4MHNA

Crystal structure of a glutaminyl cyclase from ixodes scapularis
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
326
structure length
326
Chain Sequence
LKWPRDLRPLAHHDLLYMGQISEEDRGDFNATLRNFLVPRVVGSQKHREVREFIVRSLKDLDWDVEEDCFDGQTPHGIKPFCNVIATLNPSACHRLVLACHYDSLLHKEGTFIGATDSAVPCAQLLYLARSLNGKLQNQKTRGDGLTLQLVFFDGEEAFERWSSHDSLYGSRHLAQKWHEDRTSAERLESCLERSEIANQIDRMEVMVLLDLLGAENPRFYSYFGETQPVYRRLVNIESRLNDAGLMELPRRRRRTNYFSNSSTVGFIEDDHIPFLKRSVPIVHIIPSPFPDVWHTLDDNEQNLHHPTISNLNKIFKAFVSEYLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analyses of a glutaminyl cyclase from Ixodes scapularis reveal metal-independent catalysis and inhibitor binding.
pubmed doi rcsb
molecule keywords Glutaminyl cyclase, putative
source organism Ixodes scapularis
molecule tags Transferase
total genus 110
structure length 326
sequence length 326
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mhnA00
1DTDA 4A38A 2BOAA 1FNOA 4ZY2A 4R8FA 1LCPA 1TF9A 1ZLHA 4DUKA 1LAPA 1Y7EA 2ZEPA 3KHZA 4P4FA 5LYFA 4OC0A 3PFOA 3VARA 1TKHA 4MCQA 4UEFA 1IY7A 4YU9A 4UIAA 3D7FA 1CBXA 3PBBA 2XEGA 3PB7X 4P4EA 4A37A 4NGNA 5DS0A 2PJ6A 2PJ5A 2Q51A 2PJ8A 3T8WA 2IJZA 4TNUA 4NGMA 1BPMA 1R3NA 5THWA 4GM5A 1Z5RA 4FAIA 2ZEHA 1LAMA 3B3SA 2IMOA 4AXVA 4FBEA 2ZEFA 3KR4A 2ABZA 3BI0A 4X8IA 1EE3P 1NSAA 3TX8A 4OMEA 2AFUA 2PE3A 2XEJA 5IB9A 2VL1A 3KR5A 2JBKA 5JM6A 4O23A 3BHXA 3B3WA 4P4DA 1VHEA 5K8MA 3D7HA 1HDUA 4JYWA 1CPSA 3WC7A 4OP4A 4W9YA 4IAVA 2V8HA 4UEEA 5LRJA 3S9NA 2C6PA 1XMBA 4PXEA 2BO9A 1XBUA 4MHNA 2WYRA 1ZG9A 3IWWA 1BAVA 2V77A 3D66A 3L2NA 3D4UA 5ELYA 3PEIA 4NJRA 2PIZA 4MHYA 4OIDA 5LYIA 4ZX8A 4RUHA 2FVGA 2JBJA 2CF4A 5LRGA 2PVVA 7CPAA 1ZG7A 2QVPA 4EWTA 4A94A 2RB7A 4P4IA 4X2TA 2F8HA 4EFDA 3FMCA 4MMOA 2PJ9A 2QYVA 3N5FA 1YW6A 1DE4C 5D8NA 4UEZA 3SJEA 3D67A 3PB9X 4MCPA 5LRKA 4R76A 4BD9A 1R43A 1BLLE 2PJCA 1YMEA 1OBRA 1PYTB 1QMUA 3JRUA 3FEDA 1H8LA 1Q7LA 3SJXA 3H8FA 2AFOA 4B6ZA 5CBMA 1HEEA 1M4LA 5I4MA 4K3NA 4CPAA 1ZG8A 5CPAA 1YW4A 2CTBA 4ZY1A 2ZEOA 4OC3A 4TWEA 3S9LA 1AYEA 2J9AA 4NJQA 2PJ1A 3IIBA 1TKJA 1LFWA 1VGYA 4OIWA 3IO1A 1PCAA 2BCOA 4F8ZA 4FUUA 3PRTA 3SI0A 2ZEDA 1F57A 2PCUA 1ARMA 3VH9A 1KWMA 2ZOGA 1ELLP 4ZX9A 4MHPA 3D7DA 4P6YA 2JEWA 3H8GA 3KL9A 2XEFA 1Z8LA 4PXBA 1Z2LA 4MHZA 3PFEA 4UF4A 2V8GA 2IQ6A 1BPNA 4R6TA 5LYDA 3GUXA 5HVHA 4OC1A 3VATA 2F7VA 3KQXA 3TC8A 4NGQA 2AFWA 3WC6A 2ZENA 4LQGA 4ZYQA 2PJ7A 4P4JA 2PIYA 3NFZA 4P4BA 2C1CA 1FT7A 4P44A 5HXDA 2EK9A 3FVLA 4KSIA 4PXCA 2GLJA 2PJ4A 2DEAA 3IC1A 1LOKA 2PRQA 1ZLIA 1YLOA 3B35A 3PB8X 2PJAA 3FEEA 1ARLA 2C6GA 3KZWA 3S9MA 3K9TA 5K8OA 3KASA 2O4HA 2ZEEA 3MN8A 3IJ3A 4H2KA 2V8DA 2G9DA 3NA6A 3KI9A 3SI1A 3RBUA 4DJLA 4WWVA 8CPAA 2Q43A 3WABA 2EWBA 4EMEA 2ZOFA 4NGPA 4P10A 1UWYA 3NH4A 4OC2A 3NH5A 3CT9A 2O53A 4R7MA 3RAMA 2RFHA 4IHMA 2ZELA 2CIJA 4PQAA 5K8NA 4NGRA 3IEHA 1VHOA 3KGQA 3KHXA 3WC5A 3ISXA 2Q4ZA 1RTQA 3B7IA 1XFOA 2GLFA 1TXRA 3FX6A 2PJBA 4ZY0A 3PB4X 2EK8A 5HVFA 5K8PA 4MXUA 1CPXA 3CPXA 2NYQA 5F09A 1XJOA 3GB0A 4F9VA 3MRUA 2XEIA 1IGBA 4ONWA 1ELMP 2ZEMA 3SJFA 4OC4A 5HVGA 3FJUA 2QJ8A 3PB6X 5D29A 2AFXA 4X3RA 3H8EA 3V7ZA 3QNVA 4G1PA 6CPAA 2WZNA 3CPAA 1XRYA 4UIBA 1TF8A 1CX8A 3FF3A 1Y0YA 2AFZA 2AFSA 1QQ9A 3HUVA 4JZ0A 2POKA 3D68A 2V8VA 3B3TA 3BXMA 4P45A 1YSJA 3BI1A 4IK2A 5JH9A 2PJ3A 3IFEA 4NGSA 1TKFA 4FWUA 3GLJA 4OC5A 2GU2A 2ANPA 5JGFA 2PJ2A 1GYTA 3B2YA 2PVWA 1CP6A 2HC9A 3LWUA 3DGVA 4MRIA 4NFRA 1LANA 4Z65A 2OOTA 1AMPA 4PXDA 3V38A 4F9UA 3B3CA 4ZI6A 4NGTA 2ZEGA 2PJ0A 3LMSA 3HLPA 4A39A 3KQZA 1JQGA 3FH4A 3CDXA 3SJGA 2C6CA 3DLJA 2OR4A 2I3CA 4MCRA 1VIXA 4DYOA 3RZAA 3WT4A 3PBEA 1F2OA 3K2KA 3NH8A 4OKOA 3I1UA 4WJBA 2HB6A 3B3VA 4YWYA 2CTCA 4PPZA 4Q7AA 1CP7A 4MCSA 1F2PA 1Y0RA 2NSMA 3FECA 5J1QA 2AFMA 3D7GA 2GREA 1HDQA 5LYLA 3ISZA 3SI2A 1CG2A
chains in the Genus database with same CATH superfamily
1DTDA 4A38A 2BOAA 1FNOA 2HUZA 5EMIA 4ZY2A 4R8FA 1LCPA 4AB7A 1TF9A 4R3LA 2FT0A 1ZLHA 2D4OA 4DUKA 2Z11A 4AG9A 1LAPA 1Y7EA 2ZEPA 3KHZA 4P4FA 4CGPA 4CGNA 5LYFA 2NMTA 4KOTA 4OC0A 3PFOA 2FXFA 2B4DB 3G3SA 1BOBA 3TOBA 3VARA 1TKHA 2B4BA 4MCQA 4UEFA 1IY7A 1XE4A 2ZW7A 1XEBA 2B3UA 4YU9A 3I9SA 4UIAA 3DDDA 3D7FA 4ONUA 1CBXA 3PBBA 2XEGA 2D4PA 3PB7X 4P4EA 5F47A 4NGNA 5DS0A 1I21A 4A37A 4LUAA 2PJ6A 1B87A 4B5PA 2PJ5A 2Q51A 2PJ8A 3IU2A 4CGLA 3T8WA 2IJZA 3E0KA 4TNUA 2P6EA 4NGMA 4A31A 1BPMA 4HNYB 1R3NA 5H84A 4KUBA 5THWA 4GM5A 3ZJ0A 2P6GA 4A32A 1Z5RA 4FAIA 5AGEA 2HQYA 2ZEHA 1LAMA 1CM0A 4KUAA 3B3SA 5F48A 2IMOA 4AXVA 4FBEA 3VWEA 3D2MA 2ZEFA 3KR4A 2ABZA 3BI0A 1TIQA 3IGRA 1KZFA 4X8IA 2Z3KA 1EE3P 1NSAA 1YK3A 2CNTA 3EFAA 2AFUA 2PE3A 2WPWA 2XEJA 4KLVA 4OMEA 2VL1A 4H6UA 5IB9A 4X5KA 3KR5A 2JBKA 5JM6A 1Z4RA 2AJ6A 1B6BA 4O23A 2FS5A 1Y7RA 1NMTA 1M4GA 2WSAA 2R7HA 3BHXA 4XNHB 3B3WA 3A9LA 4P4DA 2ZW4A 1VHEA 4MFPA 1VKCA 4C7IA 5K8MA 2QIRA 3D7HA 4RI1A 4UCMA 1HDUA 2G3AA 4JYWA 4R3KA 4XNHC 1IOFA 1CPSA 1Q2YA 2PQ8A 3WC7A 2Z3MA 1I1DA 4OP4A 4W9YA 4IAVA 2V8HA 4UEEA 5LRJA 3S9NA 3SHPA 2C6PA 1XMBA 4QUSA 4KS9A 3DNSA 2B5GB 4PXEA 2DPSA 2BO9A 1XBUA 4MHNA 2WYRA 2VI7A 2Q04A 5KTAA 1Z4EA 4BBHA 1ZG9A 3JUWA 3IWWA 1BAVA 2Q7SA 2V77A 2Z10A 1IU8A 4AVAA 3D66A 3L2NA 3D4UA 2DPTA 4OADA 2CNMA 2Q4YA 3JTKA 3PEIA 4NJRA 5ELYA 2YNCA 1Z8WA 2REEA 4CYNA 2PIZA 4MHYA 3DR8A 3R9EA 3RYOA 1ON0A 4OIDA 2BL1A 4F6AA 4KSFA 2REFA 5LYIA 4CGMA 3D2PA 4ZX8A 3R9FA 4RUHA 2FVGA 2JBJA 5AG4A 2CF4A 5LRGA 2PVVA 5I0CA 1Q2DA 2OH1A 5DWNA 3H5ZA 7CPAA 1XOVA 5J8FA 4JWPA 4B14A 4Y49B 2GE3A 1ZG7A 3EO4A 3TO9A 1BO4A 1R57A 4NCZA 3TX8A 4NEXA 2QVPA 1Y9WA 4EWTA 4A94A 2JDDA 4Y49C 2EO8A 2RB7A 4P4IA 3PP9A 2F8HA 4X2TA 5J8CA 3N7ZA 4QC6A 4HNXB 4JJXA 1XMTA 3R95A 4EFDA 3FMCA 4H6ZA 1OZPA 4QB9A 4MMOA 2PJ9A 2QYVA 3BJ8A 3TT2A 3N5FA 1YLEA 4I49A 4MY3A 5KTCA 3TO6A 4U9YA 1YW6A 4KVOE 3W91A 4C68A 1DE4C 2Z3NA 4A2ZA 1Q2CA 5D8NA 4UEZA 1YREA 2HV2A 3S6GA 3SJEA 4JXRA 3D67A 3PB9X 4KOSA 4MCPA 5LRKA 4R76A 4B5PB 3K9UA 4F0YA 4BD9A 1R43A 1SQHA 2VBQA 4B10A 1BLLE 3EC4A 2PJCA 1YMEA 2B3VA 3S6FA 2KCWA 2H5MA 1OBRA 2I00A 2FE7A 1PYTB 4LX9A 1QMUA 3JRUA 1S7FA 4KLWA 1PU9A 5AG5A 3FEDA 1NSLA 2OZGA 4QVTA 1H8LA 1Q7LA 5CNPA 3SJXA 3H8FA 2AFOA 4B6ZA 2P6FA 5AG7A 5JQ4A 5CBMA 1HEEA 1RO5A 1S7NA 4CAFA 3R9GA 1M4LA 5I4MA 2JLMA 4K3NA 4HKFA 3CXQA 4C7HA 4CPAA 1ZG8A 4JXQA 3KKWA 5CPAA 4CRYB 1YW4A 3GIUA 4NSQA 2EVNA 2CTBA 4ZY1A 4XPKA 5G21A 4B11A 2WPXA 2ZEOA 4HNWB 2P0WA 2PR8A 3C26A 4M6IA 3B8GA 4OC3A 5H86A 5IV0A 4NXYA 4M6HA 2B58A 4OLLA 4TWEA 1AYEA 2J9AA 3S6HA 3S9LA 4NJQA 4MY0A 2PJ1A 4CAEA 3IIBA 4M85A 1KUYA 1TKJA 2DF5A 2CNSA 1Y9KA 3W6SA 1LFWA 4MFQA 1VGYA 4OIWA 3IO1A 1PCAA 2BCOA 4F8ZA 3R1KA 1J4JA 3PRTA 4FUUA 4B5OA 3CXSA 4PK3A 4MFLA 3SI0A 2ZEDA 1IICA 1F57A 3H4QA 4BINA 2PCUA 2PSWA 1ARMA 4H89A 1P4NA 3VH9A 1KWMA 2ZOGA 1ELLP 2JDCA 4ZX9A 4MHPA 4MFKA 3D7DA 4MI4A 4MBUA 3TO7A 3ZZIA 4P6YA 1VHSA 2JEWA 2I79A 2PDOA 1YGHA 4CGOA 4IUSA 3H8GA 4KOWA 3GYAA 4RS2A 3KL9A 2XEFA 1Z8LA 4PXBA 1LRZA 1Z2LA 4MHZA 3PFEA 4ORFA 2V8GA 2IQ6A 1BPNA 1WWZA 4R6TA 4Q38A 4UF4A 1QSOA 3MGDA 5LYDA 1IIDA 2YNCC 3GUXA 3RO0A 4F0XA 5C88A 5HVHA 4OC1A 3VATA 2F7VA 2FIAA 3TFYA 4KORA 3KQXA 4MFZA 3TCVA 3DR6A 4PK2A 3TC8A 1IB1E 4UA3A 4KVME 2AFWA 4NGQA 3WC6A 4AVCA 4CAXA 2ZENA 2Z3PA 2IL4A 1M4DA 3GKRA 3IWGA 1YVOA 4YRHA 2J8RA 4LQGA 4ZYQA 2PJ7A 2WUUA 4P4JA 2ZW6A 5KTDA 2PIYA 3NFZA 4P4BA 2C1CA 1FT7A 2G0BA 4C2YA 2PR1A 2ZPAA 4P44A 5HXDA 5GCNA 2QMLA 2Y0MA 2YNDA 2EK9A 3FVLA 4KSIA 3G8WA 4U5YA 2ZXVA 4KSAA 2BUEA 4E0AA 3GY9A 5EBVA 2VZYA 2GLJA 3QAHA 2EBJA 2PJ4A 2YNEA 4PXCA 1QSRA 2YGWA 2CY2A 1UFHA 1M1DA 4GS4A 3BJ7A 2DEAA 3IC1A 5G1ZA 4A95A 3RNZA 1LOKA 3FXTA 5G20A 2PRQA 1S3ZA 1ZLIA 1XIXA 3EXNA 4J3GA 2FSRA 1S5KA 1YLOA 1CJWA 3B35A 3P2HA 3PB8X 5FVJA 2PJAA 2O28A 4BMHA 3FEEA 2Q44A 4RN7A 2A4NA 1ARLA 3F0AA 2C6GA 3KZWA 2PC1A 3S9MA 3K9TA 5K8OA 4E8OA 5A28A 3FYNA 3OWCA 3JVNA 3KASA 2O4HA 2ZEEA 3VWDA 2RC4A 3MN8A 3TE4A 3IJ3A 2Z3LA 4H2KA 2J8NA 2V8DA 2G9DA 4YFJA 3QB8A 3NA6A 5JPHA 3KI9A 4PSXA 3EY5A 4CAVA 3SI1A 4UFXA 1S60A 1X10A 4II9A 2FL4A 3RBUA 4DJLA 4WWVA 8CPAA 4UWIA 2Q43A 3SXOA 3WABA 3WR7A 2EWBA 2PRBA 4EMEA 2ZOFA 4NGPA 4P10A 1MK4A 1UWYA 2VXKA 3NH4A 3NH5A 4JLYA 4OC2A 3CT9A 2O53A 2ODFA 1ZO0A 4R7MA 2GFQA 3RAMA 2RFHA 4IHMA 2ZELA 4B12A 2CIJA 4CYOA 4PQAA 1MJAA 5K8NA 4FD5A 4NGRA 3IEHA 1VHOA 3KGQA 3KHXA 4R87A 3WC5A 3ISXA 4R57A 2Q4ZA 1RTQA 3B7IA 4AVBA 2EUIA 1XFOA 3DSBA 3TOAA 2GLFA 4MJ8A 3BLNA 3TTHA 2BEIA 3QAYA 1TXRA 3FB3A 3FX6A 2PJBA 4ZY0A 3PB4X 5F46A 2EK8A 5HVFA 5K8PA 4MXUA 1CPXA 1A2ZA 1KUXA 3FIXA 2Q4VA 4Q36A 2X7BA 3CPXA 2NYQA 3FRMA 3NE7A 5F09A 1IOIA 4C2XA 1XJOA 4KOUA 4C2ZA 3GB0A 4UFVA 4F9VA 3MRUA 4GXHA 2J8MA 2XEIA 1IGBA 4R9MA 4ONWA 3V8IA 5HMNA 4FD4A 1ELMP 2ZEMA 2GIVA 4OC4A 3SJFA 1QSTA 3FJUA 2QJ8A 4AG7A 5HVGA 3PB6X 4ZGYB 4FD6A 5D29A 4HPSA 2Q7BA 5ISVA 2AFXA 4CS0B 1V0CA 3IWEA 1Z9UA 4X3RA 3H8EA 4MFJA 4E2AA 1IYKA 3V7ZA 3QNVA 4G1PA 6CPAA 2WZNA 4KVXA 2ATRA 2FCKA 1I12A 2VZZA 3T9YA 2OZUA 4XPLA 3CPAA 4IF5A 1N71A 1XRYA 1TF8A 1CX8A 1YX0A 3D3SA 3FF3A 4UIBA 1K4JA 4YGOA 4UBRA 1Y0YA 2AFZA 2B4DA 2AFSA 1QQ9A 3HUVA 5C82A 1AUGA 4NF1A 4JZ0A 2POKA 3D68A 4UCPA 2OU2A 4XPDB 2V8VA 2Z3OA 1GHEA 1QSMA 2Q0YA 3B3TA 3BXMA 4P45A 1YSJA 3BI1A 4IK2A 3LACA 1M44A 2FIWA 4M6GA 4B13A 5JH9A 2PJ3A 4XPDC 3IFEA 3NE8A 4NGSA 5E96A 1TKFA 1S7KA 2R8VA 4FWUA 3GLJA 4OC5A 5EC4A 2GU2A 4EVYA 4U9ZA 4KZTA 5G22A 2ANPA 1WK4A 5JGFA 2VQYA 2K5TA 1GYTA 2ARHA 2PJ2A 3B2YA 4KOYA 4OAEA 2PVWA 4UFWA 4A33A 5IX3A 1CP6A 2HC9A 3LWUA 3DGVA 1QSNA 2DXQA 4K30A 4MRIA 1LANA 4NFRA 3IU1A 4Z65A 2VEZA 2OOTA 1AMPA 4PXDA 3V38A 1P0HA 4F9UA 3D8PA 3B3CA 3CXPA 4ZI6A 1MJBA 4NGTA 4CRZB 3F5BA 2ZEGA 2PJ0A 3LMSA 2OB0A 3F8KA 3HLPA 5HH1A 4A39A 3KQZA 4A30A 1JQGA 1XF8A 3FH4A 4ZBGA 3CDXA 3SJGA 2C6CA 1IYLA 3DLJA 5F49A 2OR4A 2I3CA 2ZW5A 4UCNA 4CAWA 4MCRA 3PZJA 3W6XA 2G3TA 4PSWA 4DNCA 3LD2A 5BWAB 3T90A 3FNCA 1VIXA 4L8AA 2GANA 5DWMA 4DYOA 3RZAA 4UWJA 3WT4A 1PUAA 3PBEA 2AE6A 4QBJA 3FBUA 2R98A 1F2OA 4JD6A 2C27A 1RXTA 3K2KA 3NH8A 4OKOA 4MHDA 3I1UA 1YR0A 2OZHA 4WJBA 2B5GA 2HB6A 3B3VA 4YWYA 4PV6A 3SXNA 4CYQA 2CXAA 3LODA 2CTCA 1KUVA 1YQEA 4PPZA 1Z8TA 4Q7AA 1CP7A 1L0CA 2Z0ZA 1JWQA 1M4IA 1MJ9A 1F2PA 1S7LA 1X12A 4MCSA 5AG6A 3UY5A 2QECA 1Z8XA 4CYPA 1Y0RA 2NSMA 3FECA 5J1QA 4L89A 5A27A 1NE9A 2AFMA 1YVKA 3D7GA 2R1IA 4M3SA 4FD7A 3I3GA 4LQ6A 5IB0A 2GREA 4KOXA 1FY7A 2JEVA 1U6MA 1HDQA 5LYLA 3ISZA 3SI2A 3CZXA 2F5IA 3P2FA 3S6KA 3R96A 4KOVA 1CG2A 3PGPA 2BSWA
chains in the Genus database with same CATH topology
1DTDA 4A38A 2BOAA 1FNOA 4ZY2A 4R8FA 1LCPA 1TF9A 1ZLHA 4DUKA 1LAPA 1Y7EA 2ZEPA 3KHZA 4P4FA 5LYFA 4OC0A 3PFOA 3VARA 1TKHA 4MCQA 4UEFA 1IY7A 4YU9A 4UIAA 3D7FA 1CBXA 3PBBA 2XEGA 3PB7X 4P4EA 4A37A 4NGNA 5DS0A 2PJ6A 2PJ5A 2Q51A 2PJ8A 3T8WA 2IJZA 4TNUA 4NGMA 1BPMA 1R3NA 5THWA 4GM5A 1Z5RA 4FAIA 2ZEHA 1LAMA 3B3SA 2IMOA 4AXVA 4FBEA 2ZEFA 3KR4A 2ABZA 3BI0A 4X8IA 1EE3P 1NSAA 3TX8A 4OMEA 2AFUA 2PE3A 2XEJA 5IB9A 2VL1A 3KR5A 2JBKA 5JM6A 4O23A 3BHXA 3B3WA 4P4DA 1VHEA 5K8MA 3D7HA 1HDUA 4JYWA 1CPSA 3WC7A 4OP4A 4W9YA 4IAVA 2V8HA 4UEEA 5LRJA 3S9NA 2C6PA 1XMBA 4PXEA 2BO9A 1XBUA 4MHNA 2WYRA 1ZG9A 3IWWA 1BAVA 2V77A 3D66A 3L2NA 3D4UA 5ELYA 3PEIA 4NJRA 2PIZA 4MHYA 4OIDA 5LYIA 4ZX8A 4RUHA 2FVGA 2JBJA 2CF4A 5LRGA 2PVVA 7CPAA 1ZG7A 2QVPA 4EWTA 4A94A 2RB7A 4P4IA 4X2TA 2F8HA 4EFDA 3FMCA 4MMOA 2PJ9A 2QYVA 3N5FA 1YW6A 1DE4C 5D8NA 4UEZA 3SJEA 3D67A 3PB9X 4MCPA 5LRKA 4R76A 4BD9A 1R43A 1BLLE 2PJCA 1YMEA 1OBRA 1PYTB 1QMUA 3JRUA 3FEDA 1H8LA 1Q7LA 3SJXA 3H8FA 2AFOA 4B6ZA 5CBMA 1HEEA 1M4LA 5I4MA 4K3NA 4CPAA 1ZG8A 5CPAA 1YW4A 2CTBA 4ZY1A 2ZEOA 4OC3A 4TWEA 3S9LA 1AYEA 2J9AA 4NJQA 2PJ1A 3IIBA 1TKJA 1LFWA 1VGYA 4OIWA 3IO1A 1PCAA 2BCOA 4F8ZA 4FUUA 3PRTA 3SI0A 2ZEDA 1F57A 2PCUA 1ARMA 3VH9A 1KWMA 2ZOGA 1ELLP 4ZX9A 4MHPA 3D7DA 4P6YA 2JEWA 3H8GA 3KL9A 2XEFA 1Z8LA 4PXBA 1Z2LA 4MHZA 3PFEA 4UF4A 2V8GA 2IQ6A 1BPNA 4R6TA 5LYDA 3GUXA 5HVHA 4OC1A 3VATA 2F7VA 3KQXA 3TC8A 4NGQA 2AFWA 3WC6A 2ZENA 4LQGA 4ZYQA 2PJ7A 4P4JA 2PIYA 3NFZA 4P4BA 2C1CA 1FT7A 4P44A 5HXDA 2EK9A 3FVLA 4KSIA 4PXCA 2GLJA 2PJ4A 2DEAA 3IC1A 1LOKA 2PRQA 1ZLIA 1YLOA 3B35A 3PB8X 2PJAA 3FEEA 1ARLA 2C6GA 3KZWA 3S9MA 3K9TA 5K8OA 3KASA 2O4HA 2ZEEA 3MN8A 3IJ3A 4H2KA 2V8DA 2G9DA 3NA6A 3KI9A 3SI1A 3RBUA 4DJLA 4WWVA 8CPAA 2Q43A 3WABA 2EWBA 4EMEA 2ZOFA 4NGPA 4P10A 1UWYA 3NH4A 4OC2A 3NH5A 3CT9A 2O53A 4R7MA 3RAMA 2RFHA 4IHMA 2ZELA 2CIJA 4PQAA 5K8NA 4NGRA 3IEHA 1VHOA 3KGQA 3KHXA 3WC5A 3ISXA 2Q4ZA 1RTQA 3B7IA 1XFOA 2GLFA 1TXRA 3FX6A 2PJBA 4ZY0A 3PB4X 2EK8A 5HVFA 5K8PA 4MXUA 1CPXA 3CPXA 2NYQA 5F09A 1XJOA 3GB0A 4F9VA 3MRUA 2XEIA 1IGBA 4ONWA 1ELMP 2ZEMA 3SJFA 4OC4A 5HVGA 3FJUA 2QJ8A 3PB6X 5D29A 2AFXA 4X3RA 3H8EA 3V7ZA 3QNVA 4G1PA 6CPAA 2WZNA 3CPAA 1XRYA 4UIBA 1TF8A 1CX8A 3FF3A 1Y0YA 2AFZA 2AFSA 1QQ9A 3HUVA 4JZ0A 2POKA 3D68A 2V8VA 3B3TA 3BXMA 4P45A 1YSJA 3BI1A 4IK2A 5JH9A 2PJ3A 3IFEA 4NGSA 1TKFA 4FWUA 3GLJA 4OC5A 2GU2A 2ANPA 5JGFA 2PJ2A 1GYTA 3B2YA 2PVWA 1CP6A 2HC9A 3LWUA 3DGVA 4MRIA 4NFRA 1LANA 4Z65A 2OOTA 1AMPA 4PXDA 3V38A 4F9UA 3B3CA 4ZI6A 4NGTA 2ZEGA 2PJ0A 3LMSA 3HLPA 4A39A 3KQZA 1JQGA 3FH4A 3CDXA 3SJGA 2C6CA 3DLJA 2OR4A 2I3CA 4MCRA 1VIXA 4DYOA 3RZAA 3WT4A 3PBEA 1F2OA 3K2KA 3NH8A 4OKOA 3I1UA 4WJBA 2HB6A 3B3VA 4YWYA 2CTCA 4PPZA 4Q7AA 1CP7A 4MCSA 1F2PA 1Y0RA 2NSMA 3FECA 5J1QA 2AFMA 3D7GA 2GREA 1HDQA 5LYLA 3ISZA 3SI2A 1CG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DTD A;  4A38 A;  2BOA A;  1FNO A;  4ZY2 A;  4R8F A;  1LCP A;  1TF9 A;  1ZLH A;  4DUK A;  1LAP A;  1Y7E A;  2ZEP A;  3KHZ A;  4P4F A;  5LYF A;  4OC0 A;  3PFO A;  3VAR A;  1TKH A;  4MCQ A;  4UEF A;  1IY7 A;  4YU9 A;  4UIA A;  3D7F A;  1CBX A;  3PBB A;  2XEG A;  3PB7 X;  4P4E A;  4A37 A;  4NGN A;  5DS0 A;  2PJ6 A;  2PJ5 A;  2Q51 A;  2PJ8 A;  3T8W A;  2IJZ A;  4TNU A;  4NGM A;  1BPM A;  1R3N A;  5THW A;  4GM5 A;  1Z5R A;  4FAI A;  2ZEH A;  1LAM A;  3B3S A;  2IMO A;  4AXV A;  4FBE A;  2ZEF A;  3KR4 A;  2ABZ A;  3BI0 A;  4X8I A;  1EE3 P;  1NSA A;  3TX8 A;  4OME A;  2AFU A;  2PE3 A;  2XEJ A;  5IB9 A;  2VL1 A;  3KR5 A;  2JBK A;  5JM6 A;  4O23 A;  3BHX A;  3B3W A;  4P4D A;  1VHE A;  5K8M A;  3D7H A;  1HDU A;  4JYW A;  1CPS A;  3WC7 A;  4OP4 A;  4W9Y A;  4IAV A;  2V8H A;  4UEE A;  5LRJ A;  3S9N A;  2C6P A;  1XMB A;  4PXE A;  2BO9 A;  1XBU A;  4MHN A;  2WYR A;  1ZG9 A;  3IWW A;  1BAV A;  2V77 A;  3D66 A;  3L2N A;  3D4U A;  5ELY A;  3PEI A;  4NJR A;  2PIZ A;  4MHY A;  4OID A;  5LYI A;  4ZX8 A;  4RUH A;  2FVG A;  2JBJ A;  2CF4 A;  5LRG A;  2PVV A;  7CPA A;  1ZG7 A;  2QVP A;  4EWT A;  4A94 A;  2RB7 A;  4P4I A;  4X2T A;  2F8H A;  4EFD A;  3FMC A;  4MMO A;  2PJ9 A;  2QYV A;  3N5F A;  1YW6 A;  1DE4 C;  5D8N A;  4UEZ A;  3SJE A;  3D67 A;  3PB9 X;  4MCP A;  5LRK A;  4R76 A;  4BD9 A;  1R43 A;  1BLL E;  2PJC A;  1YME A;  1OBR A;  1PYT B;  1QMU A;  3JRU A;  3FED A;  1H8L A;  1Q7L A;  3SJX A;  3H8F A;  2AFO A;  4B6Z A;  5CBM A;  1HEE A;  1M4L A;  5I4M A;  4K3N A;  4CPA A;  1ZG8 A;  5CPA A;  1YW4 A;  2CTB A;  4ZY1 A;  2ZEO A;  4OC3 A;  4TWE A;  3S9L A;  1AYE A;  2J9A A;  4NJQ A;  2PJ1 A;  3IIB A;  1TKJ A;  1LFW A;  1VGY A;  4OIW A;  3IO1 A;  1PCA A;  2BCO A;  4F8Z A;  4FUU A;  3PRT A;  3SI0 A;  2ZED A;  1F57 A;  2PCU A;  1ARM A;  3VH9 A;  1KWM A;  2ZOG A;  1ELL P;  4ZX9 A;  4MHP A;  3D7D A;  4P6Y A;  2JEW A;  3H8G A;  3KL9 A;  2XEF A;  1Z8L A;  4PXB A;  1Z2L A;  4MHZ A;  3PFE A;  4UF4 A;  2V8G A;  2IQ6 A;  1BPN A;  4R6T A;  5LYD A;  3GUX A;  5HVH A;  4OC1 A;  3VAT A;  2F7V A;  3KQX A;  3TC8 A;  4NGQ A;  2AFW A;  3WC6 A;  2ZEN A;  4LQG A;  4ZYQ A;  2PJ7 A;  4P4J A;  2PIY A;  3NFZ A;  4P4B A;  2C1C A;  1FT7 A;  4P44 A;  5HXD A;  2EK9 A;  3FVL A;  4KSI A;  4PXC A;  2GLJ A;  2PJ4 A;  2DEA A;  3IC1 A;  1LOK A;  2PRQ A;  1ZLI A;  1YLO A;  3B35 A;  3PB8 X;  2PJA A;  3FEE A;  1ARL A;  2C6G A;  3KZW A;  3S9M A;  3K9T A;  5K8O A;  3KAS A;  2O4H A;  2ZEE A;  3MN8 A;  3IJ3 A;  4H2K A;  2V8D A;  2G9D A;  3NA6 A;  3KI9 A;  3SI1 A;  3RBU A;  4DJL A;  4WWV A;  8CPA A;  2Q43 A;  3WAB A;  2EWB A;  4EME A;  2ZOF A;  4NGP A;  4P10 A;  1UWY A;  3NH4 A;  4OC2 A;  3NH5 A;  3CT9 A;  2O53 A;  4R7M A;  3RAM A;  2RFH A;  4IHM A;  2ZEL A;  2CIJ A;  4PQA A;  5K8N A;  4NGR A;  3IEH A;  1VHO A;  3KGQ A;  3KHX A;  3WC5 A;  3ISX A;  2Q4Z A;  1RTQ A;  3B7I A;  1XFO A;  2GLF A;  1TXR A;  3FX6 A;  2PJB A;  4ZY0 A;  3PB4 X;  2EK8 A;  5HVF A;  5K8P A;  4MXU A;  1CPX A;  3CPX A;  2NYQ A;  5F09 A;  1XJO A;  3GB0 A;  4F9V A;  3MRU A;  2XEI A;  1IGB A;  4ONW A;  1ELM P;  2ZEM A;  3SJF A;  4OC4 A;  5HVG A;  3FJU A;  2QJ8 A;  3PB6 X;  5D29 A;  2AFX A;  4X3R A;  3H8E A;  3V7Z A;  3QNV A;  4G1P A;  6CPA A;  2WZN A;  3CPA A;  1XRY A;  4UIB A;  1TF8 A;  1CX8 A;  3FF3 A;  1Y0Y A;  2AFZ A;  2AFS A;  1QQ9 A;  3HUV A;  4JZ0 A;  2POK A;  3D68 A;  2V8V A;  3B3T A;  3BXM A;  4P45 A;  1YSJ A;  3BI1 A;  4IK2 A;  5JH9 A;  2PJ3 A;  3IFE A;  4NGS A;  1TKF A;  4FWU A;  3GLJ A;  4OC5 A;  2GU2 A;  2ANP A;  5JGF A;  2PJ2 A;  1GYT A;  3B2Y A;  2PVW A;  1CP6 A;  2HC9 A;  3LWU A;  3DGV A;  4MRI A;  4NFR A;  1LAN A;  4Z65 A;  2OOT A;  1AMP A;  4PXD A;  3V38 A;  4F9U A;  3B3C A;  4ZI6 A;  4NGT A;  2ZEG A;  2PJ0 A;  3LMS A;  3HLP A;  4A39 A;  3KQZ A;  1JQG A;  3FH4 A;  3CDX A;  3SJG A;  2C6C A;  3DLJ A;  2OR4 A;  2I3C A;  4MCR A;  1VIX A;  4DYO A;  3RZA A;  3WT4 A;  3PBE A;  1F2O A;  3K2K A;  3NH8 A;  4OKO A;  3I1U A;  4WJB A;  2HB6 A;  3B3V A;  4YWY A;  2CTC A;  4PPZ A;  4Q7A A;  1CP7 A;  4MCS A;  1F2P A;  1Y0R A;  2NSM A;  3FEC A;  5J1Q A;  2AFM A;  3D7G A;  2GRE A;  1HDQ A;  5LYL A;  3ISZ A;  3SI2 A;  1CG2 A; 
#chains in the Genus database with same CATH topology
 1DTD A;  4A38 A;  2BOA A;  1FNO A;  2HUZ A;  5EMI A;  4ZY2 A;  4R8F A;  1LCP A;  4AB7 A;  1TF9 A;  4R3L A;  2FT0 A;  1ZLH A;  2D4O A;  4DUK A;  2Z11 A;  4AG9 A;  1LAP A;  1Y7E A;  2ZEP A;  3KHZ A;  4P4F A;  4CGP A;  4CGN A;  5LYF A;  2NMT A;  4KOT A;  4OC0 A;  3PFO A;  2FXF A;  2B4D B;  3G3S A;  1BOB A;  3TOB A;  3VAR A;  1TKH A;  2B4B A;  4MCQ A;  4UEF A;  1IY7 A;  1XE4 A;  2ZW7 A;  1XEB A;  2B3U A;  4YU9 A;  3I9S A;  4UIA A;  3DDD A;  3D7F A;  4ONU A;  1CBX A;  3PBB A;  2XEG A;  2D4P A;  3PB7 X;  4P4E A;  5F47 A;  4NGN A;  5DS0 A;  1I21 A;  4A37 A;  4LUA A;  2PJ6 A;  1B87 A;  4B5P A;  2PJ5 A;  2Q51 A;  2PJ8 A;  3IU2 A;  4CGL A;  3T8W A;  2IJZ A;  3E0K A;  4TNU A;  2P6E A;  4NGM A;  4A31 A;  1BPM A;  4HNY B;  1R3N A;  5H84 A;  4KUB A;  5THW A;  4GM5 A;  3ZJ0 A;  2P6G A;  4A32 A;  1Z5R A;  4FAI A;  5AGE A;  2HQY A;  2ZEH A;  1LAM A;  1CM0 A;  4KUA A;  3B3S A;  5F48 A;  2IMO A;  4AXV A;  4FBE A;  3VWE A;  3D2M A;  2ZEF A;  3KR4 A;  2ABZ A;  3BI0 A;  1TIQ A;  3IGR A;  1KZF A;  4X8I A;  2Z3K A;  1EE3 P;  1NSA A;  1YK3 A;  2CNT A;  3EFA A;  2AFU A;  2PE3 A;  2WPW A;  2XEJ A;  4KLV A;  4OME A;  2VL1 A;  4H6U A;  5IB9 A;  4X5K A;  3KR5 A;  2JBK A;  5JM6 A;  1Z4R A;  2AJ6 A;  1B6B A;  4O23 A;  2FS5 A;  1Y7R A;  1NMT A;  1M4G A;  2WSA A;  2R7H A;  3BHX A;  4XNH B;  3B3W A;  3A9L A;  4P4D A;  2ZW4 A;  1VHE A;  4MFP A;  1VKC A;  4C7I A;  5K8M A;  2QIR A;  3D7H A;  4RI1 A;  4UCM A;  1HDU A;  2G3A A;  4JYW A;  4R3K A;  4XNH C;  1IOF A;  1CPS A;  1Q2Y A;  2PQ8 A;  3WC7 A;  2Z3M A;  1I1D A;  4OP4 A;  4W9Y A;  4IAV A;  2V8H A;  4UEE A;  5LRJ A;  3S9N A;  3SHP A;  2C6P A;  1XMB A;  4QUS A;  4KS9 A;  3DNS A;  2B5G B;  4PXE A;  2DPS A;  2BO9 A;  1XBU A;  4MHN A;  2WYR A;  2VI7 A;  2Q04 A;  5KTA A;  1Z4E A;  4BBH A;  1ZG9 A;  3JUW A;  3IWW A;  1BAV A;  2Q7S A;  2V77 A;  2Z10 A;  1IU8 A;  4AVA A;  3D66 A;  3L2N A;  3D4U A;  2DPT A;  4OAD A;  2CNM A;  2Q4Y A;  3JTK A;  3PEI A;  4NJR A;  5ELY A;  2YNC A;  1Z8W A;  2REE A;  4CYN A;  2PIZ A;  4MHY A;  3DR8 A;  3R9E A;  3RYO A;  1ON0 A;  4OID A;  2BL1 A;  4F6A A;  4KSF A;  2REF A;  5LYI A;  4CGM A;  3D2P A;  4ZX8 A;  3R9F A;  4RUH A;  2FVG A;  2JBJ A;  5AG4 A;  2CF4 A;  5LRG A;  2PVV A;  5I0C A;  1Q2D A;  2OH1 A;  5DWN A;  3H5Z A;  7CPA A;  1XOV A;  5J8F A;  4JWP A;  4B14 A;  4Y49 B;  2GE3 A;  1ZG7 A;  3EO4 A;  3TO9 A;  1BO4 A;  1R57 A;  4NCZ A;  3TX8 A;  4NEX A;  2QVP A;  1Y9W A;  4EWT A;  4A94 A;  2JDD A;  4Y49 C;  2EO8 A;  2RB7 A;  4P4I A;  3PP9 A;  2F8H A;  4X2T A;  5J8C A;  3N7Z A;  4QC6 A;  4HNX B;  4JJX A;  1XMT A;  3R95 A;  4EFD A;  3FMC A;  4H6Z A;  1OZP A;  4QB9 A;  4MMO A;  2PJ9 A;  2QYV A;  3BJ8 A;  3TT2 A;  3N5F A;  1YLE A;  4I49 A;  4MY3 A;  5KTC A;  3TO6 A;  4U9Y A;  1YW6 A;  4KVO E;  3W91 A;  4C68 A;  1DE4 C;  2Z3N A;  4A2Z A;  1Q2C A;  5D8N A;  4UEZ A;  1YRE A;  2HV2 A;  3S6G A;  3SJE A;  4JXR A;  3D67 A;  3PB9 X;  4KOS A;  4MCP A;  5LRK A;  4R76 A;  4B5P B;  3K9U A;  4F0Y A;  4BD9 A;  1R43 A;  1SQH A;  2VBQ A;  4B10 A;  1BLL E;  3EC4 A;  2PJC A;  1YME A;  2B3V A;  3S6F A;  2KCW A;  2H5M A;  1OBR A;  2I00 A;  2FE7 A;  1PYT B;  4LX9 A;  1QMU A;  3JRU A;  1S7F A;  4KLW A;  1PU9 A;  5AG5 A;  3FED A;  1NSL A;  2OZG A;  4QVT A;  1H8L A;  1Q7L A;  5CNP A;  3SJX A;  3H8F A;  2AFO A;  4B6Z A;  2P6F A;  5AG7 A;  5JQ4 A;  5CBM A;  1HEE A;  1RO5 A;  1S7N A;  4CAF A;  3R9G A;  1M4L A;  5I4M A;  2JLM A;  4K3N A;  4HKF A;  3CXQ A;  4C7H A;  4CPA A;  1ZG8 A;  4JXQ A;  3KKW A;  5CPA A;  4CRY B;  1YW4 A;  3GIU A;  4NSQ A;  2EVN A;  2CTB A;  4ZY1 A;  4XPK A;  5G21 A;  4B11 A;  2WPX A;  2ZEO A;  4HNW B;  2P0W A;  2PR8 A;  3C26 A;  4M6I A;  3B8G A;  4OC3 A;  5H86 A;  5IV0 A;  4NXY A;  4M6H A;  2B58 A;  4OLL A;  4TWE A;  1AYE A;  2J9A A;  3S6H A;  3S9L A;  4NJQ A;  4MY0 A;  2PJ1 A;  4CAE A;  3IIB A;  4M85 A;  1KUY A;  1TKJ A;  2DF5 A;  2CNS A;  1Y9K A;  3W6S A;  1LFW A;  4MFQ A;  1VGY A;  4OIW A;  3IO1 A;  1PCA A;  2BCO A;  4F8Z A;  3R1K A;  1J4J A;  3PRT A;  4FUU A;  4B5O A;  3CXS A;  4PK3 A;  4MFL A;  3SI0 A;  2ZED A;  1IIC A;  1F57 A;  3H4Q A;  4BIN A;  2PCU A;  2PSW A;  1ARM A;  4H89 A;  1P4N A;  3VH9 A;  1KWM A;  2ZOG A;  1ELL P;  2JDC A;  4ZX9 A;  4MHP A;  4MFK A;  3D7D A;  4MI4 A;  4MBU A;  3TO7 A;  3ZZI A;  4P6Y A;  1VHS A;  2JEW A;  2I79 A;  2PDO A;  1YGH A;  4CGO A;  4IUS A;  3H8G A;  4KOW A;  3GYA A;  4RS2 A;  3KL9 A;  2XEF A;  1Z8L A;  4PXB A;  1LRZ A;  1Z2L A;  4MHZ A;  3PFE A;  4ORF A;  2V8G A;  2IQ6 A;  1BPN A;  1WWZ A;  4R6T A;  4Q38 A;  4UF4 A;  1QSO A;  3MGD A;  5LYD A;  1IID A;  2YNC C;  3GUX A;  3RO0 A;  4F0X A;  5C88 A;  5HVH A;  4OC1 A;  3VAT A;  2F7V A;  2FIA A;  3TFY A;  4KOR A;  3KQX A;  4MFZ A;  3TCV A;  3DR6 A;  4PK2 A;  3TC8 A;  1IB1 E;  4UA3 A;  4KVM E;  2AFW A;  4NGQ A;  3WC6 A;  4AVC A;  4CAX A;  2ZEN A;  2Z3P A;  2IL4 A;  1M4D A;  3GKR A;  3IWG A;  1YVO A;  4YRH A;  2J8R A;  4LQG A;  4ZYQ A;  2PJ7 A;  2WUU A;  4P4J A;  2ZW6 A;  5KTD A;  2PIY A;  3NFZ A;  4P4B A;  2C1C A;  1FT7 A;  2G0B A;  4C2Y A;  2PR1 A;  2ZPA A;  4P44 A;  5HXD A;  5GCN A;  2QML A;  2Y0M A;  2YND A;  2EK9 A;  3FVL A;  4KSI A;  3G8W A;  4U5Y A;  2ZXV A;  4KSA A;  2BUE A;  4E0A A;  3GY9 A;  5EBV A;  2VZY A;  2GLJ A;  3QAH A;  2EBJ A;  2PJ4 A;  2YNE A;  4PXC A;  1QSR A;  2YGW A;  2CY2 A;  1UFH A;  1M1D A;  4GS4 A;  3BJ7 A;  2DEA A;  3IC1 A;  5G1Z A;  4A95 A;  3RNZ A;  1LOK A;  3FXT A;  5G20 A;  2PRQ A;  1S3Z A;  1ZLI A;  1XIX A;  3EXN A;  4J3G A;  2FSR A;  1S5K A;  1YLO A;  1CJW A;  3B35 A;  3P2H A;  3PB8 X;  5FVJ A;  2PJA A;  2O28 A;  4BMH A;  3FEE A;  2Q44 A;  4RN7 A;  2A4N A;  1ARL A;  3F0A A;  2C6G A;  3KZW A;  2PC1 A;  3S9M A;  3K9T A;  5K8O A;  4E8O A;  5A28 A;  3FYN A;  3OWC A;  3JVN A;  3KAS A;  2O4H A;  2ZEE A;  3VWD A;  2RC4 A;  3MN8 A;  3TE4 A;  3IJ3 A;  2Z3L A;  4H2K A;  2J8N A;  2V8D A;  2G9D A;  4YFJ A;  3QB8 A;  3NA6 A;  5JPH A;  3KI9 A;  4PSX A;  3EY5 A;  4CAV A;  3SI1 A;  4UFX A;  1S60 A;  1X10 A;  4II9 A;  2FL4 A;  3RBU A;  4DJL A;  4WWV A;  8CPA A;  4UWI A;  2Q43 A;  3SXO A;  3WAB A;  3WR7 A;  2EWB A;  2PRB A;  4EME A;  2ZOF A;  4NGP A;  4P10 A;  1MK4 A;  1UWY A;  2VXK A;  3NH4 A;  3NH5 A;  4JLY A;  4OC2 A;  3CT9 A;  2O53 A;  2ODF A;  1ZO0 A;  4R7M A;  2GFQ A;  3RAM A;  2RFH A;  4IHM A;  2ZEL A;  4B12 A;  2CIJ A;  4CYO A;  4PQA A;  1MJA A;  5K8N A;  4FD5 A;  4NGR A;  3IEH A;  1VHO A;  3KGQ A;  3KHX A;  4R87 A;  3WC5 A;  3ISX A;  4R57 A;  2Q4Z A;  1RTQ A;  3B7I A;  4AVB A;  2EUI A;  1XFO A;  3DSB A;  3TOA A;  2GLF A;  4MJ8 A;  3BLN A;  3TTH A;  2BEI A;  3QAY A;  1TXR A;  3FB3 A;  3FX6 A;  2PJB A;  4ZY0 A;  3PB4 X;  5F46 A;  2EK8 A;  5HVF A;  5K8P A;  4MXU A;  1CPX A;  1A2Z A;  1KUX A;  3FIX A;  2Q4V A;  4Q36 A;  2X7B A;  3CPX A;  2NYQ A;  3FRM A;  3NE7 A;  5F09 A;  1IOI A;  4C2X A;  1XJO A;  4KOU A;  4C2Z A;  3GB0 A;  4UFV A;  4F9V A;  3MRU A;  4GXH A;  2J8M A;  2XEI A;  1IGB A;  4R9M A;  4ONW A;  3V8I A;  5HMN A;  4FD4 A;  1ELM P;  2ZEM A;  2GIV A;  4OC4 A;  3SJF A;  1QST A;  3FJU A;  2QJ8 A;  4AG7 A;  5HVG A;  3PB6 X;  4ZGY B;  4FD6 A;  5D29 A;  4HPS A;  2Q7B A;  5ISV A;  2AFX A;  4CS0 B;  1V0C A;  3IWE A;  1Z9U A;  4X3R A;  3H8E A;  4MFJ A;  4E2A A;  1IYK A;  3V7Z A;  3QNV A;  4G1P A;  6CPA A;  2WZN A;  4KVX A;  2ATR A;  2FCK A;  1I12 A;  2VZZ A;  3T9Y A;  2OZU A;  4XPL A;  3CPA A;  4IF5 A;  1N71 A;  1XRY A;  1TF8 A;  1CX8 A;  1YX0 A;  3D3S A;  3FF3 A;  4UIB A;  1K4J A;  4YGO A;  4UBR A;  1Y0Y A;  2AFZ A;  2B4D A;  2AFS A;  1QQ9 A;  3HUV A;  5C82 A;  1AUG A;  4NF1 A;  4JZ0 A;  2POK A;  3D68 A;  4UCP A;  2OU2 A;  4XPD B;  2V8V A;  2Z3O A;  1GHE A;  1QSM A;  2Q0Y A;  3B3T A;  3BXM A;  4P45 A;  1YSJ A;  3BI1 A;  4IK2 A;  3LAC A;  1M44 A;  2FIW A;  4M6G A;  4B13 A;  5JH9 A;  2PJ3 A;  4XPD C;  3IFE A;  3NE8 A;  4NGS A;  5E96 A;  1TKF A;  1S7K A;  2R8V A;  4FWU A;  3GLJ A;  4OC5 A;  5EC4 A;  2GU2 A;  4EVY A;  4U9Z A;  4KZT A;  5G22 A;  2ANP A;  1WK4 A;  5JGF A;  2VQY A;  2K5T A;  1GYT A;  2ARH A;  2PJ2 A;  3B2Y A;  4KOY A;  4OAE A;  2PVW A;  4UFW A;  4A33 A;  5IX3 A;  1CP6 A;  2HC9 A;  3LWU A;  3DGV A;  1QSN A;  2DXQ A;  4K30 A;  4MRI A;  1LAN A;  4NFR A;  3IU1 A;  4Z65 A;  2VEZ A;  2OOT A;  1AMP A;  4PXD A;  3V38 A;  1P0H A;  4F9U A;  3D8P A;  3B3C A;  3CXP A;  4ZI6 A;  1MJB A;  4NGT A;  4CRZ B;  3F5B A;  2ZEG A;  2PJ0 A;  3LMS A;  2OB0 A;  3F8K A;  3HLP A;  5HH1 A;  4A39 A;  3KQZ A;  4A30 A;  1JQG A;  1XF8 A;  3FH4 A;  4ZBG A;  3CDX A;  3SJG A;  2C6C A;  1IYL A;  3DLJ A;  5F49 A;  2OR4 A;  2I3C A;  2ZW5 A;  4UCN A;  4CAW A;  4MCR A;  3PZJ A;  3W6X A;  2G3T A;  4PSW A;  4DNC A;  3LD2 A;  5BWA B;  3T90 A;  3FNC A;  1VIX A;  4L8A A;  2GAN A;  5DWM A;  4DYO A;  3RZA A;  4UWJ A;  3WT4 A;  1PUA A;  3PBE A;  2AE6 A;  4QBJ A;  3FBU A;  2R98 A;  1F2O A;  4JD6 A;  2C27 A;  1RXT A;  3K2K A;  3NH8 A;  4OKO A;  4MHD A;  3I1U A;  1YR0 A;  2OZH A;  4WJB A;  2B5G A;  2HB6 A;  3B3V A;  4YWY A;  4PV6 A;  3SXN A;  4CYQ A;  2CXA A;  3LOD A;  2CTC A;  1KUV A;  1YQE A;  4PPZ A;  1Z8T A;  4Q7A A;  1CP7 A;  1L0C A;  2Z0Z A;  1JWQ A;  1M4I A;  1MJ9 A;  1F2P A;  1S7L A;  1X12 A;  4MCS A;  5AG6 A;  3UY5 A;  2QEC A;  1Z8X A;  4CYP A;  1Y0R A;  2NSM A;  3FEC A;  5J1Q A;  4L89 A;  5A27 A;  1NE9 A;  2AFM A;  1YVK A;  3D7G A;  2R1I A;  4M3S A;  4FD7 A;  3I3G A;  4LQ6 A;  5IB0 A;  2GRE A;  4KOX A;  1FY7 A;  2JEV A;  1U6M A;  1HDQ A;  5LYL A;  3ISZ A;  3SI2 A;  3CZX A;  2F5I A;  3P2F A;  3S6K A;  3R96 A;  4KOV A;  1CG2 A;  3PGP A;  2BSW A; 
#chains in the Genus database with same CATH homology
 1DTD A;  4A38 A;  2BOA A;  1FNO A;  4ZY2 A;  4R8F A;  1LCP A;  1TF9 A;  1ZLH A;  4DUK A;  1LAP A;  1Y7E A;  2ZEP A;  3KHZ A;  4P4F A;  5LYF A;  4OC0 A;  3PFO A;  3VAR A;  1TKH A;  4MCQ A;  4UEF A;  1IY7 A;  4YU9 A;  4UIA A;  3D7F A;  1CBX A;  3PBB A;  2XEG A;  3PB7 X;  4P4E A;  4A37 A;  4NGN A;  5DS0 A;  2PJ6 A;  2PJ5 A;  2Q51 A;  2PJ8 A;  3T8W A;  2IJZ A;  4TNU A;  4NGM A;  1BPM A;  1R3N A;  5THW A;  4GM5 A;  1Z5R A;  4FAI A;  2ZEH A;  1LAM A;  3B3S A;  2IMO A;  4AXV A;  4FBE A;  2ZEF A;  3KR4 A;  2ABZ A;  3BI0 A;  4X8I A;  1EE3 P;  1NSA A;  3TX8 A;  4OME A;  2AFU A;  2PE3 A;  2XEJ A;  5IB9 A;  2VL1 A;  3KR5 A;  2JBK A;  5JM6 A;  4O23 A;  3BHX A;  3B3W A;  4P4D A;  1VHE A;  5K8M A;  3D7H A;  1HDU A;  4JYW A;  1CPS A;  3WC7 A;  4OP4 A;  4W9Y A;  4IAV A;  2V8H A;  4UEE A;  5LRJ A;  3S9N A;  2C6P A;  1XMB A;  4PXE A;  2BO9 A;  1XBU A;  4MHN A;  2WYR A;  1ZG9 A;  3IWW A;  1BAV A;  2V77 A;  3D66 A;  3L2N A;  3D4U A;  5ELY A;  3PEI A;  4NJR A;  2PIZ A;  4MHY A;  4OID A;  5LYI A;  4ZX8 A;  4RUH A;  2FVG A;  2JBJ A;  2CF4 A;  5LRG A;  2PVV A;  7CPA A;  1ZG7 A;  2QVP A;  4EWT A;  4A94 A;  2RB7 A;  4P4I A;  4X2T A;  2F8H A;  4EFD A;  3FMC A;  4MMO A;  2PJ9 A;  2QYV A;  3N5F A;  1YW6 A;  1DE4 C;  5D8N A;  4UEZ A;  3SJE A;  3D67 A;  3PB9 X;  4MCP A;  5LRK A;  4R76 A;  4BD9 A;  1R43 A;  1BLL E;  2PJC A;  1YME A;  1OBR A;  1PYT B;  1QMU A;  3JRU A;  3FED A;  1H8L A;  1Q7L A;  3SJX A;  3H8F A;  2AFO A;  4B6Z A;  5CBM A;  1HEE A;  1M4L A;  5I4M A;  4K3N A;  4CPA A;  1ZG8 A;  5CPA A;  1YW4 A;  2CTB A;  4ZY1 A;  2ZEO A;  4OC3 A;  4TWE A;  3S9L A;  1AYE A;  2J9A A;  4NJQ A;  2PJ1 A;  3IIB A;  1TKJ A;  1LFW A;  1VGY A;  4OIW A;  3IO1 A;  1PCA A;  2BCO A;  4F8Z A;  4FUU A;  3PRT A;  3SI0 A;  2ZED A;  1F57 A;  2PCU A;  1ARM A;  3VH9 A;  1KWM A;  2ZOG A;  1ELL P;  4ZX9 A;  4MHP A;  3D7D A;  4P6Y A;  2JEW A;  3H8G A;  3KL9 A;  2XEF A;  1Z8L A;  4PXB A;  1Z2L A;  4MHZ A;  3PFE A;  4UF4 A;  2V8G A;  2IQ6 A;  1BPN A;  4R6T A;  5LYD A;  3GUX A;  5HVH A;  4OC1 A;  3VAT A;  2F7V A;  3KQX A;  3TC8 A;  4NGQ A;  2AFW A;  3WC6 A;  2ZEN A;  4LQG A;  4ZYQ A;  2PJ7 A;  4P4J A;  2PIY A;  3NFZ A;  4P4B A;  2C1C A;  1FT7 A;  4P44 A;  5HXD A;  2EK9 A;  3FVL A;  4KSI A;  4PXC A;  2GLJ A;  2PJ4 A;  2DEA A;  3IC1 A;  1LOK A;  2PRQ A;  1ZLI A;  1YLO A;  3B35 A;  3PB8 X;  2PJA A;  3FEE A;  1ARL A;  2C6G A;  3KZW A;  3S9M A;  3K9T A;  5K8O A;  3KAS A;  2O4H A;  2ZEE A;  3MN8 A;  3IJ3 A;  4H2K A;  2V8D A;  2G9D A;  3NA6 A;  3KI9 A;  3SI1 A;  3RBU A;  4DJL A;  4WWV A;  8CPA A;  2Q43 A;  3WAB A;  2EWB A;  4EME A;  2ZOF A;  4NGP A;  4P10 A;  1UWY A;  3NH4 A;  4OC2 A;  3NH5 A;  3CT9 A;  2O53 A;  4R7M A;  3RAM A;  2RFH A;  4IHM A;  2ZEL A;  2CIJ A;  4PQA A;  5K8N A;  4NGR A;  3IEH A;  1VHO A;  3KGQ A;  3KHX A;  3WC5 A;  3ISX A;  2Q4Z A;  1RTQ A;  3B7I A;  1XFO A;  2GLF A;  1TXR A;  3FX6 A;  2PJB A;  4ZY0 A;  3PB4 X;  2EK8 A;  5HVF A;  5K8P A;  4MXU A;  1CPX A;  3CPX A;  2NYQ A;  5F09 A;  1XJO A;  3GB0 A;  4F9V A;  3MRU A;  2XEI A;  1IGB A;  4ONW A;  1ELM P;  2ZEM A;  3SJF A;  4OC4 A;  5HVG A;  3FJU A;  2QJ8 A;  3PB6 X;  5D29 A;  2AFX A;  4X3R A;  3H8E A;  3V7Z A;  3QNV A;  4G1P A;  6CPA A;  2WZN A;  3CPA A;  1XRY A;  4UIB A;  1TF8 A;  1CX8 A;  3FF3 A;  1Y0Y A;  2AFZ A;  2AFS A;  1QQ9 A;  3HUV A;  4JZ0 A;  2POK A;  3D68 A;  2V8V A;  3B3T A;  3BXM A;  4P45 A;  1YSJ A;  3BI1 A;  4IK2 A;  5JH9 A;  2PJ3 A;  3IFE A;  4NGS A;  1TKF A;  4FWU A;  3GLJ A;  4OC5 A;  2GU2 A;  2ANP A;  5JGF A;  2PJ2 A;  1GYT A;  3B2Y A;  2PVW A;  1CP6 A;  2HC9 A;  3LWU A;  3DGV A;  4MRI A;  4NFR A;  1LAN A;  4Z65 A;  2OOT A;  1AMP A;  4PXD A;  3V38 A;  4F9U A;  3B3C A;  4ZI6 A;  4NGT A;  2ZEG A;  2PJ0 A;  3LMS A;  3HLP A;  4A39 A;  3KQZ A;  1JQG A;  3FH4 A;  3CDX A;  3SJG A;  2C6C A;  3DLJ A;  2OR4 A;  2I3C A;  4MCR A;  1VIX A;  4DYO A;  3RZA A;  3WT4 A;  3PBE A;  1F2O A;  3K2K A;  3NH8 A;  4OKO A;  3I1U A;  4WJB A;  2HB6 A;  3B3V A;  4YWY A;  2CTC A;  4PPZ A;  4Q7A A;  1CP7 A;  4MCS A;  1F2P A;  1Y0R A;  2NSM A;  3FEC A;  5J1Q A;  2AFM A;  3D7G A;  2GRE A;  1HDQ A;  5LYL A;  3ISZ A;  3SI2 A;  1CG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...