4MHPA

Crystal structure of apo-form of glutaminyl cyclase from ixodes scapularis
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
326
structure length
326
Chain Sequence
LKWPRDLRPLAHHDLLYMGQISEEDRGDFNATLRNFLVPRVVGSQKHREVREFIVRSLKDLDWDVEEDCFDGQTPHGIKPFCNVIATLNPSACHRLVLACHYDSLLHKEGTFIGATDSAVPCAQLLYLARSLNGKLQNQKTRGDGLTLQLVFFDGEEAFERWSSHDSLYGSRHLAQKWHEDRTSAERLESCLERSEIANQIDRMEVMVLLDLLGAENPRFYSYFGETQPVYRRLVNIESRLNDAGLMELPRRRRRTNYFSNSSTVGFIEDDHIPFLKRSVPIVHIIPSPFPDVWHTLDDNEQNLHHPTISNLNKIFKAFVSEYLQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutaminyl cyclase, putative
publication title Structural and functional analyses of a glutaminyl cyclase from Ixodes scapularis reveal metal-independent catalysis and inhibitor binding.
pubmed doi rcsb
source organism Ixodes scapularis
molecule tags Transferase
total genus 110
structure length 326
sequence length 326
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4mhpA00
1CPSA 5CBMA 5ELYA 2ZOFA 4WWVA 4BD9A 4B6ZA 4P45A 2C6CA 2V8HA 2I3CA 3H8FA 5J1QA 3VATA 4AXVA 2DEAA 3L2NA 4R7MA 3HLPA 2GLJA 5LRKA 3BXMA 4NGQA 2ZEPA 3NH8A 4A38A 1Y7EA 3KGQA 1LFWA 3B7IA 3LWUA 4KSIA 3B3WA 3PB8X 3KR4A 4NGPA 3D7GA 3CT9A 1BLLE 1VHOA 4MMOA 3KASA 4IK2A 2PJAA 2CTCA 1HDUA 1EE3P 5K8MA 3PRTA 1CBXA 1VGYA 4FAIA 1HEEA 1ZLIA 4X8IA 8CPAA 3VH9A 3FEEA 4P4BA 2PJ0A 2EK9A 3V7ZA 2HB6A 5JM6A 2XEIA 1XRYA 3FECA 3V38A 3DGVA 2PJ2A 2CTBA 4H2KA 2PVVA 3K9TA 4OIWA 4UEZA 3B3TA 3B35A 2G9DA 2ZEDA 3PB7X 2QVPA 4OMEA 3DLJA 4MCRA 4NGSA 4P4DA 4K3NA 4OC1A 1LCPA 1TF9A 4OC5A 1Z2LA 5K8OA 3WC6A 5HXDA 2PIYA 4FUUA 3NFZA 1XJOA 3SI0A 2XEJA 3RBUA 1BAVA 2PJ5A 2V8GA 4UEEA 4EFDA 1Y0YA 1QQ9A 4ONWA 3D7FA 1IY7A 2CIJA 2PCUA 4FWUA 2IMOA 2PJ9A 3IFEA 4P4IA 5LYIA 3WC7A 1YLOA 4PXCA 4NFRA 4P4FA 3KHXA 1LOKA 3NA6A 3NH4A 3K2KA 1CPXA 2AFZA 2EWBA 2ZEMA 5JGFA 3D7HA 1M4LA 2C1CA 4PXBA 3PFEA 2PRQA 3KI9A 1CG2A 4ZI6A 3TX8A 3MRUA 1TKHA 4MCQA 4MXUA 4A39A 1QMUA 2JBKA 1CP7A 3KQZA 1PYTB 4YWYA 3WC5A 2IQ6A 4R76A 1ZG7A 3T8WA 3KQXA 1FNOA 3D68A 1KWMA 2BCOA 4MCSA 5D29A 2QJ8A 2GREA 4MHPA 3FEDA 2AFWA 3JRUA 1GYTA 5HVFA 4A37A 4X3RA 4Q7AA 2WZNA 3LMSA 2PJBA 5DS0A 4FBEA 3SI2A 2ZEEA 2PJ6A 2ZEOA 3GUXA 4OP4A 4UEFA 3S9LA 2ZOGA 5K8PA 3GB0A 1ZG8A 4ZY0A 2WYRA 3SJXA 3HUVA 4IAVA 3PB6X 3WABA 4PXEA 2J9AA 3B3SA 1Q7LA 3FVLA 4PQAA 2ANPA 2Q43A 4LQGA 2V8DA 2F7VA 1YSJA 1DTDA 4CPAA 4NJQA 1LAMA 1YW6A 4UF4A 1JQGA 5LRGA 2PJ7A 4ZY2A 4P4EA 2ZEFA 1Z5RA 3FMCA 2OOTA 4YU9A 3PB4X 1TXRA 3RZAA 5LRJA 3H8GA 2C6PA 4TNUA 2POKA 1F2OA 4NGNA 4NGRA 3VARA 2RB7A 4P44A 1LAPA 2O53A 3SJGA 3SJEA 2F8HA 3CPXA 4OC3A 4MHZA 4F9VA 3CPAA 3I1UA 1CX8A 2AFUA 4ZY1A 2AFXA 4UIBA 1LANA 2GLFA 4NGMA 2BOAA 3ISZA 1ARMA 2PJ4A 3N5FA 1AMPA 3FH4A 4ZYQA 4OIDA 3B3CA 2PJ8A 4RUHA 2PJ1A 2HC9A 3FF3A 4OKOA 1IGBA 2XEFA 4R6TA 4TWEA 2AFSA 3BI0A 1UWYA 1Y0RA 2PJCA 2Q4ZA 4A94A 2XEGA 4EMEA 3S9NA 4O23A 2BO9A 3TC8A 1CP6A 2GU2A 1ZLHA 2NSMA 1F57A 2ZELA 4X2TA 3PBBA 5CPAA 1R43A 2JBJA 2PVWA 1BPMA 3IC1A 3WT4A 3MN8A 3PEIA 5LYLA 3ISXA 4OC4A 4DUKA 1ELMP 4GM5A 3PBEA 2PIZA 4PPZA 7CPAA 1AYEA 1YW4A 2FVGA 3IO1A 1XBUA 4JYWA 5I4MA 3GLJA 5LYDA 4DJLA 2EK8A 3BHXA 4MCPA 3FX6A 2OR4A 3D4UA 6CPAA 3PB9X 5F09A 3IJ3A 2O4HA 4DYOA 1OBRA 1RTQA 4F8ZA 1F2PA 4R8FA 3SJFA 2PJ3A 4G1PA 3IEHA 4IHMA 2ABZA 5HVGA 2ZEGA 3KHZA 4MHYA 1PCAA 3D67A 4EWTA 1TKFA 3FJUA 1VHEA 2ZENA 1NSAA 5IB9A 4WJBA 3KZWA 2JEWA 3NH5A 4PXDA 1FT7A 1TF8A 3RAMA 3B3VA 2AFOA 2QYVA 2RFHA 5JH9A 1Z8LA 2VL1A 4W9YA 4ZX9A 3PFOA 4P10A 1YMEA 1R3NA 2CF4A 2V77A 1H8LA 4UIAA 1BPNA 5THWA 2NYQA 4OC2A 4MRIA 1HDQA 5LYFA 3SI1A 3QNVA 4JZ0A 2IJZA 5HVHA 5D8NA 1VIXA 2Q51A 3S9MA 2PE3A 4P4JA 1TKJA 2V8VA 3D66A 2AFMA 4OC0A 3H8EA 1DE4C 1ZG9A 2C6GA 3D7DA 3IWWA 4NJRA 1XFOA 3KR5A 4NGTA 2ZEHA 3IIBA 5K8NA 4MHNA 1XMBA 3BI1A 1ARLA 4P6YA 1ELLP 4ZX8A 3KL9A 3CDXA 3B2YA 4Z65A 4F9UA
chains in the Genus database with same CATH superfamily
3TO7A 1CPSA 5CBMA 2ZW7A 5ELYA 1YR0A 2IL4A 2DPSA 2ZOFA 4MFPA 4QBJA 4WWVA 4BD9A 4CGPA 4B6ZA 4P45A 1X10A 4HNYB 2C6CA 2WPWA 1S60A 2V8HA 1IOIA 2I3CA 2JDCA 3IU1A 4HKFA 1KZFA 3H8FA 4H89A 1NSLA 3E0KA 5J1QA 4ONUA 3VATA 2JLMA 2Z3NA 4AXVA 2DEAA 1P4NA 3L2NA 4R7MA 3HLPA 1M4GA 2GLJA 4HNXB 3BXMA 3G8WA 3NE8A 4NGQA 3TT2A 5LRKA 3SJXA 4JJXA 2ZEPA 3NH8A 4CGNA 4A38A 1MJ9A 1Y7EA 3KGQA 1LFWA 3B7IA 2BL1A 3LWUA 4KSIA 5GCNA 3B3WA 3PB8X 5BWAB 2HUZA 3KR4A 3EFAA 3D7GA 1QSMA 3CT9A 4NGPA 3TTHA 1BLLE 1VHOA 2HQYA 4MMOA 3KASA 3CXPA 1Z9UA 2NMTA 2PJAA 4IK2A 2CTCA 1HDUA 1XOVA 1YREA 5H84A 1EE3P 4AB7A 4CAXA 4M3SA 5K8MA 3PRTA 1CBXA 3JVNA 1VGYA 3VWEA 2B58A 3H4QA 4BMHA 1JWQA 4FAIA 2OZGA 3PGPA 1HEEA 1ZLIA 4X8IA 4CAFA 4F0XA 4B12A 4LUAA 1XEBA 3OWCA 2QIRA 2RC4A 4CRZB 3JTKA 8CPAA 4PSWA 3VH9A 5E96A 2GIVA 1Z4EA 3FEEA 4OLLA 4P4BA 1RXTA 2PJ0A 2EK9A 3V7ZA 2HB6A 5JM6A 2VI7A 2XEIA 1XRYA 1NE9A 2FIAA 1IYKA 2CNMA 3FECA 2I00A 3V38A 1J4JA 2OH1A 3FIXA 3DGVA 3TOBA 2QMLA 4KORA 1NMTA 2PJ2A 2CTBA 4H2KA 4KSAA 2PVVA 3K9TA 4OIWA 4UEZA 3D3SA 4UFWA 3GY9A 1I1DA 3B3TA 2Q7BA 3B35A 2G9DA 5AG6A 2ZEDA 2VZYA 4UWJA 3PB7X 3W6XA 2QVPA 3P2HA 2EBJA 2ATRA 3DLJA 4OMEA 5AG5A 4MCRA 1WWZA 4MI4A 4CGLA 4NGSA 4P4DA 4ZGYB 2GE3A 3F5BA 4K3NA 4OC1A 1LCPA 4JXQA 1TF9A 3F0AA 4OC5A 4NEXA 1YGHA 1Z2LA 2JDDA 3FYNA 1PU9A 3EC4A 4UCPA 5K8OA 3WC6A 3ZZIA 5HXDA 4II9A 2PIYA 4FUUA 3NFZA 4FD7A 5G21A 2QECA 1XJOA 3SI0A 3TFYA 4XPKA 1Y9WA 2XEJA 2X7BA 4Y49C 3RBUA 1BAVA 4NCZA 4KUBA 2VBQA 4CAWA 1M1DA 2WSAA 5AGEA 2A4NA 2PJ5A 2V8GA 4UEEA 5IB0A 4CAVA 1Y0YA 1QQ9A 4EFDA 2EVNA 2AE6A 4ONWA 3D7FA 2P6FA 2Z3KA 1IY7A 4J3GA 1U6MA 2CIJA 4NF1A 4PV6A 5JQ4A 2PCUA 4KOXA 2ZPAA 4XPDB 4FWUA 1S7NA 2IMOA 2PJ9A 4JLYA 2R1IA 1YX0A 3IFEA 4P4IA 1YLEA 2OU2A 5LYIA 3WC7A 5IV0A 3TO6A 1YLOA 4PXCA 2D4OA 4M6GA 4A95A 4NFRA 4AVCA 4P4FA 3KHXA 3TO9A 3W91A 4KZTA 1LOKA 3NA6A 5AG7A 4E8OA 4MFLA 3FB3A 3NH4A 1S7KA 3K2KA 1CPXA 1BO4A 2AFZA 2FE7A 2Z3PA 2EWBA 2Z3OA 2ZEMA 5G22A 5JGFA 5KTAA 1R57A 2ZXVA 3D7HA 1M4LA 2C1CA 4H6UA 2HV2A 2PR8A 2B3UA 4PXBA 4U5YA 4FD6A 3PFEA 2PRQA 2P6GA 1CJWA 2PQ8A 1P0HA 1CG2A 3KI9A 4ZI6A 3TX8A 3MRUA 1TKHA 4MCQA 1B87A 4CYPA 3TOAA 2GANA 4MXUA 4MFJA 4KVME 4A39A 1QMUA 2JBKA 4M6HA 1CP7A 3KQZA 1PYTB 4YWYA 3WC5A 2IQ6A 4R76A 1ZG7A 2B4DA 3T8WA 4B13A 3KQXA 3S6GA 4UA3A 1FNOA 2ARHA 2FXFA 5AG4A 3LD2A 3D68A 2VZZA 4QC6A 1KWMA 2BCOA 4MCSA 4CS0B 2JEVA 1SQHA 5D29A 2YNDA 2QJ8A 3H5ZA 4PSXA 3FXTA 3QB8A 2GREA 4C68A 1KUYA 2BEIA 4CYQA 4MHPA 1YQEA 1YK3A 2WUUA 1KUXA 3FEDA 2ZW6A 3R9FA 2AFWA 2Z10A 1BOBA 3JRUA 1GYTA 5HVFA 1YVKA 4A37A 5A28A 3CZXA 4X3RA 4KLVA 1S7LA 4Q7AA 2WZNA 4MY0A 3LMSA 4MFQA 2PJBA 4KOWA 1IB1E 1QSOA 3IWEA 5DS0A 4FBEA 3SI2A 1FY7A 2ZEEA 2PRBA 2PJ6A 2ZEOA 3GUXA 2YGWA 4OP4A 4UEFA 3DSBA 3R95A 1Q2DA 2ZOGA 3S6FA 4B5PA 4E2AA 5K8PA 4BBHA 3S9LA 4Q38A 3GB0A 3PP9A 1ZG8A 4GXHA 4ZY0A 2WYRA 4MJ8A 1ON0A 4OAEA 2AJ6A 3HUVA 4IAVA 3PB6X 4Q36A 3R9EA 1S7FA 1TIQA 3WABA 5JPHA 4PXEA 2J9AA 4KOYA 3B3SA 4L89A 2CY2A 1Z4RA 1Q7LA 3FVLA 5EC4A 3VWDA 4I49A 4PQAA 4A30A 2ANPA 2Q43A 4LQGA 2V8DA 2Q7SA 2F7VA 5EMIA 4JXRA 1YSJA 1DTDA 1Z8WA 2Q44A 4CPAA 4NJQA 1PUAA 1LAMA 1RO5A 1YW6A 2Q4VA 4UF4A 4X5KA 3B8GA 1JQGA 4FD4A 5LRGA 4B10A 5F49A 2PJ7A 4ZY2A 4P4EA 1GHEA 2ZEFA 1Z5RA 1B6BA 3FMCA 4XPDC 4A33A 3SXOA 2OOTA 4YU9A 3PB4X 3LACA 4IUSA 1I12A 1TXRA 3DNSA 3RZAA 2REFA 5LRJA 5IX3A 3H8GA 2C6PA 3G3SA 4KOTA 2F5IA 4TNUA 1UFHA 3IGRA 2POKA 1F2OA 4NGNA 2YNCC 4NGRA 3VARA 1QSNA 2Z0ZA 1XF8A 2B5GA 2RB7A 4P44A 1LAPA 4IF5A 2O53A 2FL4A 2G0BA 2H5MA 3A9LA 2F8HA 4QUSA 3CPXA 4UFXA 4YRHA 4ZBGA 1MJAA 3SJEA 4HPSA 2R7HA 4UFVA 4OC3A 2EO8A 4MHZA 1S5KA 4KOSA 4F9VA 3CPAA 3I1UA 3SJGA 4RN7A 3R96A 1CX8A 1N71A 2AFUA 4H6ZA 4ZY1A 2AFXA 2D4PA 4UIBA 1LANA 5KTCA 4KOUA 2GLFA 4NGMA 2BOAA 3ISZA 4RI1A 5EBVA 5F47A 4MFZA 1ARMA 1CM0A 4M85A 3S6HA 5C82A 3D2MA 5J8CA 2PJ4A 4L8AA 3N5FA 2B3VA 3ZJ0A 1I21A 1AMPA 2EUIA 3FH4A 4OIDA 1MK4A 3B3CA 4ZYQA 4R9MA 1Z8XA 2PJ8A 5G1ZA 5DWMA 4OADA 3UY5A 5ISVA 3N7ZA 4RUHA 2I79A 2PJ1A 2FIWA 3LODA 1IOFA 4KS9A 4CGMA 2HC9A 2FSRA 3FF3A 4BINA 2CNTA 4OKOA 1IGBA 4JWPA 2XEFA 4R6TA 4TWEA 4CGOA 2AFSA 3BI0A 3S6KA 1UWYA 1Y0RA 3BJ7A 4MBUA 2PJCA 1LRZA 4A32A 2Q4ZA 2Y0MA 2VXKA 4A94A 2VQYA 1A2ZA 2XEGA 4XNHB 3V8IA 3DR6A 4EMEA 3S9NA 4B14A 1XIXA 2CNSA 4M6IA 4O23A 2BO9A 1Y7RA 1Z8TA 2FT0A 1CP6A 4MHDA 3TC8A 2C27A 2GU2A 4QB9A 3BLNA 1ZLHA 3TCVA 5I0CA 3NE7A 2NSMA 1F57A 3K9UA 2ZELA 4R3LA 3PBBA 4X2TA 1R43A 2BSWA 3D2PA 5CPAA 3SHPA 2JBJA 3I9SA 5CNPA 2PVWA 4YFJA 1BPMA 2DPTA 1XE4A 1M4IA 3IC1A 4GS4A 3WT4A 2Q0YA 2ODFA 2PDOA 3MN8A 3PEIA 5LYLA 1M44A 1X12A 3ISXA 4AVBA 4OC4A 4KOVA 3CXQA 3R1KA 3CXSA 4DUKA 1ELMP 4GM5A 3PBEA 2PIZA 2P6EA 4PPZA 3RO0A 7CPAA 1AYEA 1YW4A 2FVGA 3IO1A 1XBUA 4JYWA 4A31A 4AG9A 4XPLA 4CRYB 1QSTA 5I4MA 2KCWA 4JD6A 3GLJA 4PK2A 5LYDA 4DJLA 2EK8A 2FS5A 3BJ8A 3BHXA 3FX6A 4MCPA 4C2YA 2OR4A 3D4UA 3P2FA 6CPAA 3PB9X 5F09A 3IJ3A 4KUAA 3T90A 4CYNA 1VHSA 3DR8A 2G3AA 2O4HA 1OBRA 1RTQA 4RS2A 4UCMA 2O28A 1F2PA 4CYOA 4DYOA 2FCKA 4F8ZA 4R8FA 4MY3A 3SJFA 5HMNA 2PJ3A 4B5PB 3FBUA 3QAHA 4G1PA 3RYOA 3DDDA 2VEZA 4F9UA 3KKWA 3MGDA 1VKCA 4HNWB 2J8NA 2P0WA 3IEHA 4IHMA 3IWGA 2ABZA 5HVGA 2ZEGA 4B5OA 2PR1A 3KHZA 4KVXA 4C7HA 2ZW5A 3D8PA 4EVYA 4MHYA 3EY5A 4AG7A 1PCAA 4UWIA 2PSWA 3D67A 4U9ZA 4EWTA 3C26A 4CAEA 2PC1A 1TKFA 3PZJA 1MJBA 3FJUA 1IU8A 4YGOA 1VHEA 3TE4A 2DXQA 2ZENA 1L0CA 1NSAA 1YVOA 5IB9A 3F8KA 4KLWA 4KVOE 5F48A 2GFQA 3T9YA 4E0AA 4WJBA 3KZWA 2JEWA 3NH5A 4PXDA 3QAYA 1FT7A 1TF8A 5F46A 3RAMA 4LQ6A 5HH1A 5J8FA 3B3VA 2AFOA 4C7IA 2QYVA 2RFHA 2WPXA 5JH9A 1Z8LA 2VL1A 2YNEA 1S3ZA 2Z11A 4W9YA 2J8RA 3I3GA 3PFOA 5G20A 4ZX9A 4P10A 1YMEA 4ORFA 1R3NA 2CF4A 5KTDA 2R98A 2R8VA 2K5TA 2V77A 2J8MA 1H8LA 1IICA 2ZW4A 4AVAA 4UIAA 1BPNA 2Z3LA 2OB0A 1QSRA 4NXYA 2Z3MA 5THWA 2NYQA 4R57A 2B5GB 3W6SA 4C2XA 4OC2A 1Q2CA 4MRIA 3GIUA 1HDQA 2G3TA 4UBRA 5LYFA 1OZPA 2Q04A 2OZUA 1XMTA 4UCNA 4B11A 4U9YA 4R3KA 3SI1A 4XNHC 1ZO0A 3QNVA 3R9GA 4JZ0A 2IJZA 5HVHA 5D8NA 5C88A 4KSFA 1M4DA 1VIXA 4R87A 2Q4YA 1IYLA 3EO4A 4MFKA 5FVJA 2Q51A 2REEA 3S9MA 2PE3A 4P4JA 2OZHA 4C2ZA 4NSQA 3SXNA 2DF5A 1TKJA 2V8VA 3D66A 5A27A 2AFMA 2CXAA 1IIDA 1WK4A 4OC0A 3H8EA 1DE4C 5DWNA 1ZG9A 1K4JA 3GYAA 4F6AA 4LX9A 2C6GA 1Q2YA 2YNCA 3D7DA 3IWWA 2B4BA 4NJRA 4FD5A 1Y9KA 1XFOA 4PK3A 2BUEA 3KR5A 2ZEHA 3IIBA 4NGTA 5K8NA 1KUVA 3EXNA 3RNZA 4F0YA 1AUGA 4MHNA 3FRMA 4Y49B 1XMBA 3WR7A 3BI1A 3JUWA 4QVTA 1ARLA 4K30A 1ELLP 4P6YA 3KL9A 4ZX8A 4DNCA 1V0CA 5H86A 3CDXA 3B2YA 4Z65A 3GKRA 3FNCA 3IU2A 4A2ZA 2B4DB
chains in the Genus database with same CATH topology
1CPSA 5CBMA 5ELYA 2ZOFA 4WWVA 4BD9A 4B6ZA 4P45A 2C6CA 2V8HA 2I3CA 3H8FA 5J1QA 3VATA 4AXVA 2DEAA 3L2NA 4R7MA 3HLPA 2GLJA 5LRKA 3BXMA 4NGQA 2ZEPA 3NH8A 4A38A 1Y7EA 3KGQA 1LFWA 3B7IA 3LWUA 4KSIA 3B3WA 3PB8X 3KR4A 4NGPA 3D7GA 3CT9A 1BLLE 1VHOA 4MMOA 3KASA 4IK2A 2PJAA 2CTCA 1HDUA 1EE3P 5K8MA 3PRTA 1CBXA 1VGYA 4FAIA 1HEEA 1ZLIA 4X8IA 8CPAA 3VH9A 3FEEA 4P4BA 2PJ0A 2EK9A 3V7ZA 2HB6A 5JM6A 2XEIA 1XRYA 3FECA 3V38A 3DGVA 2PJ2A 2CTBA 4H2KA 2PVVA 3K9TA 4OIWA 4UEZA 3B3TA 3B35A 2G9DA 2ZEDA 3PB7X 2QVPA 4OMEA 3DLJA 4MCRA 4NGSA 4P4DA 4K3NA 4OC1A 1LCPA 1TF9A 4OC5A 1Z2LA 5K8OA 3WC6A 5HXDA 2PIYA 4FUUA 3NFZA 1XJOA 3SI0A 2XEJA 3RBUA 1BAVA 2PJ5A 2V8GA 4UEEA 4EFDA 1Y0YA 1QQ9A 4ONWA 3D7FA 1IY7A 2CIJA 2PCUA 4FWUA 2IMOA 2PJ9A 3IFEA 4P4IA 5LYIA 3WC7A 1YLOA 4PXCA 4NFRA 4P4FA 3KHXA 1LOKA 3NA6A 3NH4A 3K2KA 1CPXA 2AFZA 2EWBA 2ZEMA 5JGFA 3D7HA 1M4LA 2C1CA 4PXBA 3PFEA 2PRQA 3KI9A 1CG2A 4ZI6A 3TX8A 3MRUA 1TKHA 4MCQA 4MXUA 4A39A 1QMUA 2JBKA 1CP7A 3KQZA 1PYTB 4YWYA 3WC5A 2IQ6A 4R76A 1ZG7A 3T8WA 3KQXA 1FNOA 3D68A 1KWMA 2BCOA 4MCSA 5D29A 2QJ8A 2GREA 4MHPA 3FEDA 2AFWA 3JRUA 1GYTA 5HVFA 4A37A 4X3RA 4Q7AA 2WZNA 3LMSA 2PJBA 5DS0A 4FBEA 3SI2A 2ZEEA 2PJ6A 2ZEOA 3GUXA 4OP4A 4UEFA 3S9LA 2ZOGA 5K8PA 3GB0A 1ZG8A 4ZY0A 2WYRA 3SJXA 3HUVA 4IAVA 3PB6X 3WABA 4PXEA 2J9AA 3B3SA 1Q7LA 3FVLA 4PQAA 2ANPA 2Q43A 4LQGA 2V8DA 2F7VA 1YSJA 1DTDA 4CPAA 4NJQA 1LAMA 1YW6A 4UF4A 1JQGA 5LRGA 2PJ7A 4ZY2A 4P4EA 2ZEFA 1Z5RA 3FMCA 2OOTA 4YU9A 3PB4X 1TXRA 3RZAA 5LRJA 3H8GA 2C6PA 4TNUA 2POKA 1F2OA 4NGNA 4NGRA 3VARA 2RB7A 4P44A 1LAPA 2O53A 3SJGA 3SJEA 2F8HA 3CPXA 4OC3A 4MHZA 4F9VA 3CPAA 3I1UA 1CX8A 2AFUA 4ZY1A 2AFXA 4UIBA 1LANA 2GLFA 4NGMA 2BOAA 3ISZA 1ARMA 2PJ4A 3N5FA 1AMPA 3FH4A 4ZYQA 4OIDA 3B3CA 2PJ8A 4RUHA 2PJ1A 2HC9A 3FF3A 4OKOA 1IGBA 2XEFA 4R6TA 4TWEA 2AFSA 3BI0A 1UWYA 1Y0RA 2PJCA 2Q4ZA 4A94A 2XEGA 4EMEA 3S9NA 4O23A 2BO9A 3TC8A 1CP6A 2GU2A 1ZLHA 2NSMA 1F57A 2ZELA 4X2TA 3PBBA 5CPAA 1R43A 2JBJA 2PVWA 1BPMA 3IC1A 3WT4A 3MN8A 3PEIA 5LYLA 3ISXA 4OC4A 4DUKA 1ELMP 4GM5A 3PBEA 2PIZA 4PPZA 7CPAA 1AYEA 1YW4A 2FVGA 3IO1A 1XBUA 4JYWA 5I4MA 3GLJA 5LYDA 4DJLA 2EK8A 3BHXA 4MCPA 3FX6A 2OR4A 3D4UA 6CPAA 3PB9X 5F09A 3IJ3A 2O4HA 4DYOA 1OBRA 1RTQA 4F8ZA 1F2PA 4R8FA 3SJFA 2PJ3A 4G1PA 3IEHA 4IHMA 2ABZA 5HVGA 2ZEGA 3KHZA 4MHYA 1PCAA 3D67A 4EWTA 1TKFA 3FJUA 1VHEA 2ZENA 1NSAA 5IB9A 4WJBA 3KZWA 2JEWA 3NH5A 4PXDA 1FT7A 1TF8A 3RAMA 3B3VA 2AFOA 2QYVA 2RFHA 5JH9A 1Z8LA 2VL1A 4W9YA 4ZX9A 3PFOA 4P10A 1YMEA 1R3NA 2CF4A 2V77A 1H8LA 4UIAA 1BPNA 5THWA 2NYQA 4OC2A 4MRIA 1HDQA 5LYFA 3SI1A 3QNVA 4JZ0A 2IJZA 5HVHA 5D8NA 1VIXA 2Q51A 3S9MA 2PE3A 4P4JA 1TKJA 2V8VA 3D66A 2AFMA 4OC0A 3H8EA 1DE4C 1ZG9A 2C6GA 3D7DA 3IWWA 4NJRA 1XFOA 3KR5A 4NGTA 2ZEHA 3IIBA 5K8NA 4MHNA 1XMBA 3BI1A 1ARLA 4P6YA 1ELLP 4ZX8A 3KL9A 3CDXA 3B2YA 4Z65A 4F9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CPS A;  5CBM A;  5ELY A;  2ZOF A;  4WWV A;  4BD9 A;  4B6Z A;  4P45 A;  2C6C A;  2V8H A;  2I3C A;  3H8F A;  5J1Q A;  3VAT A;  4AXV A;  2DEA A;  3L2N A;  4R7M A;  3HLP A;  2GLJ A;  5LRK A;  3BXM A;  4NGQ A;  2ZEP A;  3NH8 A;  4A38 A;  1Y7E A;  3KGQ A;  1LFW A;  3B7I A;  3LWU A;  4KSI A;  3B3W A;  3PB8 X;  3KR4 A;  4NGP A;  3D7G A;  3CT9 A;  1BLL E;  1VHO A;  4MMO A;  3KAS A;  4IK2 A;  2PJA A;  2CTC A;  1HDU A;  1EE3 P;  5K8M A;  3PRT A;  1CBX A;  1VGY A;  4FAI A;  1HEE A;  1ZLI A;  4X8I A;  8CPA A;  3VH9 A;  3FEE A;  4P4B A;  2PJ0 A;  2EK9 A;  3V7Z A;  2HB6 A;  5JM6 A;  2XEI A;  1XRY A;  3FEC A;  3V38 A;  3DGV A;  2PJ2 A;  2CTB A;  4H2K A;  2PVV A;  3K9T A;  4OIW A;  4UEZ A;  3B3T A;  3B35 A;  2G9D A;  2ZED A;  3PB7 X;  2QVP A;  4OME A;  3DLJ A;  4MCR A;  4NGS A;  4P4D A;  4K3N A;  4OC1 A;  1LCP A;  1TF9 A;  4OC5 A;  1Z2L A;  5K8O A;  3WC6 A;  5HXD A;  2PIY A;  4FUU A;  3NFZ A;  1XJO A;  3SI0 A;  2XEJ A;  3RBU A;  1BAV A;  2PJ5 A;  2V8G A;  4UEE A;  4EFD A;  1Y0Y A;  1QQ9 A;  4ONW A;  3D7F A;  1IY7 A;  2CIJ A;  2PCU A;  4FWU A;  2IMO A;  2PJ9 A;  3IFE A;  4P4I A;  5LYI A;  3WC7 A;  1YLO A;  4PXC A;  4NFR A;  4P4F A;  3KHX A;  1LOK A;  3NA6 A;  3NH4 A;  3K2K A;  1CPX A;  2AFZ A;  2EWB A;  2ZEM A;  5JGF A;  3D7H A;  1M4L A;  2C1C A;  4PXB A;  3PFE A;  2PRQ A;  3KI9 A;  1CG2 A;  4ZI6 A;  3TX8 A;  3MRU A;  1TKH A;  4MCQ A;  4MXU A;  4A39 A;  1QMU A;  2JBK A;  1CP7 A;  3KQZ A;  1PYT B;  4YWY A;  3WC5 A;  2IQ6 A;  4R76 A;  1ZG7 A;  3T8W A;  3KQX A;  1FNO A;  3D68 A;  1KWM A;  2BCO A;  4MCS A;  5D29 A;  2QJ8 A;  2GRE A;  4MHP A;  3FED A;  2AFW A;  3JRU A;  1GYT A;  5HVF A;  4A37 A;  4X3R A;  4Q7A A;  2WZN A;  3LMS A;  2PJB A;  5DS0 A;  4FBE A;  3SI2 A;  2ZEE A;  2PJ6 A;  2ZEO A;  3GUX A;  4OP4 A;  4UEF A;  3S9L A;  2ZOG A;  5K8P A;  3GB0 A;  1ZG8 A;  4ZY0 A;  2WYR A;  3SJX A;  3HUV A;  4IAV A;  3PB6 X;  3WAB A;  4PXE A;  2J9A A;  3B3S A;  1Q7L A;  3FVL A;  4PQA A;  2ANP A;  2Q43 A;  4LQG A;  2V8D A;  2F7V A;  1YSJ A;  1DTD A;  4CPA A;  4NJQ A;  1LAM A;  1YW6 A;  4UF4 A;  1JQG A;  5LRG A;  2PJ7 A;  4ZY2 A;  4P4E A;  2ZEF A;  1Z5R A;  3FMC A;  2OOT A;  4YU9 A;  3PB4 X;  1TXR A;  3RZA A;  5LRJ A;  3H8G A;  2C6P A;  4TNU A;  2POK A;  1F2O A;  4NGN A;  4NGR A;  3VAR A;  2RB7 A;  4P44 A;  1LAP A;  2O53 A;  3SJG A;  3SJE A;  2F8H A;  3CPX A;  4OC3 A;  4MHZ A;  4F9V A;  3CPA A;  3I1U A;  1CX8 A;  2AFU A;  4ZY1 A;  2AFX A;  4UIB A;  1LAN A;  2GLF A;  4NGM A;  2BOA A;  3ISZ A;  1ARM A;  2PJ4 A;  3N5F A;  1AMP A;  3FH4 A;  4ZYQ A;  4OID A;  3B3C A;  2PJ8 A;  4RUH A;  2PJ1 A;  2HC9 A;  3FF3 A;  4OKO A;  1IGB A;  2XEF A;  4R6T A;  4TWE A;  2AFS A;  3BI0 A;  1UWY A;  1Y0R A;  2PJC A;  2Q4Z A;  4A94 A;  2XEG A;  4EME A;  3S9N A;  4O23 A;  2BO9 A;  3TC8 A;  1CP6 A;  2GU2 A;  1ZLH A;  2NSM A;  1F57 A;  2ZEL A;  4X2T A;  3PBB A;  5CPA A;  1R43 A;  2JBJ A;  2PVW A;  1BPM A;  3IC1 A;  3WT4 A;  3MN8 A;  3PEI A;  5LYL A;  3ISX A;  4OC4 A;  4DUK A;  1ELM P;  4GM5 A;  3PBE A;  2PIZ A;  4PPZ A;  7CPA A;  1AYE A;  1YW4 A;  2FVG A;  3IO1 A;  1XBU A;  4JYW A;  5I4M A;  3GLJ A;  5LYD A;  4DJL A;  2EK8 A;  3BHX A;  4MCP A;  3FX6 A;  2OR4 A;  3D4U A;  6CPA A;  3PB9 X;  5F09 A;  3IJ3 A;  2O4H A;  4DYO A;  1OBR A;  1RTQ A;  4F8Z A;  1F2P A;  4R8F A;  3SJF A;  2PJ3 A;  4G1P A;  3IEH A;  4IHM A;  2ABZ A;  5HVG A;  2ZEG A;  3KHZ A;  4MHY A;  1PCA A;  3D67 A;  4EWT A;  1TKF A;  3FJU A;  1VHE A;  2ZEN A;  1NSA A;  5IB9 A;  4WJB A;  3KZW A;  2JEW A;  3NH5 A;  4PXD A;  1FT7 A;  1TF8 A;  3RAM A;  3B3V A;  2AFO A;  2QYV A;  2RFH A;  5JH9 A;  1Z8L A;  2VL1 A;  4W9Y A;  4ZX9 A;  3PFO A;  4P10 A;  1YME A;  1R3N A;  2CF4 A;  2V77 A;  1H8L A;  4UIA A;  1BPN A;  5THW A;  2NYQ A;  4OC2 A;  4MRI A;  1HDQ A;  5LYF A;  3SI1 A;  3QNV A;  4JZ0 A;  2IJZ A;  5HVH A;  5D8N A;  1VIX A;  2Q51 A;  3S9M A;  2PE3 A;  4P4J A;  1TKJ A;  2V8V A;  3D66 A;  2AFM A;  4OC0 A;  3H8E A;  1DE4 C;  1ZG9 A;  2C6G A;  3D7D A;  3IWW A;  4NJR A;  1XFO A;  3KR5 A;  4NGT A;  2ZEH A;  3IIB A;  5K8N A;  4MHN A;  1XMB A;  3BI1 A;  1ARL A;  4P6Y A;  1ELL P;  4ZX8 A;  3KL9 A;  3CDX A;  3B2Y A;  4Z65 A;  4F9U A; 
#chains in the Genus database with same CATH topology
 3TO7 A;  1CPS A;  5CBM A;  2ZW7 A;  5ELY A;  1YR0 A;  2IL4 A;  2DPS A;  2ZOF A;  4MFP A;  4QBJ A;  4WWV A;  4BD9 A;  4CGP A;  4B6Z A;  4P45 A;  1X10 A;  4HNY B;  2C6C A;  2WPW A;  1S60 A;  2V8H A;  1IOI A;  2I3C A;  2JDC A;  3IU1 A;  4HKF A;  1KZF A;  3H8F A;  4H89 A;  1NSL A;  3E0K A;  5J1Q A;  4ONU A;  3VAT A;  2JLM A;  2Z3N A;  4AXV A;  2DEA A;  1P4N A;  3L2N A;  4R7M A;  3HLP A;  1M4G A;  2GLJ A;  4HNX B;  3BXM A;  3G8W A;  3NE8 A;  4NGQ A;  3TT2 A;  5LRK A;  3SJX A;  4JJX A;  2ZEP A;  3NH8 A;  4CGN A;  4A38 A;  1MJ9 A;  1Y7E A;  3KGQ A;  1LFW A;  3B7I A;  2BL1 A;  3LWU A;  4KSI A;  5GCN A;  3B3W A;  3PB8 X;  5BWA B;  2HUZ A;  3KR4 A;  3EFA A;  3D7G A;  1QSM A;  3CT9 A;  4NGP A;  3TTH A;  1BLL E;  1VHO A;  2HQY A;  4MMO A;  3KAS A;  3CXP A;  1Z9U A;  2NMT A;  2PJA A;  4IK2 A;  2CTC A;  1HDU A;  1XOV A;  1YRE A;  5H84 A;  1EE3 P;  4AB7 A;  4CAX A;  4M3S A;  5K8M A;  3PRT A;  1CBX A;  3JVN A;  1VGY A;  3VWE A;  2B58 A;  3H4Q A;  4BMH A;  1JWQ A;  4FAI A;  2OZG A;  3PGP A;  1HEE A;  1ZLI A;  4X8I A;  4CAF A;  4F0X A;  4B12 A;  4LUA A;  1XEB A;  3OWC A;  2QIR A;  2RC4 A;  4CRZ B;  3JTK A;  8CPA A;  4PSW A;  3VH9 A;  5E96 A;  2GIV A;  1Z4E A;  3FEE A;  4OLL A;  4P4B A;  1RXT A;  2PJ0 A;  2EK9 A;  3V7Z A;  2HB6 A;  5JM6 A;  2VI7 A;  2XEI A;  1XRY A;  1NE9 A;  2FIA A;  1IYK A;  2CNM A;  3FEC A;  2I00 A;  3V38 A;  1J4J A;  2OH1 A;  3FIX A;  3DGV A;  3TOB A;  2QML A;  4KOR A;  1NMT A;  2PJ2 A;  2CTB A;  4H2K A;  4KSA A;  2PVV A;  3K9T A;  4OIW A;  4UEZ A;  3D3S A;  4UFW A;  3GY9 A;  1I1D A;  3B3T A;  2Q7B A;  3B35 A;  2G9D A;  5AG6 A;  2ZED A;  2VZY A;  4UWJ A;  3PB7 X;  3W6X A;  2QVP A;  3P2H A;  2EBJ A;  2ATR A;  3DLJ A;  4OME A;  5AG5 A;  4MCR A;  1WWZ A;  4MI4 A;  4CGL A;  4NGS A;  4P4D A;  4ZGY B;  2GE3 A;  3F5B A;  4K3N A;  4OC1 A;  1LCP A;  4JXQ A;  1TF9 A;  3F0A A;  4OC5 A;  4NEX A;  1YGH A;  1Z2L A;  2JDD A;  3FYN A;  1PU9 A;  3EC4 A;  4UCP A;  5K8O A;  3WC6 A;  3ZZI A;  5HXD A;  4II9 A;  2PIY A;  4FUU A;  3NFZ A;  4FD7 A;  5G21 A;  2QEC A;  1XJO A;  3SI0 A;  3TFY A;  4XPK A;  1Y9W A;  2XEJ A;  2X7B A;  4Y49 C;  3RBU A;  1BAV A;  4NCZ A;  4KUB A;  2VBQ A;  4CAW A;  1M1D A;  2WSA A;  5AGE A;  2A4N A;  2PJ5 A;  2V8G A;  4UEE A;  5IB0 A;  4CAV A;  1Y0Y A;  1QQ9 A;  4EFD A;  2EVN A;  2AE6 A;  4ONW A;  3D7F A;  2P6F A;  2Z3K A;  1IY7 A;  4J3G A;  1U6M A;  2CIJ A;  4NF1 A;  4PV6 A;  5JQ4 A;  2PCU A;  4KOX A;  2ZPA A;  4XPD B;  4FWU A;  1S7N A;  2IMO A;  2PJ9 A;  4JLY A;  2R1I A;  1YX0 A;  3IFE A;  4P4I A;  1YLE A;  2OU2 A;  5LYI A;  3WC7 A;  5IV0 A;  3TO6 A;  1YLO A;  4PXC A;  2D4O A;  4M6G A;  4A95 A;  4NFR A;  4AVC A;  4P4F A;  3KHX A;  3TO9 A;  3W91 A;  4KZT A;  1LOK A;  3NA6 A;  5AG7 A;  4E8O A;  4MFL A;  3FB3 A;  3NH4 A;  1S7K A;  3K2K A;  1CPX A;  1BO4 A;  2AFZ A;  2FE7 A;  2Z3P A;  2EWB A;  2Z3O A;  2ZEM A;  5G22 A;  5JGF A;  5KTA A;  1R57 A;  2ZXV A;  3D7H A;  1M4L A;  2C1C A;  4H6U A;  2HV2 A;  2PR8 A;  2B3U A;  4PXB A;  4U5Y A;  4FD6 A;  3PFE A;  2PRQ A;  2P6G A;  1CJW A;  2PQ8 A;  1P0H A;  1CG2 A;  3KI9 A;  4ZI6 A;  3TX8 A;  3MRU A;  1TKH A;  4MCQ A;  1B87 A;  4CYP A;  3TOA A;  2GAN A;  4MXU A;  4MFJ A;  4KVM E;  4A39 A;  1QMU A;  2JBK A;  4M6H A;  1CP7 A;  3KQZ A;  1PYT B;  4YWY A;  3WC5 A;  2IQ6 A;  4R76 A;  1ZG7 A;  2B4D A;  3T8W A;  4B13 A;  3KQX A;  3S6G A;  4UA3 A;  1FNO A;  2ARH A;  2FXF A;  5AG4 A;  3LD2 A;  3D68 A;  2VZZ A;  4QC6 A;  1KWM A;  2BCO A;  4MCS A;  4CS0 B;  2JEV A;  1SQH A;  5D29 A;  2YND A;  2QJ8 A;  3H5Z A;  4PSX A;  3FXT A;  3QB8 A;  2GRE A;  4C68 A;  1KUY A;  2BEI A;  4CYQ A;  4MHP A;  1YQE A;  1YK3 A;  2WUU A;  1KUX A;  3FED A;  2ZW6 A;  3R9F A;  2AFW A;  2Z10 A;  1BOB A;  3JRU A;  1GYT A;  5HVF A;  1YVK A;  4A37 A;  5A28 A;  3CZX A;  4X3R A;  4KLV A;  1S7L A;  4Q7A A;  2WZN A;  4MY0 A;  3LMS A;  4MFQ A;  2PJB A;  4KOW A;  1IB1 E;  1QSO A;  3IWE A;  5DS0 A;  4FBE A;  3SI2 A;  1FY7 A;  2ZEE A;  2PRB A;  2PJ6 A;  2ZEO A;  3GUX A;  2YGW A;  4OP4 A;  4UEF A;  3DSB A;  3R95 A;  1Q2D A;  2ZOG A;  3S6F A;  4B5P A;  4E2A A;  5K8P A;  4BBH A;  3S9L A;  4Q38 A;  3GB0 A;  3PP9 A;  1ZG8 A;  4GXH A;  4ZY0 A;  2WYR A;  4MJ8 A;  1ON0 A;  4OAE A;  2AJ6 A;  3HUV A;  4IAV A;  3PB6 X;  4Q36 A;  3R9E A;  1S7F A;  1TIQ A;  3WAB A;  5JPH A;  4PXE A;  2J9A A;  4KOY A;  3B3S A;  4L89 A;  2CY2 A;  1Z4R A;  1Q7L A;  3FVL A;  5EC4 A;  3VWD A;  4I49 A;  4PQA A;  4A30 A;  2ANP A;  2Q43 A;  4LQG A;  2V8D A;  2Q7S A;  2F7V A;  5EMI A;  4JXR A;  1YSJ A;  1DTD A;  1Z8W A;  2Q44 A;  4CPA A;  4NJQ A;  1PUA A;  1LAM A;  1RO5 A;  1YW6 A;  2Q4V A;  4UF4 A;  4X5K A;  3B8G A;  1JQG A;  4FD4 A;  5LRG A;  4B10 A;  5F49 A;  2PJ7 A;  4ZY2 A;  4P4E A;  1GHE A;  2ZEF A;  1Z5R A;  1B6B A;  3FMC A;  4XPD C;  4A33 A;  3SXO A;  2OOT A;  4YU9 A;  3PB4 X;  3LAC A;  4IUS A;  1I12 A;  1TXR A;  3DNS A;  3RZA A;  2REF A;  5LRJ A;  5IX3 A;  3H8G A;  2C6P A;  3G3S A;  4KOT A;  2F5I A;  4TNU A;  1UFH A;  3IGR A;  2POK A;  1F2O A;  4NGN A;  2YNC C;  4NGR A;  3VAR A;  1QSN A;  2Z0Z A;  1XF8 A;  2B5G A;  2RB7 A;  4P44 A;  1LAP A;  4IF5 A;  2O53 A;  2FL4 A;  2G0B A;  2H5M A;  3A9L A;  2F8H A;  4QUS A;  3CPX A;  4UFX A;  4YRH A;  4ZBG A;  1MJA A;  3SJE A;  4HPS A;  2R7H A;  4UFV A;  4OC3 A;  2EO8 A;  4MHZ A;  1S5K A;  4KOS A;  4F9V A;  3CPA A;  3I1U A;  3SJG A;  4RN7 A;  3R96 A;  1CX8 A;  1N71 A;  2AFU A;  4H6Z A;  4ZY1 A;  2AFX A;  2D4P A;  4UIB A;  1LAN A;  5KTC A;  4KOU A;  2GLF A;  4NGM A;  2BOA A;  3ISZ A;  4RI1 A;  5EBV A;  5F47 A;  4MFZ A;  1ARM A;  1CM0 A;  4M85 A;  3S6H A;  5C82 A;  3D2M A;  5J8C A;  2PJ4 A;  4L8A A;  3N5F A;  2B3V A;  3ZJ0 A;  1I21 A;  1AMP A;  2EUI A;  3FH4 A;  4OID A;  1MK4 A;  3B3C A;  4ZYQ A;  4R9M A;  1Z8X A;  2PJ8 A;  5G1Z A;  5DWM A;  4OAD A;  3UY5 A;  5ISV A;  3N7Z A;  4RUH A;  2I79 A;  2PJ1 A;  2FIW A;  3LOD A;  1IOF A;  4KS9 A;  4CGM A;  2HC9 A;  2FSR A;  3FF3 A;  4BIN A;  2CNT A;  4OKO A;  1IGB A;  4JWP A;  2XEF A;  4R6T A;  4TWE A;  4CGO A;  2AFS A;  3BI0 A;  3S6K A;  1UWY A;  1Y0R A;  3BJ7 A;  4MBU A;  2PJC A;  1LRZ A;  4A32 A;  2Q4Z A;  2Y0M A;  2VXK A;  4A94 A;  2VQY A;  1A2Z A;  2XEG A;  4XNH B;  3V8I A;  3DR6 A;  4EME A;  3S9N A;  4B14 A;  1XIX A;  2CNS A;  4M6I A;  4O23 A;  2BO9 A;  1Y7R A;  1Z8T A;  2FT0 A;  1CP6 A;  4MHD A;  3TC8 A;  2C27 A;  2GU2 A;  4QB9 A;  3BLN A;  1ZLH A;  3TCV A;  5I0C A;  3NE7 A;  2NSM A;  1F57 A;  3K9U A;  2ZEL A;  4R3L A;  3PBB A;  4X2T A;  1R43 A;  2BSW A;  3D2P A;  5CPA A;  3SHP A;  2JBJ A;  3I9S A;  5CNP A;  2PVW A;  4YFJ A;  1BPM A;  2DPT A;  1XE4 A;  1M4I A;  3IC1 A;  4GS4 A;  3WT4 A;  2Q0Y A;  2ODF A;  2PDO A;  3MN8 A;  3PEI A;  5LYL A;  1M44 A;  1X12 A;  3ISX A;  4AVB A;  4OC4 A;  4KOV A;  3CXQ A;  3R1K A;  3CXS A;  4DUK A;  1ELM P;  4GM5 A;  3PBE A;  2PIZ A;  2P6E A;  4PPZ A;  3RO0 A;  7CPA A;  1AYE A;  1YW4 A;  2FVG A;  3IO1 A;  1XBU A;  4JYW A;  4A31 A;  4AG9 A;  4XPL A;  4CRY B;  1QST A;  5I4M A;  2KCW A;  4JD6 A;  3GLJ A;  4PK2 A;  5LYD A;  4DJL A;  2EK8 A;  2FS5 A;  3BJ8 A;  3BHX A;  3FX6 A;  4MCP A;  4C2Y A;  2OR4 A;  3D4U A;  3P2F A;  6CPA A;  3PB9 X;  5F09 A;  3IJ3 A;  4KUA A;  3T90 A;  4CYN A;  1VHS A;  3DR8 A;  2G3A A;  2O4H A;  1OBR A;  1RTQ A;  4RS2 A;  4UCM A;  2O28 A;  1F2P A;  4CYO A;  4DYO A;  2FCK A;  4F8Z A;  4R8F A;  4MY3 A;  3SJF A;  5HMN A;  2PJ3 A;  4B5P B;  3FBU A;  3QAH A;  4G1P A;  3RYO A;  3DDD A;  2VEZ A;  4F9U A;  3KKW A;  3MGD A;  1VKC A;  4HNW B;  2J8N A;  2P0W A;  3IEH A;  4IHM A;  3IWG A;  2ABZ A;  5HVG A;  2ZEG A;  4B5O A;  2PR1 A;  3KHZ A;  4KVX A;  4C7H A;  2ZW5 A;  3D8P A;  4EVY A;  4MHY A;  3EY5 A;  4AG7 A;  1PCA A;  4UWI A;  2PSW A;  3D67 A;  4U9Z A;  4EWT A;  3C26 A;  4CAE A;  2PC1 A;  1TKF A;  3PZJ A;  1MJB A;  3FJU A;  1IU8 A;  4YGO A;  1VHE A;  3TE4 A;  2DXQ A;  2ZEN A;  1L0C A;  1NSA A;  1YVO A;  5IB9 A;  3F8K A;  4KLW A;  4KVO E;  5F48 A;  2GFQ A;  3T9Y A;  4E0A A;  4WJB A;  3KZW A;  2JEW A;  3NH5 A;  4PXD A;  3QAY A;  1FT7 A;  1TF8 A;  5F46 A;  3RAM A;  4LQ6 A;  5HH1 A;  5J8F A;  3B3V A;  2AFO A;  4C7I A;  2QYV A;  2RFH A;  2WPX A;  5JH9 A;  1Z8L A;  2VL1 A;  2YNE A;  1S3Z A;  2Z11 A;  4W9Y A;  2J8R A;  3I3G A;  3PFO A;  5G20 A;  4ZX9 A;  4P10 A;  1YME A;  4ORF A;  1R3N A;  2CF4 A;  5KTD A;  2R98 A;  2R8V A;  2K5T A;  2V77 A;  2J8M A;  1H8L A;  1IIC A;  2ZW4 A;  4AVA A;  4UIA A;  1BPN A;  2Z3L A;  2OB0 A;  1QSR A;  4NXY A;  2Z3M A;  5THW A;  2NYQ A;  4R57 A;  2B5G B;  3W6S A;  4C2X A;  4OC2 A;  1Q2C A;  4MRI A;  3GIU A;  1HDQ A;  2G3T A;  4UBR A;  5LYF A;  1OZP A;  2Q04 A;  2OZU A;  1XMT A;  4UCN A;  4B11 A;  4U9Y A;  4R3K A;  3SI1 A;  4XNH C;  1ZO0 A;  3QNV A;  3R9G A;  4JZ0 A;  2IJZ A;  5HVH A;  5D8N A;  5C88 A;  4KSF A;  1M4D A;  1VIX A;  4R87 A;  2Q4Y A;  1IYL A;  3EO4 A;  4MFK A;  5FVJ A;  2Q51 A;  2REE A;  3S9M A;  2PE3 A;  4P4J A;  2OZH A;  4C2Z A;  4NSQ A;  3SXN A;  2DF5 A;  1TKJ A;  2V8V A;  3D66 A;  5A27 A;  2AFM A;  2CXA A;  1IID A;  1WK4 A;  4OC0 A;  3H8E A;  1DE4 C;  5DWN A;  1ZG9 A;  1K4J A;  3GYA A;  4F6A A;  4LX9 A;  2C6G A;  1Q2Y A;  2YNC A;  3D7D A;  3IWW A;  2B4B A;  4NJR A;  4FD5 A;  1Y9K A;  1XFO A;  4PK3 A;  2BUE A;  3KR5 A;  2ZEH A;  3IIB A;  4NGT A;  5K8N A;  1KUV A;  3EXN A;  3RNZ A;  4F0Y A;  1AUG A;  4MHN A;  3FRM A;  4Y49 B;  1XMB A;  3WR7 A;  3BI1 A;  3JUW A;  4QVT A;  1ARL A;  4K30 A;  1ELL P;  4P6Y A;  3KL9 A;  4ZX8 A;  4DNC A;  1V0C A;  5H86 A;  3CDX A;  3B2Y A;  4Z65 A;  3GKR A;  3FNC A;  3IU2 A;  4A2Z A;  2B4D B; 
#chains in the Genus database with same CATH homology
 1CPS A;  5CBM A;  5ELY A;  2ZOF A;  4WWV A;  4BD9 A;  4B6Z A;  4P45 A;  2C6C A;  2V8H A;  2I3C A;  3H8F A;  5J1Q A;  3VAT A;  4AXV A;  2DEA A;  3L2N A;  4R7M A;  3HLP A;  2GLJ A;  5LRK A;  3BXM A;  4NGQ A;  2ZEP A;  3NH8 A;  4A38 A;  1Y7E A;  3KGQ A;  1LFW A;  3B7I A;  3LWU A;  4KSI A;  3B3W A;  3PB8 X;  3KR4 A;  4NGP A;  3D7G A;  3CT9 A;  1BLL E;  1VHO A;  4MMO A;  3KAS A;  4IK2 A;  2PJA A;  2CTC A;  1HDU A;  1EE3 P;  5K8M A;  3PRT A;  1CBX A;  1VGY A;  4FAI A;  1HEE A;  1ZLI A;  4X8I A;  8CPA A;  3VH9 A;  3FEE A;  4P4B A;  2PJ0 A;  2EK9 A;  3V7Z A;  2HB6 A;  5JM6 A;  2XEI A;  1XRY A;  3FEC A;  3V38 A;  3DGV A;  2PJ2 A;  2CTB A;  4H2K A;  2PVV A;  3K9T A;  4OIW A;  4UEZ A;  3B3T A;  3B35 A;  2G9D A;  2ZED A;  3PB7 X;  2QVP A;  4OME A;  3DLJ A;  4MCR A;  4NGS A;  4P4D A;  4K3N A;  4OC1 A;  1LCP A;  1TF9 A;  4OC5 A;  1Z2L A;  5K8O A;  3WC6 A;  5HXD A;  2PIY A;  4FUU A;  3NFZ A;  1XJO A;  3SI0 A;  2XEJ A;  3RBU A;  1BAV A;  2PJ5 A;  2V8G A;  4UEE A;  4EFD A;  1Y0Y A;  1QQ9 A;  4ONW A;  3D7F A;  1IY7 A;  2CIJ A;  2PCU A;  4FWU A;  2IMO A;  2PJ9 A;  3IFE A;  4P4I A;  5LYI A;  3WC7 A;  1YLO A;  4PXC A;  4NFR A;  4P4F A;  3KHX A;  1LOK A;  3NA6 A;  3NH4 A;  3K2K A;  1CPX A;  2AFZ A;  2EWB A;  2ZEM A;  5JGF A;  3D7H A;  1M4L A;  2C1C A;  4PXB A;  3PFE A;  2PRQ A;  3KI9 A;  1CG2 A;  4ZI6 A;  3TX8 A;  3MRU A;  1TKH A;  4MCQ A;  4MXU A;  4A39 A;  1QMU A;  2JBK A;  1CP7 A;  3KQZ A;  1PYT B;  4YWY A;  3WC5 A;  2IQ6 A;  4R76 A;  1ZG7 A;  3T8W A;  3KQX A;  1FNO A;  3D68 A;  1KWM A;  2BCO A;  4MCS A;  5D29 A;  2QJ8 A;  2GRE A;  4MHP A;  3FED A;  2AFW A;  3JRU A;  1GYT A;  5HVF A;  4A37 A;  4X3R A;  4Q7A A;  2WZN A;  3LMS A;  2PJB A;  5DS0 A;  4FBE A;  3SI2 A;  2ZEE A;  2PJ6 A;  2ZEO A;  3GUX A;  4OP4 A;  4UEF A;  3S9L A;  2ZOG A;  5K8P A;  3GB0 A;  1ZG8 A;  4ZY0 A;  2WYR A;  3SJX A;  3HUV A;  4IAV A;  3PB6 X;  3WAB A;  4PXE A;  2J9A A;  3B3S A;  1Q7L A;  3FVL A;  4PQA A;  2ANP A;  2Q43 A;  4LQG A;  2V8D A;  2F7V A;  1YSJ A;  1DTD A;  4CPA A;  4NJQ A;  1LAM A;  1YW6 A;  4UF4 A;  1JQG A;  5LRG A;  2PJ7 A;  4ZY2 A;  4P4E A;  2ZEF A;  1Z5R A;  3FMC A;  2OOT A;  4YU9 A;  3PB4 X;  1TXR A;  3RZA A;  5LRJ A;  3H8G A;  2C6P A;  4TNU A;  2POK A;  1F2O A;  4NGN A;  4NGR A;  3VAR A;  2RB7 A;  4P44 A;  1LAP A;  2O53 A;  3SJG A;  3SJE A;  2F8H A;  3CPX A;  4OC3 A;  4MHZ A;  4F9V A;  3CPA A;  3I1U A;  1CX8 A;  2AFU A;  4ZY1 A;  2AFX A;  4UIB A;  1LAN A;  2GLF A;  4NGM A;  2BOA A;  3ISZ A;  1ARM A;  2PJ4 A;  3N5F A;  1AMP A;  3FH4 A;  4ZYQ A;  4OID A;  3B3C A;  2PJ8 A;  4RUH A;  2PJ1 A;  2HC9 A;  3FF3 A;  4OKO A;  1IGB A;  2XEF A;  4R6T A;  4TWE A;  2AFS A;  3BI0 A;  1UWY A;  1Y0R A;  2PJC A;  2Q4Z A;  4A94 A;  2XEG A;  4EME A;  3S9N A;  4O23 A;  2BO9 A;  3TC8 A;  1CP6 A;  2GU2 A;  1ZLH A;  2NSM A;  1F57 A;  2ZEL A;  4X2T A;  3PBB A;  5CPA A;  1R43 A;  2JBJ A;  2PVW A;  1BPM A;  3IC1 A;  3WT4 A;  3MN8 A;  3PEI A;  5LYL A;  3ISX A;  4OC4 A;  4DUK A;  1ELM P;  4GM5 A;  3PBE A;  2PIZ A;  4PPZ A;  7CPA A;  1AYE A;  1YW4 A;  2FVG A;  3IO1 A;  1XBU A;  4JYW A;  5I4M A;  3GLJ A;  5LYD A;  4DJL A;  2EK8 A;  3BHX A;  4MCP A;  3FX6 A;  2OR4 A;  3D4U A;  6CPA A;  3PB9 X;  5F09 A;  3IJ3 A;  2O4H A;  4DYO A;  1OBR A;  1RTQ A;  4F8Z A;  1F2P A;  4R8F A;  3SJF A;  2PJ3 A;  4G1P A;  3IEH A;  4IHM A;  2ABZ A;  5HVG A;  2ZEG A;  3KHZ A;  4MHY A;  1PCA A;  3D67 A;  4EWT A;  1TKF A;  3FJU A;  1VHE A;  2ZEN A;  1NSA A;  5IB9 A;  4WJB A;  3KZW A;  2JEW A;  3NH5 A;  4PXD A;  1FT7 A;  1TF8 A;  3RAM A;  3B3V A;  2AFO A;  2QYV A;  2RFH A;  5JH9 A;  1Z8L A;  2VL1 A;  4W9Y A;  4ZX9 A;  3PFO A;  4P10 A;  1YME A;  1R3N A;  2CF4 A;  2V77 A;  1H8L A;  4UIA A;  1BPN A;  5THW A;  2NYQ A;  4OC2 A;  4MRI A;  1HDQ A;  5LYF A;  3SI1 A;  3QNV A;  4JZ0 A;  2IJZ A;  5HVH A;  5D8N A;  1VIX A;  2Q51 A;  3S9M A;  2PE3 A;  4P4J A;  1TKJ A;  2V8V A;  3D66 A;  2AFM A;  4OC0 A;  3H8E A;  1DE4 C;  1ZG9 A;  2C6G A;  3D7D A;  3IWW A;  4NJR A;  1XFO A;  3KR5 A;  4NGT A;  2ZEH A;  3IIB A;  5K8N A;  4MHN A;  1XMB A;  3BI1 A;  1ARL A;  4P6Y A;  1ELL P;  4ZX8 A;  3KL9 A;  3CDX A;  3B2Y A;  4Z65 A;  4F9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...