 4LQ6A 4KZTA 2VZYA 1IOIA 4NF1A 2FIWA 4KSAA 1PUAA 3JRUA 2JLMA 3PP9A 2AFWA 1QSTA 4R9MA 4M6HA 4JWPA 2AE6A 2BO9A 1M4LA 1R43A 4EVYA 1CX8A 3WC7A 3PBEA 4R57A 1M4IA 3NE7A 4M85A 1OZPA 5F09A 5HH1A 4NCZA 4NGSA 4RS2A 5C82A 5A27A 1XMBA 1WK4A 4H89A 3BHXA 2QYVA 3B3TA 2PRBA 1N71A 2PDOA 4UCMA 3D68A 3CXSA 1B87A 2AJ6A 3FJUA 3DGVA 4WWVA 2ZEOA 1Q2CA 3F8KA 3DSBA 1Y9KA 2XEIA 1Q2DA 3N5FA 5ELYA 1LOKA 5FVJA 2GREA 1VHEA 3JVNA 1BO4A 2RC4A 3IO1A 5GCNA 2REFA 4P4JA 3WR7A 2BCOA 3RNZA 1S3ZA 3I3GA 4UIAA 1IYKA 3SXNA 1I12A 1QQ9A 4UA3A 1Y9WA 2OU2A 4P44A 2GE3A 3KZWA 1RO5A 2Q4VA 3SJFA 4XNHC 1P4NA 4KORA 2WYRA 4H2KA 4ZBGA 4P10A 4GS4A 2JDDA 4OC2A 3W6SA 4A30A 3S9LA 2G0BA 3GB0A 4B11A 1KUVA 1UWYA 2ZEHA 4OMEA 3FBUA 4KVME 3SXOA 2PJ1A 4Q36A 4KOVA 4BBHA 4E0AA 5HVHA 2OZUA 3PB7X 4AVAA 1DTDA 4IF5A 2EO8A 4MXUA 2CXAA 3WABA 3B35A 1ZG7A 1Z2LA 2Q51A 4R3LA 3D67A 3FX6A 1MK4A 3IWWA 3H5ZA 4KOTA 4OIDA 5LRJA 2GU2A 3PB4X 4B6ZA 1CJWA 1XE4A 4JYWA 5DS0A 2CNTA 5DWMA 2O28A 4JZ0A 1VIXA 2Z10A 5LYIA 2FL4A 4A31A 2C6PA 5HMNA 3WT4A 1CG2A 4QVTA 1YLEA 2BL1A 5A28A 3QAYA 3R1KA 2VI7A 1XOVA 4MY0A 3S9MA 1F2PA 2EBJA 4CAEA 2HUZA 4CYNA 1Y7RA 3GKRA 4HNYB 2YGWA 4CPAA 4PXEA 4R8FA 4CAVA 1QMUA 4UF4A 2F5IA 2JEVA 1Z8XA 2VBQA 3GY9A 4UFVA 4A38A 4MFLA 2Q43A 4C7IA 1XRYA 1L0CA 3B3CA 3H4QA 4KSIA 8CPAA 3B7IA 2Z3LA 2AFZA 1IOFA 2ZENA 1YR0A 3R9FA 1Z5RA 1S60A 2HV2A 3L2NA 2FCKA 6CPAA 3PRTA 5LYDA 5H84A 2IL4A 1YW6A 4PV6A 5BWAB 1Y7EA 3DNSA 3TO6A 5THWA 4H6UA 5K8NA 3PB8X 2BSWA 4YRHA 5JM6A 2P6FA 3TTHA 1IU8A 4MRIA 1I1DA 1QSOA 4MMOA 4ONUA 4B14A 2GFQA 3D2MA 1LCPA 3GYAA 4XPLA 3IEHA 4C2ZA 2QJ8A 4MHZA 4ORFA 4LQGA 2FVGA 4CS0B 2BOAA 4GXHA 2BEIA 2V8DA 3CXPA 2WUUA 4AG9A 4ZI6A 2Z3KA 2OB0A 4CGLA 2J8MA 4NFRA 1YMEA 2QVPA 1CM0A 4X8IA 3FEEA 5K8OA 1GHEA 3K9TA 2PQ8A 3TOBA 2QMLA 2JDCA 2ZEMA 3IGRA 4EWTA 2FSRA 3ISZA 5F46A 3BJ7A 3F0AA 3W6XA 4DJLA 2KCWA 3BLNA 2HB6A 4AG7A 4M6GA 1M1DA 3GUXA 3PB9X 3R95A 4A37A 2Z3MA 3IIBA 1I21A 3ZZIA 1M44A 2B4BA 1TKJA 3ZJ0A 1ARLA 2VXKA 3FF3A 1CP7A 4YGOA 1VHSA 3H8GA 5AG5A 4NGNA 3KKWA 4JXRA 2R1IA 2OZHA 1YK3A 4R7MA 5EBVA 5F48A 2J8NA 4CGPA 2F7VA 2OOTA 4BD9A 2JBKA 1X10A 4R87A 3CT9A 5JPHA 3NH8A 4M6IA 1IICA 2PIZA 5E96A 4NGRA 4IAVA 3IWEA 2EUIA 2PJ4A 2RFHA 4XPDB 2Z0ZA 4O23A 4Y49C 4LX9A 3TCVA 3SHPA 2O53A 1M4GA 4NJRA 2AFXA 4B5OA 2K5TA 1CPXA 1YLOA 2ABZA 4EMEA 2PE3A 5JH9A 4BMHA 1Y0YA 2VL1A 3QAHA 1NSAA 2Q0YA 4FD6A 3VATA 4NSQA 4HNWB 4F6AA 4U5YA 4Z65A 1SQHA 3CPAA 4Q38A 5LRKA 4UIBA 2C6CA 3D4UA 3IC1A 1VKCA 3B3VA 4KOYA 1BPNA 5G1ZA 2B3UA 3D2PA 2D4PA 3HLPA 4QUSA 2CNMA 4CYQA 4MHYA 3DR6A 1XIXA 2X7BA 2AFSA 2DPTA 1J4JA 1Z8WA 3V38A 3S6FA 3HUVA 4C2XA 2YNCA 1A2ZA 4KVXA 2J8RA 4CGMA 1Y0RA 2GLJA 3D7HA 4MY3A 4KVOE 4OAEA 2VEZA 2FXFA 2IQ6A 2OR4A 2GLFA 4JXQA 3VARA 2POKA 4MCSA 2Z3OA 3CXQA 3S6KA 3LWUA 4OADA 4UCPA 3R9GA 3TFYA 1H8LA 1XEBA 1FT7A 4P4IA 1AMPA 2PR1A 1ZLHA 2DEAA 2C6GA 3TX8A 4NGQA 2AFOA 2Q4YA 3B2YA 4UEFA 2DPSA 3WC5A 2ATRA 2FIAA 5LYLA 3DDDA 4MFPA 2O4HA 4ONWA 4RI1A 4DYOA 5KTAA 4A2ZA 1Z4EA 3B3WA 1CP6A 1HEEA 4M3SA 1ELMP 1TXRA 2DXQA 4DUKA 3FXTA 3D7DA 4F0XA 1XMTA 3SI1A 1LANA 2B5GB 2EWBA 2ANPA 3PZJA 2BUEA 2I79A 3IFEA 5CNPA 3BI1A 2CTBA 4R6TA 5LYFA 3I1UA 5I0CA 2C1CA 3D66A 2RB7A 4I49A 2QECA 3UY5A 3LMSA 4U9YA 3KASA 3TO7A 4ZYQA 4OC4A 1S5KA 2CIJA 3PGPA 4ZY0A 4P6YA 3FMCA 4TWEA 5K8MA 3FIXA 4AXVA 4MHNA 3RO0A 1Q7LA 1GYTA 1RTQA 1YW4A 2B5GA 3D7FA 1LAMA 3MN8A 3F5BA 4GM5A 3RAMA 4AB7A 5ISVA 5EC4A 2J9AA 4R76A 4ZGYB 1RXTA 2ZELA 2ZEFA 4B5PB 2PR8A 2H5MA 2PRQA 4HNXB 4ZY2A 1QSNA 3LODA 1ON0A 2PJ0A 3R96A 4A32A 1TKHA 4XNHB 3FEDA 5CBMA 1PYTB 1S7FA 2YNDA 1ZG9A 3KI9A 1NMTA 4KOUA 4KUAA 7CPAA 3IJ3A 3VWEA 3SI0A 4II9A 1BLLE 1IGBA 2CNSA 2FS5A 4NGPA 4A33A 2ARHA 4CAFA 1AYEA 4NXYA 1Z4RA 2EK8A 2PVVA 4W9YA 1S7NA 2ZW5A 2R98A 3S9NA 4E2AA 2PC1A 3CZXA 4MCPA 1R3NA 2YNCC 2ZEGA 4YFJA 1XJOA 2PSWA 2Q7BA 1PCAA 4EFDA 1BAVA 2V77A 4FUUA 5IV0A 4UWIA 4CYPA 2Q04A 2IMOA 4HKFA 2OZGA 3T9YA 5JQ4A 4CAXA 3K2KA 4UBRA 1KZFA 4P4BA 1B6BA 5KTCA 5J1QA 1PU9A 2ZXVA 3KQZA 3TE4A 4B13A 3WC6A 1Z8TA 3C26A 4OC0A 5C88A 1WWZA 2V8GA 2VZZA 2D4OA
chains in the Genus database with same CATH topology
4NGMA 2ZEPA 3PEIA 4F8ZA 4G1PA 2ZOFA 1IY7A 3SJGA 3V7ZA 2ZOGA 2F8HA 2PJAA 4OC1A 2JBJA 3KHXA 3TC8A 4PPZA 2WZNA 2AFMA 1TF9A 2JEWA 4MCRA 4YU9A 2I3CA 4MCQA 4FBEA 1HDQA 3NH4A 4RUHA 4P4FA 3H8FA 1JQGA 2PJ8A 3NFZA 4PXBA 1XFOA 1ZG8A 2G9DA 1HDUA 2PJ3A 2XEGA 1Z8LA 1FNOA 5D8NA 2PJ7A 1LAPA 4P4EA 1DE4C 1TF8A 3KR4A 3PFEA 1ZLIA 2CF4A 5HVGA 2Q4ZA 4A39A 3NA6A 4PXDA 3BXMA 2V8HA 2PJ2A 1EE3P 4TNUA 4K3NA 3MRUA 2XEFA 4OC5A 3GLJA 3PBBA 4F9VA 1CBXA 4F9UA 5K8PA 2ZEDA 1LFWA 3KR5A 4IHMA 4UEZA 3FECA 4ZY1A 5I4MA 2IJZA 1F2OA 2PCUA 2PJ9A 1CPSA 1F57A 2PJCA 4FAIA 1VGYA 2V8VA 4WJBA 2PJ6A 4OKOA 4NJQA 4OC3A 4FWUA 2NYQA 5D29A 4A94A 4IK2A 3VH9A 4ZX9A 4OP4A 4X2TA 3RBUA 4ZX8A 2XEJA 5HXDA 1YSJA 3BI0A 3RZAA 2HC9A 4P45A 3KGQA 4PXCA 1OBRA 3KQXA 1KWMA 4P4DA 3CPXA 2PJ5A 4X3RA 5IB9A 2EK9A 2PJBA 1VHOA 3ISXA 3CDXA 3D7GA 3FVLA 1BPMA 2CTCA 2ZEEA 3NH5A 1TKFA 3SJEA 4UEEA 2NSMA 2PIYA 3KHZA 4PQAA 5HVFA 4Q7AA 3T8WA 3H8EA 1ARMA 1ELLP 5JGFA 5K8OA 3SJXA 3SI2A 3FH4A 5LRGA 3PFOA 5CPAA 3PB6X 2PVWA 4MHPA 1XBUA 3B3SA 3DLJA 3QNVA 2AFUA 3KL9A 4YWYA 4OIWA 4NGTA 3JRUA 2AFWA 2BO9A 1M4LA 1R43A 1CX8A 3WC7A 3PBEA 5F09A 4NGSA 1XMBA 3BHXA 2QYVA 3B3TA 3D68A 3FJUA 3DGVA 4WWVA 2ZEOA 3N5FA 2XEIA 5ELYA 1LOKA 2GREA 1VHEA 3IO1A 4P4JA 2BCOA 4UIAA 1QQ9A 4P44A 3KZWA 3SJFA 2WYRA 4H2KA 4P10A 4OC2A 3S9LA 3GB0A 1UWYA 2ZEHA 4OMEA 2PJ1A 5HVHA 3PB7X 1DTDA 4MXUA 3WABA 3B35A 1ZG7A 1Z2LA 2Q51A 3D67A 3FX6A 3IWWA 4OIDA 5LRJA 2GU2A 3PB4X 4B6ZA 4JYWA 5DS0A 4JZ0A 1VIXA 5LYIA 2C6PA 3WT4A 1CG2A 3S9MA 1F2PA 4CPAA 4PXEA 4R8FA 1QMUA 4UF4A 4A38A 2Q43A 1XRYA 3B3CA 4KSIA 8CPAA 3B7IA 2AFZA 2ZENA 1Z5RA 3L2NA 6CPAA 3PRTA 5LYDA 1YW6A 1Y7EA 5THWA 5K8NA 3PB8X 5JM6A 4MRIA 4MMOA 1LCPA 3IEHA 2QJ8A 4MHZA 4LQGA 2FVGA 2BOAA 2V8DA 4ZI6A 4NFRA 1YMEA 2QVPA 4X8IA 3FEEA 3K9TA 2ZEMA 4EWTA 3ISZA 4DJLA 2HB6A 3GUXA 3PB9X 4A37A 3IIBA 1TKJA 1ARLA 3FF3A 1CP7A 3H8GA 4NGNA 4R7MA 2F7VA 2OOTA 4BD9A 2JBKA 3CT9A 3NH8A 2PIZA 4NGRA 4IAVA 2PJ4A 2RFHA 4O23A 2O53A 4NJRA 2AFXA 1CPXA 2ABZA 4EMEA 2PE3A 5JH9A 1Y0YA 2VL1A 1NSAA 3VATA 4Z65A 3CPAA 5LRKA 4UIBA 3D4UA 2C6CA 3IC1A 3B3VA 1BPNA 3HLPA 4MHYA 2AFSA 3V38A 3HUVA 1Y0RA 2GLJA 3D7HA 2IQ6A 2OR4A 2GLFA 3VARA 2POKA 4MCSA 3LWUA 1H8LA 1FT7A 4P4IA 1AMPA 1ZLHA 2DEAA 2C6GA 3TX8A 4NGQA 2AFOA 3WC5A 3B2YA 4UEFA 5LYLA 2O4HA 4ONWA 4DYOA 3B3WA 1CP6A 1HEEA 1ELMP 1TXRA 4DUKA 3D7DA 3SI1A 1LANA 2EWBA 2ANPA 3IFEA 3BI1A 2CTBA 4R6TA 5LYFA 3I1UA 2C1CA 3D66A 2RB7A 3LMSA 3KASA 4ZYQA 4OC4A 2CIJA 4ZY0A 4P6YA 3FMCA 4TWEA 5K8MA 4AXVA 4MHNA 1Q7LA 1GYTA 1RTQA 1YW4A 3D7FA 3MN8A 1LAMA 4GM5A 3RAMA 2J9AA 4R76A 2ZELA 2ZEFA 2PRQA 4ZY2A 2PJ0A 1TKHA 5CBMA 3FEDA 1PYTB 1ZG9A 3KI9A 7CPAA 3IJ3A 3SI0A 1BLLE 1IGBA 4NGPA 1AYEA 2EK8A 2PVVA 4W9YA 3S9NA 4MCPA 1R3NA 2ZEGA 1XJOA 1PCAA 4EFDA 1BAVA 2V77A 4FUUA 2IMOA 3K2KA 4P4BA 5J1QA 3KQZA 3WC6A 4OC0A 1YLOA 2V8GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NGM A;  2ZEP A;  3PEI A;  4F8Z A;  4G1P A;  2ZOF A;  1IY7 A;  3SJG A;  3V7Z A;  2ZOG A;  2F8H A;  2PJA A;  4OC1 A;  2JBJ A;  3KHX A;  3TC8 A;  4PPZ A;  2WZN A;  2AFM A;  1TF9 A;  2JEW A;  4MCR A;  4YU9 A;  2I3C A;  4MCQ A;  4FBE A;  1HDQ A;  3NH4 A;  4RUH A;  4P4F A;  3H8F A;  1JQG A;  2PJ8 A;  3NFZ A;  4PXB A;  1XFO A;  1ZG8 A;  2G9D A;  1HDU A;  2PJ3 A;  2XEG A;  1Z8L A;  1FNO A;  5D8N A;  2PJ7 A;  1LAP A;  4P4E A;  1DE4 C;  1TF8 A;  3KR4 A;  3PFE A;  1ZLI A;  2CF4 A;  5HVG A;  2Q4Z A;  4A39 A;  3NA6 A;  4PXD A;  3BXM A;  2V8H A;  2PJ2 A;  1EE3 P;  4TNU A;  4K3N A;  3MRU A;  2XEF A;  4OC5 A;  3GLJ A;  3PBB A;  4F9V A;  1CBX A;  4F9U A;  5K8P A;  2ZED A;  1LFW A;  3KR5 A;  4IHM A;  4UEZ A;  3FEC A;  4ZY1 A;  5I4M A;  2IJZ A;  1F2O A;  2PCU A;  2PJ9 A;  1CPS A;  1F57 A;  2PJC A;  4FAI A;  1VGY A;  2V8V A;  4WJB A;  2PJ6 A;  4OKO A;  4NJQ A;  4OC3 A;  4FWU A;  2NYQ A;  5D29 A;  4A94 A;  4IK2 A;  3VH9 A;  4ZX9 A;  4OP4 A;  4X2T A;  3RBU A;  4ZX8 A;  2XEJ A;  5HXD A;  1YSJ A;  3BI0 A;  3RZA A;  2HC9 A;  4P45 A;  3KGQ A;  4PXC A;  1OBR A;  3KQX A;  1KWM A;  4P4D A;  3CPX A;  2PJ5 A;  4X3R A;  5IB9 A;  2EK9 A;  2PJB A;  1VHO A;  3ISX A;  3CDX A;  3D7G A;  3FVL A;  1BPM A;  2CTC A;  2ZEE A;  3NH5 A;  1TKF A;  3SJE A;  4UEE A;  2NSM A;  2PIY A;  3KHZ A;  4PQA A;  5HVF A;  4Q7A A;  3T8W A;  3H8E A;  1ARM A;  1ELL P;  5JGF A;  5K8O A;  3SJX A;  3SI2 A;  3FH4 A;  5LRG A;  3PFO A;  5CPA A;  3PB6 X;  2PVW A;  4MHP A;  1XBU A;  3B3S A;  3DLJ A;  3QNV A;  2AFU A;  3KL9 A;  4YWY A;  4OIW A;  4NGT A;  3JRU A;  2AFW A;  2BO9 A;  1M4L A;  1R43 A;  1CX8 A;  3WC7 A;  3PBE A;  5F09 A;  4NGS A;  1XMB A;  3BHX A;  2QYV A;  3B3T A;  3D68 A;  3FJU A;  3DGV A;  4WWV A;  2ZEO A;  3N5F A;  2XEI A;  5ELY A;  1LOK A;  2GRE A;  1VHE A;  3IO1 A;  4P4J A;  2BCO A;  4UIA A;  1QQ9 A;  4P44 A;  3KZW A;  3SJF A;  2WYR A;  4H2K A;  4P10 A;  4OC2 A;  3S9L A;  3GB0 A;  1UWY A;  2ZEH A;  4OME A;  2PJ1 A;  5HVH A;  3PB7 X;  1DTD A;  4MXU A;  3WAB A;  3B35 A;  1ZG7 A;  1Z2L A;  2Q51 A;  3D67 A;  3FX6 A;  3IWW A;  4OID A;  5LRJ A;  2GU2 A;  3PB4 X;  4B6Z A;  4JYW A;  5DS0 A;  4JZ0 A;  1VIX A;  5LYI A;  2C6P A;  3WT4 A;  1CG2 A;  3S9M A;  1F2P A;  4CPA A;  4PXE A;  4R8F A;  1QMU A;  4UF4 A;  4A38 A;  2Q43 A;  1XRY A;  3B3C A;  4KSI A;  8CPA A;  3B7I A;  2AFZ A;  2ZEN A;  1Z5R A;  3L2N A;  6CPA A;  3PRT A;  5LYD A;  1YW6 A;  1Y7E A;  5THW A;  5K8N A;  3PB8 X;  5JM6 A;  4MRI A;  4MMO A;  1LCP A;  3IEH A;  2QJ8 A;  4MHZ A;  4LQG A;  2FVG A;  2BOA A;  2V8D A;  4ZI6 A;  4NFR A;  1YME A;  2QVP A;  4X8I A;  3FEE A;  3K9T A;  2ZEM A;  4EWT A;  3ISZ A;  4DJL A;  2HB6 A;  3GUX A;  3PB9 X;  4A37 A;  3IIB A;  1TKJ A;  1ARL A;  3FF3 A;  1CP7 A;  3H8G A;  4NGN A;  4R7M A;  2F7V A;  2OOT A;  4BD9 A;  2JBK A;  3CT9 A;  3NH8 A;  2PIZ A;  4NGR A;  4IAV A;  2PJ4 A;  2RFH A;  4O23 A;  2O53 A;  4NJR A;  2AFX A;  1CPX A;  2ABZ A;  4EME A;  2PE3 A;  5JH9 A;  1Y0Y A;  2VL1 A;  1NSA A;  3VAT A;  4Z65 A;  3CPA A;  5LRK A;  4UIB A;  3D4U A;  2C6C A;  3IC1 A;  3B3V A;  1BPN A;  3HLP A;  4MHY A;  2AFS A;  3V38 A;  3HUV A;  1Y0R A;  2GLJ A;  3D7H A;  2IQ6 A;  2OR4 A;  2GLF A;  3VAR A;  2POK A;  4MCS A;  3LWU A;  1H8L A;  1FT7 A;  4P4I A;  1AMP A;  1ZLH A;  2DEA A;  2C6G A;  3TX8 A;  4NGQ A;  2AFO A;  3WC5 A;  3B2Y A;  4UEF A;  5LYL A;  2O4H A;  4ONW A;  4DYO A;  3B3W A;  1CP6 A;  1HEE A;  1ELM P;  1TXR A;  4DUK A;  3D7D A;  3SI1 A;  1LAN A;  2EWB A;  2ANP A;  3IFE A;  3BI1 A;  2CTB A;  4R6T A;  5LYF A;  3I1U A;  2C1C A;  3D66 A;  2RB7 A;  3LMS A;  3KAS A;  4ZYQ A;  4OC4 A;  2CIJ A;  4ZY0 A;  4P6Y A;  3FMC A;  4TWE A;  5K8M A;  4AXV A;  4MHN A;  1Q7L A;  1GYT A;  1RTQ A;  1YW4 A;  3D7F A;  3MN8 A;  1LAM A;  4GM5 A;  3RAM A;  2J9A A;  4R76 A;  2ZEL A;  2ZEF A;  2PRQ A;  4ZY2 A;  2PJ0 A;  1TKH A;  5CBM A;  3FED A;  1PYT B;  1ZG9 A;  3KI9 A;  7CPA A;  3IJ3 A;  3SI0 A;  1BLL E;  1IGB A;  4NGP A;  1AYE A;  2EK8 A;  2PVV A;  4W9Y A;  3S9N A;  4MCP A;  1R3N A;  2ZEG A;  1XJO A;  1PCA A;  4EFD A;  1BAV A;  2V77 A;  4FUU A;  2IMO A;  3K2K A;  4P4B A;  5J1Q A;  3KQZ A;  3WC6 A;  4OC0 A;  1YLO A;  2V8G A; 
#chains in the Genus database with same CATH topology
 4NGM A;  2ZEP A;  3PEI A;  2P6E A;  3VWD A;  3EFA A;  4XPK A;  4F8Z A;  4MFZ A;  4G1P A;  2ZOF A;  3TO9 A;  1IY7 A;  2Z11 A;  1YRE A;  3R9E A;  3SJG A;  3V7Z A;  2EVN A;  2ZOG A;  4L8A A;  4PK3 A;  3V8I A;  2G3A A;  1MJA A;  2F8H A;  4QB9 A;  3TT2 A;  5IB0 A;  2PJA A;  4OC1 A;  2JBJ A;  4C68 A;  4CRY B;  3KHX A;  1S7K A;  3TC8 A;  4PPZ A;  2R8V A;  2WZN A;  2AFM A;  1TF9 A;  1K4J A;  1YVO A;  2JEW A;  4MCR A;  4YU9 A;  2I3C A;  4MCQ A;  4FBE A;  4KLW A;  1HDQ A;  1MJ9 A;  3NH4 A;  4P4F A;  3H8F A;  4RUH A;  4UCN A;  3RYO A;  1JQG A;  2FT0 A;  2Z3N A;  2PJ8 A;  3NFZ A;  4OLL A;  4UFX A;  2YNE A;  1S7L A;  4PXB A;  4UWJ A;  1XFO A;  1ZG8 A;  1X12 A;  2G9D A;  1HDU A;  5G20 A;  4JD6 A;  2PJ3 A;  2XEG A;  1Z8L A;  1FNO A;  3IU2 A;  5D8N A;  5J8C A;  1JWQ A;  2ODF A;  1MJB A;  2B3V A;  2VQY A;  1TIQ A;  2PJ7 A;  1LAP A;  3LD2 A;  4P4E A;  1AUG A;  1DE4 C;  1TF8 A;  1V0C A;  3G8W A;  3A9L A;  3KR4 A;  3PFE A;  2DF5 A;  4FD4 A;  4FD7 A;  4MFK A;  1ZLI A;  2CF4 A;  3MGD A;  5HVG A;  2REE A;  2Q4Z A;  2P0W A;  2GAN A;  4C2Y A;  4A39 A;  4C7H A;  1UFH A;  3B8G A;  3NA6 A;  2CY2 A;  4MFJ A;  4PXD A;  3BXM A;  3N7Z A;  4MJ8 A;  4PSW A;  2ZPA A;  2Z3P A;  2V8H A;  2R7H A;  4R3K A;  2PJ2 A;  4IUS A;  1EE3 P;  4CYO A;  3P2H A;  4JJX A;  3K9U A;  1IYL A;  4TNU A;  4K3N A;  3MRU A;  4KOS A;  2XEF A;  4B10 A;  4OC5 A;  3OWC A;  3GLJ A;  3PBB A;  4F9V A;  2C27 A;  1R57 A;  3JTK A;  4E8O A;  1CBX A;  2WPX A;  3EO4 A;  4MI4 A;  4F9U A;  5K8P A;  2ZED A;  5AG7 A;  1LFW A;  3KR5 A;  4IHM A;  4UEZ A;  2QIR A;  3FEC A;  4ZY1 A;  4Y49 B;  4FD5 A;  3FYN A;  2IJZ A;  5I4M A;  2B58 A;  2I00 A;  4PK2 A;  1F2O A;  2PCU A;  1NE9 A;  3W91 A;  2PJ9 A;  2OH1 A;  1KUX A;  1CPS A;  2B4D B;  1F57 A;  2PJC A;  4CGN A;  1VGY A;  2V8V A;  4FAI A;  4MFQ A;  2PJ6 A;  4OKO A;  1Q2Y A;  4WJB A;  4NJQ A;  4OC3 A;  4UFW A;  3T90 A;  5J8F A;  4FWU A;  5DWN A;  2NYQ A;  2GIV A;  3G3S A;  1YGH A;  3D8P A;  2WPW A;  5D29 A;  5G21 A;  3P2F A;  1FY7 A;  3GIU A;  5AG4 A;  4A94 A;  4IK2 A;  4KUB A;  4CGO A;  3VH9 A;  4ZX9 A;  3IWG A;  3JUW A;  3D3S A;  4OP4 A;  2Q44 A;  5F49 A;  4X2T A;  3RBU A;  2B4D A;  4ZX8 A;  2XEJ A;  5EMI A;  3LAC A;  5HXD A;  3FNC A;  1YSJ A;  3BI0 A;  3RZA A;  2HC9 A;  2G3T A;  2ZW4 A;  3NE8 A;  4H6Z A;  4HPS A;  4P45 A;  3KGQ A;  4B5P A;  1M4D A;  2P6G A;  1U6M A;  5F47 A;  4PXC A;  1OBR A;  3KQX A;  1KWM A;  3QB8 A;  4P4D A;  4XPD C;  3CPX A;  2PJ5 A;  4AVC A;  4X3R A;  3FRM A;  5IB9 A;  2ZW6 A;  4PSX A;  4JLY A;  4LUA A;  2Q7S A;  3S6G A;  2EK9 A;  2PJB A;  1IB1 E;  3I9S A;  1VHO A;  3ISX A;  4MHD A;  1ZO0 A;  3CDX A;  1QSR A;  3D7G A;  4KLV A;  2NMT A;  3BJ8 A;  4QBJ A;  3FVL A;  4MBU A;  1BPM A;  2CTC A;  4RN7 A;  2FE7 A;  4CRZ B;  1YX0 A;  2ZEE A;  2WSA A;  3NH5 A;  1TKF A;  4L89 A;  4F0Y A;  5KTD A;  3SJE A;  3EC4 A;  4UEE A;  1BOB A;  2NSM A;  2PIY A;  3TOA A;  5AG6 A;  2A4N A;  3IU1 A;  3EXN A;  3KHZ A;  4NEX A;  4PQA A;  5HVF A;  4QC6 A;  1IID A;  4Q7A A;  5IX3 A;  4KOW A;  5G22 A;  2Y0M A;  3T8W A;  1NSL A;  4X5K A;  1QSM A;  4AVB A;  4BIN A;  1XF8 A;  2ZW7 A;  3H8E A;  1ARM A;  1ELL P;  4KOX A;  5JGF A;  1Z9U A;  2HQY A;  4U9Z A;  3SI2 A;  3SJX A;  3FH4 A;  1P0H A;  1YQE A;  5LRG A;  1LRZ A;  3PFO A;  5CPA A;  4K30 A;  1YVK A;  3PB6 X;  4KSF A;  1KUY A;  2PVW A;  4KS9 A;  4MHP A;  4CAW A;  1XBU A;  4B12 A;  3B3S A;  4A95 A;  3DLJ A;  5AGE A;  3QNV A;  2AFU A;  3KL9 A;  3E0K A;  4YWY A;  4DNC A;  3DR8 A;  4NGT A;  4OIW A;  3EY5 A;  5H86 A;  3FB3 A;  4J3G A;  3S6H A;  4LQ6 A;  4KZT A;  2VZY A;  1IOI A;  4NF1 A;  2FIW A;  4KSA A;  1PUA A;  3JRU A;  2JLM A;  3PP9 A;  2AFW A;  1QST A;  4R9M A;  4M6H A;  4JWP A;  2AE6 A;  2BO9 A;  1M4L A;  1R43 A;  4EVY A;  1CX8 A;  3WC7 A;  3PBE A;  4R57 A;  1M4I A;  3NE7 A;  4M85 A;  1OZP A;  5F09 A;  5HH1 A;  4NCZ A;  4NGS A;  4RS2 A;  5C82 A;  5A27 A;  1XMB A;  1WK4 A;  4H89 A;  3BHX A;  2QYV A;  3B3T A;  2PRB A;  1N71 A;  2PDO A;  4UCM A;  3D68 A;  3CXS A;  1B87 A;  2AJ6 A;  3FJU A;  3DGV A;  4WWV A;  2ZEO A;  1Q2C A;  3F8K A;  3DSB A;  1Y9K A;  2XEI A;  1Q2D A;  3N5F A;  5ELY A;  1LOK A;  5FVJ A;  2GRE A;  1VHE A;  3JVN A;  1BO4 A;  2RC4 A;  3IO1 A;  5GCN A;  2REF A;  4P4J A;  3WR7 A;  2BCO A;  3RNZ A;  1S3Z A;  3I3G A;  4UIA A;  1IYK A;  3SXN A;  1I12 A;  1QQ9 A;  4UA3 A;  1Y9W A;  2OU2 A;  4P44 A;  2GE3 A;  3KZW A;  1RO5 A;  2Q4V A;  3SJF A;  4XNH C;  1P4N A;  4KOR A;  2WYR A;  4H2K A;  4ZBG A;  4P10 A;  4GS4 A;  2JDD A;  4OC2 A;  3W6S A;  4A30 A;  3S9L A;  2G0B A;  3GB0 A;  4B11 A;  1KUV A;  1UWY A;  2ZEH A;  4OME A;  3FBU A;  4KVM E;  3SXO A;  2PJ1 A;  4Q36 A;  4KOV A;  4BBH A;  4E0A A;  5HVH A;  2OZU A;  3PB7 X;  4AVA A;  1DTD A;  4IF5 A;  2EO8 A;  4MXU A;  2CXA A;  3WAB A;  3B35 A;  1ZG7 A;  1Z2L A;  2Q51 A;  4R3L A;  3D67 A;  3FX6 A;  1MK4 A;  3IWW A;  3H5Z A;  4KOT A;  4OID A;  5LRJ A;  2GU2 A;  3PB4 X;  4B6Z A;  1CJW A;  1XE4 A;  4JYW A;  5DS0 A;  2CNT A;  5DWM A;  2O28 A;  4JZ0 A;  1VIX A;  2Z10 A;  5LYI A;  2FL4 A;  4A31 A;  2C6P A;  5HMN A;  3WT4 A;  1CG2 A;  4QVT A;  1YLE A;  2BL1 A;  5A28 A;  3QAY A;  3R1K A;  2VI7 A;  1XOV A;  4MY0 A;  3S9M A;  1F2P A;  2EBJ A;  4CAE A;  2HUZ A;  4CYN A;  1Y7R A;  3GKR A;  4HNY B;  2YGW A;  4CPA A;  4PXE A;  4R8F A;  4CAV A;  1QMU A;  4UF4 A;  2F5I A;  2JEV A;  1Z8X A;  2VBQ A;  3GY9 A;  4UFV A;  4A38 A;  4MFL A;  2Q43 A;  4C7I A;  1XRY A;  1L0C A;  3B3C A;  3H4Q A;  4KSI A;  8CPA A;  3B7I A;  2Z3L A;  2AFZ A;  1IOF A;  2ZEN A;  1YR0 A;  3R9F A;  1Z5R A;  1S60 A;  2HV2 A;  3L2N A;  2FCK A;  6CPA A;  3PRT A;  5LYD A;  5H84 A;  2IL4 A;  1YW6 A;  4PV6 A;  5BWA B;  1Y7E A;  3DNS A;  3TO6 A;  5THW A;  4H6U A;  5K8N A;  3PB8 X;  2BSW A;  4YRH A;  5JM6 A;  2P6F A;  3TTH A;  1IU8 A;  4MRI A;  1I1D A;  1QSO A;  4MMO A;  4ONU A;  4B14 A;  2GFQ A;  3D2M A;  1LCP A;  3GYA A;  4XPL A;  3IEH A;  4C2Z A;  2QJ8 A;  4MHZ A;  4ORF A;  4LQG A;  2FVG A;  4CS0 B;  2BOA A;  4GXH A;  2BEI A;  2V8D A;  3CXP A;  2WUU A;  4AG9 A;  4ZI6 A;  2Z3K A;  2OB0 A;  4CGL A;  2J8M A;  4NFR A;  1YME A;  2QVP A;  1CM0 A;  4X8I A;  3FEE A;  5K8O A;  1GHE A;  3K9T A;  2PQ8 A;  3TOB A;  2QML A;  2JDC A;  2ZEM A;  3IGR A;  4EWT A;  2FSR A;  3ISZ A;  5F46 A;  3BJ7 A;  3F0A A;  3W6X A;  4DJL A;  2KCW A;  3BLN A;  2HB6 A;  4AG7 A;  4M6G A;  1M1D A;  3GUX A;  3PB9 X;  3R95 A;  4A37 A;  2Z3M A;  3IIB A;  1I21 A;  3ZZI A;  1M44 A;  2B4B A;  1TKJ A;  3ZJ0 A;  1ARL A;  2VXK A;  3FF3 A;  1CP7 A;  4YGO A;  1VHS A;  3H8G A;  5AG5 A;  4NGN A;  3KKW A;  4JXR A;  2R1I A;  2OZH A;  1YK3 A;  4R7M A;  5EBV A;  5F48 A;  2J8N A;  4CGP A;  2F7V A;  2OOT A;  4BD9 A;  2JBK A;  1X10 A;  4R87 A;  3CT9 A;  5JPH A;  3NH8 A;  4M6I A;  1IIC A;  2PIZ A;  5E96 A;  4NGR A;  4IAV A;  3IWE A;  2EUI A;  2PJ4 A;  2RFH A;  4XPD B;  2Z0Z A;  4O23 A;  4Y49 C;  4LX9 A;  3TCV A;  3SHP A;  2O53 A;  1M4G A;  4NJR A;  2AFX A;  4B5O A;  2K5T A;  1CPX A;  1YLO A;  2ABZ A;  4EME A;  2PE3 A;  5JH9 A;  4BMH A;  1Y0Y A;  2VL1 A;  3QAH A;  1NSA A;  2Q0Y A;  4FD6 A;  3VAT A;  4NSQ A;  4HNW B;  4F6A A;  4U5Y A;  4Z65 A;  1SQH A;  3CPA A;  4Q38 A;  5LRK A;  4UIB A;  2C6C A;  3D4U A;  3IC1 A;  1VKC A;  3B3V A;  4KOY A;  1BPN A;  5G1Z A;  2B3U A;  3D2P A;  2D4P A;  3HLP A;  4QUS A;  2CNM A;  4CYQ A;  4MHY A;  3DR6 A;  1XIX A;  2X7B A;  2AFS A;  2DPT A;  1J4J A;  1Z8W A;  3V38 A;  3S6F A;  3HUV A;  4C2X A;  2YNC A;  1A2Z A;  4KVX A;  2J8R A;  4CGM A;  1Y0R A;  2GLJ A;  3D7H A;  4MY3 A;  4KVO E;  4OAE A;  2VEZ A;  2FXF A;  2IQ6 A;  2OR4 A;  2GLF A;  4JXQ A;  3VAR A;  2POK A;  4MCS A;  2Z3O A;  3CXQ A;  3S6K A;  3LWU A;  4OAD A;  4UCP A;  3R9G A;  3TFY A;  1H8L A;  1XEB A;  1FT7 A;  4P4I A;  1AMP A;  2PR1 A;  1ZLH A;  2DEA A;  2C6G A;  3TX8 A;  4NGQ A;  2AFO A;  2Q4Y A;  3B2Y A;  4UEF A;  2DPS A;  3WC5 A;  2ATR A;  2FIA A;  5LYL A;  3DDD A;  4MFP A;  2O4H A;  4ONW A;  4RI1 A;  4DYO A;  5KTA A;  4A2Z A;  1Z4E A;  3B3W A;  1CP6 A;  1HEE A;  4M3S A;  1ELM P;  1TXR A;  2DXQ A;  4DUK A;  3FXT A;  3D7D A;  4F0X A;  1XMT A;  3SI1 A;  1LAN A;  2B5G B;  2EWB A;  2ANP A;  3PZJ A;  2BUE A;  2I79 A;  3IFE A;  5CNP A;  3BI1 A;  2CTB A;  4R6T A;  5LYF A;  3I1U A;  5I0C A;  2C1C A;  3D66 A;  2RB7 A;  4I49 A;  2QEC A;  3UY5 A;  3LMS A;  4U9Y A;  3KAS A;  3TO7 A;  4ZYQ A;  4OC4 A;  1S5K A;  2CIJ A;  3PGP A;  4ZY0 A;  4P6Y A;  3FMC A;  4TWE A;  5K8M A;  3FIX A;  4AXV A;  4MHN A;  3RO0 A;  1Q7L A;  1GYT A;  1RTQ A;  1YW4 A;  2B5G A;  3D7F A;  1LAM A;  3MN8 A;  3F5B A;  4GM5 A;  3RAM A;  4AB7 A;  5ISV A;  5EC4 A;  2J9A A;  4R76 A;  4ZGY B;  1RXT A;  2ZEL A;  2ZEF A;  4B5P B;  2PR8 A;  2H5M A;  2PRQ A;  4HNX B;  4ZY2 A;  1QSN A;  3LOD A;  1ON0 A;  2PJ0 A;  3R96 A;  4A32 A;  1TKH A;  4XNH B;  3FED A;  5CBM A;  1PYT B;  1S7F A;  2YND A;  1ZG9 A;  3KI9 A;  1NMT A;  4KOU A;  4KUA A;  7CPA A;  3IJ3 A;  3VWE A;  3SI0 A;  4II9 A;  1BLL E;  1IGB A;  2CNS A;  2FS5 A;  4NGP A;  4A33 A;  2ARH A;  4CAF A;  1AYE A;  4NXY A;  1Z4R A;  2EK8 A;  2PVV A;  4W9Y A;  1S7N A;  2ZW5 A;  2R98 A;  3S9N A;  4E2A A;  2PC1 A;  3CZX A;  4MCP A;  1R3N A;  2YNC C;  2ZEG A;  4YFJ A;  1XJO A;  2PSW A;  2Q7B A;  1PCA A;  4EFD A;  1BAV A;  2V77 A;  4FUU A;  5IV0 A;  4UWI A;  4CYP A;  2Q04 A;  2IMO A;  4HKF A;  2OZG A;  3T9Y A;  5JQ4 A;  4CAX A;  3K2K A;  4UBR A;  1KZF A;  4P4B A;  1B6B A;  5KTC A;  5J1Q A;  1PU9 A;  2ZXV A;  3KQZ A;  3TE4 A;  4B13 A;  3WC6 A;  1Z8T A;  3C26 A;  4OC0 A;  5C88 A;  1WWZ A;  2V8G A;  2VZZ A;  2D4O A; 
#chains in the Genus database with same CATH homology
 4NGM A;  2ZEP A;  3PEI A;  4F8Z A;  4G1P A;  2ZOF A;  1IY7 A;  3SJG A;  3V7Z A;  2ZOG A;  2F8H A;  2PJA A;  4OC1 A;  2JBJ A;  3KHX A;  3TC8 A;  4PPZ A;  2WZN A;  2AFM A;  1TF9 A;  2JEW A;  4MCR A;  4YU9 A;  2I3C A;  4MCQ A;  4FBE A;  1HDQ A;  3NH4 A;  4RUH A;  4P4F A;  3H8F A;  1JQG A;  2PJ8 A;  3NFZ A;  4PXB A;  1XFO A;  1ZG8 A;  2G9D A;  1HDU A;  2PJ3 A;  2XEG A;  1Z8L A;  1FNO A;  5D8N A;  2PJ7 A;  1LAP A;  4P4E A;  1DE4 C;  1TF8 A;  3KR4 A;  3PFE A;  1ZLI A;  2CF4 A;  5HVG A;  2Q4Z A;  4A39 A;  3NA6 A;  4PXD A;  3BXM A;  2V8H A;  2PJ2 A;  1EE3 P;  4TNU A;  4K3N A;  3MRU A;  2XEF A;  4OC5 A;  3GLJ A;  3PBB A;  4F9V A;  1CBX A;  4F9U A;  5K8P A;  2ZED A;  1LFW A;  3KR5 A;  4IHM A;  4UEZ A;  3FEC A;  4ZY1 A;  5I4M A;  2IJZ A;  1F2O A;  2PCU A;  2PJ9 A;  1CPS A;  1F57 A;  2PJC A;  4FAI A;  1VGY A;  2V8V A;  4WJB A;  2PJ6 A;  4OKO A;  4NJQ A;  4OC3 A;  4FWU A;  2NYQ A;  5D29 A;  4A94 A;  4IK2 A;  3VH9 A;  4ZX9 A;  4OP4 A;  4X2T A;  3RBU A;  4ZX8 A;  2XEJ A;  5HXD A;  1YSJ A;  3BI0 A;  3RZA A;  2HC9 A;  4P45 A;  3KGQ A;  4PXC A;  1OBR A;  3KQX A;  1KWM A;  4P4D A;  3CPX A;  2PJ5 A;  4X3R A;  5IB9 A;  2EK9 A;  2PJB A;  1VHO A;  3ISX A;  3CDX A;  3D7G A;  3FVL A;  1BPM A;  2CTC A;  2ZEE A;  3NH5 A;  1TKF A;  3SJE A;  4UEE A;  2NSM A;  2PIY A;  3KHZ A;  4PQA A;  5HVF A;  4Q7A A;  3T8W A;  3H8E A;  1ARM A;  1ELL P;  5JGF A;  5K8O A;  3SJX A;  3SI2 A;  3FH4 A;  5LRG A;  3PFO A;  5CPA A;  3PB6 X;  2PVW A;  4MHP A;  1XBU A;  3B3S A;  3DLJ A;  3QNV A;  2AFU A;  3KL9 A;  4YWY A;  4OIW A;  4NGT A;  3JRU A;  2AFW A;  2BO9 A;  1M4L A;  1R43 A;  1CX8 A;  3WC7 A;  3PBE A;  5F09 A;  4NGS A;  1XMB A;  3BHX A;  2QYV A;  3B3T A;  3D68 A;  3FJU A;  3DGV A;  4WWV A;  2ZEO A;  3N5F A;  2XEI A;  5ELY A;  1LOK A;  2GRE A;  1VHE A;  3IO1 A;  4P4J A;  2BCO A;  4UIA A;  1QQ9 A;  4P44 A;  3KZW A;  3SJF A;  2WYR A;  4H2K A;  4P10 A;  4OC2 A;  3S9L A;  3GB0 A;  1UWY A;  2ZEH A;  4OME A;  2PJ1 A;  5HVH A;  3PB7 X;  1DTD A;  4MXU A;  3WAB A;  3B35 A;  1ZG7 A;  1Z2L A;  2Q51 A;  3D67 A;  3FX6 A;  3IWW A;  4OID A;  5LRJ A;  2GU2 A;  3PB4 X;  4B6Z A;  4JYW A;  5DS0 A;  4JZ0 A;  1VIX A;  5LYI A;  2C6P A;  3WT4 A;  1CG2 A;  3S9M A;  1F2P A;  4CPA A;  4PXE A;  4R8F A;  1QMU A;  4UF4 A;  4A38 A;  2Q43 A;  1XRY A;  3B3C A;  4KSI A;  8CPA A;  3B7I A;  2AFZ A;  2ZEN A;  1Z5R A;  3L2N A;  6CPA A;  3PRT A;  5LYD A;  1YW6 A;  1Y7E A;  5THW A;  5K8N A;  3PB8 X;  5JM6 A;  4MRI A;  4MMO A;  1LCP A;  3IEH A;  2QJ8 A;  4MHZ A;  4LQG A;  2FVG A;  2BOA A;  2V8D A;  4ZI6 A;  4NFR A;  1YME A;  2QVP A;  4X8I A;  3FEE A;  3K9T A;  2ZEM A;  4EWT A;  3ISZ A;  4DJL A;  2HB6 A;  3GUX A;  3PB9 X;  4A37 A;  3IIB A;  1TKJ A;  1ARL A;  3FF3 A;  1CP7 A;  3H8G A;  4NGN A;  4R7M A;  2F7V A;  2OOT A;  4BD9 A;  2JBK A;  3CT9 A;  3NH8 A;  2PIZ A;  4NGR A;  4IAV A;  2PJ4 A;  2RFH A;  4O23 A;  2O53 A;  4NJR A;  2AFX A;  1CPX A;  2ABZ A;  4EME A;  2PE3 A;  5JH9 A;  1Y0Y A;  2VL1 A;  1NSA A;  3VAT A;  4Z65 A;  3CPA A;  5LRK A;  4UIB A;  3D4U A;  2C6C A;  3IC1 A;  3B3V A;  1BPN A;  3HLP A;  4MHY A;  2AFS A;  3V38 A;  3HUV A;  1Y0R A;  2GLJ A;  3D7H A;  2IQ6 A;  2OR4 A;  2GLF A;  3VAR A;  2POK A;  4MCS A;  3LWU A;  1H8L A;  1FT7 A;  4P4I A;  1AMP A;  1ZLH A;  2DEA A;  2C6G A;  3TX8 A;  4NGQ A;  2AFO A;  3WC5 A;  3B2Y A;  4UEF A;  5LYL A;  2O4H A;  4ONW A;  4DYO A;  3B3W A;  1CP6 A;  1HEE A;  1ELM P;  1TXR A;  4DUK A;  3D7D A;  3SI1 A;  1LAN A;  2EWB A;  2ANP A;  3IFE A;  3BI1 A;  2CTB A;  4R6T A;  5LYF A;  3I1U A;  2C1C A;  3D66 A;  2RB7 A;  3LMS A;  3KAS A;  4ZYQ A;  4OC4 A;  2CIJ A;  4ZY0 A;  4P6Y A;  3FMC A;  4TWE A;  5K8M A;  4AXV A;  4MHN A;  1Q7L A;  1GYT A;  1RTQ A;  1YW4 A;  3D7F A;  3MN8 A;  1LAM A;  4GM5 A;  3RAM A;  2J9A A;  4R76 A;  2ZEL A;  2ZEF A;  2PRQ A;  4ZY2 A;  2PJ0 A;  1TKH A;  5CBM A;  3FED A;  1PYT B;  1ZG9 A;  3KI9 A;  7CPA A;  3IJ3 A;  3SI0 A;  1BLL E;  1IGB A;  4NGP A;  1AYE A;  2EK8 A;  2PVV A;  4W9Y A;  3S9N A;  4MCP A;  1R3N A;  2ZEG A;  1XJO A;  1PCA A;  4EFD A;  1BAV A;  2V77 A;  4FUU A;  2IMO A;  3K2K A;  4P4B A;  5J1Q A;  3KQZ A;  3WC6 A;  4OC0 A;  1YLO A;  2V8G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...