4MHPA

Crystal structure of apo-form of glutaminyl cyclase from ixodes scapularis
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
326
structure length
326
Chain Sequence
b'LKWPRDLRPLAHHDLLYMGQISEEDRGDFNATLRNFLVPRVVGSQKHREVREFIVRSLKDLDWDVEEDCFDGQTPHGIKPFCNVIATLNPSACHRLVLACHYDSLLHKEGTFIGATDSAVPCAQLLYLARSLNGKLQNQKTRGDGLTLQLVFFDGEEAFERWSSHDSLYGSRHLAQKWHEDRTSAERLESCLERSEIANQIDRMEVMVLLDLLGAENPRFYSYFGETQPVYRRLVNIESRLNDAGLMELPRRRRRTNYFSNSSTVGFIEDDHIPFLKRSVPIVHIIPSPFPDVWHTLDDNEQNLHHPTISNLNKIFKAFVSEYLQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl cyclase, putative
publication title Structural and functional analyses of a glutaminyl cyclase from Ixodes scapularis reveal metal-independent catalysis and inhibitor binding.
pubmed doi rcsb
source organism Ixodes scapularis
molecule tags Transferase
total genus 110
structure length 326
sequence length 326
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mhpA00
4X2TA 4NGRA 4P44A 4F8ZA 3H8FA 3D7FA 5LYLA 3K9TA 2OOTA 3SI2A 1XMBA 4NFRA 1IGBA 4OIDA 1HDUA 1F2OA 2PE3A 4F9VA 2C6PA 4ZX9A 1PCAA 2QJ8A 4KSIA 2PJAA 3KASA 4NGPA 4FBEA 1VHEA 1XFOA 4NGQA 3BI1A 4MXUA 3CPXA 1ZLIA 1Z2LA 3PB6X 5LRJA 4IHMA 3H8EA 3CPAA 1Y0YA 2V8VA 4PXEA 4P4DA 1LAMA 1TKHA 2C6CA 3DLJA 4TWEA 1LFWA 4WJBA 2ZEHA 1RTQA 4P10A 1YW4A 2PJ1A 2AFWA 2XEJA 3IO1A 3RZAA 5K8PA 3KGQA 4OP4A 4UEFA 2V8HA 4DUKA 1ELLP 2JEWA 3NH8A 4NJQA 2EK9A 4P4JA 1CPSA 2PIYA 4MCSA 4ZY0A 1VIXA 5CBMA 4P4EA 1DE4C 1YLOA 2HB6A 1YSJA 3CT9A 1H8LA 3GB0A 2PJCA 3FMCA 3V38A 2PJ0A 2Q51A 2ZEEA 5HVGA 4O23A 3ISZA 4A94A 5IB9A 4UIBA 3SI0A 2RB7A 1VGYA 3FJUA 2ABZA 1DTDA 3HUVA 1Z8LA 3SJEA 3B3TA 1Y0RA 4MHZA 2Q4ZA 5JGFA 2VL1A 5JH9A 1QQ9A 4FWUA 1HDQA 1Z5RA 4DYOA 4F9UA 2CF4A 4WWVA 4NGSA 1UWYA 4Z65A 2DEAA 2PVVA 3IEHA 3WC6A 2XEGA 3RAMA 2AFUA 4UF4A 2PVWA 2BCOA 3H8GA 3SJGA 3WABA 1TKFA 4UIAA 2PRQA 4IK2A 5K8NA 3NFZA 5LRGA 4P4IA 4ZY1A 3FX6A 2O53A 3MN8A 3D67A 3D66A 4X3RA 3D4UA 3PEIA 4PXCA 6CPAA 1ARLA 4ONWA 1ZG8A 3LWUA 3KQXA 2PCUA 3PFOA 4BD9A 5THWA 2JBJA 2WYRA 1HEEA 1KWMA 3S9LA 4IAVA 2IJZA 3KR5A 3PBEA 2NSMA 4NGMA 5D8NA 3FEEA 2WZNA 4R8FA 3DGVA 1ZG9A 3FF3A 4YU9A 2PJ2A 3IWWA 4TNUA 5LYIA 1QMUA 2O4HA 3KHXA 4PXDA 2ZEMA 2QYVA 2NYQA 1FT7A 1JQGA 4A38A 2BO9A 3V7ZA 1M4LA 4R76A 2PJ7A 1LANA 2GREA 3KI9A 2PJ8A 3IC1A 4MCQA 2PJBA 4FAIA 1GYTA 4CPAA 2GU2A 4ZI6A 2PJ3A 5JM6A 4DJLA 2RFHA 1TXRA 1XRYA 3PBBA 4PQAA 3FVLA 3SJFA 2ZOGA 4PXBA 1AYEA 1YMEA 2IQ6A 3PFEA 1CX8A 3WT4A 3IIBA 3B3SA 5F09A 4OMEA 4MMOA 1BLLE 2Q43A 4LQGA 2V77A 3D7HA 3CDXA 3SJXA 1BAVA 1LCPA 3D68A 1CG2A 3N5FA 3NH5A 2ZEFA 4P6YA 4EFDA 4A39A 2XEFA 4P4BA 8CPAA 4A37A 1VHOA 2OR4A 5HVHA 3B35A 5DS0A 3KHZA 1ZLHA 2PJ6A 4G1PA 2ZENA 3FECA 4ZY2A 2XEIA 3IFEA 2ANPA 1CP7A 4MCPA 1F2PA 4MRIA 3JRUA 4OC4A 3VH9A 1OBRA 3TX8A 2CIJA 5K8OA 3FEDA 2F8HA 3B2YA 1YW6A 3PB9X 2HC9A 3IJ3A 4P45A 3PB8X 3ISXA 2EWBA 2PJ4A 3S9MA 3RBUA 7CPAA 2AFMA 1PYTB 1Q7LA 1TKJA 4Q7AA 3LMSA 3T8WA 3S9NA 2I3CA 2F7VA 1ARMA 2CTCA 1BPMA 3FH4A 2C1CA 2EK8A 4UEEA 4MCRA 4P4FA 3KR4A 1LAPA 5K8MA 3L2NA 4GM5A 1FNOA 3QNVA 3GUXA 3BXMA 4H2KA 4MHYA 4OKOA 2BOAA 4OIWA 1BPNA 3B7IA 1XJOA 1CBXA 1TF8A 4R7MA 2ZEGA 1CP6A 5ELYA 2ZEOA 3PB7X 2PIZA 5J1QA 1XBUA 5I4MA 4EMEA 1IY7A 2ZEPA 5CPAA 1ZG7A 3K2KA 4OC0A 2CTBA 2JBKA 3PRTA 5HVFA 3HLPA 3GLJA 1R3NA 2IMOA 2GLJA 3SI1A 4UEZA 4ZYQA 1TF9A 5HXDA 3NA6A 1CPXA 2ZOFA 2QVPA 4ZX8A 3WC7A 4EWTA 1R43A 4R6TA 5D29A 1EE3P 4X8IA 3PB4X 2ZEDA 2POKA 3B3VA 4W9YA 2PJ5A 2ZELA 3KZWA 3BI0A 2PJ9A 1F57A 3NH4A 2AFZA 2AFSA 5LYFA 4OC5A 4FUUA 2GLFA 4RUHA 4AXVA 3I1UA 4PPZA 3B3WA 4NJRA 3D7GA 2AFOA 5LRKA 3TC8A 1NSAA 4OC3A 3WC5A 3VARA 4NGNA 5LYDA 1Y7EA 4JYWA 3MRUA 2V8DA 2AFXA 2J9AA 3KL9A 1LOKA 4MHPA 2FVGA 2G9DA 4NGTA 3KQZA 3D7DA 3B3CA 4K3NA 3VATA 4OC2A 4JZ0A 4OC1A 4YWYA 3BHXA 2C6GA 4MHNA 2V8GA 1ELMP 4B6ZA 1AMPA
chains in the Genus database with same CATH superfamily
2IL4A 1X10A 4X2TA 2BEIA 3H4QA 4NGRA 4P44A 3UY5A 3CXPA 5KTCA 4B11A 1UFHA 4F8ZA 3H8FA 3D7FA 5LYLA 3K9TA 2OOTA 4HPSA 3SI2A 1XMBA 1S60A 4NFRA 4C68A 1IGBA 4OIDA 3R1KA 1HDUA 1F2OA 5JPHA 2PE3A 1S7KA 4CAFA 4F9VA 4DNCA 2C6PA 3B8GA 3F5BA 4ZX9A 4BBHA 2FSRA 3DR6A 1PCAA 2P0WA 2QJ8A 4KSIA 5G22A 2PJAA 3KASA 3N7ZA 4NGPA 4XNHC 4FBEA 3IU1A 4KOWA 4A31A 1VHEA 4C7HA 1XFOA 2FE7A 4NGQA 3S6HA 2B58A 3BI1A 4KLVA 4XNHB 4OAEA 5DWNA 4JXRA 4MXUA 4MFPA 3CPXA 1ZLIA 1Z2LA 3PB6X 5LRJA 2Q4VA 4IHMA 2YGWA 1Z4EA 2B5GB 2VEZA 1M4GA 1RO5A 3CPAA 3H8EA 4A30A 1S7FA 4R87A 1Y0YA 2V8VA 4PXEA 5JQ4A 4P4DA 1LAMA 5BWAB 1TKHA 4HNWB 2C6CA 3DLJA 4PSXA 2EO8A 4TWEA 3A9LA 4UBRA 3IWEA 1LFWA 4WJBA 2ZEHA 5C88A 1RTQA 2B3UA 2ZW7A 4P10A 1YGHA 4PSWA 1S3ZA 1YW4A 2PJ1A 3FRMA 4KUAA 1YQEA 2AFWA 3TTHA 2F5IA 2XEJA 3JTKA 3IO1A 5H86A 3RZAA 5K8PA 2Z0ZA 3I3GA 3KGQA 4OP4A 4UEFA 4CS0B 2V8HA 4DUKA 3NE7A 2WPWA 1ELLP 2JEWA 1IOIA 3NH8A 3W6XA 2ATRA 1I12A 4KVOE 4CAWA 4NJQA 2EK9A 4Q38A 5AG4A 2YNEA 4P4JA 1CPSA 2PIYA 2VXKA 2D4OA 1VIXA 4MCSA 4ZY0A 1S5KA 2Q04A 4QC6A 5CBMA 4P4EA 1DE4C 1YLOA 2HB6A 1YSJA 3CT9A 3H5ZA 2OB0A 3EC4A 1H8LA 2R1IA 3IGRA 3GB0A 2PJCA 3DDDA 3FMCA 3V38A 1VKCA 2CNSA 3PP9A 4HNYB 1KUXA 2PJ0A 2Q51A 3G8WA 2ZEEA 2X7BA 5HVGA 4O23A 3ISZA 4A94A 5IB9A 2VZYA 4UIBA 3F8KA 3R9FA 3SI0A 2RB7A 4AVCA 4F0YA 1QSNA 1VGYA 3FJUA 3TOBA 1IYLA 2R7HA 2ABZA 1DTDA 1GHEA 3HUVA 1K4JA 3CXQA 1Z8LA 2GFQA 2QMLA 3D8PA 3SJEA 3B3TA 4R3KA 1Y0RA 4MHZA 2Q4ZA 1RXTA 2VL1A 5JGFA 5JH9A 1S7NA 1QQ9A 1Z8WA 3BJ8A 4FWUA 1HDQA 2ZW4A 3S9LA 4LUAA 1Z5RA 2PDOA 1Q2CA 4DYOA 3PGPA 4F9UA 2CF4A 4WWVA 4NGSA 2B4DA 1UWYA 4Z65A 4H6ZA 2DEAA 2PVVA 3IEHA 4U9YA 3WC6A 5IB0A 3T9YA 5HMNA 1I1DA 2XEGA 2G3AA 3OWCA 4IUSA 1M1DA 3RAMA 2GE3A 3DR8A 1N71A 4RN7A 4QBJA 1M4DA 2AFUA 3TO9A 3MGDA 4LQ6A 5C82A 4UF4A 3RNZA 1WK4A 1YX0A 2PVWA 2Z3PA 2VZZA 5IV0A 3S6KA 2BCOA 1VHSA 3H8GA 3SJGA 2ZW5A 3SXOA 3WABA 1IOFA 1TKFA 4JJXA 4MFQA 4MFLA 4UIAA 4YGOA 1CM0A 2BL1A 3DNSA 1MK4A 3W91A 2PRQA 4IK2A 5K8NA 3NFZA 5LRGA 3SHPA 1Q2DA 4P4IA 4YFJA 4RI1A 4ZY1A 1Z8XA 3FX6A 4A32A 4GS4A 2FS5A 2O53A 3D67A 3MN8A 4H89A 3FB3A 3D66A 4XPKA 3JUWA 4KOXA 4X3RA 3D4UA 4R9MA 1QSOA 4FD4A 3PEIA 4PXCA 1NMTA 6CPAA 4RS2A 4ZGYB 1ARLA 1XF8A 2EVNA 4ONWA 4A33A 1J4JA 4E0AA 1ZG8A 3R96A 4LX9A 4CYQA 3LWUA 5DWMA 3KQXA 2PCUA 3PFOA 2WSAA 3SXNA 2B5GA 4UCPA 5THWA 3IU2A 4A2ZA 2JBJA 4BD9A 2WYRA 5F46A 2PR1A 1HEEA 3I9SA 1KWMA 1B87A 4FD7A 4IAVA 2IJZA 4MFJA 3KR5A 4C2YA 3FIXA 3PBEA 1BO4A 5E96A 2JLMA 2NSMA 3V8IA 4NGMA 3NE8A 5D8NA 2ODFA 3FEEA 2VI7A 2WZNA 2J8NA 4R8FA 3D2PA 3DGVA 5F48A 4Q36A 4C2ZA 2CNTA 5HH1A 1ZG9A 3FYNA 1XE4A 2OH1A 5A28A 3FF3A 3WR7A 4YU9A 1QSRA 2PJ2A 2P6EA 3IWWA 4TNUA 4CAXA 5LYIA 1QMUA 2O4HA 4FD5A 2FT0A 3KHXA 4PXDA 2ZEMA 2QYVA 2FIWA 2NYQA 4GXHA 1FT7A 2O28A 2VBQA 1MJAA 1JQGA 2R98A 2WPXA 4MY0A 2BO9A 4A38A 4BMHA 3V7ZA 1M4LA 4AVAA 2Z10A 1B6BA 3LODA 4U5YA 2FL4A 4R76A 2PJ7A 2Z3NA 1LANA 2GREA 4AG9A 5CNPA 3KI9A 2PJ8A 3IC1A 4QVTA 5H84A 4MCQA 2OZHA 2PJBA 4KSFA 4FAIA 1GYTA 4CPAA 3JVNA 2GU2A 4AVBA 4ZI6A 2PJ3A 4KOVA 1IU8A 5JM6A 1Z9UA 4CGLA 3P2FA 2RFHA 4DJLA 1TXRA 1XRYA 4NEXA 3GY9A 3PBBA 2ZXVA 3R9GA 4PQAA 1Z8TA 1MJBA 3FVLA 3SJFA 2ZOGA 1YR0A 4PXBA 5G21A 3TFYA 1AYEA 1YMEA 2G3TA 2IQ6A 3PFEA 1CX8A 3WT4A 3IIBA 3B3SA 4UFVA 1A2ZA 2VQYA 4JLYA 5F09A 3QAYA 3QAHA 4MMOA 4OMEA 5GCNA 1BLLE 2Q43A 4CRYB 4HKFA 1MJ9A 3LD2A 3ZZIA 4LQGA 2D4PA 2V77A 1M44A 3PZJA 3TOAA 3D7HA 3CDXA 4R57A 3SJXA 1BAVA 1LCPA 3D68A 1CG2A 3N5FA 3NH5A 4KOTA 4L89A 2ZEFA 1JWQA 4B5PB 2Y0MA 4P6YA 4MJ8A 2JDCA 3TE4A 4B13A 4EFDA 2DXQA 4NCZA 2B3VA 4A39A 1PU9A 4CGPA 3LACA 4MFKA 4KOYA 2XEFA 4P4BA 8CPAA 4MHDA 3TO7A 4A37A 1VHOA 1ZO0A 2OR4A 4CGOA 4CYOA 4B14A 5HVHA 1QSTA 1YVOA 1TIQA 2ZPAA 3B35A 4M3SA 4XPDB 1IYKA 5DS0A 3BJ7A 3KHZA 1ZLHA 2DF5A 2PJ6A 2ZENA 4G1PA 3VWDA 3FECA 4ZY2A 4F6AA 2XEIA 3IFEA 2ANPA 1CP7A 3D3SA 4KOSA 4ORFA 4ZBGA 4MCPA 1F2PA 4M6HA 4UWIA 2PSWA 4MBUA 5EC4A 1XEBA 4MRIA 2FXFA 3JRUA 2JEVA 3DSBA 4OC4A 3VH9A 4J3GA 1YREA 1KZFA 1OBRA 2CXAA 4KS9A 3TX8A 2CIJA 5G20A 5K8OA 2PR8A 3FEDA 4UCMA 2F8HA 2GANA 3B2YA 1YW6A 2Z3KA 3PB9X 2HC9A 4CGMA 3IJ3A 1R57A 2FIAA 1Z4RA 4P45A 4I49A 5KTDA 1QSMA 1P0HA 3TO6A 3PB8X 2A4NA 4C2XA 4KORA 3ISXA 4II9A 2EWBA 2G0BA 2R8VA 4UA3A 2PJ4A 3S9MA 3RBUA 4KUBA 2AFMA 4U9ZA 1NSLA 3RYOA 7CPAA 1PYTB 1Q7LA 1TKJA 3BLNA 4Q7AA 3LMSA 3T8WA 3S9NA 2KCWA 3K9UA 2DPSA 2P6GA 4NSQA 2I3CA 5AG7A 2F7VA 2AJ6A 1YLEA 2OU2A 1ARMA 2Q0YA 2CTCA 4CGNA 1BPMA 4MFZA 4AB7A 3FH4A 2C1CA 2EK8A 4UFXA 4BINA 4UEEA 4KOUA 1PUAA 4MCRA 1Y9KA 4P4FA 3KR4A 3FXTA 3W6SA 1LAPA 4Y49C 3VWEA 2RC4A 5K8MA 3GIUA 3IWGA 2YNCA 4JXQA 3TCVA 4CYPA 4E8OA 3L2NA 4GM5A 1FNOA 2J8MA 3QNVA 4Y49B 3RO0A 5F47A 3GUXA 3BXMA 4PV6A 4H2KA 4IF5A 1KUVA 4MHYA 2REFA 4OKOA 2H5MA 2BOAA 4JWPA 3QB8A 4A95A 4OIWA 1BPNA 2YNCC 4R3LA 2Q7BA 3B7IA 1YVKA 1XIXA 1XJOA 2J8RA 2PRBA 4KVME 4CAVA 3GKRA 1P4NA 2FCKA 2ZW6A 4M6GA 4OADA 1CBXA 1TF8A 4R7MA 3R95A 4B5OA 2ZEGA 2K5TA 1CP6A 3G3SA 5ELYA 2ZEOA 4JD6A 4H6UA 2EBJA 4B10A 5FVJA 3PB7X 2PIZA 5KTAA 4FD6A 5AG6A 5J1QA 1OZPA 3FBUA 1XBUA 4M85A 3ZJ0A 4CRZB 5A27A 5G1ZA 3S6FA 5I4MA 1IICA 1IB1E 4EMEA 1IY7A 2ZEPA 3F0AA 1SQHA 4PK3A 5CPAA 1ZG7A 5EMIA 3K2KA 1XMTA 3EFAA 4OC0A 2QECA 2CTBA 2NMTA 2Q7SA 2Q44A 2JBKA 3PRTA 4UFWA 3HLPA 3EO4A 3GLJA 5HVFA 4L8AA 4C7IA 1R3NA 1Y7RA 2REEA 4B5PA 2IMOA 5J8FA 2I79A 2Q4YA 2GLJA 3SI1A 1FY7A 4UEZA 1TF9A 4CAEA 3NA6A 4ZYQA 1CPXA 5HXDA 4OLLA 2AE6A 1I21A 1X12A 2OZGA 5AG5A 2ZOFA 1KUYA 2QVPA 5ISVA 3EXNA 2HUZA 2Z11A 4ZX8A 1M4IA 3WC7A 4EWTA 1R43A 2OZUA 1L0CA 4QB9A 4R6TA 5D29A 5EBVA 1EE3P 4KSAA 4X8IA 3PB4X 1V0CA 2ZEDA 2POKA 3B3VA 4W9YA 3R9EA 2ARHA 3S6GA 4F0XA 4MY3A 2PJ5A 2ZELA 5F49A 4M6IA 3KZWA 4XPDC 1AUGA 1IIDA 3BI0A 2P6FA 4ONUA 3FNCA 1CJWA 2PJ9A 1F57A 3CZXA 3NH4A 2AFZA 2AFSA 2I00A 2QIRA 5LYFA 3C26A 4OC5A 4FUUA 2GLFA 4RUHA 4AXVA 4X5KA 3I1UA 4PPZA 3B3WA 4NJRA 4KVXA 3D7GA 4EVYA 3EY5A 5I0CA 4QUSA 2AFOA 2EUIA 5LRKA 3TC8A 3TT2A 1S7LA 5AGEA 4XPLA 1NSAA 2GIVA 5IX3A 4PK2A 4OC3A 1XOVA 3KKWA 3WC5A 3VARA 1NE9A 4CYNA 2DPTA 1LRZA 4B12A 4NGNA 1U6MA 4UWJA 2PQ8A 2CNMA 2PC1A 1Y7EA 5LYDA 4JYWA 3MRUA 2B4BA 4AG7A 2HQYA 3D2MA 2C27A 4E2AA 2V8DA 2AFXA 5J8CA 2J9AA 2Z3OA 3KL9A 1LOKA 3P2HA 4MHPA 4YRHA 1ON0A 2FVGA 2G9DA 4NGTA 4KZTA 3KQZA 4HNXB 3D7DA 4NF1A 3B3CA 4KLWA 2Z3LA 4K3NA 2HV2A 2CY2A 1Y9WA 3GYAA 2BSWA 1WWZA 3VATA 4OC2A 4JZ0A 2B4DB 4MI4A 4OC1A 2YNDA 4YWYA 3BHXA 2WUUA 4NXYA 3E0KA 1Q2YA 2C6GA 3CXSA 2BUEA 2Z3MA 4K30A 1BOBA 4MHNA 1YK3A 2JDDA 2V8GA 1ELMP 3T90A 4UCNA 4B6ZA 1AMPA
chains in the Genus database with same CATH topology
4X2TA 4NGRA 4P44A 4F8ZA 3H8FA 3D7FA 5LYLA 3K9TA 2OOTA 3SI2A 1XMBA 4NFRA 1IGBA 4OIDA 1HDUA 1F2OA 2PE3A 4F9VA 2C6PA 4ZX9A 1PCAA 2QJ8A 4KSIA 2PJAA 3KASA 4NGPA 4FBEA 1VHEA 1XFOA 4NGQA 3BI1A 4MXUA 3CPXA 1ZLIA 1Z2LA 3PB6X 5LRJA 4IHMA 3H8EA 3CPAA 1Y0YA 2V8VA 4PXEA 4P4DA 1LAMA 1TKHA 2C6CA 3DLJA 4TWEA 1LFWA 4WJBA 2ZEHA 1RTQA 4P10A 1YW4A 2PJ1A 2AFWA 2XEJA 3IO1A 3RZAA 5K8PA 3KGQA 4OP4A 4UEFA 2V8HA 4DUKA 1ELLP 2JEWA 3NH8A 4NJQA 2EK9A 4P4JA 1CPSA 2PIYA 4MCSA 4ZY0A 1VIXA 5CBMA 4P4EA 1DE4C 1YLOA 2HB6A 1YSJA 3CT9A 1H8LA 3GB0A 2PJCA 3FMCA 3V38A 2PJ0A 2Q51A 2ZEEA 5HVGA 4O23A 3ISZA 4A94A 5IB9A 4UIBA 3SI0A 2RB7A 1VGYA 3FJUA 2ABZA 1DTDA 3HUVA 1Z8LA 3SJEA 3B3TA 1Y0RA 4MHZA 2Q4ZA 5JGFA 2VL1A 5JH9A 1QQ9A 4FWUA 1HDQA 1Z5RA 4DYOA 4F9UA 2CF4A 4WWVA 4NGSA 1UWYA 4Z65A 2DEAA 2PVVA 3IEHA 3WC6A 2XEGA 3RAMA 2AFUA 4UF4A 2PVWA 2BCOA 3H8GA 3SJGA 3WABA 1TKFA 4UIAA 2PRQA 4IK2A 5K8NA 3NFZA 5LRGA 4P4IA 4ZY1A 3FX6A 2O53A 3MN8A 3D67A 3D66A 4X3RA 3D4UA 3PEIA 4PXCA 6CPAA 1ARLA 4ONWA 1ZG8A 3LWUA 3KQXA 2PCUA 3PFOA 4BD9A 5THWA 2JBJA 2WYRA 1HEEA 1KWMA 3S9LA 4IAVA 2IJZA 3KR5A 3PBEA 2NSMA 4NGMA 5D8NA 3FEEA 2WZNA 4R8FA 3DGVA 1ZG9A 3FF3A 4YU9A 2PJ2A 3IWWA 4TNUA 5LYIA 1QMUA 2O4HA 3KHXA 4PXDA 2ZEMA 2QYVA 2NYQA 1FT7A 1JQGA 4A38A 2BO9A 3V7ZA 1M4LA 4R76A 2PJ7A 1LANA 2GREA 3KI9A 2PJ8A 3IC1A 4MCQA 2PJBA 4FAIA 1GYTA 4CPAA 2GU2A 4ZI6A 2PJ3A 5JM6A 4DJLA 2RFHA 1TXRA 1XRYA 3PBBA 4PQAA 3FVLA 3SJFA 2ZOGA 4PXBA 1AYEA 1YMEA 2IQ6A 3PFEA 1CX8A 3WT4A 3IIBA 3B3SA 5F09A 4OMEA 4MMOA 1BLLE 2Q43A 4LQGA 2V77A 3D7HA 3CDXA 3SJXA 1BAVA 1LCPA 3D68A 1CG2A 3N5FA 3NH5A 2ZEFA 4P6YA 4EFDA 4A39A 2XEFA 4P4BA 8CPAA 4A37A 1VHOA 2OR4A 5HVHA 3B35A 5DS0A 3KHZA 1ZLHA 2PJ6A 4G1PA 2ZENA 3FECA 4ZY2A 2XEIA 3IFEA 2ANPA 1CP7A 4MCPA 1F2PA 4MRIA 3JRUA 4OC4A 3VH9A 1OBRA 3TX8A 2CIJA 5K8OA 3FEDA 2F8HA 3B2YA 1YW6A 3PB9X 2HC9A 3IJ3A 4P45A 3PB8X 3ISXA 2EWBA 2PJ4A 3S9MA 3RBUA 7CPAA 2AFMA 1PYTB 1Q7LA 1TKJA 4Q7AA 3LMSA 3T8WA 3S9NA 2I3CA 2F7VA 1ARMA 2CTCA 1BPMA 3FH4A 2C1CA 2EK8A 4UEEA 4MCRA 4P4FA 3KR4A 1LAPA 5K8MA 3L2NA 4GM5A 1FNOA 3QNVA 3GUXA 3BXMA 4H2KA 4MHYA 4OKOA 2BOAA 4OIWA 1BPNA 3B7IA 1XJOA 1CBXA 1TF8A 4R7MA 2ZEGA 1CP6A 5ELYA 2ZEOA 3PB7X 2PIZA 5J1QA 1XBUA 5I4MA 4EMEA 1IY7A 2ZEPA 5CPAA 1ZG7A 3K2KA 4OC0A 2CTBA 2JBKA 3PRTA 5HVFA 3HLPA 3GLJA 1R3NA 2IMOA 2GLJA 3SI1A 4UEZA 4ZYQA 1TF9A 5HXDA 3NA6A 1CPXA 2ZOFA 2QVPA 4ZX8A 3WC7A 4EWTA 1R43A 4R6TA 5D29A 1EE3P 4X8IA 3PB4X 2ZEDA 2POKA 3B3VA 4W9YA 2PJ5A 2ZELA 3KZWA 3BI0A 2PJ9A 1F57A 3NH4A 2AFZA 2AFSA 5LYFA 4OC5A 4FUUA 2GLFA 4RUHA 4AXVA 3I1UA 4PPZA 3B3WA 4NJRA 3D7GA 2AFOA 5LRKA 3TC8A 1NSAA 4OC3A 3WC5A 3VARA 4NGNA 5LYDA 1Y7EA 4JYWA 3MRUA 2V8DA 2AFXA 2J9AA 3KL9A 1LOKA 4MHPA 2FVGA 2G9DA 4NGTA 3KQZA 3D7DA 3B3CA 4K3NA 3VATA 4OC2A 4JZ0A 4OC1A 4YWYA 3BHXA 2C6GA 4MHNA 2V8GA 1ELMP 4B6ZA 1AMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X2T A;  4NGR A;  4P44 A;  4F8Z A;  3H8F A;  3D7F A;  5LYL A;  3K9T A;  2OOT A;  3SI2 A;  1XMB A;  4NFR A;  1IGB A;  4OID A;  1HDU A;  1F2O A;  2PE3 A;  4F9V A;  2C6P A;  4ZX9 A;  1PCA A;  2QJ8 A;  4KSI A;  2PJA A;  3KAS A;  4NGP A;  4FBE A;  1VHE A;  1XFO A;  4NGQ A;  3BI1 A;  4MXU A;  3CPX A;  1ZLI A;  1Z2L A;  3PB6 X;  5LRJ A;  4IHM A;  3H8E A;  3CPA A;  1Y0Y A;  2V8V A;  4PXE A;  4P4D A;  1LAM A;  1TKH A;  2C6C A;  3DLJ A;  4TWE A;  1LFW A;  4WJB A;  2ZEH A;  1RTQ A;  4P10 A;  1YW4 A;  2PJ1 A;  2AFW A;  2XEJ A;  3IO1 A;  3RZA A;  5K8P A;  3KGQ A;  4OP4 A;  4UEF A;  2V8H A;  4DUK A;  1ELL P;  2JEW A;  3NH8 A;  4NJQ A;  2EK9 A;  4P4J A;  1CPS A;  2PIY A;  4MCS A;  4ZY0 A;  1VIX A;  5CBM A;  4P4E A;  1DE4 C;  1YLO A;  2HB6 A;  1YSJ A;  3CT9 A;  1H8L A;  3GB0 A;  2PJC A;  3FMC A;  3V38 A;  2PJ0 A;  2Q51 A;  2ZEE A;  5HVG A;  4O23 A;  3ISZ A;  4A94 A;  5IB9 A;  4UIB A;  3SI0 A;  2RB7 A;  1VGY A;  3FJU A;  2ABZ A;  1DTD A;  3HUV A;  1Z8L A;  3SJE A;  3B3T A;  1Y0R A;  4MHZ A;  2Q4Z A;  5JGF A;  2VL1 A;  5JH9 A;  1QQ9 A;  4FWU A;  1HDQ A;  1Z5R A;  4DYO A;  4F9U A;  2CF4 A;  4WWV A;  4NGS A;  1UWY A;  4Z65 A;  2DEA A;  2PVV A;  3IEH A;  3WC6 A;  2XEG A;  3RAM A;  2AFU A;  4UF4 A;  2PVW A;  2BCO A;  3H8G A;  3SJG A;  3WAB A;  1TKF A;  4UIA A;  2PRQ A;  4IK2 A;  5K8N A;  3NFZ A;  5LRG A;  4P4I A;  4ZY1 A;  3FX6 A;  2O53 A;  3MN8 A;  3D67 A;  3D66 A;  4X3R A;  3D4U A;  3PEI A;  4PXC A;  6CPA A;  1ARL A;  4ONW A;  1ZG8 A;  3LWU A;  3KQX A;  2PCU A;  3PFO A;  4BD9 A;  5THW A;  2JBJ A;  2WYR A;  1HEE A;  1KWM A;  3S9L A;  4IAV A;  2IJZ A;  3KR5 A;  3PBE A;  2NSM A;  4NGM A;  5D8N A;  3FEE A;  2WZN A;  4R8F A;  3DGV A;  1ZG9 A;  3FF3 A;  4YU9 A;  2PJ2 A;  3IWW A;  4TNU A;  5LYI A;  1QMU A;  2O4H A;  3KHX A;  4PXD A;  2ZEM A;  2QYV A;  2NYQ A;  1FT7 A;  1JQG A;  4A38 A;  2BO9 A;  3V7Z A;  1M4L A;  4R76 A;  2PJ7 A;  1LAN A;  2GRE A;  3KI9 A;  2PJ8 A;  3IC1 A;  4MCQ A;  2PJB A;  4FAI A;  1GYT A;  4CPA A;  2GU2 A;  4ZI6 A;  2PJ3 A;  5JM6 A;  4DJL A;  2RFH A;  1TXR A;  1XRY A;  3PBB A;  4PQA A;  3FVL A;  3SJF A;  2ZOG A;  4PXB A;  1AYE A;  1YME A;  2IQ6 A;  3PFE A;  1CX8 A;  3WT4 A;  3IIB A;  3B3S A;  5F09 A;  4OME A;  4MMO A;  1BLL E;  2Q43 A;  4LQG A;  2V77 A;  3D7H A;  3CDX A;  3SJX A;  1BAV A;  1LCP A;  3D68 A;  1CG2 A;  3N5F A;  3NH5 A;  2ZEF A;  4P6Y A;  4EFD A;  4A39 A;  2XEF A;  4P4B A;  8CPA A;  4A37 A;  1VHO A;  2OR4 A;  5HVH A;  3B35 A;  5DS0 A;  3KHZ A;  1ZLH A;  2PJ6 A;  4G1P A;  2ZEN A;  3FEC A;  4ZY2 A;  2XEI A;  3IFE A;  2ANP A;  1CP7 A;  4MCP A;  1F2P A;  4MRI A;  3JRU A;  4OC4 A;  3VH9 A;  1OBR A;  3TX8 A;  2CIJ A;  5K8O A;  3FED A;  2F8H A;  3B2Y A;  1YW6 A;  3PB9 X;  2HC9 A;  3IJ3 A;  4P45 A;  3PB8 X;  3ISX A;  2EWB A;  2PJ4 A;  3S9M A;  3RBU A;  7CPA A;  2AFM A;  1PYT B;  1Q7L A;  1TKJ A;  4Q7A A;  3LMS A;  3T8W A;  3S9N A;  2I3C A;  2F7V A;  1ARM A;  2CTC A;  1BPM A;  3FH4 A;  2C1C A;  2EK8 A;  4UEE A;  4MCR A;  4P4F A;  3KR4 A;  1LAP A;  5K8M A;  3L2N A;  4GM5 A;  1FNO A;  3QNV A;  3GUX A;  3BXM A;  4H2K A;  4MHY A;  4OKO A;  2BOA A;  4OIW A;  1BPN A;  3B7I A;  1XJO A;  1CBX A;  1TF8 A;  4R7M A;  2ZEG A;  1CP6 A;  5ELY A;  2ZEO A;  3PB7 X;  2PIZ A;  5J1Q A;  1XBU A;  5I4M A;  4EME A;  1IY7 A;  2ZEP A;  5CPA A;  1ZG7 A;  3K2K A;  4OC0 A;  2CTB A;  2JBK A;  3PRT A;  5HVF A;  3HLP A;  3GLJ A;  1R3N A;  2IMO A;  2GLJ A;  3SI1 A;  4UEZ A;  4ZYQ A;  1TF9 A;  5HXD A;  3NA6 A;  1CPX A;  2ZOF A;  2QVP A;  4ZX8 A;  3WC7 A;  4EWT A;  1R43 A;  4R6T A;  5D29 A;  1EE3 P;  4X8I A;  3PB4 X;  2ZED A;  2POK A;  3B3V A;  4W9Y A;  2PJ5 A;  2ZEL A;  3KZW A;  3BI0 A;  2PJ9 A;  1F57 A;  3NH4 A;  2AFZ A;  2AFS A;  5LYF A;  4OC5 A;  4FUU A;  2GLF A;  4RUH A;  4AXV A;  3I1U A;  4PPZ A;  3B3W A;  4NJR A;  3D7G A;  2AFO A;  5LRK A;  3TC8 A;  1NSA A;  4OC3 A;  3WC5 A;  3VAR A;  4NGN A;  5LYD A;  1Y7E A;  4JYW A;  3MRU A;  2V8D A;  2AFX A;  2J9A A;  3KL9 A;  1LOK A;  4MHP A;  2FVG A;  2G9D A;  4NGT A;  3KQZ A;  3D7D A;  3B3C A;  4K3N A;  3VAT A;  4OC2 A;  4JZ0 A;  4OC1 A;  4YWY A;  3BHX A;  2C6G A;  4MHN A;  2V8G A;  1ELM P;  4B6Z A;  1AMP A; 
#chains in the Genus database with same CATH topology
 2IL4 A;  1X10 A;  4X2T A;  2BEI A;  3H4Q A;  4NGR A;  4P44 A;  3UY5 A;  3CXP A;  5KTC A;  4B11 A;  1UFH A;  4F8Z A;  3H8F A;  3D7F A;  5LYL A;  3K9T A;  2OOT A;  4HPS A;  3SI2 A;  1XMB A;  1S60 A;  4NFR A;  4C68 A;  1IGB A;  4OID A;  3R1K A;  1HDU A;  1F2O A;  5JPH A;  2PE3 A;  1S7K A;  4CAF A;  4F9V A;  4DNC A;  2C6P A;  3B8G A;  3F5B A;  4ZX9 A;  4BBH A;  2FSR A;  3DR6 A;  1PCA A;  2P0W A;  2QJ8 A;  4KSI A;  5G22 A;  2PJA A;  3KAS A;  3N7Z A;  4NGP A;  4XNH C;  4FBE A;  3IU1 A;  4KOW A;  4A31 A;  1VHE A;  4C7H A;  1XFO A;  2FE7 A;  4NGQ A;  3S6H A;  2B58 A;  3BI1 A;  4KLV A;  4XNH B;  4OAE A;  5DWN A;  4JXR A;  4MXU A;  4MFP A;  3CPX A;  1ZLI A;  1Z2L A;  3PB6 X;  5LRJ A;  2Q4V A;  4IHM A;  2YGW A;  1Z4E A;  2B5G B;  2VEZ A;  1M4G A;  1RO5 A;  3CPA A;  3H8E A;  4A30 A;  1S7F A;  4R87 A;  1Y0Y A;  2V8V A;  4PXE A;  5JQ4 A;  4P4D A;  1LAM A;  5BWA B;  1TKH A;  4HNW B;  2C6C A;  3DLJ A;  4PSX A;  2EO8 A;  4TWE A;  3A9L A;  4UBR A;  3IWE A;  1LFW A;  4WJB A;  2ZEH A;  5C88 A;  1RTQ A;  2B3U A;  2ZW7 A;  4P10 A;  1YGH A;  4PSW A;  1S3Z A;  1YW4 A;  2PJ1 A;  3FRM A;  4KUA A;  1YQE A;  2AFW A;  3TTH A;  2F5I A;  2XEJ A;  3JTK A;  3IO1 A;  5H86 A;  3RZA A;  5K8P A;  2Z0Z A;  3I3G A;  3KGQ A;  4OP4 A;  4UEF A;  4CS0 B;  2V8H A;  4DUK A;  3NE7 A;  2WPW A;  1ELL P;  2JEW A;  1IOI A;  3NH8 A;  3W6X A;  2ATR A;  1I12 A;  4KVO E;  4CAW A;  4NJQ A;  2EK9 A;  4Q38 A;  5AG4 A;  2YNE A;  4P4J A;  1CPS A;  2PIY A;  2VXK A;  2D4O A;  1VIX A;  4MCS A;  4ZY0 A;  1S5K A;  2Q04 A;  4QC6 A;  5CBM A;  4P4E A;  1DE4 C;  1YLO A;  2HB6 A;  1YSJ A;  3CT9 A;  3H5Z A;  2OB0 A;  3EC4 A;  1H8L A;  2R1I A;  3IGR A;  3GB0 A;  2PJC A;  3DDD A;  3FMC A;  3V38 A;  1VKC A;  2CNS A;  3PP9 A;  4HNY B;  1KUX A;  2PJ0 A;  2Q51 A;  3G8W A;  2ZEE A;  2X7B A;  5HVG A;  4O23 A;  3ISZ A;  4A94 A;  5IB9 A;  2VZY A;  4UIB A;  3F8K A;  3R9F A;  3SI0 A;  2RB7 A;  4AVC A;  4F0Y A;  1QSN A;  1VGY A;  3FJU A;  3TOB A;  1IYL A;  2R7H A;  2ABZ A;  1DTD A;  1GHE A;  3HUV A;  1K4J A;  3CXQ A;  1Z8L A;  2GFQ A;  2QML A;  3D8P A;  3SJE A;  3B3T A;  4R3K A;  1Y0R A;  4MHZ A;  2Q4Z A;  1RXT A;  2VL1 A;  5JGF A;  5JH9 A;  1S7N A;  1QQ9 A;  1Z8W A;  3BJ8 A;  4FWU A;  1HDQ A;  2ZW4 A;  3S9L A;  4LUA A;  1Z5R A;  2PDO A;  1Q2C A;  4DYO A;  3PGP A;  4F9U A;  2CF4 A;  4WWV A;  4NGS A;  2B4D A;  1UWY A;  4Z65 A;  4H6Z A;  2DEA A;  2PVV A;  3IEH A;  4U9Y A;  3WC6 A;  5IB0 A;  3T9Y A;  5HMN A;  1I1D A;  2XEG A;  2G3A A;  3OWC A;  4IUS A;  1M1D A;  3RAM A;  2GE3 A;  3DR8 A;  1N71 A;  4RN7 A;  4QBJ A;  1M4D A;  2AFU A;  3TO9 A;  3MGD A;  4LQ6 A;  5C82 A;  4UF4 A;  3RNZ A;  1WK4 A;  1YX0 A;  2PVW A;  2Z3P A;  2VZZ A;  5IV0 A;  3S6K A;  2BCO A;  1VHS A;  3H8G A;  3SJG A;  2ZW5 A;  3SXO A;  3WAB A;  1IOF A;  1TKF A;  4JJX A;  4MFQ A;  4MFL A;  4UIA A;  4YGO A;  1CM0 A;  2BL1 A;  3DNS A;  1MK4 A;  3W91 A;  2PRQ A;  4IK2 A;  5K8N A;  3NFZ A;  5LRG A;  3SHP A;  1Q2D A;  4P4I A;  4YFJ A;  4RI1 A;  4ZY1 A;  1Z8X A;  3FX6 A;  4A32 A;  4GS4 A;  2FS5 A;  2O53 A;  3D67 A;  3MN8 A;  4H89 A;  3FB3 A;  3D66 A;  4XPK A;  3JUW A;  4KOX A;  4X3R A;  3D4U A;  4R9M A;  1QSO A;  4FD4 A;  3PEI A;  4PXC A;  1NMT A;  6CPA A;  4RS2 A;  4ZGY B;  1ARL A;  1XF8 A;  2EVN A;  4ONW A;  4A33 A;  1J4J A;  4E0A A;  1ZG8 A;  3R96 A;  4LX9 A;  4CYQ A;  3LWU A;  5DWM A;  3KQX A;  2PCU A;  3PFO A;  2WSA A;  3SXN A;  2B5G A;  4UCP A;  5THW A;  3IU2 A;  4A2Z A;  2JBJ A;  4BD9 A;  2WYR A;  5F46 A;  2PR1 A;  1HEE A;  3I9S A;  1KWM A;  1B87 A;  4FD7 A;  4IAV A;  2IJZ A;  4MFJ A;  3KR5 A;  4C2Y A;  3FIX A;  3PBE A;  1BO4 A;  5E96 A;  2JLM A;  2NSM A;  3V8I A;  4NGM A;  3NE8 A;  5D8N A;  2ODF A;  3FEE A;  2VI7 A;  2WZN A;  2J8N A;  4R8F A;  3D2P A;  3DGV A;  5F48 A;  4Q36 A;  4C2Z A;  2CNT A;  5HH1 A;  1ZG9 A;  3FYN A;  1XE4 A;  2OH1 A;  5A28 A;  3FF3 A;  3WR7 A;  4YU9 A;  1QSR A;  2PJ2 A;  2P6E A;  3IWW A;  4TNU A;  4CAX A;  5LYI A;  1QMU A;  2O4H A;  4FD5 A;  2FT0 A;  3KHX A;  4PXD A;  2ZEM A;  2QYV A;  2FIW A;  2NYQ A;  4GXH A;  1FT7 A;  2O28 A;  2VBQ A;  1MJA A;  1JQG A;  2R98 A;  2WPX A;  4MY0 A;  2BO9 A;  4A38 A;  4BMH A;  3V7Z A;  1M4L A;  4AVA A;  2Z10 A;  1B6B A;  3LOD A;  4U5Y A;  2FL4 A;  4R76 A;  2PJ7 A;  2Z3N A;  1LAN A;  2GRE A;  4AG9 A;  5CNP A;  3KI9 A;  2PJ8 A;  3IC1 A;  4QVT A;  5H84 A;  4MCQ A;  2OZH A;  2PJB A;  4KSF A;  4FAI A;  1GYT A;  4CPA A;  3JVN A;  2GU2 A;  4AVB A;  4ZI6 A;  2PJ3 A;  4KOV A;  1IU8 A;  5JM6 A;  1Z9U A;  4CGL A;  3P2F A;  2RFH A;  4DJL A;  1TXR A;  1XRY A;  4NEX A;  3GY9 A;  3PBB A;  2ZXV A;  3R9G A;  4PQA A;  1Z8T A;  1MJB A;  3FVL A;  3SJF A;  2ZOG A;  1YR0 A;  4PXB A;  5G21 A;  3TFY A;  1AYE A;  1YME A;  2G3T A;  2IQ6 A;  3PFE A;  1CX8 A;  3WT4 A;  3IIB A;  3B3S A;  4UFV A;  1A2Z A;  2VQY A;  4JLY A;  5F09 A;  3QAY A;  3QAH A;  4MMO A;  4OME A;  5GCN A;  1BLL E;  2Q43 A;  4CRY B;  4HKF A;  1MJ9 A;  3LD2 A;  3ZZI A;  4LQG A;  2D4P A;  2V77 A;  1M44 A;  3PZJ A;  3TOA A;  3D7H A;  3CDX A;  4R57 A;  3SJX A;  1BAV A;  1LCP A;  3D68 A;  1CG2 A;  3N5F A;  3NH5 A;  4KOT A;  4L89 A;  2ZEF A;  1JWQ A;  4B5P B;  2Y0M A;  4P6Y A;  4MJ8 A;  2JDC A;  3TE4 A;  4B13 A;  4EFD A;  2DXQ A;  4NCZ A;  2B3V A;  4A39 A;  1PU9 A;  4CGP A;  3LAC A;  4MFK A;  4KOY A;  2XEF A;  4P4B A;  8CPA A;  4MHD A;  3TO7 A;  4A37 A;  1VHO A;  1ZO0 A;  2OR4 A;  4CGO A;  4CYO A;  4B14 A;  5HVH A;  1QST A;  1YVO A;  1TIQ A;  2ZPA A;  3B35 A;  4M3S A;  4XPD B;  1IYK A;  5DS0 A;  3BJ7 A;  3KHZ A;  1ZLH A;  2DF5 A;  2PJ6 A;  2ZEN A;  4G1P A;  3VWD A;  3FEC A;  4ZY2 A;  4F6A A;  2XEI A;  3IFE A;  2ANP A;  1CP7 A;  3D3S A;  4KOS A;  4ORF A;  4ZBG A;  4MCP A;  1F2P A;  4M6H A;  4UWI A;  2PSW A;  4MBU A;  5EC4 A;  1XEB A;  4MRI A;  2FXF A;  3JRU A;  2JEV A;  3DSB A;  4OC4 A;  3VH9 A;  4J3G A;  1YRE A;  1KZF A;  1OBR A;  2CXA A;  4KS9 A;  3TX8 A;  2CIJ A;  5G20 A;  5K8O A;  2PR8 A;  3FED A;  4UCM A;  2F8H A;  2GAN A;  3B2Y A;  1YW6 A;  2Z3K A;  3PB9 X;  2HC9 A;  4CGM A;  3IJ3 A;  1R57 A;  2FIA A;  1Z4R A;  4P45 A;  4I49 A;  5KTD A;  1QSM A;  1P0H A;  3TO6 A;  3PB8 X;  2A4N A;  4C2X A;  4KOR A;  3ISX A;  4II9 A;  2EWB A;  2G0B A;  2R8V A;  4UA3 A;  2PJ4 A;  3S9M A;  3RBU A;  4KUB A;  2AFM A;  4U9Z A;  1NSL A;  3RYO A;  7CPA A;  1PYT B;  1Q7L A;  1TKJ A;  3BLN A;  4Q7A A;  3LMS A;  3T8W A;  3S9N A;  2KCW A;  3K9U A;  2DPS A;  2P6G A;  4NSQ A;  2I3C A;  5AG7 A;  2F7V A;  2AJ6 A;  1YLE A;  2OU2 A;  1ARM A;  2Q0Y A;  2CTC A;  4CGN A;  1BPM A;  4MFZ A;  4AB7 A;  3FH4 A;  2C1C A;  2EK8 A;  4UFX A;  4BIN A;  4UEE A;  4KOU A;  1PUA A;  4MCR A;  1Y9K A;  4P4F A;  3KR4 A;  3FXT A;  3W6S A;  1LAP A;  4Y49 C;  3VWE A;  2RC4 A;  5K8M A;  3GIU A;  3IWG A;  2YNC A;  4JXQ A;  3TCV A;  4CYP A;  4E8O A;  3L2N A;  4GM5 A;  1FNO A;  2J8M A;  3QNV A;  4Y49 B;  3RO0 A;  5F47 A;  3GUX A;  3BXM A;  4PV6 A;  4H2K A;  4IF5 A;  1KUV A;  4MHY A;  2REF A;  4OKO A;  2H5M A;  2BOA A;  4JWP A;  3QB8 A;  4A95 A;  4OIW A;  1BPN A;  2YNC C;  4R3L A;  2Q7B A;  3B7I A;  1YVK A;  1XIX A;  1XJO A;  2J8R A;  2PRB A;  4KVM E;  4CAV A;  3GKR A;  1P4N A;  2FCK A;  2ZW6 A;  4M6G A;  4OAD A;  1CBX A;  1TF8 A;  4R7M A;  3R95 A;  4B5O A;  2ZEG A;  2K5T A;  1CP6 A;  3G3S A;  5ELY A;  2ZEO A;  4JD6 A;  4H6U A;  2EBJ A;  4B10 A;  5FVJ A;  3PB7 X;  2PIZ A;  5KTA A;  4FD6 A;  5AG6 A;  5J1Q A;  1OZP A;  3FBU A;  1XBU A;  4M85 A;  3ZJ0 A;  4CRZ B;  5A27 A;  5G1Z A;  3S6F A;  5I4M A;  1IIC A;  1IB1 E;  4EME A;  1IY7 A;  2ZEP A;  3F0A A;  1SQH A;  4PK3 A;  5CPA A;  1ZG7 A;  5EMI A;  3K2K A;  1XMT A;  3EFA A;  4OC0 A;  2QEC A;  2CTB A;  2NMT A;  2Q7S A;  2Q44 A;  2JBK A;  3PRT A;  4UFW A;  3HLP A;  3EO4 A;  3GLJ A;  5HVF A;  4L8A A;  4C7I A;  1R3N A;  1Y7R A;  2REE A;  4B5P A;  2IMO A;  5J8F A;  2I79 A;  2Q4Y A;  2GLJ A;  3SI1 A;  1FY7 A;  4UEZ A;  1TF9 A;  4CAE A;  3NA6 A;  4ZYQ A;  1CPX A;  5HXD A;  4OLL A;  2AE6 A;  1I21 A;  1X12 A;  2OZG A;  5AG5 A;  2ZOF A;  1KUY A;  2QVP A;  5ISV A;  3EXN A;  2HUZ A;  2Z11 A;  4ZX8 A;  1M4I A;  3WC7 A;  4EWT A;  1R43 A;  2OZU A;  1L0C A;  4QB9 A;  4R6T A;  5D29 A;  5EBV A;  1EE3 P;  4KSA A;  4X8I A;  3PB4 X;  1V0C A;  2ZED A;  2POK A;  3B3V A;  4W9Y A;  3R9E A;  2ARH A;  3S6G A;  4F0X A;  4MY3 A;  2PJ5 A;  2ZEL A;  5F49 A;  4M6I A;  3KZW A;  4XPD C;  1AUG A;  1IID A;  3BI0 A;  2P6F A;  4ONU A;  3FNC A;  1CJW A;  2PJ9 A;  1F57 A;  3CZX A;  3NH4 A;  2AFZ A;  2AFS A;  2I00 A;  2QIR A;  5LYF A;  3C26 A;  4OC5 A;  4FUU A;  2GLF A;  4RUH A;  4AXV A;  4X5K A;  3I1U A;  4PPZ A;  3B3W A;  4NJR A;  4KVX A;  3D7G A;  4EVY A;  3EY5 A;  5I0C A;  4QUS A;  2AFO A;  2EUI A;  5LRK A;  3TC8 A;  3TT2 A;  1S7L A;  5AGE A;  4XPL A;  1NSA A;  2GIV A;  5IX3 A;  4PK2 A;  4OC3 A;  1XOV A;  3KKW A;  3WC5 A;  3VAR A;  1NE9 A;  4CYN A;  2DPT A;  1LRZ A;  4B12 A;  4NGN A;  1U6M A;  4UWJ A;  2PQ8 A;  2CNM A;  2PC1 A;  1Y7E A;  5LYD A;  4JYW A;  3MRU A;  2B4B A;  4AG7 A;  2HQY A;  3D2M A;  2C27 A;  4E2A A;  2V8D A;  2AFX A;  5J8C A;  2J9A A;  2Z3O A;  3KL9 A;  1LOK A;  3P2H A;  4MHP A;  4YRH A;  1ON0 A;  2FVG A;  2G9D A;  4NGT A;  4KZT A;  3KQZ A;  4HNX B;  3D7D A;  4NF1 A;  3B3C A;  4KLW A;  2Z3L A;  4K3N A;  2HV2 A;  2CY2 A;  1Y9W A;  3GYA A;  2BSW A;  1WWZ A;  3VAT A;  4OC2 A;  4JZ0 A;  2B4D B;  4MI4 A;  4OC1 A;  2YND A;  4YWY A;  3BHX A;  2WUU A;  4NXY A;  3E0K A;  1Q2Y A;  2C6G A;  3CXS A;  2BUE A;  2Z3M A;  4K30 A;  1BOB A;  4MHN A;  1YK3 A;  2JDD A;  2V8G A;  1ELM P;  3T90 A;  4UCN A;  4B6Z A;  1AMP A; 
#chains in the Genus database with same CATH homology
 4X2T A;  4NGR A;  4P44 A;  4F8Z A;  3H8F A;  3D7F A;  5LYL A;  3K9T A;  2OOT A;  3SI2 A;  1XMB A;  4NFR A;  1IGB A;  4OID A;  1HDU A;  1F2O A;  2PE3 A;  4F9V A;  2C6P A;  4ZX9 A;  1PCA A;  2QJ8 A;  4KSI A;  2PJA A;  3KAS A;  4NGP A;  4FBE A;  1VHE A;  1XFO A;  4NGQ A;  3BI1 A;  4MXU A;  3CPX A;  1ZLI A;  1Z2L A;  3PB6 X;  5LRJ A;  4IHM A;  3H8E A;  3CPA A;  1Y0Y A;  2V8V A;  4PXE A;  4P4D A;  1LAM A;  1TKH A;  2C6C A;  3DLJ A;  4TWE A;  1LFW A;  4WJB A;  2ZEH A;  1RTQ A;  4P10 A;  1YW4 A;  2PJ1 A;  2AFW A;  2XEJ A;  3IO1 A;  3RZA A;  5K8P A;  3KGQ A;  4OP4 A;  4UEF A;  2V8H A;  4DUK A;  1ELL P;  2JEW A;  3NH8 A;  4NJQ A;  2EK9 A;  4P4J A;  1CPS A;  2PIY A;  4MCS A;  4ZY0 A;  1VIX A;  5CBM A;  4P4E A;  1DE4 C;  1YLO A;  2HB6 A;  1YSJ A;  3CT9 A;  1H8L A;  3GB0 A;  2PJC A;  3FMC A;  3V38 A;  2PJ0 A;  2Q51 A;  2ZEE A;  5HVG A;  4O23 A;  3ISZ A;  4A94 A;  5IB9 A;  4UIB A;  3SI0 A;  2RB7 A;  1VGY A;  3FJU A;  2ABZ A;  1DTD A;  3HUV A;  1Z8L A;  3SJE A;  3B3T A;  1Y0R A;  4MHZ A;  2Q4Z A;  5JGF A;  2VL1 A;  5JH9 A;  1QQ9 A;  4FWU A;  1HDQ A;  1Z5R A;  4DYO A;  4F9U A;  2CF4 A;  4WWV A;  4NGS A;  1UWY A;  4Z65 A;  2DEA A;  2PVV A;  3IEH A;  3WC6 A;  2XEG A;  3RAM A;  2AFU A;  4UF4 A;  2PVW A;  2BCO A;  3H8G A;  3SJG A;  3WAB A;  1TKF A;  4UIA A;  2PRQ A;  4IK2 A;  5K8N A;  3NFZ A;  5LRG A;  4P4I A;  4ZY1 A;  3FX6 A;  2O53 A;  3MN8 A;  3D67 A;  3D66 A;  4X3R A;  3D4U A;  3PEI A;  4PXC A;  6CPA A;  1ARL A;  4ONW A;  1ZG8 A;  3LWU A;  3KQX A;  2PCU A;  3PFO A;  4BD9 A;  5THW A;  2JBJ A;  2WYR A;  1HEE A;  1KWM A;  3S9L A;  4IAV A;  2IJZ A;  3KR5 A;  3PBE A;  2NSM A;  4NGM A;  5D8N A;  3FEE A;  2WZN A;  4R8F A;  3DGV A;  1ZG9 A;  3FF3 A;  4YU9 A;  2PJ2 A;  3IWW A;  4TNU A;  5LYI A;  1QMU A;  2O4H A;  3KHX A;  4PXD A;  2ZEM A;  2QYV A;  2NYQ A;  1FT7 A;  1JQG A;  4A38 A;  2BO9 A;  3V7Z A;  1M4L A;  4R76 A;  2PJ7 A;  1LAN A;  2GRE A;  3KI9 A;  2PJ8 A;  3IC1 A;  4MCQ A;  2PJB A;  4FAI A;  1GYT A;  4CPA A;  2GU2 A;  4ZI6 A;  2PJ3 A;  5JM6 A;  4DJL A;  2RFH A;  1TXR A;  1XRY A;  3PBB A;  4PQA A;  3FVL A;  3SJF A;  2ZOG A;  4PXB A;  1AYE A;  1YME A;  2IQ6 A;  3PFE A;  1CX8 A;  3WT4 A;  3IIB A;  3B3S A;  5F09 A;  4OME A;  4MMO A;  1BLL E;  2Q43 A;  4LQG A;  2V77 A;  3D7H A;  3CDX A;  3SJX A;  1BAV A;  1LCP A;  3D68 A;  1CG2 A;  3N5F A;  3NH5 A;  2ZEF A;  4P6Y A;  4EFD A;  4A39 A;  2XEF A;  4P4B A;  8CPA A;  4A37 A;  1VHO A;  2OR4 A;  5HVH A;  3B35 A;  5DS0 A;  3KHZ A;  1ZLH A;  2PJ6 A;  4G1P A;  2ZEN A;  3FEC A;  4ZY2 A;  2XEI A;  3IFE A;  2ANP A;  1CP7 A;  4MCP A;  1F2P A;  4MRI A;  3JRU A;  4OC4 A;  3VH9 A;  1OBR A;  3TX8 A;  2CIJ A;  5K8O A;  3FED A;  2F8H A;  3B2Y A;  1YW6 A;  3PB9 X;  2HC9 A;  3IJ3 A;  4P45 A;  3PB8 X;  3ISX A;  2EWB A;  2PJ4 A;  3S9M A;  3RBU A;  7CPA A;  2AFM A;  1PYT B;  1Q7L A;  1TKJ A;  4Q7A A;  3LMS A;  3T8W A;  3S9N A;  2I3C A;  2F7V A;  1ARM A;  2CTC A;  1BPM A;  3FH4 A;  2C1C A;  2EK8 A;  4UEE A;  4MCR A;  4P4F A;  3KR4 A;  1LAP A;  5K8M A;  3L2N A;  4GM5 A;  1FNO A;  3QNV A;  3GUX A;  3BXM A;  4H2K A;  4MHY A;  4OKO A;  2BOA A;  4OIW A;  1BPN A;  3B7I A;  1XJO A;  1CBX A;  1TF8 A;  4R7M A;  2ZEG A;  1CP6 A;  5ELY A;  2ZEO A;  3PB7 X;  2PIZ A;  5J1Q A;  1XBU A;  5I4M A;  4EME A;  1IY7 A;  2ZEP A;  5CPA A;  1ZG7 A;  3K2K A;  4OC0 A;  2CTB A;  2JBK A;  3PRT A;  5HVF A;  3HLP A;  3GLJ A;  1R3N A;  2IMO A;  2GLJ A;  3SI1 A;  4UEZ A;  4ZYQ A;  1TF9 A;  5HXD A;  3NA6 A;  1CPX A;  2ZOF A;  2QVP A;  4ZX8 A;  3WC7 A;  4EWT A;  1R43 A;  4R6T A;  5D29 A;  1EE3 P;  4X8I A;  3PB4 X;  2ZED A;  2POK A;  3B3V A;  4W9Y A;  2PJ5 A;  2ZEL A;  3KZW A;  3BI0 A;  2PJ9 A;  1F57 A;  3NH4 A;  2AFZ A;  2AFS A;  5LYF A;  4OC5 A;  4FUU A;  2GLF A;  4RUH A;  4AXV A;  3I1U A;  4PPZ A;  3B3W A;  4NJR A;  3D7G A;  2AFO A;  5LRK A;  3TC8 A;  1NSA A;  4OC3 A;  3WC5 A;  3VAR A;  4NGN A;  5LYD A;  1Y7E A;  4JYW A;  3MRU A;  2V8D A;  2AFX A;  2J9A A;  3KL9 A;  1LOK A;  4MHP A;  2FVG A;  2G9D A;  4NGT A;  3KQZ A;  3D7D A;  3B3C A;  4K3N A;  3VAT A;  4OC2 A;  4JZ0 A;  4OC1 A;  4YWY A;  3BHX A;  2C6G A;  4MHN A;  2V8G A;  1ELM P;  4B6Z A;  1AMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...