4MHPA

Crystal structure of apo-form of glutaminyl cyclase from ixodes scapularis
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
326
structure length
326
Chain Sequence
LKWPRDLRPLAHHDLLYMGQISEEDRGDFNATLRNFLVPRVVGSQKHREVREFIVRSLKDLDWDVEEDCFDGQTPHGIKPFCNVIATLNPSACHRLVLACHYDSLLHKEGTFIGATDSAVPCAQLLYLARSLNGKLQNQKTRGDGLTLQLVFFDGEEAFERWSSHDSLYGSRHLAQKWHEDRTSAERLESCLERSEIANQIDRMEVMVLLDLLGAENPRFYSYFGETQPVYRRLVNIESRLNDAGLMELPRRRRRTNYFSNSSTVGFIEDDHIPFLKRSVPIVHIIPSPFPDVWHTLDDNEQNLHHPTISNLNKIFKAFVSEYLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional analyses of a glutaminyl cyclase from Ixodes scapularis reveal metal-independent catalysis and inhibitor binding.
pubmed doi rcsb
source organism Ixodes scapularis
molecule tags Transferase
molecule keywords Glutaminyl cyclase, putative
total genus 110
structure length 326
sequence length 326
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mhpA00
3PB7X 4OIDA 3D66A 1VHOA 5LYLA 2ANPA 3IWWA 1IGBA 5JGFA 1VIXA 4Z65A 3IIBA 1ZLIA 4MRIA 4ZY0A 1YW6A 3RZAA 2CIJA 3NA6A 4NGQA 3PB6X 3QNVA 2XEJA 2PJ8A 1VHEA 3K2KA 3KZWA 3D67A 1RTQA 3B7IA 4NJQA 3D68A 1LAMA 2O4HA 3LWUA 3IO1A 2ZOGA 5J1QA 2PIZA 4MHNA 2CTCA 3VARA 3IJ3A 3CPAA 3T8WA 4DYOA 2HB6A 4OIWA 2QYVA 3IEHA 2EK8A 1CBXA 5CBMA 4TNUA 4OC1A 1ARLA 2GLFA 2V8HA 5LYFA 5LRGA 5DS0A 3MRUA 2PJCA 2VL1A 4LQGA 4ZY2A 3IFEA 2GREA 1ELMP 3FX6A 1BPNA 4OC5A 2EWBA 1IY7A 5IB9A 1TXRA 4UEFA 1Z5RA 3KL9A 3WC5A 4P4IA 4OC4A 3I1UA 4MHPA 2PVWA 2WZNA 3D4UA 4DJLA 1Y0YA 4MCPA 8CPAA 1YSJA 2PJ6A 2PJ9A 4ZX8A 2AFUA 4ZYQA 2JBJA 1HEEA 1PCAA 1YW4A 3D7GA 2IMOA 5F09A 4K3NA 4X2TA 3PB8X 2JEWA 2I3CA 2AFMA 4PQAA 5D29A 3SJFA 3D7HA 2O53A 3KI9A 1F2OA 4IAVA 4P44A 1Z8LA 3JRUA 4WJBA 4NGSA 1F57A 1LCPA 2NSMA 2HC9A 4ZX9A 3PB4X 2GU2A 3CPXA 3HUVA 4F9UA 3N5FA 3FEEA 3SJGA 4A39A 2C1CA 2BOAA 3NH8A 3DLJA 5I4MA 1TKHA 3H8FA 3KGQA 4MMOA 3BHXA 1CG2A 5LYIA 3B3WA 3KR5A 3PB9X 1UWYA 4MHZA 1AMPA 4GM5A 4R8FA 2CF4A 1LOKA 1NSAA 4P4BA 3V7ZA 2AFOA 4NGPA 4OC3A 2V8VA 1FT7A 3B35A 2PVVA 4P6YA 5JM6A 2Q51A 4R76A 1XRYA 2C6GA 3TC8A 4KSIA 3GUXA 1LAPA 3L2NA 2BCOA 3HLPA 2C6PA 3RBUA 5K8PA 2J9AA 3GB0A 3NFZA 3SI1A 4A38A 1CX8A 1ZLHA 2CTBA 2ZEDA 2ZELA 1DE4C 3B2YA 2ZEOA 4F8ZA 5JH9A 3KQZA 3FJUA 2PJ2A 3KHXA 2AFXA 2AFZA 1VGYA 3MN8A 4A94A 2PRQA 2IQ6A 3BI0A 3PFEA 1JQGA 2PJBA 2EK9A 2ZOFA 2PJ4A 3BXMA 2NYQA 4WWVA 3WC7A 2F8HA 2PJ3A 4MHYA 1ZG8A 1GYTA 2OR4A 1LANA 4A37A 1AYEA 3SJXA 2ZEFA 1CPSA 3ISZA 3S9MA 2ZENA 1ELLP 1R43A 1CP6A 2PCUA 4R6TA 4UIBA 2ZEPA 2RFHA 4FUUA 4MXUA 3VH9A 3H8EA 4JZ0A 2DEAA 3B3SA 3NH5A 3LMSA 2WYRA 4Q7AA 2OOTA 3PFOA 3PBBA 7CPAA 3PRTA 1TKFA 4ZY1A 3DGVA 3BI1A 4X8IA 1QMUA 1EE3P 1XMBA 4PXEA 4UIAA 4NGNA 4CPAA 2V8DA 2ZEGA 2GLJA 2C6CA 4P10A 1BLLE 2XEIA 4NJRA 1YLOA 1ZG7A 4OC0A 4AXVA 4PXDA 4NFRA 3SJEA 3IC1A 3VATA 1R3NA 3PBEA 1CPXA 4G1PA 2QJ8A 5K8MA 4P45A 4P4EA 3V38A 1Q7LA 4X3RA 5K8OA 1XFOA 2XEFA 2PJ0A 2Q4ZA 4NGRA 2AFWA 5ELYA 3H8GA 2IJZA 2ZEHA 4BD9A 1F2PA 3B3VA 3CT9A 3B3CA 3FMCA 4PXBA 1XBUA 4P4JA 3FH4A 2PJ7A 3WABA 2BO9A 4O23A 1H8LA 3D7DA 3WC6A 3WT4A 2ABZA 3S9LA 3KHZA 4DUKA 2FVGA 5CPAA 5HVFA 1HDQA 4FWUA 4OKOA 4PXCA 2PJAA 3ISXA 1BPMA 1TF8A 5THWA 3S9NA 3FVLA 4EMEA 4P4FA 4IHMA 3CDXA 4OMEA 4NGMA 4OC2A 4EWTA 4TWEA 4NGTA 1ZG9A 5K8NA 2AFSA 3SI0A 4YWYA 2F7VA 1XJOA 1HDUA 3GLJA 4RUHA 3K9TA 3PEIA 5LYDA 4EFDA 1KWMA 1BAVA 1M4LA 3D7FA 4B6ZA 2PJ1A 1CP7A 1FNOA 3FEDA 5D8NA 1Y7EA 4H2KA 4OP4A 4MCRA 2V77A 4ONWA 3RAMA 3FF3A 6CPAA 4UF4A 1PYTB 3KR4A 3KQXA 3FECA 1TF9A 1ARMA 4JYWA 4FBEA 2ZEMA 1OBRA 3KASA 2ZEEA 4UEZA 4MCSA 4ZI6A 5HVHA 5HXDA 4P4DA 1Z2LA 3SI2A 5HVGA 4W9YA 4FAIA 2V8GA 3TX8A 5LRJA 2JBKA 4IK2A 2RB7A 4YU9A 1LFWA 2PE3A 1Y0RA 1TKJA 1YMEA 2POKA 2PIYA 1QQ9A 4PPZA 4F9VA 2G9DA 3NH4A 4R7MA 5LRKA 4MCQA 2PJ5A 3B3TA 2Q43A 2XEGA 2QVPA 4UEEA 1DTDA
chains in the Genus database with same CATH superfamily
3PB7X 2P6EA 4M85A 4OIDA 3D66A 1IICA 1VHOA 3QAYA 5LYLA 2ANPA 3R96A 3IWWA 4NEXA 4LQ6A 2REEA 1IGBA 5JGFA 1VIXA 4Z65A 2R7HA 3IIBA 4KVME 1Y7RA 1ZLIA 2YNEA 4KOSA 4MRIA 1YW6A 3RZAA 4CGMA 4ZY0A 2CIJA 2G3TA 3GKRA 3N7ZA 4NXYA 2REFA 4Q36A 3NA6A 4NGQA 3LACA 2I00A 3PB6X 3QNVA 3LD2A 2H5MA 4KLWA 2XEJA 2PJ8A 1VHEA 3C26A 3EY5A 1SQHA 3K2KA 3KZWA 4XPLA 2ZPAA 1QSNA 3D67A 3R95A 3DDDA 5AG7A 4BMHA 1RTQA 3B7IA 1YVKA 4E0AA 2OZUA 2FCKA 4NJQA 3TT2A 3D68A 5AG4A 1J4JA 2R1IA 1LAMA 1S7LA 2O4HA 4UCMA 3LWUA 4UCNA 3IO1A 3BJ7A 2ZOGA 2HQYA 5G22A 3R9GA 3RYOA 4M6GA 5E96A 5J1QA 5ISVA 5KTAA 2PIZA 3JTKA 2Z11A 3R1KA 4MJ8A 3FNCA 4MHNA 2CTCA 3VARA 4AB7A 3IJ3A 3CPAA 3T8WA 4DYOA 2FT0A 2HB6A 3T9YA 4OIWA 2QIRA 2VI7A 2QYVA 3IEHA 3D2PA 4AVCA 4MFKA 2EK8A 1CBXA 5CBMA 1NE9A 4TNUA 4OC1A 1ARLA 2B4BA 2FL4A 2GLFA 4E8OA 2ARHA 2V8HA 1XE4A 5LYFA 3H4QA 5LRGA 3FIXA 5C82A 5DS0A 3MRUA 2PJCA 4ONUA 4R87A 4NF1A 4OADA 4C2YA 2VL1A 4LQGA 1XOVA 4ZY2A 2Q04A 3IFEA 4ZGYB 2GREA 1ELMP 3FX6A 1Z8WA 2PRBA 5H84A 4CGLA 2VXKA 3EC4A 1M4GA 1BPNA 2QMLA 2Z3OA 4OC5A 2EWBA 1UFHA 4XNHC 1IY7A 2ODFA 1TXRA 4KLVA 5IB9A 2J8NA 2YNCA 2WSAA 4UEFA 1Z5RA 3CXQA 3W6SA 4KSFA 2P6GA 1ZO0A 3KL9A 4NSQA 3WC5A 4F6AA 2PR1A 4L8AA 4P4IA 1YQEA 4OC4A 1QSMA 3I1UA 4MHPA 5F48A 4AG9A 2FIWA 2DXQA 2PVWA 2WZNA 3D4UA 4DJLA 1IYKA 1Y0YA 2I79A 4R3LA 3TO7A 3MGDA 4MCPA 2VEZA 4RS2A 1YSJA 8CPAA 2CNSA 1KUYA 2YNDA 3FBUA 2PJ6A 3R9EA 3R9FA 1YREA 4JLYA 2PJ9A 4Y49B 2AFUA 4ZX8A 4ZYQA 3TO9A 3SHPA 4CRZB 3WR7A 2JBJA 1HEEA 1PCAA 4HNYB 1YW4A 1MK4A 3D7GA 4A31A 2FE7A 2HV2A 4KOYA 4MBUA 2IMOA 2KCWA 5F09A 2EVNA 1YK3A 4K3NA 4X2TA 3PB8X 4B13A 4CYQA 2JEWA 2I3CA 2AFMA 4PQAA 5D29A 3SJFA 1KUXA 3DSBA 3D7HA 4YFJA 2ZW5A 2DPSA 4B12A 1B87A 2O53A 4MFJA 3UY5A 3KI9A 1F2OA 4IAVA 1M1DA 2Z3NA 3I3GA 4P44A 1Z8LA 3JRUA 4WJBA 4NGSA 1F57A 4M6HA 2PQ8A 2F5IA 4KVXA 5G21A 3FXTA 5IX3A 1RXTA 1LCPA 2WPWA 4JXQA 3ZJ0A 2NSMA 3T90A 2Y0MA 1QSOA 2HC9A 4ZX9A 3PB4X 2GU2A 2PC1A 1VHSA 3CPXA 3HUVA 4CYNA 4JJXA 3N5FA 4F9UA 2Z3KA 3FEEA 3S6FA 1Q2YA 3SJGA 3CXPA 4A39A 4GXHA 2C1CA 2BOAA 3NH8A 1MJ9A 3DLJA 4CRYB 4MI4A 5I4MA 1TKHA 3GIUA 2PDOA 2ZW7A 4GS4A 4KOTA 3H8FA 3KGQA 4MMOA 3BHXA 1CG2A 5LYIA 1YLEA 3B3WA 4B5PB 4CAFA 3KR5A 3PB9X 1UWYA 4MHZA 2CNMA 3GYAA 1YX0A 1AMPA 4GM5A 4R8FA 3VWDA 4MFPA 4MHDA 2CF4A 1LOKA 1NSAA 2X7BA 4P4BA 4PV6A 3V7ZA 4C68A 4CGPA 2AFOA 4NGPA 1P0HA 1B6BA 4R57A 3TE4A 4OC3A 2V8VA 1FT7A 1XEBA 2WPXA 3B35A 4UFXA 2PVVA 3ZZIA 4P6YA 4HNXB 2WUUA 5HH1A 5JM6A 2Q51A 4XPDB 1XRYA 2C6GA 4R76A 4JXRA 3S6GA 1WK4A 4BBHA 2PR8A 3TC8A 4KSIA 3GUXA 1FY7A 3SXNA 1LAPA 3L2NA 3KKWA 3LODA 2BCOA 3HLPA 1MJAA 3E0KA 2OZHA 1YGHA 2C6PA 3RBUA 5K8PA 4J3GA 2J9AA 4XPKA 3GB0A 3NFZA 3SI1A 4PK2A 1CX8A 1ZLHA 1IB1E 4A38A 4KUAA 2CTBA 2ZEDA 2ZELA 4UBRA 1Q2CA 1DE4C 3B2YA 2ZEOA 4L89A 4F8ZA 3NE7A 5JH9A 4B5OA 3KQZA 2EO8A 2QECA 1K4JA 2PJ2A 3DR6A 3FJUA 3JUWA 2AFXA 2AFZA 3KHXA 4R9MA 1VGYA 3MN8A 1AUGA 3EO4A 2J8RA 2B3VA 4CAXA 2JLMA 4E2AA 4A94A 2Q4VA 2PRQA 2IQ6A 3BI0A 5H86A 3PFEA 2Q7BA 1JQGA 5AG6A 3TOAA 2CY2A 4PSWA 5KTDA 2PJBA 2EK9A 1U6MA 2ZOFA 2PJ4A 2JEVA 4DNCA 4H89A 1OZPA 3BXMA 2NYQA 3F8KA 4WWVA 3WC7A 4C7IA 2F8HA 3DNSA 3D2MA 5F49A 2PJ3A 1XF8A 3IU2A 4MHYA 4KS9A 1ZG8A 1GYTA 4UFWA 5IB0A 2OR4A 4C7HA 4II9A 1IOFA 1LANA 4A37A 1AYEA 2VZZA 5G1ZA 3A9LA 4A2ZA 2JDDA 2R98A 3SJXA 3D8PA 2ZEFA 1CPSA 3BJ8A 3ISZA 3S9MA 2ZENA 1ELLP 3VWEA 1R43A 4C2XA 5C88A 1V0CA 1CP6A 2PCUA 1WWZA 4MFZA 2BL1A 4R6TA 4A95A 2ZW4A 4UIBA 2ZEPA 4QB9A 1S7KA 2RFHA 3IWEA 3JVNA 3K9UA 4KOXA 4FUUA 3EXNA 4MXUA 3H8EA 4JZ0A 2DEAA 1S5KA 2AJ6A 3VH9A 3B3SA 3NH5A 4CS0B 3LMSA 4KOUA 4X8IA 2WYRA 2P0WA 1IU8A 3F5BA 4Q7AA 2FSRA 4CAEA 4B11A 2OOTA 4KOWA 2DF5A 3PFOA 1Z4EA 4EVYA 3PBBA 1Z8TA 2CXAA 3F0AA 4RI1A 3B8GA 4F0XA 7CPAA 1BO4A 1P4NA 3PRTA 1TKFA 2YGWA 4ZY1A 2B4DB 3DGVA 3BI1A 2B5GB 3H5ZA 1NMTA 1QMUA 1I21A 1EE3P 1XMBA 4PXEA 2Z3MA 4NGNA 2RC4A 4UIAA 2VQYA 2V8DA 4K30A 3RO0A 2J8MA 4QUSA 4CPAA 4PSXA 2FIAA 2ZEGA 2GLJA 2C6CA 3OWCA 4P10A 1JWQA 1CM0A 2BSWA 2NMTA 4PK3A 4UWIA 5AGEA 1BLLE 4CYPA 4LX9A 2XEIA 2D4OA 1Y9WA 4X5KA 4NJRA 3S6HA 1YLOA 3W6XA 5A28A 5KTCA 1ZG7A 3CZXA 4OC0A 4ORFA 5BWAB 2JDCA 4AXVA 2R8VA 3EFAA 3TCVA 4PXDA 4NFRA 3SJEA 3CXSA 1S3ZA 4UA3A 3IC1A 3VATA 3P2FA 5G20A 1R3NA 3PBEA 4I49A 1CPXA 2ATRA 4G1PA 4CGOA 2QJ8A 1Z9UA 2GANA 4HKFA 2VBQA 1YR0A 4P45A 4P4EA 1Q7LA 4X3RA 3V38A 5K8MA 5K8OA 1XFOA 2XEFA 2Z3PA 4KSAA 1X12A 2PJ0A 1VKCA 3IWGA 2Q44A 4A33A 5DWNA 2Q4ZA 4NGRA 2BEIA 4MY0A 2AFWA 1BOBA 2VZYA 2Q4YA 5EBVA 5ELYA 3H8GA 3P2HA 4U5YA 1NSLA 3TO6A 2IJZA 2PSWA 5FVJA 4CAVA 4OAEA 4OLLA 2B58A 4CGNA 1S7FA 2ZEHA 4CYOA 4BD9A 1KZFA 1F2PA 4IUSA 2A4NA 3B3VA 3CT9A 2GIVA 3B3CA 1QSRA 2OU2A 3FMCA 4C2ZA 5EC4A 4PXBA 1XBUA 4P4JA 2C27A 3FH4A 2PJ7A 3WABA 1TIQA 2BO9A 3I9SA 2GE3A 4O23A 1RO5A 1H8LA 4IF5A 3D7DA 3WC6A 3WT4A 2ABZA 2DPTA 1LRZA 4B5PA 4FD5A 4B10A 5JPHA 4QBJA 3S9LA 3KHZA 4DUKA 5CNPA 4MFQA 4XPDC 4U9YA 4AVBA 4JWPA 2FVGA 5EMIA 4A30A 5CPAA 5HVFA 1HDQA 1IOIA 4FWUA 2AE6A 3G3SA 4OKOA 1GHEA 1N71A 4PXCA 2PJAA 4U9ZA 1ON0A 1IYLA 1YVOA 2YNCC 3ISXA 1Q2DA 2HUZA 3IGRA 1BPMA 1TF8A 4KZTA 5THWA 3S9NA 2BUEA 3FVLA 1XIXA 4EMEA 2OH1A 4P4FA 4IHMA 1QSTA 4NCZA 3CDXA 4AVAA 3TOBA 1XMTA 4OMEA 4NGMA 4F0YA 2O28A 3V8IA 3FB3A 3FRMA 4OC2A 4AG7A 5AG5A 4EWTA 4TWEA 4NGTA 4UFVA 1R57A 4KORA 4YGOA 4BINA 1ZG9A 2EUIA 5J8FA 5K8NA 2P6FA 4H6UA 2K5TA 2AFSA 4A32A 1Z8XA 3TFYA 2Z10A 2ZXVA 3RNZA 3SI0A 1MJBA 4YWYA 2F7VA 1XJOA 2D4PA 1HDUA 3G8WA 3GLJA 1I12A 4ZBGA 4RUHA 2FXFA 4M6IA 5JQ4A 3K9TA 3PEIA 5LYDA 4FD4A 1KUVA 1KWMA 4EFDA 1BAVA 4QVTA 2IL4A 3BLNA 1M4LA 5F47A 3D7FA 4B6ZA 2PJ1A 4UCPA 1CP7A 4HNWB 1FNOA 4B14A 3FEDA 4MY3A 5D8NA 5DWMA 1Y7EA 4H2KA 4OP4A 4MCRA 4RN7A 4KOVA 2GFQA 2V77A 4ONWA 3RAMA 3FF3A 4HPSA 4UF4A 6CPAA 1PYTB 4Q38A 4CAWA 2EBJA 1I1DA 1M44A 2Q0YA 2Z3LA 3KQXA 3KR4A 4KUBA 3FECA 1TF9A 2Z0ZA 2OZGA 1IIDA 3S6KA 1ARMA 4JYWA 4Y49C 3IU1A 4M3SA 5J8CA 4FBEA 2ZEMA 1OBRA 3FYNA 1CJWA 3KASA 5GCNA 3W91A 2ZEEA 2ZW6A 4MCSA 4UEZA 4YRHA 3PGPA 3SXOA 3DR8A 3PZJA 4ZI6A 5HVHA 5HXDA 4P4DA 2G3AA 4FD6A 1Z2LA 3QB8A 4XNHB 3SI2A 1A2ZA 3NE8A 2B5GA 5HVGA 4W9YA 4FAIA 2V8GA 3TX8A 1PUAA 2FS5A 5LRJA 4H6ZA 4MFLA 2JBKA 4IK2A 2RB7A 4YU9A 5HMNA 5A27A 1LFWA 3D3SA 4UWJA 1PU9A 2PE3A 5F46A 4JD6A 1Y0RA 3PP9A 2OB0A 4QC6A 1TKJA 1X10A 2Q7SA 4R3KA 1Y9KA 5I0CA 1YMEA 2POKA 4LUAA 2PIYA 3QAHA 1QQ9A 1S60A 4PPZA 4F9VA 4KVOE 2G9DA 3NH4A 4R7MA 5LRKA 3GY9A 4FD7A 2B4DA 4MCQA 1S7NA 1M4DA 1Z4RA 2PJ5A 5IV0A 1M4IA 1L0CA 2Q43A 2XEGA 2QVPA 3B3TA 4UEEA 2B3UA 3TTHA 1DTDA 2CNTA 2G0BA
chains in the Genus database with same CATH topology
3PB7X 4OIDA 3D66A 1VHOA 5LYLA 2ANPA 3IWWA 1IGBA 5JGFA 1VIXA 4Z65A 3IIBA 1ZLIA 4MRIA 4ZY0A 1YW6A 3RZAA 2CIJA 3NA6A 4NGQA 3PB6X 3QNVA 2XEJA 2PJ8A 1VHEA 3K2KA 3KZWA 3D67A 1RTQA 3B7IA 4NJQA 3D68A 1LAMA 2O4HA 3LWUA 3IO1A 2ZOGA 5J1QA 2PIZA 4MHNA 2CTCA 3VARA 3IJ3A 3CPAA 3T8WA 4DYOA 2HB6A 4OIWA 2QYVA 3IEHA 2EK8A 1CBXA 5CBMA 4TNUA 4OC1A 1ARLA 2GLFA 2V8HA 5LYFA 5LRGA 5DS0A 3MRUA 2PJCA 2VL1A 4LQGA 4ZY2A 3IFEA 2GREA 1ELMP 3FX6A 1BPNA 4OC5A 2EWBA 1IY7A 5IB9A 1TXRA 4UEFA 1Z5RA 3KL9A 3WC5A 4P4IA 4OC4A 3I1UA 4MHPA 2PVWA 2WZNA 3D4UA 4DJLA 1Y0YA 4MCPA 8CPAA 1YSJA 2PJ6A 2PJ9A 4ZX8A 2AFUA 4ZYQA 2JBJA 1HEEA 1PCAA 1YW4A 3D7GA 2IMOA 5F09A 4K3NA 4X2TA 3PB8X 2JEWA 2I3CA 2AFMA 4PQAA 5D29A 3SJFA 3D7HA 2O53A 3KI9A 1F2OA 4IAVA 4P44A 1Z8LA 3JRUA 4WJBA 4NGSA 1F57A 1LCPA 2NSMA 2HC9A 4ZX9A 3PB4X 2GU2A 3CPXA 3HUVA 4F9UA 3N5FA 3FEEA 3SJGA 4A39A 2C1CA 2BOAA 3NH8A 3DLJA 5I4MA 1TKHA 3H8FA 3KGQA 4MMOA 3BHXA 1CG2A 5LYIA 3B3WA 3KR5A 3PB9X 1UWYA 4MHZA 1AMPA 4GM5A 4R8FA 2CF4A 1LOKA 1NSAA 4P4BA 3V7ZA 2AFOA 4NGPA 4OC3A 2V8VA 1FT7A 3B35A 2PVVA 4P6YA 5JM6A 2Q51A 4R76A 1XRYA 2C6GA 3TC8A 4KSIA 3GUXA 1LAPA 3L2NA 2BCOA 3HLPA 2C6PA 3RBUA 5K8PA 2J9AA 3GB0A 3NFZA 3SI1A 4A38A 1CX8A 1ZLHA 2CTBA 2ZEDA 2ZELA 1DE4C 3B2YA 2ZEOA 4F8ZA 5JH9A 3KQZA 3FJUA 2PJ2A 3KHXA 2AFXA 2AFZA 1VGYA 3MN8A 4A94A 2PRQA 2IQ6A 3BI0A 3PFEA 1JQGA 2PJBA 2EK9A 2ZOFA 2PJ4A 3BXMA 2NYQA 4WWVA 3WC7A 2F8HA 2PJ3A 4MHYA 1ZG8A 1GYTA 2OR4A 1LANA 4A37A 1AYEA 3SJXA 2ZEFA 1CPSA 3ISZA 3S9MA 2ZENA 1ELLP 1R43A 1CP6A 2PCUA 4R6TA 4UIBA 2ZEPA 2RFHA 4FUUA 4MXUA 3VH9A 3H8EA 4JZ0A 2DEAA 3B3SA 3NH5A 3LMSA 2WYRA 4Q7AA 2OOTA 3PFOA 3PBBA 7CPAA 3PRTA 1TKFA 4ZY1A 3DGVA 3BI1A 4X8IA 1QMUA 1EE3P 1XMBA 4PXEA 4UIAA 4NGNA 4CPAA 2V8DA 2ZEGA 2GLJA 2C6CA 4P10A 1BLLE 2XEIA 4NJRA 1YLOA 1ZG7A 4OC0A 4AXVA 4PXDA 4NFRA 3SJEA 3IC1A 3VATA 1R3NA 3PBEA 1CPXA 4G1PA 2QJ8A 5K8MA 4P45A 4P4EA 3V38A 1Q7LA 4X3RA 5K8OA 1XFOA 2XEFA 2PJ0A 2Q4ZA 4NGRA 2AFWA 5ELYA 3H8GA 2IJZA 2ZEHA 4BD9A 1F2PA 3B3VA 3CT9A 3B3CA 3FMCA 4PXBA 1XBUA 4P4JA 3FH4A 2PJ7A 3WABA 2BO9A 4O23A 1H8LA 3D7DA 3WC6A 3WT4A 2ABZA 3S9LA 3KHZA 4DUKA 2FVGA 5CPAA 5HVFA 1HDQA 4FWUA 4OKOA 4PXCA 2PJAA 3ISXA 1BPMA 1TF8A 5THWA 3S9NA 3FVLA 4EMEA 4P4FA 4IHMA 3CDXA 4OMEA 4NGMA 4OC2A 4EWTA 4TWEA 4NGTA 1ZG9A 5K8NA 2AFSA 3SI0A 4YWYA 2F7VA 1XJOA 1HDUA 3GLJA 4RUHA 3K9TA 3PEIA 5LYDA 4EFDA 1KWMA 1BAVA 1M4LA 3D7FA 4B6ZA 2PJ1A 1CP7A 1FNOA 3FEDA 5D8NA 1Y7EA 4H2KA 4OP4A 4MCRA 2V77A 4ONWA 3RAMA 3FF3A 6CPAA 4UF4A 1PYTB 3KR4A 3KQXA 3FECA 1TF9A 1ARMA 4JYWA 4FBEA 2ZEMA 1OBRA 3KASA 2ZEEA 4UEZA 4MCSA 4ZI6A 5HVHA 5HXDA 4P4DA 1Z2LA 3SI2A 5HVGA 4W9YA 4FAIA 2V8GA 3TX8A 5LRJA 2JBKA 4IK2A 2RB7A 4YU9A 1LFWA 2PE3A 1Y0RA 1TKJA 1YMEA 2POKA 2PIYA 1QQ9A 4PPZA 4F9VA 2G9DA 3NH4A 4R7MA 5LRKA 4MCQA 2PJ5A 3B3TA 2Q43A 2XEGA 2QVPA 4UEEA 1DTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PB7 X;  4OID A;  3D66 A;  1VHO A;  5LYL A;  2ANP A;  3IWW A;  1IGB A;  5JGF A;  1VIX A;  4Z65 A;  3IIB A;  1ZLI A;  4MRI A;  4ZY0 A;  1YW6 A;  3RZA A;  2CIJ A;  3NA6 A;  4NGQ A;  3PB6 X;  3QNV A;  2XEJ A;  2PJ8 A;  1VHE A;  3K2K A;  3KZW A;  3D67 A;  1RTQ A;  3B7I A;  4NJQ A;  3D68 A;  1LAM A;  2O4H A;  3LWU A;  3IO1 A;  2ZOG A;  5J1Q A;  2PIZ A;  4MHN A;  2CTC A;  3VAR A;  3IJ3 A;  3CPA A;  3T8W A;  4DYO A;  2HB6 A;  4OIW A;  2QYV A;  3IEH A;  2EK8 A;  1CBX A;  5CBM A;  4TNU A;  4OC1 A;  1ARL A;  2GLF A;  2V8H A;  5LYF A;  5LRG A;  5DS0 A;  3MRU A;  2PJC A;  2VL1 A;  4LQG A;  4ZY2 A;  3IFE A;  2GRE A;  1ELM P;  3FX6 A;  1BPN A;  4OC5 A;  2EWB A;  1IY7 A;  5IB9 A;  1TXR A;  4UEF A;  1Z5R A;  3KL9 A;  3WC5 A;  4P4I A;  4OC4 A;  3I1U A;  4MHP A;  2PVW A;  2WZN A;  3D4U A;  4DJL A;  1Y0Y A;  4MCP A;  8CPA A;  1YSJ A;  2PJ6 A;  2PJ9 A;  4ZX8 A;  2AFU A;  4ZYQ A;  2JBJ A;  1HEE A;  1PCA A;  1YW4 A;  3D7G A;  2IMO A;  5F09 A;  4K3N A;  4X2T A;  3PB8 X;  2JEW A;  2I3C A;  2AFM A;  4PQA A;  5D29 A;  3SJF A;  3D7H A;  2O53 A;  3KI9 A;  1F2O A;  4IAV A;  4P44 A;  1Z8L A;  3JRU A;  4WJB A;  4NGS A;  1F57 A;  1LCP A;  2NSM A;  2HC9 A;  4ZX9 A;  3PB4 X;  2GU2 A;  3CPX A;  3HUV A;  4F9U A;  3N5F A;  3FEE A;  3SJG A;  4A39 A;  2C1C A;  2BOA A;  3NH8 A;  3DLJ A;  5I4M A;  1TKH A;  3H8F A;  3KGQ A;  4MMO A;  3BHX A;  1CG2 A;  5LYI A;  3B3W A;  3KR5 A;  3PB9 X;  1UWY A;  4MHZ A;  1AMP A;  4GM5 A;  4R8F A;  2CF4 A;  1LOK A;  1NSA A;  4P4B A;  3V7Z A;  2AFO A;  4NGP A;  4OC3 A;  2V8V A;  1FT7 A;  3B35 A;  2PVV A;  4P6Y A;  5JM6 A;  2Q51 A;  4R76 A;  1XRY A;  2C6G A;  3TC8 A;  4KSI A;  3GUX A;  1LAP A;  3L2N A;  2BCO A;  3HLP A;  2C6P A;  3RBU A;  5K8P A;  2J9A A;  3GB0 A;  3NFZ A;  3SI1 A;  4A38 A;  1CX8 A;  1ZLH A;  2CTB A;  2ZED A;  2ZEL A;  1DE4 C;  3B2Y A;  2ZEO A;  4F8Z A;  5JH9 A;  3KQZ A;  3FJU A;  2PJ2 A;  3KHX A;  2AFX A;  2AFZ A;  1VGY A;  3MN8 A;  4A94 A;  2PRQ A;  2IQ6 A;  3BI0 A;  3PFE A;  1JQG A;  2PJB A;  2EK9 A;  2ZOF A;  2PJ4 A;  3BXM A;  2NYQ A;  4WWV A;  3WC7 A;  2F8H A;  2PJ3 A;  4MHY A;  1ZG8 A;  1GYT A;  2OR4 A;  1LAN A;  4A37 A;  1AYE A;  3SJX A;  2ZEF A;  1CPS A;  3ISZ A;  3S9M A;  2ZEN A;  1ELL P;  1R43 A;  1CP6 A;  2PCU A;  4R6T A;  4UIB A;  2ZEP A;  2RFH A;  4FUU A;  4MXU A;  3VH9 A;  3H8E A;  4JZ0 A;  2DEA A;  3B3S A;  3NH5 A;  3LMS A;  2WYR A;  4Q7A A;  2OOT A;  3PFO A;  3PBB A;  7CPA A;  3PRT A;  1TKF A;  4ZY1 A;  3DGV A;  3BI1 A;  4X8I A;  1QMU A;  1EE3 P;  1XMB A;  4PXE A;  4UIA A;  4NGN A;  4CPA A;  2V8D A;  2ZEG A;  2GLJ A;  2C6C A;  4P10 A;  1BLL E;  2XEI A;  4NJR A;  1YLO A;  1ZG7 A;  4OC0 A;  4AXV A;  4PXD A;  4NFR A;  3SJE A;  3IC1 A;  3VAT A;  1R3N A;  3PBE A;  1CPX A;  4G1P A;  2QJ8 A;  5K8M A;  4P45 A;  4P4E A;  3V38 A;  1Q7L A;  4X3R A;  5K8O A;  1XFO A;  2XEF A;  2PJ0 A;  2Q4Z A;  4NGR A;  2AFW A;  5ELY A;  3H8G A;  2IJZ A;  2ZEH A;  4BD9 A;  1F2P A;  3B3V A;  3CT9 A;  3B3C A;  3FMC A;  4PXB A;  1XBU A;  4P4J A;  3FH4 A;  2PJ7 A;  3WAB A;  2BO9 A;  4O23 A;  1H8L A;  3D7D A;  3WC6 A;  3WT4 A;  2ABZ A;  3S9L A;  3KHZ A;  4DUK A;  2FVG A;  5CPA A;  5HVF A;  1HDQ A;  4FWU A;  4OKO A;  4PXC A;  2PJA A;  3ISX A;  1BPM A;  1TF8 A;  5THW A;  3S9N A;  3FVL A;  4EME A;  4P4F A;  4IHM A;  3CDX A;  4OME A;  4NGM A;  4OC2 A;  4EWT A;  4TWE A;  4NGT A;  1ZG9 A;  5K8N A;  2AFS A;  3SI0 A;  4YWY A;  2F7V A;  1XJO A;  1HDU A;  3GLJ A;  4RUH A;  3K9T A;  3PEI A;  5LYD A;  4EFD A;  1KWM A;  1BAV A;  1M4L A;  3D7F A;  4B6Z A;  2PJ1 A;  1CP7 A;  1FNO A;  3FED A;  5D8N A;  1Y7E A;  4H2K A;  4OP4 A;  4MCR A;  2V77 A;  4ONW A;  3RAM A;  3FF3 A;  6CPA A;  4UF4 A;  1PYT B;  3KR4 A;  3KQX A;  3FEC A;  1TF9 A;  1ARM A;  4JYW A;  4FBE A;  2ZEM A;  1OBR A;  3KAS A;  2ZEE A;  4UEZ A;  4MCS A;  4ZI6 A;  5HVH A;  5HXD A;  4P4D A;  1Z2L A;  3SI2 A;  5HVG A;  4W9Y A;  4FAI A;  2V8G A;  3TX8 A;  5LRJ A;  2JBK A;  4IK2 A;  2RB7 A;  4YU9 A;  1LFW A;  2PE3 A;  1Y0R A;  1TKJ A;  1YME A;  2POK A;  2PIY A;  1QQ9 A;  4PPZ A;  4F9V A;  2G9D A;  3NH4 A;  4R7M A;  5LRK A;  4MCQ A;  2PJ5 A;  3B3T A;  2Q43 A;  2XEG A;  2QVP A;  4UEE A;  1DTD A; 
#chains in the Genus database with same CATH topology
 3PB7 X;  2P6E A;  4M85 A;  4OID A;  3D66 A;  1IIC A;  1VHO A;  3QAY A;  5LYL A;  2ANP A;  3R96 A;  3IWW A;  4NEX A;  4LQ6 A;  2REE A;  1IGB A;  5JGF A;  1VIX A;  4Z65 A;  2R7H A;  3IIB A;  4KVM E;  1Y7R A;  1ZLI A;  2YNE A;  4KOS A;  4MRI A;  1YW6 A;  3RZA A;  4CGM A;  4ZY0 A;  2CIJ A;  2G3T A;  3GKR A;  3N7Z A;  4NXY A;  2REF A;  4Q36 A;  3NA6 A;  4NGQ A;  3LAC A;  2I00 A;  3PB6 X;  3QNV A;  3LD2 A;  2H5M A;  4KLW A;  2XEJ A;  2PJ8 A;  1VHE A;  3C26 A;  3EY5 A;  1SQH A;  3K2K A;  3KZW A;  4XPL A;  2ZPA A;  1QSN A;  3D67 A;  3R95 A;  3DDD A;  5AG7 A;  4BMH A;  1RTQ A;  3B7I A;  1YVK A;  4E0A A;  2OZU A;  2FCK A;  4NJQ A;  3TT2 A;  3D68 A;  5AG4 A;  1J4J A;  2R1I A;  1LAM A;  1S7L A;  2O4H A;  4UCM A;  3LWU A;  4UCN A;  3IO1 A;  3BJ7 A;  2ZOG A;  2HQY A;  5G22 A;  3R9G A;  3RYO A;  4M6G A;  5E96 A;  5J1Q A;  5ISV A;  5KTA A;  2PIZ A;  3JTK A;  2Z11 A;  3R1K A;  4MJ8 A;  3FNC A;  4MHN A;  2CTC A;  3VAR A;  4AB7 A;  3IJ3 A;  3CPA A;  3T8W A;  4DYO A;  2FT0 A;  2HB6 A;  3T9Y A;  4OIW A;  2QIR A;  2VI7 A;  2QYV A;  3IEH A;  3D2P A;  4AVC A;  4MFK A;  2EK8 A;  1CBX A;  5CBM A;  1NE9 A;  4TNU A;  4OC1 A;  1ARL A;  2B4B A;  2FL4 A;  2GLF A;  4E8O A;  2ARH A;  2V8H A;  1XE4 A;  5LYF A;  3H4Q A;  5LRG A;  3FIX A;  5C82 A;  5DS0 A;  3MRU A;  2PJC A;  4ONU A;  4R87 A;  4NF1 A;  4OAD A;  4C2Y A;  2VL1 A;  4LQG A;  1XOV A;  4ZY2 A;  2Q04 A;  3IFE A;  4ZGY B;  2GRE A;  1ELM P;  3FX6 A;  1Z8W A;  2PRB A;  5H84 A;  4CGL A;  2VXK A;  3EC4 A;  1M4G A;  1BPN A;  2QML A;  2Z3O A;  4OC5 A;  2EWB A;  1UFH A;  4XNH C;  1IY7 A;  2ODF A;  1TXR A;  4KLV A;  5IB9 A;  2J8N A;  2YNC A;  2WSA A;  4UEF A;  1Z5R A;  3CXQ A;  3W6S A;  4KSF A;  2P6G A;  1ZO0 A;  3KL9 A;  4NSQ A;  3WC5 A;  4F6A A;  2PR1 A;  4L8A A;  4P4I A;  1YQE A;  4OC4 A;  1QSM A;  3I1U A;  4MHP A;  5F48 A;  4AG9 A;  2FIW A;  2DXQ A;  2PVW A;  2WZN A;  3D4U A;  4DJL A;  1IYK A;  1Y0Y A;  2I79 A;  4R3L A;  3TO7 A;  3MGD A;  4MCP A;  2VEZ A;  4RS2 A;  1YSJ A;  8CPA A;  2CNS A;  1KUY A;  2YND A;  3FBU A;  2PJ6 A;  3R9E A;  3R9F A;  1YRE A;  4JLY A;  2PJ9 A;  4Y49 B;  2AFU A;  4ZX8 A;  4ZYQ A;  3TO9 A;  3SHP A;  4CRZ B;  3WR7 A;  2JBJ A;  1HEE A;  1PCA A;  4HNY B;  1YW4 A;  1MK4 A;  3D7G A;  4A31 A;  2FE7 A;  2HV2 A;  4KOY A;  4MBU A;  2IMO A;  2KCW A;  5F09 A;  2EVN A;  1YK3 A;  4K3N A;  4X2T A;  3PB8 X;  4B13 A;  4CYQ A;  2JEW A;  2I3C A;  2AFM A;  4PQA A;  5D29 A;  3SJF A;  1KUX A;  3DSB A;  3D7H A;  4YFJ A;  2ZW5 A;  2DPS A;  4B12 A;  1B87 A;  2O53 A;  4MFJ A;  3UY5 A;  3KI9 A;  1F2O A;  4IAV A;  1M1D A;  2Z3N A;  3I3G A;  4P44 A;  1Z8L A;  3JRU A;  4WJB A;  4NGS A;  1F57 A;  4M6H A;  2PQ8 A;  2F5I A;  4KVX A;  5G21 A;  3FXT A;  5IX3 A;  1RXT A;  1LCP A;  2WPW A;  4JXQ A;  3ZJ0 A;  2NSM A;  3T90 A;  2Y0M A;  1QSO A;  2HC9 A;  4ZX9 A;  3PB4 X;  2GU2 A;  2PC1 A;  1VHS A;  3CPX A;  3HUV A;  4CYN A;  4JJX A;  3N5F A;  4F9U A;  2Z3K A;  3FEE A;  3S6F A;  1Q2Y A;  3SJG A;  3CXP A;  4A39 A;  4GXH A;  2C1C A;  2BOA A;  3NH8 A;  1MJ9 A;  3DLJ A;  4CRY B;  4MI4 A;  5I4M A;  1TKH A;  3GIU A;  2PDO A;  2ZW7 A;  4GS4 A;  4KOT A;  3H8F A;  3KGQ A;  4MMO A;  3BHX A;  1CG2 A;  5LYI A;  1YLE A;  3B3W A;  4B5P B;  4CAF A;  3KR5 A;  3PB9 X;  1UWY A;  4MHZ A;  2CNM A;  3GYA A;  1YX0 A;  1AMP A;  4GM5 A;  4R8F A;  3VWD A;  4MFP A;  4MHD A;  2CF4 A;  1LOK A;  1NSA A;  2X7B A;  4P4B A;  4PV6 A;  3V7Z A;  4C68 A;  4CGP A;  2AFO A;  4NGP A;  1P0H A;  1B6B A;  4R57 A;  3TE4 A;  4OC3 A;  2V8V A;  1FT7 A;  1XEB A;  2WPX A;  3B35 A;  4UFX A;  2PVV A;  3ZZI A;  4P6Y A;  4HNX B;  2WUU A;  5HH1 A;  5JM6 A;  2Q51 A;  4XPD B;  1XRY A;  2C6G A;  4R76 A;  4JXR A;  3S6G A;  1WK4 A;  4BBH A;  2PR8 A;  3TC8 A;  4KSI A;  3GUX A;  1FY7 A;  3SXN A;  1LAP A;  3L2N A;  3KKW A;  3LOD A;  2BCO A;  3HLP A;  1MJA A;  3E0K A;  2OZH A;  1YGH A;  2C6P A;  3RBU A;  5K8P A;  4J3G A;  2J9A A;  4XPK A;  3GB0 A;  3NFZ A;  3SI1 A;  4PK2 A;  1CX8 A;  1ZLH A;  1IB1 E;  4A38 A;  4KUA A;  2CTB A;  2ZED A;  2ZEL A;  4UBR A;  1Q2C A;  1DE4 C;  3B2Y A;  2ZEO A;  4L89 A;  4F8Z A;  3NE7 A;  5JH9 A;  4B5O A;  3KQZ A;  2EO8 A;  2QEC A;  1K4J A;  2PJ2 A;  3DR6 A;  3FJU A;  3JUW A;  2AFX A;  2AFZ A;  3KHX A;  4R9M A;  1VGY A;  3MN8 A;  1AUG A;  3EO4 A;  2J8R A;  2B3V A;  4CAX A;  2JLM A;  4E2A A;  4A94 A;  2Q4V A;  2PRQ A;  2IQ6 A;  3BI0 A;  5H86 A;  3PFE A;  2Q7B A;  1JQG A;  5AG6 A;  3TOA A;  2CY2 A;  4PSW A;  5KTD A;  2PJB A;  2EK9 A;  1U6M A;  2ZOF A;  2PJ4 A;  2JEV A;  4DNC A;  4H89 A;  1OZP A;  3BXM A;  2NYQ A;  3F8K A;  4WWV A;  3WC7 A;  4C7I A;  2F8H A;  3DNS A;  3D2M A;  5F49 A;  2PJ3 A;  1XF8 A;  3IU2 A;  4MHY A;  4KS9 A;  1ZG8 A;  1GYT A;  4UFW A;  5IB0 A;  2OR4 A;  4C7H A;  4II9 A;  1IOF A;  1LAN A;  4A37 A;  1AYE A;  2VZZ A;  5G1Z A;  3A9L A;  4A2Z A;  2JDD A;  2R98 A;  3SJX A;  3D8P A;  2ZEF A;  1CPS A;  3BJ8 A;  3ISZ A;  3S9M A;  2ZEN A;  1ELL P;  3VWE A;  1R43 A;  4C2X A;  5C88 A;  1V0C A;  1CP6 A;  2PCU A;  1WWZ A;  4MFZ A;  2BL1 A;  4R6T A;  4A95 A;  2ZW4 A;  4UIB A;  2ZEP A;  4QB9 A;  1S7K A;  2RFH A;  3IWE A;  3JVN A;  3K9U A;  4KOX A;  4FUU A;  3EXN A;  4MXU A;  3H8E A;  4JZ0 A;  2DEA A;  1S5K A;  2AJ6 A;  3VH9 A;  3B3S A;  3NH5 A;  4CS0 B;  3LMS A;  4KOU A;  4X8I A;  2WYR A;  2P0W A;  1IU8 A;  3F5B A;  4Q7A A;  2FSR A;  4CAE A;  4B11 A;  2OOT A;  4KOW A;  2DF5 A;  3PFO A;  1Z4E A;  4EVY A;  3PBB A;  1Z8T A;  2CXA A;  3F0A A;  4RI1 A;  3B8G A;  4F0X A;  7CPA A;  1BO4 A;  1P4N A;  3PRT A;  1TKF A;  2YGW A;  4ZY1 A;  2B4D B;  3DGV A;  3BI1 A;  2B5G B;  3H5Z A;  1NMT A;  1QMU A;  1I21 A;  1EE3 P;  1XMB A;  4PXE A;  2Z3M A;  4NGN A;  2RC4 A;  4UIA A;  2VQY A;  2V8D A;  4K30 A;  3RO0 A;  2J8M A;  4QUS A;  4CPA A;  4PSX A;  2FIA A;  2ZEG A;  2GLJ A;  2C6C A;  3OWC A;  4P10 A;  1JWQ A;  1CM0 A;  2BSW A;  2NMT A;  4PK3 A;  4UWI A;  5AGE A;  1BLL E;  4CYP A;  4LX9 A;  2XEI A;  2D4O A;  1Y9W A;  4X5K A;  4NJR A;  3S6H A;  1YLO A;  3W6X A;  5A28 A;  5KTC A;  1ZG7 A;  3CZX A;  4OC0 A;  4ORF A;  5BWA B;  2JDC A;  4AXV A;  2R8V A;  3EFA A;  3TCV A;  4PXD A;  4NFR A;  3SJE A;  3CXS A;  1S3Z A;  4UA3 A;  3IC1 A;  3VAT A;  3P2F A;  5G20 A;  1R3N A;  3PBE A;  4I49 A;  1CPX A;  2ATR A;  4G1P A;  4CGO A;  2QJ8 A;  1Z9U A;  2GAN A;  4HKF A;  2VBQ A;  1YR0 A;  4P45 A;  4P4E A;  1Q7L A;  4X3R A;  3V38 A;  5K8M A;  5K8O A;  1XFO A;  2XEF A;  2Z3P A;  4KSA A;  1X12 A;  2PJ0 A;  1VKC A;  3IWG A;  2Q44 A;  4A33 A;  5DWN A;  2Q4Z A;  4NGR A;  2BEI A;  4MY0 A;  2AFW A;  1BOB A;  2VZY A;  2Q4Y A;  5EBV A;  5ELY A;  3H8G A;  3P2H A;  4U5Y A;  1NSL A;  3TO6 A;  2IJZ A;  2PSW A;  5FVJ A;  4CAV A;  4OAE A;  4OLL A;  2B58 A;  4CGN A;  1S7F A;  2ZEH A;  4CYO A;  4BD9 A;  1KZF A;  1F2P A;  4IUS A;  2A4N A;  3B3V A;  3CT9 A;  2GIV A;  3B3C A;  1QSR A;  2OU2 A;  3FMC A;  4C2Z A;  5EC4 A;  4PXB A;  1XBU A;  4P4J A;  2C27 A;  3FH4 A;  2PJ7 A;  3WAB A;  1TIQ A;  2BO9 A;  3I9S A;  2GE3 A;  4O23 A;  1RO5 A;  1H8L A;  4IF5 A;  3D7D A;  3WC6 A;  3WT4 A;  2ABZ A;  2DPT A;  1LRZ A;  4B5P A;  4FD5 A;  4B10 A;  5JPH A;  4QBJ A;  3S9L A;  3KHZ A;  4DUK A;  5CNP A;  4MFQ A;  4XPD C;  4U9Y A;  4AVB A;  4JWP A;  2FVG A;  5EMI A;  4A30 A;  5CPA A;  5HVF A;  1HDQ A;  1IOI A;  4FWU A;  2AE6 A;  3G3S A;  4OKO A;  1GHE A;  1N71 A;  4PXC A;  2PJA A;  4U9Z A;  1ON0 A;  1IYL A;  1YVO A;  2YNC C;  3ISX A;  1Q2D A;  2HUZ A;  3IGR A;  1BPM A;  1TF8 A;  4KZT A;  5THW A;  3S9N A;  2BUE A;  3FVL A;  1XIX A;  4EME A;  2OH1 A;  4P4F A;  4IHM A;  1QST A;  4NCZ A;  3CDX A;  4AVA A;  3TOB A;  1XMT A;  4OME A;  4NGM A;  4F0Y A;  2O28 A;  3V8I A;  3FB3 A;  3FRM A;  4OC2 A;  4AG7 A;  5AG5 A;  4EWT A;  4TWE A;  4NGT A;  4UFV A;  1R57 A;  4KOR A;  4YGO A;  4BIN A;  1ZG9 A;  2EUI A;  5J8F A;  5K8N A;  2P6F A;  4H6U A;  2K5T A;  2AFS A;  4A32 A;  1Z8X A;  3TFY A;  2Z10 A;  2ZXV A;  3RNZ A;  3SI0 A;  1MJB A;  4YWY A;  2F7V A;  1XJO A;  2D4P A;  1HDU A;  3G8W A;  3GLJ A;  1I12 A;  4ZBG A;  4RUH A;  2FXF A;  4M6I A;  5JQ4 A;  3K9T A;  3PEI A;  5LYD A;  4FD4 A;  1KUV A;  1KWM A;  4EFD A;  1BAV A;  4QVT A;  2IL4 A;  3BLN A;  1M4L A;  5F47 A;  3D7F A;  4B6Z A;  2PJ1 A;  4UCP A;  1CP7 A;  4HNW B;  1FNO A;  4B14 A;  3FED A;  4MY3 A;  5D8N A;  5DWM A;  1Y7E A;  4H2K A;  4OP4 A;  4MCR A;  4RN7 A;  4KOV A;  2GFQ A;  2V77 A;  4ONW A;  3RAM A;  3FF3 A;  4HPS A;  4UF4 A;  6CPA A;  1PYT B;  4Q38 A;  4CAW A;  2EBJ A;  1I1D A;  1M44 A;  2Q0Y A;  2Z3L A;  3KQX A;  3KR4 A;  4KUB A;  3FEC A;  1TF9 A;  2Z0Z A;  2OZG A;  1IID A;  3S6K A;  1ARM A;  4JYW A;  4Y49 C;  3IU1 A;  4M3S A;  5J8C A;  4FBE A;  2ZEM A;  1OBR A;  3FYN A;  1CJW A;  3KAS A;  5GCN A;  3W91 A;  2ZEE A;  2ZW6 A;  4MCS A;  4UEZ A;  4YRH A;  3PGP A;  3SXO A;  3DR8 A;  3PZJ A;  4ZI6 A;  5HVH A;  5HXD A;  4P4D A;  2G3A A;  4FD6 A;  1Z2L A;  3QB8 A;  4XNH B;  3SI2 A;  1A2Z A;  3NE8 A;  2B5G A;  5HVG A;  4W9Y A;  4FAI A;  2V8G A;  3TX8 A;  1PUA A;  2FS5 A;  5LRJ A;  4H6Z A;  4MFL A;  2JBK A;  4IK2 A;  2RB7 A;  4YU9 A;  5HMN A;  5A27 A;  1LFW A;  3D3S A;  4UWJ A;  1PU9 A;  2PE3 A;  5F46 A;  4JD6 A;  1Y0R A;  3PP9 A;  2OB0 A;  4QC6 A;  1TKJ A;  1X10 A;  2Q7S A;  4R3K A;  1Y9K A;  5I0C A;  1YME A;  2POK A;  4LUA A;  2PIY A;  3QAH A;  1QQ9 A;  1S60 A;  4PPZ A;  4F9V A;  4KVO E;  2G9D A;  3NH4 A;  4R7M A;  5LRK A;  3GY9 A;  4FD7 A;  2B4D A;  4MCQ A;  1S7N A;  1M4D A;  1Z4R A;  2PJ5 A;  5IV0 A;  1M4I A;  1L0C A;  2Q43 A;  2XEG A;  2QVP A;  3B3T A;  4UEE A;  2B3U A;  3TTH A;  1DTD A;  2CNT A;  2G0B A; 
#chains in the Genus database with same CATH homology
 3PB7 X;  4OID A;  3D66 A;  1VHO A;  5LYL A;  2ANP A;  3IWW A;  1IGB A;  5JGF A;  1VIX A;  4Z65 A;  3IIB A;  1ZLI A;  4MRI A;  4ZY0 A;  1YW6 A;  3RZA A;  2CIJ A;  3NA6 A;  4NGQ A;  3PB6 X;  3QNV A;  2XEJ A;  2PJ8 A;  1VHE A;  3K2K A;  3KZW A;  3D67 A;  1RTQ A;  3B7I A;  4NJQ A;  3D68 A;  1LAM A;  2O4H A;  3LWU A;  3IO1 A;  2ZOG A;  5J1Q A;  2PIZ A;  4MHN A;  2CTC A;  3VAR A;  3IJ3 A;  3CPA A;  3T8W A;  4DYO A;  2HB6 A;  4OIW A;  2QYV A;  3IEH A;  2EK8 A;  1CBX A;  5CBM A;  4TNU A;  4OC1 A;  1ARL A;  2GLF A;  2V8H A;  5LYF A;  5LRG A;  5DS0 A;  3MRU A;  2PJC A;  2VL1 A;  4LQG A;  4ZY2 A;  3IFE A;  2GRE A;  1ELM P;  3FX6 A;  1BPN A;  4OC5 A;  2EWB A;  1IY7 A;  5IB9 A;  1TXR A;  4UEF A;  1Z5R A;  3KL9 A;  3WC5 A;  4P4I A;  4OC4 A;  3I1U A;  4MHP A;  2PVW A;  2WZN A;  3D4U A;  4DJL A;  1Y0Y A;  4MCP A;  8CPA A;  1YSJ A;  2PJ6 A;  2PJ9 A;  4ZX8 A;  2AFU A;  4ZYQ A;  2JBJ A;  1HEE A;  1PCA A;  1YW4 A;  3D7G A;  2IMO A;  5F09 A;  4K3N A;  4X2T A;  3PB8 X;  2JEW A;  2I3C A;  2AFM A;  4PQA A;  5D29 A;  3SJF A;  3D7H A;  2O53 A;  3KI9 A;  1F2O A;  4IAV A;  4P44 A;  1Z8L A;  3JRU A;  4WJB A;  4NGS A;  1F57 A;  1LCP A;  2NSM A;  2HC9 A;  4ZX9 A;  3PB4 X;  2GU2 A;  3CPX A;  3HUV A;  4F9U A;  3N5F A;  3FEE A;  3SJG A;  4A39 A;  2C1C A;  2BOA A;  3NH8 A;  3DLJ A;  5I4M A;  1TKH A;  3H8F A;  3KGQ A;  4MMO A;  3BHX A;  1CG2 A;  5LYI A;  3B3W A;  3KR5 A;  3PB9 X;  1UWY A;  4MHZ A;  1AMP A;  4GM5 A;  4R8F A;  2CF4 A;  1LOK A;  1NSA A;  4P4B A;  3V7Z A;  2AFO A;  4NGP A;  4OC3 A;  2V8V A;  1FT7 A;  3B35 A;  2PVV A;  4P6Y A;  5JM6 A;  2Q51 A;  4R76 A;  1XRY A;  2C6G A;  3TC8 A;  4KSI A;  3GUX A;  1LAP A;  3L2N A;  2BCO A;  3HLP A;  2C6P A;  3RBU A;  5K8P A;  2J9A A;  3GB0 A;  3NFZ A;  3SI1 A;  4A38 A;  1CX8 A;  1ZLH A;  2CTB A;  2ZED A;  2ZEL A;  1DE4 C;  3B2Y A;  2ZEO A;  4F8Z A;  5JH9 A;  3KQZ A;  3FJU A;  2PJ2 A;  3KHX A;  2AFX A;  2AFZ A;  1VGY A;  3MN8 A;  4A94 A;  2PRQ A;  2IQ6 A;  3BI0 A;  3PFE A;  1JQG A;  2PJB A;  2EK9 A;  2ZOF A;  2PJ4 A;  3BXM A;  2NYQ A;  4WWV A;  3WC7 A;  2F8H A;  2PJ3 A;  4MHY A;  1ZG8 A;  1GYT A;  2OR4 A;  1LAN A;  4A37 A;  1AYE A;  3SJX A;  2ZEF A;  1CPS A;  3ISZ A;  3S9M A;  2ZEN A;  1ELL P;  1R43 A;  1CP6 A;  2PCU A;  4R6T A;  4UIB A;  2ZEP A;  2RFH A;  4FUU A;  4MXU A;  3VH9 A;  3H8E A;  4JZ0 A;  2DEA A;  3B3S A;  3NH5 A;  3LMS A;  2WYR A;  4Q7A A;  2OOT A;  3PFO A;  3PBB A;  7CPA A;  3PRT A;  1TKF A;  4ZY1 A;  3DGV A;  3BI1 A;  4X8I A;  1QMU A;  1EE3 P;  1XMB A;  4PXE A;  4UIA A;  4NGN A;  4CPA A;  2V8D A;  2ZEG A;  2GLJ A;  2C6C A;  4P10 A;  1BLL E;  2XEI A;  4NJR A;  1YLO A;  1ZG7 A;  4OC0 A;  4AXV A;  4PXD A;  4NFR A;  3SJE A;  3IC1 A;  3VAT A;  1R3N A;  3PBE A;  1CPX A;  4G1P A;  2QJ8 A;  5K8M A;  4P45 A;  4P4E A;  3V38 A;  1Q7L A;  4X3R A;  5K8O A;  1XFO A;  2XEF A;  2PJ0 A;  2Q4Z A;  4NGR A;  2AFW A;  5ELY A;  3H8G A;  2IJZ A;  2ZEH A;  4BD9 A;  1F2P A;  3B3V A;  3CT9 A;  3B3C A;  3FMC A;  4PXB A;  1XBU A;  4P4J A;  3FH4 A;  2PJ7 A;  3WAB A;  2BO9 A;  4O23 A;  1H8L A;  3D7D A;  3WC6 A;  3WT4 A;  2ABZ A;  3S9L A;  3KHZ A;  4DUK A;  2FVG A;  5CPA A;  5HVF A;  1HDQ A;  4FWU A;  4OKO A;  4PXC A;  2PJA A;  3ISX A;  1BPM A;  1TF8 A;  5THW A;  3S9N A;  3FVL A;  4EME A;  4P4F A;  4IHM A;  3CDX A;  4OME A;  4NGM A;  4OC2 A;  4EWT A;  4TWE A;  4NGT A;  1ZG9 A;  5K8N A;  2AFS A;  3SI0 A;  4YWY A;  2F7V A;  1XJO A;  1HDU A;  3GLJ A;  4RUH A;  3K9T A;  3PEI A;  5LYD A;  4EFD A;  1KWM A;  1BAV A;  1M4L A;  3D7F A;  4B6Z A;  2PJ1 A;  1CP7 A;  1FNO A;  3FED A;  5D8N A;  1Y7E A;  4H2K A;  4OP4 A;  4MCR A;  2V77 A;  4ONW A;  3RAM A;  3FF3 A;  6CPA A;  4UF4 A;  1PYT B;  3KR4 A;  3KQX A;  3FEC A;  1TF9 A;  1ARM A;  4JYW A;  4FBE A;  2ZEM A;  1OBR A;  3KAS A;  2ZEE A;  4UEZ A;  4MCS A;  4ZI6 A;  5HVH A;  5HXD A;  4P4D A;  1Z2L A;  3SI2 A;  5HVG A;  4W9Y A;  4FAI A;  2V8G A;  3TX8 A;  5LRJ A;  2JBK A;  4IK2 A;  2RB7 A;  4YU9 A;  1LFW A;  2PE3 A;  1Y0R A;  1TKJ A;  1YME A;  2POK A;  2PIY A;  1QQ9 A;  4PPZ A;  4F9V A;  2G9D A;  3NH4 A;  4R7M A;  5LRK A;  4MCQ A;  2PJ5 A;  3B3T A;  2Q43 A;  2XEG A;  2QVP A;  4UEE A;  1DTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...