4MHNA

Crystal structure of a glutaminyl cyclase from ixodes scapularis
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
326
structure length
326
Chain Sequence
b'LKWPRDLRPLAHHDLLYMGQISEEDRGDFNATLRNFLVPRVVGSQKHREVREFIVRSLKDLDWDVEEDCFDGQTPHGIKPFCNVIATLNPSACHRLVLACHYDSLLHKEGTFIGATDSAVPCAQLLYLARSLNGKLQNQKTRGDGLTLQLVFFDGEEAFERWSSHDSLYGSRHLAQKWHEDRTSAERLESCLERSEIANQIDRMEVMVLLDLLGAENPRFYSYFGETQPVYRRLVNIESRLNDAGLMELPRRRRRTNYFSNSSTVGFIEDDHIPFLKRSVPIVHIIPSPFPDVWHTLDDNEQNLHHPTISNLNKIFKAFVSEYLQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl cyclase, putative
molecule tags Transferase
source organism Ixodes scapularis
publication title Structural and functional analyses of a glutaminyl cyclase from Ixodes scapularis reveal metal-independent catalysis and inhibitor binding.
pubmed doi rcsb
total genus 110
structure length 326
sequence length 326
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mhnA00
2ZOFA 4WJBA 2C1CA 1DE4C 3NH5A 4OC1A 3MRUA 3DGVA 1PYTB 3D7GA 4NGTA 2GLFA 4TNUA 3DLJA 3MN8A 2AFZA 3PRTA 5JM6A 1Y0RA 4UEZA 3PFOA 3TX8A 4NGMA 3WC5A 5LYFA 1M4LA 1H8LA 4FWUA 2GU2A 2IQ6A 5LYLA 3FEDA 4EFDA 2WZNA 2POKA 2F7VA 1VHEA 3IEHA 4NGRA 3PFEA 4A38A 1HDUA 4UF4A 4PXEA 1ZLIA 2RFHA 3BI0A 4JYWA 2IMOA 3FF3A 4OC3A 1LOKA 1Y0YA 5D8NA 2PJ7A 4X2TA 2FVGA 5K8OA 2AFMA 4F9VA 2PJAA 3L2NA 3B35A 2EK8A 2ZEOA 4OP4A 4P4FA 2F8HA 4FAIA 1NSAA 3VARA 1BPNA 3FX6A 4MHPA 5LYIA 4RUHA 3GB0A 2PJ4A 2ABZA 4DUKA 2BO9A 2PJ8A 4OC5A 4P4DA 4R6TA 2XEFA 2PJCA 3PB6X 4UEEA 5HVGA 1R43A 3IC1A 4YU9A 2PIZA 3H8EA 4NJRA 2PJ2A 2CIJA 1LCPA 1FT7A 1LAPA 3PB4X 3KHXA 4PQAA 5THWA 4IAVA 5CBMA 2XEJA 2CF4A 2AFOA 3SI2A 3WC6A 3K9TA 4ONWA 4BD9A 1F2OA 2QJ8A 1Y7EA 4P45A 4ZX8A 1FNOA 3WABA 4CPAA 7CPAA 3SI0A 3N5FA 1KWMA 4X3RA 3H8FA 1UWYA 4NGSA 2V8DA 1BPMA 4MCRA 3LMSA 2JBKA 4P44A 3TC8A 3CT9A 1IGBA 2ZEDA 2G9DA 3D7DA 1Z5RA 2VL1A 4OIWA 3NH4A 3PB9X 4MCQA 1Q7LA 1TKFA 5IB9A 2PVWA 4P4JA 5LRKA 3SJGA 1ELMP 2ZEFA 3KR4A 2ZEMA 2EWBA 1VIXA 2PJ9A 1JQGA 1LANA 1YSJA 2QVPA 5LYDA 2V8GA 4OC0A 4FUUA 2Q51A 2JBJA 3BXMA 5JGFA 1CBXA 4WWVA 4P10A 1TKJA 3I1UA 4P4EA 3V7ZA 4DYOA 3K2KA 4A39A 4OMEA 4EWTA 1DTDA 1CPSA 3FMCA 1ZG7A 1ZLHA 2AFWA 3NFZA 4UEFA 3GLJA 3VATA 1YMEA 1F2PA 5HVFA 1ARLA 3CDXA 2Q4ZA 1XBUA 3VH9A 1GYTA 5HXDA 1CP6A 4EMEA 1VGYA 4NGQA 3CPAA 3H8GA 2CTBA 2NYQA 4G1PA 4JZ0A 1YLOA 4MXUA 3ISXA 4MCPA 3PBEA 4MRIA 3SJFA 3PB7X 3HLPA 2RB7A 1TXRA 3KR5A 3NH8A 1ARMA 2ANPA 3PEIA 4NGNA 3GUXA 4F8ZA 3KL9A 1XFOA 2Q43A 1R3NA 3IWWA 4LQGA 1CX8A 4UIBA 4ZY0A 3SJXA 3BI1A 5K8MA 3KHZA 4F9UA 3IFEA 2PJ3A 1Z8LA 3KI9A 4ZYQA 2PRQA 3FH4A 3KQXA 5HVHA 2ZEHA 2C6GA 2IJZA 3FEEA 1QQ9A 2GREA 5CPAA 3D66A 1CP7A 3RZAA 4A37A 4AXVA 1LAMA 2PJ6A 5LRGA 2BCOA 3IJ3A 2OR4A 1TF8A 3PB8X 3S9NA 4MCSA 2ZELA 4O23A 1ZG8A 2NSMA 3KGQA 3IO1A 4KSIA 3SI1A 4X8IA 3B3VA 3QNVA 3D68A 5LRJA 4Z65A 2BOAA 2O53A 4NFRA 1BLLE 2ZOGA 3KQZA 1AYEA 1F57A 2PE3A 1XJOA 6CPAA 4OIDA 1OBRA 3LWUA 1RTQA 2XEIA 3B7IA 3B2YA 2DEAA 2AFSA 4P4IA 1XMBA 2PJ5A 2ZEGA 4K3NA 4PXBA 4R8FA 4YWYA 1VHOA 4MHYA 4OC2A 5K8PA 3CPXA 4ZI6A 3ISZA 5K8NA 4MHZA 5JH9A 4MHNA 2V77A 4OC4A 4P6YA 3D7HA 2PJ1A 3RBUA 5ELYA 3T8WA 3KASA 2HC9A 2JEWA 2WYRA 4ZY2A 1LFWA 1PCAA 3V38A 3WC7A 3B3TA 2GLJA 3B3SA 2HB6A 4FBEA 4PPZA 3BHXA 4ZX9A 3D4UA 4B6ZA 2ZEPA 2PJBA 2I3CA 3HUVA 8CPAA 1TKHA 2V8VA 1ZG9A 4PXCA 1Z2LA 5D29A 4NJQA 2ZENA 2C6CA 5I4MA 2J9AA 2EK9A 3NA6A 4TWEA 3S9MA 3KZWA 4UIAA 5DS0A 2CTCA 4R7MA 2C6PA 5J1QA 2PIYA 3D7FA 1QMUA 1EE3P 2ZEEA 3B3CA 2AFXA 4IK2A 2PJ0A 4Q7AA 5F09A 3IIBA 1HEEA 3WT4A 4R76A 4H2KA 1BAVA 2XEGA 3FVLA 4MMOA 3B3WA 4NGPA 1YW6A 4P4BA 2OOTA 3SJEA 2O4HA 4PXDA 3PBBA 3FECA 1CPXA 1XRYA 3JRUA 1ELLP 4OKOA 4ZY1A 2PCUA 1IY7A 3D67A 4IHMA 2AFUA 2V8HA 4GM5A 1YW4A 4A94A 2QYVA 3FJUA 1CG2A 4W9YA 1TF9A 3S9LA 2PVVA 4DJLA 3RAMA 1HDQA 1AMPA
chains in the Genus database with same CATH superfamily
3FNCA 2ZOFA 4QVTA 1KUVA 4WJBA 2C1CA 3TCVA 2Z3OA 1DE4C 1XE4A 2ODFA 4C7HA 4JWPA 2FS5A 1RXTA 1ZO0A 1S7KA 4Y49C 3NH5A 4CYQA 4OC1A 3MRUA 3DGVA 3BLNA 2X7BA 4KOUA 1PYTB 3D7GA 1SQHA 1L0CA 3JVNA 4NGTA 2BSWA 2ARHA 3K9UA 2GLFA 4QC6A 4TNUA 4B12A 3TO9A 3DLJA 3MN8A 4XPKA 4MFQA 2AFZA 4MFKA 3PRTA 5JM6A 1MK4A 1Y0RA 4NSQA 4PSXA 1IB1E 4ZBGA 4KS9A 1PU9A 4UEZA 3PFOA 2Z11A 2EBJA 1QSRA 4KVXA 1OZPA 1YGHA 3TX8A 4NGMA 4CGPA 3WC5A 5LYFA 1U6MA 1M4LA 1H8LA 4FWUA 5JQ4A 2GU2A 3QB8A 4K30A 2IQ6A 5LYLA 3FEDA 5KTCA 1B6BA 4IUSA 4XNHB 2WZNA 1ON0A 4EFDA 2POKA 2F7VA 1VHEA 3IEHA 4NGRA 3PFEA 4UBRA 1HDUA 3S6FA 4A38A 4UF4A 1IICA 5G1ZA 4OAEA 3RYOA 2DF5A 4PXEA 2Z3KA 1S60A 3BJ8A 1ZLIA 4R3KA 2RFHA 3BI0A 2Z3MA 1R57A 4OLLA 4JYWA 2IMOA 3FF3A 4OC3A 4MFLA 1LOKA 1Y0YA 4NXYA 5D8NA 2PJ7A 4X2TA 1YK3A 4HPSA 1YR0A 4ZGYB 2P6FA 2FVGA 4UWJA 1IIDA 1QSMA 5K8OA 4Y49B 2G3TA 2OZHA 2B3UA 2AFMA 3W6XA 4F9VA 2PJAA 3L2NA 3B35A 2EK8A 2ZEOA 1I12A 4OP4A 3H5ZA 4C7IA 4P4FA 4B13A 1JWQA 3CXSA 2F8HA 3I3GA 2F5IA 4KUBA 4A33A 4FAIA 5A28A 1X10A 1NSAA 3VARA 4MFJA 1BPNA 1M1DA 2PRBA 3LACA 2C27A 3FX6A 1M4DA 4MHPA 5LYIA 1YREA 2FXFA 4RUHA 4KOTA 3GB0A 2GE3A 2PJ4A 2ABZA 4DUKA 2BO9A 2PJ8A 1YQEA 4OC5A 3W6SA 4P4DA 4R6TA 2XEFA 4M6HA 2AJ6A 4JLYA 3SXNA 2PJCA 3BJ7A 3PB6X 3F0AA 4UEEA 5HVGA 1P0HA 1R43A 4II9A 2OU2A 4UWIA 4R57A 3IC1A 2VQYA 3FB3A 2Q4VA 3R96A 3B8GA 3LODA 3NE7A 2PIZA 3H8EA 4YU9A 3VWDA 5J8FA 2OZUA 4NJRA 4Q36A 4CYNA 1V0CA 2PJ2A 2CIJA 3I9SA 3TT2A 1LCPA 1FT7A 2YNCA 4FD5A 4U5YA 3D8PA 4M85A 1LAPA 3RNZA 3PB4X 5DWMA 3KHXA 4PQAA 4UCPA 5THWA 2J8MA 4B5PA 4H6UA 3IGRA 4IAVA 4MHDA 5CBMA 4IF5A 2XEJA 3C26A 1TIQA 2AFOA 2CF4A 2WPXA 3CZXA 5GCNA 1Y9KA 3SI2A 3K9TA 3WC6A 2JLMA 4ONWA 4BD9A 1F2OA 2QJ8A 5KTDA 4KOYA 1Y9WA 1Y7EA 4MBUA 4P45A 1FNOA 4ZX8A 4A31A 2AE6A 3WABA 1RO5A 4MY0A 4CPAA 7CPAA 3SI0A 3N5FA 2VXKA 4KOWA 1KWMA 4X3RA 3T90A 3H8FA 2VZZA 3FYNA 1M4IA 4NEXA 1XMTA 5E96A 1UWYA 4NGSA 3QAYA 2V8DA 3IWGA 1BPMA 4KVME 4MCRA 1M44A 3TOBA 2B4DB 4AXVA 3LMSA 5HMNA 1BO4A 2JBKA 4P44A 3JTKA 2CNTA 5AG4A 3TC8A 4AG7A 4CYOA 4KOSA 3EFAA 2FT0A 2PDOA 3CT9A 1IGBA 2Q44A 2ZEDA 1S3ZA 2G9DA 4A2ZA 4GXHA 3D7DA 3EC4A 4FD7A 4M3SA 2DPSA 1N71A 1Z5RA 2VL1A 2J8NA 2CNSA 3GIUA 4OIWA 3NH4A 3PB9X 4MCQA 1Q7LA 4KLVA 2HUZA 1TKFA 5IB9A 2PVWA 4MFZA 1XOVA 5HH1A 4AVCA 4P4JA 2EO8A 2ZXVA 5LRKA 2YGWA 3SJGA 4RS2A 1ELMP 2ZEFA 3KR4A 2ZEMA 2EWBA 4AB7A 1VIXA 4L89A 2Z0ZA 2PJ9A 4PK2A 1MJAA 3NE8A 1JQGA 3E0KA 3FIXA 4LQ6A 3F5BA 1LANA 4KUAA 1YSJA 1XEBA 3MGDA 4HNWB 4U9ZA 2QVPA 5AG6A 5LYDA 2V8GA 4OC0A 4FUUA 1Z8TA 1IOIA 2O28A 4XNHC 4JXRA 2Q7BA 1UFHA 1Z9UA 2Q51A 2Q0YA 4MFPA 2JBJA 3R95A 1I1DA 3BXMA 2GIVA 5JGFA 1CBXA 4WWVA 4P10A 1TKJA 3G3SA 3I1UA 2R7HA 1QSTA 4P4EA 2EVNA 4MI4A 3R9GA 4E8OA 1S7LA 3P2HA 4UCNA 3V7ZA 3D2MA 1M4GA 4DYOA 2GFQA 3K2KA 3ZJ0A 2P6GA 4OADA 4OMEA 4A39A 1KUYA 4EWTA 1DTDA 4CRZB 1CPSA 4C2XA 3FMCA 1MJBA 1ZG7A 1ZLHA 2AFWA 1NSLA 3NFZA 4UEFA 3GLJA 1A2ZA 3VATA 3G8WA 1Z8XA 1YMEA 1F2PA 5HVFA 1VHSA 1ARLA 3CDXA 1X12A 2Q4ZA 4AVAA 1XBUA 5G20A 3TOAA 4EVYA 4YFJA 3VH9A 1GYTA 2ATRA 2BL1A 2Q7SA 1CP6A 4R87A 3ZZIA 4EMEA 3FBUA 5HXDA 4QB9A 3LD2A 4XPLA 2VZYA 4UFWA 1I21A 1VGYA 2PC1A 3GY9A 4NGQA 2DPTA 1S7FA 3TO7A 5IB0A 3CPAA 5JPHA 2R8VA 3DDDA 2Z3NA 3P2FA 4CGOA 3H8GA 2CTBA 1WK4A 4AG9A 4M6GA 2NYQA 3IWEA 4G1PA 4JZ0A 3T9YA 1YLOA 1Q2YA 1Y7RA 4MXUA 2OZGA 3ISXA 2D4OA 4PSWA 4F0YA 4MCPA 1YVKA 3PBEA 3R1KA 3DSBA 4MRIA 3SJFA 4YRHA 4A30A 2Q04A 3PB7X 4KLWA 3HLPA 1QSOA 1LRZA 2RB7A 1TXRA 3KR5A 3NH8A 4C2ZA 1ARMA 2ANPA 4A32A 3PEIA 4GS4A 4NGNA 2H5MA 1P4NA 3GUXA 1NE9A 4F8ZA 3KL9A 1Q2CA 1XFOA 2Q43A 2PQ8A 3DR6A 1R3NA 2EUIA 2R98A 3IWWA 4LQGA 1CX8A 2REFA 1YVOA 3W91A 2JDDA 4UIBA 4CAWA 2ZPAA 4ZY0A 4KZTA 4Q38A 3SJXA 3BI1A 4L8AA 5BWAB 3JUWA 5K8MA 4ORFA 3KHZA 4JD6A 4XPDC 4F9UA 3IFEA 2PJ3A 1Z8LA 3KI9A 3TO6A 5F47A 4BMHA 4ZYQA 2PRQA 3FH4A 2KCWA 2QECA 1AUGA 3KQXA 5EBVA 4E0AA 2ZEHA 5HVHA 3TFYA 2C6GA 2FIAA 2FSRA 5ISVA 2FE7A 3CXPA 2IJZA 3FXTA 3FEEA 2FL4A 1QQ9A 2GREA 2D4PA 5CPAA 2B5GA 1CP7A 3D66A 4FD6A 3RZAA 4KSFA 1LAMA 4A37A 2OB0A 2PJ6A 2CY2A 5LRGA 5G22A 2BCOA 4B5PB 4B10A 3IJ3A 5F48A 5IX3A 2OR4A 2Q4YA 3SXOA 3EXNA 4CGMA 1Z8WA 2ZW4A 4CAFA 5DWNA 2I79A 2VI7A 4DNCA 5AG7A 3GYAA 1TF8A 4KORA 3PB8X 3IU1A 3S9NA 4MY3A 1IYKA 2G3AA 2QMLA 1J4JA 4MCSA 2ZELA 4O23A 1ZG8A 2A4NA 2NSMA 1YLEA 3DR8A 4NCZA 3KGQA 3IO1A 4KSIA 3SI1A 3D2PA 4X8IA 2GANA 2Z10A 4CGNA 1IU8A 4I49A 3B3VA 3QNVA 5IV0A 3D68A 5LRJA 1KZFA 1WWZA 4Z65A 4C2YA 2BOAA 2Z3LA 2O53A 2I00A 1XF8A 4NFRA 3CXQA 2B4BA 2FIWA 1BLLE 2Z3PA 2ZOGA 3KQZA 3F8KA 1AYEA 2PE3A 2K5TA 2P6EA 1F57A 1XJOA 4MJ8A 6CPAA 4OIDA 1OBRA 2CXAA 3LWUA 4LX9A 4PV6A 1RTQA 4B5OA 2XEIA 3B7IA 3B2YA 2DEAA 2AFSA 4P4IA 1XMBA 2PJ5A 2ZEGA 4K3NA 4PK3A 4PXBA 4R8FA 1IOFA 2PR1A 2WUUA 4CYPA 5A27A 3IU2A 4YWYA 5I0CA 1VHOA 4MHYA 4OC2A 2QIRA 5K8PA 2VBQA 3CPXA 3UY5A 3S6GA 4B11A 1CM0A 4ZI6A 5F46A 4RN7A 2FCKA 3FRMA 2P0WA 3ISZA 3PGPA 3R9FA 4MHZA 5JH9A 5K8NA 3DNSA 4MHNA 2V77A 2DXQA 4OC4A 4ONUA 2CNMA 2ZW6A 4P6YA 4UA3A 3TE4A 1Z4EA 3WR7A 4HKFA 3S6HA 3SHPA 2Y0MA 3D7HA 2PJ1A 3RBUA 5ELYA 3T8WA 2J8RA 3KASA 2HC9A 4E2AA 2JEWA 2WYRA 4ZY2A 3OWCA 1LFWA 1PCAA 3V38A 3WC7A 3B3TA 5FVJA 2R1IA 1Q2DA 2GLJA 4HNYB 3B3SA 2HB6A 4FBEA 2JDCA 2WPWA 1NMTA 4PPZA 2BEIA 3BHXA 4ZX9A 4X5KA 5AGEA 3D4UA 2REEA 4UFVA 2ZEPA 4B6ZA 4JJXA 4CRYB 1GHEA 2PJBA 1FY7A 2I3CA 3HUVA 8CPAA 3EO4A 1TKHA 2V8VA 1ZG9A 4H6ZA 4B14A 1MJ9A 1Z2LA 4PXCA 4R9MA 5D29A 5EC4A 3H4QA 4NJQA 3TTHA 1S7NA 3VWEA 5H84A 4CGLA 2ZENA 2C6CA 3PZJA 4KVOE 5I4MA 2HV2A 4J3GA 2J9AA 2EK9A 3NA6A 5EMIA 4TWEA 3RO0A 3S9MA 3KZWA 4R3LA 4CAEA 1VKCA 4CAVA 4FD4A 4H89A 4KOXA 2G0BA 4UIAA 2ZW5A 2VEZA 5DS0A 5F49A 4JXQA 2IL4A 2CTCA 1KUXA 4R7MA 4AVBA 2C6PA 5J1QA 2PIYA 1Z4RA 3D7FA 1QMUA 1EE3P 2ZEEA 4KSAA 2OH1A 4QUSA 3R9EA 3B3CA 4A95A 2AFXA 4IK2A 2PJ0A 4Q7AA 5H86A 5F09A 4M6IA 2PR8A 3IIBA 4BINA 1HEEA 2BUEA 2PSWA 2WSAA 5CNPA 4R76A 4XPDB 3WT4A 5J8CA 3EY5A 4H2KA 1BAVA 1K4JA 2XEGA 3KKWA 3FVLA 3N7ZA 3B3WA 4MMOA 4CS0B 4F0XA 4NGPA 2B3VA 1YX0A 2NMTA 3PP9A 4F6AA 1YW6A 4P4BA 5G21A 2OOTA 3D3SA 2YNEA 2YNCC 3SJEA 2B5GB 3S6KA 2O4HA 4PXDA 1S5KA 3QAHA 4BBHA 3PBBA 3FECA 1CPXA 4YGOA 1XRYA 3JRUA 1PUAA 4C68A 5C82A 1ELLP 4OKOA 5AG5A 2PCUA 4ZY1A 1CJWA 4LUAA 1IY7A 2ZW7A 2B58A 1BOBA 3D67A 4IHMA 2AFUA 2V8HA 2JEVA 4GM5A 1YW4A 4U9YA 1B87A 4A94A 4NF1A 2QYVA 4HNXB 3FJUA 4UFXA 1CG2A 1XIXA 2RC4A 3V8IA 3GKRA 5KTAA 4W9YA 1IYLA 1QSNA 4UCMA 5C88A 4QBJA 2YNDA 2B4DA 4KOVA 3A9LA 1TF9A 4CAXA 2HQYA 3S9LA 2PVVA 4DJLA 3RAMA 4RI1A 1HDQA 1AMPA
chains in the Genus database with same CATH topology
2ZOFA 4WJBA 2C1CA 1DE4C 3NH5A 4OC1A 3MRUA 3DGVA 1PYTB 3D7GA 4NGTA 2GLFA 4TNUA 3DLJA 3MN8A 2AFZA 3PRTA 5JM6A 1Y0RA 4UEZA 3PFOA 3TX8A 4NGMA 3WC5A 5LYFA 1M4LA 1H8LA 4FWUA 2GU2A 2IQ6A 5LYLA 3FEDA 4EFDA 2WZNA 2POKA 2F7VA 1VHEA 3IEHA 4NGRA 3PFEA 4A38A 1HDUA 4UF4A 4PXEA 1ZLIA 2RFHA 3BI0A 4JYWA 2IMOA 3FF3A 4OC3A 1LOKA 1Y0YA 5D8NA 2PJ7A 4X2TA 2FVGA 5K8OA 2AFMA 4F9VA 2PJAA 3L2NA 3B35A 2EK8A 2ZEOA 4OP4A 4P4FA 2F8HA 4FAIA 1NSAA 3VARA 1BPNA 3FX6A 4MHPA 5LYIA 4RUHA 3GB0A 2PJ4A 2ABZA 4DUKA 2BO9A 2PJ8A 4OC5A 4P4DA 4R6TA 2XEFA 2PJCA 3PB6X 4UEEA 5HVGA 1R43A 3IC1A 4YU9A 2PIZA 3H8EA 4NJRA 2PJ2A 2CIJA 1LCPA 1FT7A 1LAPA 3PB4X 3KHXA 4PQAA 5THWA 4IAVA 5CBMA 2XEJA 2CF4A 2AFOA 3SI2A 3WC6A 3K9TA 4ONWA 4BD9A 1F2OA 2QJ8A 1Y7EA 4P45A 4ZX8A 1FNOA 3WABA 4CPAA 7CPAA 3SI0A 3N5FA 1KWMA 4X3RA 3H8FA 1UWYA 4NGSA 2V8DA 1BPMA 4MCRA 3LMSA 2JBKA 4P44A 3TC8A 3CT9A 1IGBA 2ZEDA 2G9DA 3D7DA 1Z5RA 2VL1A 4OIWA 3NH4A 3PB9X 4MCQA 1Q7LA 1TKFA 5IB9A 2PVWA 4P4JA 5LRKA 3SJGA 1ELMP 2ZEFA 3KR4A 2ZEMA 2EWBA 1VIXA 2PJ9A 1JQGA 1LANA 1YSJA 2QVPA 5LYDA 2V8GA 4OC0A 4FUUA 2Q51A 2JBJA 3BXMA 5JGFA 1CBXA 4WWVA 4P10A 1TKJA 3I1UA 4P4EA 3V7ZA 4DYOA 3K2KA 4A39A 4OMEA 4EWTA 1DTDA 1CPSA 3FMCA 1ZG7A 1ZLHA 2AFWA 3NFZA 4UEFA 3GLJA 3VATA 1YMEA 1F2PA 5HVFA 1ARLA 3CDXA 2Q4ZA 1XBUA 3VH9A 1GYTA 5HXDA 1CP6A 4EMEA 1VGYA 4NGQA 3CPAA 3H8GA 2CTBA 2NYQA 4G1PA 4JZ0A 1YLOA 4MXUA 3ISXA 4MCPA 3PBEA 4MRIA 3SJFA 3PB7X 3HLPA 2RB7A 1TXRA 3KR5A 3NH8A 1ARMA 2ANPA 3PEIA 4NGNA 3GUXA 4F8ZA 3KL9A 1XFOA 2Q43A 1R3NA 3IWWA 4LQGA 1CX8A 4UIBA 4ZY0A 3SJXA 3BI1A 5K8MA 3KHZA 4F9UA 3IFEA 2PJ3A 1Z8LA 3KI9A 4ZYQA 2PRQA 3FH4A 3KQXA 5HVHA 2ZEHA 2C6GA 2IJZA 3FEEA 1QQ9A 2GREA 5CPAA 3D66A 1CP7A 3RZAA 4A37A 4AXVA 1LAMA 2PJ6A 5LRGA 2BCOA 3IJ3A 2OR4A 1TF8A 3PB8X 3S9NA 4MCSA 2ZELA 4O23A 1ZG8A 2NSMA 3KGQA 3IO1A 4KSIA 3SI1A 4X8IA 3B3VA 3QNVA 3D68A 5LRJA 4Z65A 2BOAA 2O53A 4NFRA 1BLLE 2ZOGA 3KQZA 1AYEA 1F57A 2PE3A 1XJOA 6CPAA 4OIDA 1OBRA 3LWUA 1RTQA 2XEIA 3B7IA 3B2YA 2DEAA 2AFSA 4P4IA 1XMBA 2PJ5A 2ZEGA 4K3NA 4PXBA 4R8FA 4YWYA 1VHOA 4MHYA 4OC2A 5K8PA 3CPXA 4ZI6A 3ISZA 5K8NA 4MHZA 5JH9A 4MHNA 2V77A 4OC4A 4P6YA 3D7HA 2PJ1A 3RBUA 5ELYA 3T8WA 3KASA 2HC9A 2JEWA 2WYRA 4ZY2A 1LFWA 1PCAA 3V38A 3WC7A 3B3TA 2GLJA 3B3SA 2HB6A 4FBEA 4PPZA 3BHXA 4ZX9A 3D4UA 4B6ZA 2ZEPA 2PJBA 2I3CA 3HUVA 8CPAA 1TKHA 2V8VA 1ZG9A 4PXCA 1Z2LA 5D29A 4NJQA 2ZENA 2C6CA 5I4MA 2J9AA 2EK9A 3NA6A 4TWEA 3S9MA 3KZWA 4UIAA 5DS0A 2CTCA 4R7MA 2C6PA 5J1QA 2PIYA 3D7FA 1QMUA 1EE3P 2ZEEA 3B3CA 2AFXA 4IK2A 2PJ0A 4Q7AA 5F09A 3IIBA 1HEEA 3WT4A 4R76A 4H2KA 1BAVA 2XEGA 3FVLA 4MMOA 3B3WA 4NGPA 1YW6A 4P4BA 2OOTA 3SJEA 2O4HA 4PXDA 3PBBA 3FECA 1CPXA 1XRYA 3JRUA 1ELLP 4OKOA 4ZY1A 2PCUA 1IY7A 3D67A 4IHMA 2AFUA 2V8HA 4GM5A 1YW4A 4A94A 2QYVA 3FJUA 1CG2A 4W9YA 1TF9A 3S9LA 2PVVA 4DJLA 3RAMA 1HDQA 1AMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZOF A;  4WJB A;  2C1C A;  1DE4 C;  3NH5 A;  4OC1 A;  3MRU A;  3DGV A;  1PYT B;  3D7G A;  4NGT A;  2GLF A;  4TNU A;  3DLJ A;  3MN8 A;  2AFZ A;  3PRT A;  5JM6 A;  1Y0R A;  4UEZ A;  3PFO A;  3TX8 A;  4NGM A;  3WC5 A;  5LYF A;  1M4L A;  1H8L A;  4FWU A;  2GU2 A;  2IQ6 A;  5LYL A;  3FED A;  4EFD A;  2WZN A;  2POK A;  2F7V A;  1VHE A;  3IEH A;  4NGR A;  3PFE A;  4A38 A;  1HDU A;  4UF4 A;  4PXE A;  1ZLI A;  2RFH A;  3BI0 A;  4JYW A;  2IMO A;  3FF3 A;  4OC3 A;  1LOK A;  1Y0Y A;  5D8N A;  2PJ7 A;  4X2T A;  2FVG A;  5K8O A;  2AFM A;  4F9V A;  2PJA A;  3L2N A;  3B35 A;  2EK8 A;  2ZEO A;  4OP4 A;  4P4F A;  2F8H A;  4FAI A;  1NSA A;  3VAR A;  1BPN A;  3FX6 A;  4MHP A;  5LYI A;  4RUH A;  3GB0 A;  2PJ4 A;  2ABZ A;  4DUK A;  2BO9 A;  2PJ8 A;  4OC5 A;  4P4D A;  4R6T A;  2XEF A;  2PJC A;  3PB6 X;  4UEE A;  5HVG A;  1R43 A;  3IC1 A;  4YU9 A;  2PIZ A;  3H8E A;  4NJR A;  2PJ2 A;  2CIJ A;  1LCP A;  1FT7 A;  1LAP A;  3PB4 X;  3KHX A;  4PQA A;  5THW A;  4IAV A;  5CBM A;  2XEJ A;  2CF4 A;  2AFO A;  3SI2 A;  3WC6 A;  3K9T A;  4ONW A;  4BD9 A;  1F2O A;  2QJ8 A;  1Y7E A;  4P45 A;  4ZX8 A;  1FNO A;  3WAB A;  4CPA A;  7CPA A;  3SI0 A;  3N5F A;  1KWM A;  4X3R A;  3H8F A;  1UWY A;  4NGS A;  2V8D A;  1BPM A;  4MCR A;  3LMS A;  2JBK A;  4P44 A;  3TC8 A;  3CT9 A;  1IGB A;  2ZED A;  2G9D A;  3D7D A;  1Z5R A;  2VL1 A;  4OIW A;  3NH4 A;  3PB9 X;  4MCQ A;  1Q7L A;  1TKF A;  5IB9 A;  2PVW A;  4P4J A;  5LRK A;  3SJG A;  1ELM P;  2ZEF A;  3KR4 A;  2ZEM A;  2EWB A;  1VIX A;  2PJ9 A;  1JQG A;  1LAN A;  1YSJ A;  2QVP A;  5LYD A;  2V8G A;  4OC0 A;  4FUU A;  2Q51 A;  2JBJ A;  3BXM A;  5JGF A;  1CBX A;  4WWV A;  4P10 A;  1TKJ A;  3I1U A;  4P4E A;  3V7Z A;  4DYO A;  3K2K A;  4A39 A;  4OME A;  4EWT A;  1DTD A;  1CPS A;  3FMC A;  1ZG7 A;  1ZLH A;  2AFW A;  3NFZ A;  4UEF A;  3GLJ A;  3VAT A;  1YME A;  1F2P A;  5HVF A;  1ARL A;  3CDX A;  2Q4Z A;  1XBU A;  3VH9 A;  1GYT A;  5HXD A;  1CP6 A;  4EME A;  1VGY A;  4NGQ A;  3CPA A;  3H8G A;  2CTB A;  2NYQ A;  4G1P A;  4JZ0 A;  1YLO A;  4MXU A;  3ISX A;  4MCP A;  3PBE A;  4MRI A;  3SJF A;  3PB7 X;  3HLP A;  2RB7 A;  1TXR A;  3KR5 A;  3NH8 A;  1ARM A;  2ANP A;  3PEI A;  4NGN A;  3GUX A;  4F8Z A;  3KL9 A;  1XFO A;  2Q43 A;  1R3N A;  3IWW A;  4LQG A;  1CX8 A;  4UIB A;  4ZY0 A;  3SJX A;  3BI1 A;  5K8M A;  3KHZ A;  4F9U A;  3IFE A;  2PJ3 A;  1Z8L A;  3KI9 A;  4ZYQ A;  2PRQ A;  3FH4 A;  3KQX A;  5HVH A;  2ZEH A;  2C6G A;  2IJZ A;  3FEE A;  1QQ9 A;  2GRE A;  5CPA A;  3D66 A;  1CP7 A;  3RZA A;  4A37 A;  4AXV A;  1LAM A;  2PJ6 A;  5LRG A;  2BCO A;  3IJ3 A;  2OR4 A;  1TF8 A;  3PB8 X;  3S9N A;  4MCS A;  2ZEL A;  4O23 A;  1ZG8 A;  2NSM A;  3KGQ A;  3IO1 A;  4KSI A;  3SI1 A;  4X8I A;  3B3V A;  3QNV A;  3D68 A;  5LRJ A;  4Z65 A;  2BOA A;  2O53 A;  4NFR A;  1BLL E;  2ZOG A;  3KQZ A;  1AYE A;  1F57 A;  2PE3 A;  1XJO A;  6CPA A;  4OID A;  1OBR A;  3LWU A;  1RTQ A;  2XEI A;  3B7I A;  3B2Y A;  2DEA A;  2AFS A;  4P4I A;  1XMB A;  2PJ5 A;  2ZEG A;  4K3N A;  4PXB A;  4R8F A;  4YWY A;  1VHO A;  4MHY A;  4OC2 A;  5K8P A;  3CPX A;  4ZI6 A;  3ISZ A;  5K8N A;  4MHZ A;  5JH9 A;  4MHN A;  2V77 A;  4OC4 A;  4P6Y A;  3D7H A;  2PJ1 A;  3RBU A;  5ELY A;  3T8W A;  3KAS A;  2HC9 A;  2JEW A;  2WYR A;  4ZY2 A;  1LFW A;  1PCA A;  3V38 A;  3WC7 A;  3B3T A;  2GLJ A;  3B3S A;  2HB6 A;  4FBE A;  4PPZ A;  3BHX A;  4ZX9 A;  3D4U A;  4B6Z A;  2ZEP A;  2PJB A;  2I3C A;  3HUV A;  8CPA A;  1TKH A;  2V8V A;  1ZG9 A;  4PXC A;  1Z2L A;  5D29 A;  4NJQ A;  2ZEN A;  2C6C A;  5I4M A;  2J9A A;  2EK9 A;  3NA6 A;  4TWE A;  3S9M A;  3KZW A;  4UIA A;  5DS0 A;  2CTC A;  4R7M A;  2C6P A;  5J1Q A;  2PIY A;  3D7F A;  1QMU A;  1EE3 P;  2ZEE A;  3B3C A;  2AFX A;  4IK2 A;  2PJ0 A;  4Q7A A;  5F09 A;  3IIB A;  1HEE A;  3WT4 A;  4R76 A;  4H2K A;  1BAV A;  2XEG A;  3FVL A;  4MMO A;  3B3W A;  4NGP A;  1YW6 A;  4P4B A;  2OOT A;  3SJE A;  2O4H A;  4PXD A;  3PBB A;  3FEC A;  1CPX A;  1XRY A;  3JRU A;  1ELL P;  4OKO A;  4ZY1 A;  2PCU A;  1IY7 A;  3D67 A;  4IHM A;  2AFU A;  2V8H A;  4GM5 A;  1YW4 A;  4A94 A;  2QYV A;  3FJU A;  1CG2 A;  4W9Y A;  1TF9 A;  3S9L A;  2PVV A;  4DJL A;  3RAM A;  1HDQ A;  1AMP A; 
#chains in the Genus database with same CATH topology
 3FNC A;  2ZOF A;  4QVT A;  1KUV A;  4WJB A;  2C1C A;  3TCV A;  2Z3O A;  1DE4 C;  1XE4 A;  2ODF A;  4C7H A;  4JWP A;  2FS5 A;  1RXT A;  1ZO0 A;  1S7K A;  4Y49 C;  3NH5 A;  4CYQ A;  4OC1 A;  3MRU A;  3DGV A;  3BLN A;  2X7B A;  4KOU A;  1PYT B;  3D7G A;  1SQH A;  1L0C A;  3JVN A;  4NGT A;  2BSW A;  2ARH A;  3K9U A;  2GLF A;  4QC6 A;  4TNU A;  4B12 A;  3TO9 A;  3DLJ A;  3MN8 A;  4XPK A;  4MFQ A;  2AFZ A;  4MFK A;  3PRT A;  5JM6 A;  1MK4 A;  1Y0R A;  4NSQ A;  4PSX A;  1IB1 E;  4ZBG A;  4KS9 A;  1PU9 A;  4UEZ A;  3PFO A;  2Z11 A;  2EBJ A;  1QSR A;  4KVX A;  1OZP A;  1YGH A;  3TX8 A;  4NGM A;  4CGP A;  3WC5 A;  5LYF A;  1U6M A;  1M4L A;  1H8L A;  4FWU A;  5JQ4 A;  2GU2 A;  3QB8 A;  4K30 A;  2IQ6 A;  5LYL A;  3FED A;  5KTC A;  1B6B A;  4IUS A;  4XNH B;  2WZN A;  1ON0 A;  4EFD A;  2POK A;  2F7V A;  1VHE A;  3IEH A;  4NGR A;  3PFE A;  4UBR A;  1HDU A;  3S6F A;  4A38 A;  4UF4 A;  1IIC A;  5G1Z A;  4OAE A;  3RYO A;  2DF5 A;  4PXE A;  2Z3K A;  1S60 A;  3BJ8 A;  1ZLI A;  4R3K A;  2RFH A;  3BI0 A;  2Z3M A;  1R57 A;  4OLL A;  4JYW A;  2IMO A;  3FF3 A;  4OC3 A;  4MFL A;  1LOK A;  1Y0Y A;  4NXY A;  5D8N A;  2PJ7 A;  4X2T A;  1YK3 A;  4HPS A;  1YR0 A;  4ZGY B;  2P6F A;  2FVG A;  4UWJ A;  1IID A;  1QSM A;  5K8O A;  4Y49 B;  2G3T A;  2OZH A;  2B3U A;  2AFM A;  3W6X A;  4F9V A;  2PJA A;  3L2N A;  3B35 A;  2EK8 A;  2ZEO A;  1I12 A;  4OP4 A;  3H5Z A;  4C7I A;  4P4F A;  4B13 A;  1JWQ A;  3CXS A;  2F8H A;  3I3G A;  2F5I A;  4KUB A;  4A33 A;  4FAI A;  5A28 A;  1X10 A;  1NSA A;  3VAR A;  4MFJ A;  1BPN A;  1M1D A;  2PRB A;  3LAC A;  2C27 A;  3FX6 A;  1M4D A;  4MHP A;  5LYI A;  1YRE A;  2FXF A;  4RUH A;  4KOT A;  3GB0 A;  2GE3 A;  2PJ4 A;  2ABZ A;  4DUK A;  2BO9 A;  2PJ8 A;  1YQE A;  4OC5 A;  3W6S A;  4P4D A;  4R6T A;  2XEF A;  4M6H A;  2AJ6 A;  4JLY A;  3SXN A;  2PJC A;  3BJ7 A;  3PB6 X;  3F0A A;  4UEE A;  5HVG A;  1P0H A;  1R43 A;  4II9 A;  2OU2 A;  4UWI A;  4R57 A;  3IC1 A;  2VQY A;  3FB3 A;  2Q4V A;  3R96 A;  3B8G A;  3LOD A;  3NE7 A;  2PIZ A;  3H8E A;  4YU9 A;  3VWD A;  5J8F A;  2OZU A;  4NJR A;  4Q36 A;  4CYN A;  1V0C A;  2PJ2 A;  2CIJ A;  3I9S A;  3TT2 A;  1LCP A;  1FT7 A;  2YNC A;  4FD5 A;  4U5Y A;  3D8P A;  4M85 A;  1LAP A;  3RNZ A;  3PB4 X;  5DWM A;  3KHX A;  4PQA A;  4UCP A;  5THW A;  2J8M A;  4B5P A;  4H6U A;  3IGR A;  4IAV A;  4MHD A;  5CBM A;  4IF5 A;  2XEJ A;  3C26 A;  1TIQ A;  2AFO A;  2CF4 A;  2WPX A;  3CZX A;  5GCN A;  1Y9K A;  3SI2 A;  3K9T A;  3WC6 A;  2JLM A;  4ONW A;  4BD9 A;  1F2O A;  2QJ8 A;  5KTD A;  4KOY A;  1Y9W A;  1Y7E A;  4MBU A;  4P45 A;  1FNO A;  4ZX8 A;  4A31 A;  2AE6 A;  3WAB A;  1RO5 A;  4MY0 A;  4CPA A;  7CPA A;  3SI0 A;  3N5F A;  2VXK A;  4KOW A;  1KWM A;  4X3R A;  3T90 A;  3H8F A;  2VZZ A;  3FYN A;  1M4I A;  4NEX A;  1XMT A;  5E96 A;  1UWY A;  4NGS A;  3QAY A;  2V8D A;  3IWG A;  1BPM A;  4KVM E;  4MCR A;  1M44 A;  3TOB A;  2B4D B;  4AXV A;  3LMS A;  5HMN A;  1BO4 A;  2JBK A;  4P44 A;  3JTK A;  2CNT A;  5AG4 A;  3TC8 A;  4AG7 A;  4CYO A;  4KOS A;  3EFA A;  2FT0 A;  2PDO A;  3CT9 A;  1IGB A;  2Q44 A;  2ZED A;  1S3Z A;  2G9D A;  4A2Z A;  4GXH A;  3D7D A;  3EC4 A;  4FD7 A;  4M3S A;  2DPS A;  1N71 A;  1Z5R A;  2VL1 A;  2J8N A;  2CNS A;  3GIU A;  4OIW A;  3NH4 A;  3PB9 X;  4MCQ A;  1Q7L A;  4KLV A;  2HUZ A;  1TKF A;  5IB9 A;  2PVW A;  4MFZ A;  1XOV A;  5HH1 A;  4AVC A;  4P4J A;  2EO8 A;  2ZXV A;  5LRK A;  2YGW A;  3SJG A;  4RS2 A;  1ELM P;  2ZEF A;  3KR4 A;  2ZEM A;  2EWB A;  4AB7 A;  1VIX A;  4L89 A;  2Z0Z A;  2PJ9 A;  4PK2 A;  1MJA A;  3NE8 A;  1JQG A;  3E0K A;  3FIX A;  4LQ6 A;  3F5B A;  1LAN A;  4KUA A;  1YSJ A;  1XEB A;  3MGD A;  4HNW B;  4U9Z A;  2QVP A;  5AG6 A;  5LYD A;  2V8G A;  4OC0 A;  4FUU A;  1Z8T A;  1IOI A;  2O28 A;  4XNH C;  4JXR A;  2Q7B A;  1UFH A;  1Z9U A;  2Q51 A;  2Q0Y A;  4MFP A;  2JBJ A;  3R95 A;  1I1D A;  3BXM A;  2GIV A;  5JGF A;  1CBX A;  4WWV A;  4P10 A;  1TKJ A;  3G3S A;  3I1U A;  2R7H A;  1QST A;  4P4E A;  2EVN A;  4MI4 A;  3R9G A;  4E8O A;  1S7L A;  3P2H A;  4UCN A;  3V7Z A;  3D2M A;  1M4G A;  4DYO A;  2GFQ A;  3K2K A;  3ZJ0 A;  2P6G A;  4OAD A;  4OME A;  4A39 A;  1KUY A;  4EWT A;  1DTD A;  4CRZ B;  1CPS A;  4C2X A;  3FMC A;  1MJB A;  1ZG7 A;  1ZLH A;  2AFW A;  1NSL A;  3NFZ A;  4UEF A;  3GLJ A;  1A2Z A;  3VAT A;  3G8W A;  1Z8X A;  1YME A;  1F2P A;  5HVF A;  1VHS A;  1ARL A;  3CDX A;  1X12 A;  2Q4Z A;  4AVA A;  1XBU A;  5G20 A;  3TOA A;  4EVY A;  4YFJ A;  3VH9 A;  1GYT A;  2ATR A;  2BL1 A;  2Q7S A;  1CP6 A;  4R87 A;  3ZZI A;  4EME A;  3FBU A;  5HXD A;  4QB9 A;  3LD2 A;  4XPL A;  2VZY A;  4UFW A;  1I21 A;  1VGY A;  2PC1 A;  3GY9 A;  4NGQ A;  2DPT A;  1S7F A;  3TO7 A;  5IB0 A;  3CPA A;  5JPH A;  2R8V A;  3DDD A;  2Z3N A;  3P2F A;  4CGO A;  3H8G A;  2CTB A;  1WK4 A;  4AG9 A;  4M6G A;  2NYQ A;  3IWE A;  4G1P A;  4JZ0 A;  3T9Y A;  1YLO A;  1Q2Y A;  1Y7R A;  4MXU A;  2OZG A;  3ISX A;  2D4O A;  4PSW A;  4F0Y A;  4MCP A;  1YVK A;  3PBE A;  3R1K A;  3DSB A;  4MRI A;  3SJF A;  4YRH A;  4A30 A;  2Q04 A;  3PB7 X;  4KLW A;  3HLP A;  1QSO A;  1LRZ A;  2RB7 A;  1TXR A;  3KR5 A;  3NH8 A;  4C2Z A;  1ARM A;  2ANP A;  4A32 A;  3PEI A;  4GS4 A;  4NGN A;  2H5M A;  1P4N A;  3GUX A;  1NE9 A;  4F8Z A;  3KL9 A;  1Q2C A;  1XFO A;  2Q43 A;  2PQ8 A;  3DR6 A;  1R3N A;  2EUI A;  2R98 A;  3IWW A;  4LQG A;  1CX8 A;  2REF A;  1YVO A;  3W91 A;  2JDD A;  4UIB A;  4CAW A;  2ZPA A;  4ZY0 A;  4KZT A;  4Q38 A;  3SJX A;  3BI1 A;  4L8A A;  5BWA B;  3JUW A;  5K8M A;  4ORF A;  3KHZ A;  4JD6 A;  4XPD C;  4F9U A;  3IFE A;  2PJ3 A;  1Z8L A;  3KI9 A;  3TO6 A;  5F47 A;  4BMH A;  4ZYQ A;  2PRQ A;  3FH4 A;  2KCW A;  2QEC A;  1AUG A;  3KQX A;  5EBV A;  4E0A A;  2ZEH A;  5HVH A;  3TFY A;  2C6G A;  2FIA A;  2FSR A;  5ISV A;  2FE7 A;  3CXP A;  2IJZ A;  3FXT A;  3FEE A;  2FL4 A;  1QQ9 A;  2GRE A;  2D4P A;  5CPA A;  2B5G A;  1CP7 A;  3D66 A;  4FD6 A;  3RZA A;  4KSF A;  1LAM A;  4A37 A;  2OB0 A;  2PJ6 A;  2CY2 A;  5LRG A;  5G22 A;  2BCO A;  4B5P B;  4B10 A;  3IJ3 A;  5F48 A;  5IX3 A;  2OR4 A;  2Q4Y A;  3SXO A;  3EXN A;  4CGM A;  1Z8W A;  2ZW4 A;  4CAF A;  5DWN A;  2I79 A;  2VI7 A;  4DNC A;  5AG7 A;  3GYA A;  1TF8 A;  4KOR A;  3PB8 X;  3IU1 A;  3S9N A;  4MY3 A;  1IYK A;  2G3A A;  2QML A;  1J4J A;  4MCS A;  2ZEL A;  4O23 A;  1ZG8 A;  2A4N A;  2NSM A;  1YLE A;  3DR8 A;  4NCZ A;  3KGQ A;  3IO1 A;  4KSI A;  3SI1 A;  3D2P A;  4X8I A;  2GAN A;  2Z10 A;  4CGN A;  1IU8 A;  4I49 A;  3B3V A;  3QNV A;  5IV0 A;  3D68 A;  5LRJ A;  1KZF A;  1WWZ A;  4Z65 A;  4C2Y A;  2BOA A;  2Z3L A;  2O53 A;  2I00 A;  1XF8 A;  4NFR A;  3CXQ A;  2B4B A;  2FIW A;  1BLL E;  2Z3P A;  2ZOG A;  3KQZ A;  3F8K A;  1AYE A;  2PE3 A;  2K5T A;  2P6E A;  1F57 A;  1XJO A;  4MJ8 A;  6CPA A;  4OID A;  1OBR A;  2CXA A;  3LWU A;  4LX9 A;  4PV6 A;  1RTQ A;  4B5O A;  2XEI A;  3B7I A;  3B2Y A;  2DEA A;  2AFS A;  4P4I A;  1XMB A;  2PJ5 A;  2ZEG A;  4K3N A;  4PK3 A;  4PXB A;  4R8F A;  1IOF A;  2PR1 A;  2WUU A;  4CYP A;  5A27 A;  3IU2 A;  4YWY A;  5I0C A;  1VHO A;  4MHY A;  4OC2 A;  2QIR A;  5K8P A;  2VBQ A;  3CPX A;  3UY5 A;  3S6G A;  4B11 A;  1CM0 A;  4ZI6 A;  5F46 A;  4RN7 A;  2FCK A;  3FRM A;  2P0W A;  3ISZ A;  3PGP A;  3R9F A;  4MHZ A;  5JH9 A;  5K8N A;  3DNS A;  4MHN A;  2V77 A;  2DXQ A;  4OC4 A;  4ONU A;  2CNM A;  2ZW6 A;  4P6Y A;  4UA3 A;  3TE4 A;  1Z4E A;  3WR7 A;  4HKF A;  3S6H A;  3SHP A;  2Y0M A;  3D7H A;  2PJ1 A;  3RBU A;  5ELY A;  3T8W A;  2J8R A;  3KAS A;  2HC9 A;  4E2A A;  2JEW A;  2WYR A;  4ZY2 A;  3OWC A;  1LFW A;  1PCA A;  3V38 A;  3WC7 A;  3B3T A;  5FVJ A;  2R1I A;  1Q2D A;  2GLJ A;  4HNY B;  3B3S A;  2HB6 A;  4FBE A;  2JDC A;  2WPW A;  1NMT A;  4PPZ A;  2BEI A;  3BHX A;  4ZX9 A;  4X5K A;  5AGE A;  3D4U A;  2REE A;  4UFV A;  2ZEP A;  4B6Z A;  4JJX A;  4CRY B;  1GHE A;  2PJB A;  1FY7 A;  2I3C A;  3HUV A;  8CPA A;  3EO4 A;  1TKH A;  2V8V A;  1ZG9 A;  4H6Z A;  4B14 A;  1MJ9 A;  1Z2L A;  4PXC A;  4R9M A;  5D29 A;  5EC4 A;  3H4Q A;  4NJQ A;  3TTH A;  1S7N A;  3VWE A;  5H84 A;  4CGL A;  2ZEN A;  2C6C A;  3PZJ A;  4KVO E;  5I4M A;  2HV2 A;  4J3G A;  2J9A A;  2EK9 A;  3NA6 A;  5EMI A;  4TWE A;  3RO0 A;  3S9M A;  3KZW A;  4R3L A;  4CAE A;  1VKC A;  4CAV A;  4FD4 A;  4H89 A;  4KOX A;  2G0B A;  4UIA A;  2ZW5 A;  2VEZ A;  5DS0 A;  5F49 A;  4JXQ A;  2IL4 A;  2CTC A;  1KUX A;  4R7M A;  4AVB A;  2C6P A;  5J1Q A;  2PIY A;  1Z4R A;  3D7F A;  1QMU A;  1EE3 P;  2ZEE A;  4KSA A;  2OH1 A;  4QUS A;  3R9E A;  3B3C A;  4A95 A;  2AFX A;  4IK2 A;  2PJ0 A;  4Q7A A;  5H86 A;  5F09 A;  4M6I A;  2PR8 A;  3IIB A;  4BIN A;  1HEE A;  2BUE A;  2PSW A;  2WSA A;  5CNP A;  4R76 A;  4XPD B;  3WT4 A;  5J8C A;  3EY5 A;  4H2K A;  1BAV A;  1K4J A;  2XEG A;  3KKW A;  3FVL A;  3N7Z A;  3B3W A;  4MMO A;  4CS0 B;  4F0X A;  4NGP A;  2B3V A;  1YX0 A;  2NMT A;  3PP9 A;  4F6A A;  1YW6 A;  4P4B A;  5G21 A;  2OOT A;  3D3S A;  2YNE A;  2YNC C;  3SJE A;  2B5G B;  3S6K A;  2O4H A;  4PXD A;  1S5K A;  3QAH A;  4BBH A;  3PBB A;  3FEC A;  1CPX A;  4YGO A;  1XRY A;  3JRU A;  1PUA A;  4C68 A;  5C82 A;  1ELL P;  4OKO A;  5AG5 A;  2PCU A;  4ZY1 A;  1CJW A;  4LUA A;  1IY7 A;  2ZW7 A;  2B58 A;  1BOB A;  3D67 A;  4IHM A;  2AFU A;  2V8H A;  2JEV A;  4GM5 A;  1YW4 A;  4U9Y A;  1B87 A;  4A94 A;  4NF1 A;  2QYV A;  4HNX B;  3FJU A;  4UFX A;  1CG2 A;  1XIX A;  2RC4 A;  3V8I A;  3GKR A;  5KTA A;  4W9Y A;  1IYL A;  1QSN A;  4UCM A;  5C88 A;  4QBJ A;  2YND A;  2B4D A;  4KOV A;  3A9L A;  1TF9 A;  4CAX A;  2HQY A;  3S9L A;  2PVV A;  4DJL A;  3RAM A;  4RI1 A;  1HDQ A;  1AMP A; 
#chains in the Genus database with same CATH homology
 2ZOF A;  4WJB A;  2C1C A;  1DE4 C;  3NH5 A;  4OC1 A;  3MRU A;  3DGV A;  1PYT B;  3D7G A;  4NGT A;  2GLF A;  4TNU A;  3DLJ A;  3MN8 A;  2AFZ A;  3PRT A;  5JM6 A;  1Y0R A;  4UEZ A;  3PFO A;  3TX8 A;  4NGM A;  3WC5 A;  5LYF A;  1M4L A;  1H8L A;  4FWU A;  2GU2 A;  2IQ6 A;  5LYL A;  3FED A;  4EFD A;  2WZN A;  2POK A;  2F7V A;  1VHE A;  3IEH A;  4NGR A;  3PFE A;  4A38 A;  1HDU A;  4UF4 A;  4PXE A;  1ZLI A;  2RFH A;  3BI0 A;  4JYW A;  2IMO A;  3FF3 A;  4OC3 A;  1LOK A;  1Y0Y A;  5D8N A;  2PJ7 A;  4X2T A;  2FVG A;  5K8O A;  2AFM A;  4F9V A;  2PJA A;  3L2N A;  3B35 A;  2EK8 A;  2ZEO A;  4OP4 A;  4P4F A;  2F8H A;  4FAI A;  1NSA A;  3VAR A;  1BPN A;  3FX6 A;  4MHP A;  5LYI A;  4RUH A;  3GB0 A;  2PJ4 A;  2ABZ A;  4DUK A;  2BO9 A;  2PJ8 A;  4OC5 A;  4P4D A;  4R6T A;  2XEF A;  2PJC A;  3PB6 X;  4UEE A;  5HVG A;  1R43 A;  3IC1 A;  4YU9 A;  2PIZ A;  3H8E A;  4NJR A;  2PJ2 A;  2CIJ A;  1LCP A;  1FT7 A;  1LAP A;  3PB4 X;  3KHX A;  4PQA A;  5THW A;  4IAV A;  5CBM A;  2XEJ A;  2CF4 A;  2AFO A;  3SI2 A;  3WC6 A;  3K9T A;  4ONW A;  4BD9 A;  1F2O A;  2QJ8 A;  1Y7E A;  4P45 A;  4ZX8 A;  1FNO A;  3WAB A;  4CPA A;  7CPA A;  3SI0 A;  3N5F A;  1KWM A;  4X3R A;  3H8F A;  1UWY A;  4NGS A;  2V8D A;  1BPM A;  4MCR A;  3LMS A;  2JBK A;  4P44 A;  3TC8 A;  3CT9 A;  1IGB A;  2ZED A;  2G9D A;  3D7D A;  1Z5R A;  2VL1 A;  4OIW A;  3NH4 A;  3PB9 X;  4MCQ A;  1Q7L A;  1TKF A;  5IB9 A;  2PVW A;  4P4J A;  5LRK A;  3SJG A;  1ELM P;  2ZEF A;  3KR4 A;  2ZEM A;  2EWB A;  1VIX A;  2PJ9 A;  1JQG A;  1LAN A;  1YSJ A;  2QVP A;  5LYD A;  2V8G A;  4OC0 A;  4FUU A;  2Q51 A;  2JBJ A;  3BXM A;  5JGF A;  1CBX A;  4WWV A;  4P10 A;  1TKJ A;  3I1U A;  4P4E A;  3V7Z A;  4DYO A;  3K2K A;  4A39 A;  4OME A;  4EWT A;  1DTD A;  1CPS A;  3FMC A;  1ZG7 A;  1ZLH A;  2AFW A;  3NFZ A;  4UEF A;  3GLJ A;  3VAT A;  1YME A;  1F2P A;  5HVF A;  1ARL A;  3CDX A;  2Q4Z A;  1XBU A;  3VH9 A;  1GYT A;  5HXD A;  1CP6 A;  4EME A;  1VGY A;  4NGQ A;  3CPA A;  3H8G A;  2CTB A;  2NYQ A;  4G1P A;  4JZ0 A;  1YLO A;  4MXU A;  3ISX A;  4MCP A;  3PBE A;  4MRI A;  3SJF A;  3PB7 X;  3HLP A;  2RB7 A;  1TXR A;  3KR5 A;  3NH8 A;  1ARM A;  2ANP A;  3PEI A;  4NGN A;  3GUX A;  4F8Z A;  3KL9 A;  1XFO A;  2Q43 A;  1R3N A;  3IWW A;  4LQG A;  1CX8 A;  4UIB A;  4ZY0 A;  3SJX A;  3BI1 A;  5K8M A;  3KHZ A;  4F9U A;  3IFE A;  2PJ3 A;  1Z8L A;  3KI9 A;  4ZYQ A;  2PRQ A;  3FH4 A;  3KQX A;  5HVH A;  2ZEH A;  2C6G A;  2IJZ A;  3FEE A;  1QQ9 A;  2GRE A;  5CPA A;  3D66 A;  1CP7 A;  3RZA A;  4A37 A;  4AXV A;  1LAM A;  2PJ6 A;  5LRG A;  2BCO A;  3IJ3 A;  2OR4 A;  1TF8 A;  3PB8 X;  3S9N A;  4MCS A;  2ZEL A;  4O23 A;  1ZG8 A;  2NSM A;  3KGQ A;  3IO1 A;  4KSI A;  3SI1 A;  4X8I A;  3B3V A;  3QNV A;  3D68 A;  5LRJ A;  4Z65 A;  2BOA A;  2O53 A;  4NFR A;  1BLL E;  2ZOG A;  3KQZ A;  1AYE A;  1F57 A;  2PE3 A;  1XJO A;  6CPA A;  4OID A;  1OBR A;  3LWU A;  1RTQ A;  2XEI A;  3B7I A;  3B2Y A;  2DEA A;  2AFS A;  4P4I A;  1XMB A;  2PJ5 A;  2ZEG A;  4K3N A;  4PXB A;  4R8F A;  4YWY A;  1VHO A;  4MHY A;  4OC2 A;  5K8P A;  3CPX A;  4ZI6 A;  3ISZ A;  5K8N A;  4MHZ A;  5JH9 A;  4MHN A;  2V77 A;  4OC4 A;  4P6Y A;  3D7H A;  2PJ1 A;  3RBU A;  5ELY A;  3T8W A;  3KAS A;  2HC9 A;  2JEW A;  2WYR A;  4ZY2 A;  1LFW A;  1PCA A;  3V38 A;  3WC7 A;  3B3T A;  2GLJ A;  3B3S A;  2HB6 A;  4FBE A;  4PPZ A;  3BHX A;  4ZX9 A;  3D4U A;  4B6Z A;  2ZEP A;  2PJB A;  2I3C A;  3HUV A;  8CPA A;  1TKH A;  2V8V A;  1ZG9 A;  4PXC A;  1Z2L A;  5D29 A;  4NJQ A;  2ZEN A;  2C6C A;  5I4M A;  2J9A A;  2EK9 A;  3NA6 A;  4TWE A;  3S9M A;  3KZW A;  4UIA A;  5DS0 A;  2CTC A;  4R7M A;  2C6P A;  5J1Q A;  2PIY A;  3D7F A;  1QMU A;  1EE3 P;  2ZEE A;  3B3C A;  2AFX A;  4IK2 A;  2PJ0 A;  4Q7A A;  5F09 A;  3IIB A;  1HEE A;  3WT4 A;  4R76 A;  4H2K A;  1BAV A;  2XEG A;  3FVL A;  4MMO A;  3B3W A;  4NGP A;  1YW6 A;  4P4B A;  2OOT A;  3SJE A;  2O4H A;  4PXD A;  3PBB A;  3FEC A;  1CPX A;  1XRY A;  3JRU A;  1ELL P;  4OKO A;  4ZY1 A;  2PCU A;  1IY7 A;  3D67 A;  4IHM A;  2AFU A;  2V8H A;  4GM5 A;  1YW4 A;  4A94 A;  2QYV A;  3FJU A;  1CG2 A;  4W9Y A;  1TF9 A;  3S9L A;  2PVV A;  4DJL A;  3RAM A;  1HDQ A;  1AMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...