4MI5A

Crystal structure of the ezh2 set domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
208
Chain Sequence
GSLQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Context of Disease-Associated Mutations and Putative Mechanism of Autoinhibition Revealed by X-Ray Crystallographic Analysis of the EZH2-SET Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase EZH2
total genus 45
structure length 208
sequence length 214
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF18264 preSET_CXC CXC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4mi5A00
4LDGA 3F9WA 3KMAA 5ARGA 3MO2A 3RQ4A 3S8PA 3TG4A 1MVXA 1O9SA 4QENA 5T5GA 3M56A 5T0MA 3M57A 5LSXA 3RU0A 5LSZA 2W5ZA 3KMTA 2G46A 1MVHA 5JINA 4FMUA 5CCLA 4C1QA 2R3AA 5EX3A 3CBPA 4J7FA 4WUYA 3SW9A 3QWPA 5KJKA 3OOIA 3PDNA 5CPRB 3F9XA 5KJLA 3M58A 5T0KA 1N6CA 4O30A 2RFIA 5F6KC 3CBMA 3OPEA 5JJ0A 4MI5A 3S7JA 5ARFA 5F59A 4E47A 3DB5A 3FPDA 3CBOA 3M59A 1N6AA 1XQHA 4YNDA 2F69A 5JHNA 3VUZA 4J83A 1H3IA 2W5YA 5HI7A 2O8JA 4J7IA 3F9YA 3QWWA 3OXFA 2BQZA 4MI0A 4QEOA 3QWVA 4IJDA 5EG2A 5TEGA 3MO5A 1MUFA 4I51A 1PEGA 4YPAA 3S7BA 3M54A 1ML9A 3M55A 4H12A 4JLGA 4YPUA 3F9ZA 4RZ0A 5HQ8A 4BUPA 4Z4PA 4NVQA 3OXGA 5AYFA 5KJNA 3RAYA 3MO0A 3M53A 4QEPA 3HNAA 2JV0A 3OXLA 5EX0A 1N3JA 3BO5A 4YNPA 2QPWA 5F5EA 5F6LA 3OS5A 3SWCA 3M5AA 3MEKA 3S7FA 4IJ8A 5KJMA 4AU7A 3RJWA 4O6FA 5CCMA 3N71A 3VV0A 4YNMA 5TTFA 3TG5A 4JDSA 4NJ5A 4YPEA 3IHXA 4J8OA 2IGQA 1MT6A 5JIYA 3K5KA 3RIBA 3S7DA 5TH7A 3DALA 3EP0A 3KMJA 1ZKKA
chains in the Genus database with same CATH superfamily
4LDGA 3F9WA 3KMAA 5ARGA 3MO2A 3RQ4A 3S8PA 3TG4A 1MVXA 1O9SA 4QENA 5T5GA 3M56A 5T0MA 3M57A 5LSXA 3RU0A 5LSZA 2W5ZA 3KMTA 2G46A 1MVHA 5JINA 4FMUA 5CCLA 4C1QA 2R3AA 5EX3A 3CBPA 4J7FA 4WUYA 3SW9A 3QWPA 5KJKA 3OOIA 3PDNA 5CPRB 3F9XA 5KJLA 3M58A 5T0KA 1N6CA 4O30A 2RFIA 5F6KC 3CBMA 3OPEA 5JJ0A 4MI5A 3S7JA 5ARFA 5F59A 4E47A 3DB5A 3FPDA 3CBOA 3M59A 1N6AA 1XQHA 4YNDA 2F69A 5JHNA 3VUZA 4J83A 1H3IA 2W5YA 5HI7A 2O8JA 4J7IA 3F9YA 3QWWA 3OXFA 2BQZA 4MI0A 4QEOA 3QWVA 4IJDA 5EG2A 5TEGA 3MO5A 1MUFA 4I51A 1PEGA 4YPAA 3S7BA 3M54A 1ML9A 3M55A 4H12A 4JLGA 4YPUA 3F9ZA 4RZ0A 5HQ8A 4BUPA 4Z4PA 4NVQA 3OXGA 5AYFA 5KJNA 3RAYA 3MO0A 3M53A 4QEPA 3HNAA 2JV0A 3OXLA 5EX0A 1N3JA 3BO5A 4YNPA 2QPWA 5F5EA 5F6LA 3OS5A 3SWCA 3M5AA 3MEKA 3S7FA 4IJ8A 5KJMA 4AU7A 3RJWA 4O6FA 5CCMA 3N71A 3VV0A 4YNMA 5TTFA 3TG5A 4JDSA 4NJ5A 4YPEA 3IHXA 4J8OA 2IGQA 1MT6A 5JIYA 3K5KA 3RIBA 3S7DA 5TH7A 3DALA 3EP0A 3KMJA 1ZKKA
chains in the Genus database with same CATH topology
4LDGA 3F9WA 3KMAA 5ARGA 3MO2A 3RQ4A 3S8PA 3TG4A 1MVXA 1O9SA 4QENA 5T5GA 3M56A 5T0MA 3M57A 5LSXA 3RU0A 5LSZA 2W5ZA 3KMTA 2G46A 1MVHA 5JINA 4FMUA 5CCLA 4C1QA 2R3AA 5EX3A 3CBPA 4J7FA 4WUYA 3SW9A 3QWPA 5KJKA 3OOIA 3PDNA 5CPRB 3F9XA 5KJLA 3M58A 5T0KA 1N6CA 4O30A 2RFIA 5F6KC 3CBMA 3OPEA 5JJ0A 4MI5A 3S7JA 5ARFA 5F59A 4E47A 3DB5A 3FPDA 3CBOA 3M59A 1N6AA 1XQHA 4YNDA 2F69A 5JHNA 3VUZA 4J83A 1H3IA 2W5YA 5HI7A 2O8JA 4J7IA 3F9YA 3QWWA 3OXFA 2BQZA 4MI0A 4QEOA 3QWVA 4IJDA 5EG2A 5TEGA 3MO5A 1MUFA 4I51A 1PEGA 4YPAA 3S7BA 3M54A 1ML9A 3M55A 4H12A 4JLGA 4YPUA 3F9ZA 4RZ0A 5HQ8A 4BUPA 4Z4PA 4NVQA 3OXGA 5AYFA 5KJNA 3RAYA 3MO0A 3M53A 4QEPA 3HNAA 2JV0A 3OXLA 5EX0A 1N3JA 3BO5A 4YNPA 2QPWA 5F5EA 5F6LA 3OS5A 3SWCA 3M5AA 3MEKA 3S7FA 4IJ8A 5KJMA 4AU7A 3RJWA 4O6FA 5CCMA 3N71A 3VV0A 4YNMA 5TTFA 3TG5A 4JDSA 4NJ5A 4YPEA 3IHXA 4J8OA 2IGQA 1MT6A 5JIYA 3K5KA 3RIBA 3S7DA 5TH7A 3DALA 3EP0A 3KMJA 1ZKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDG A;  3F9W A;  3KMA A;  5ARG A;  3MO2 A;  3RQ4 A;  3S8P A;  3TG4 A;  1MVX A;  1O9S A;  4QEN A;  5T5G A;  3M56 A;  5T0M A;  3M57 A;  5LSX A;  3RU0 A;  5LSZ A;  2W5Z A;  3KMT A;  2G46 A;  1MVH A;  5JIN A;  4FMU A;  5CCL A;  4C1Q A;  2R3A A;  5EX3 A;  3CBP A;  4J7F A;  4WUY A;  3SW9 A;  3QWP A;  5KJK A;  3OOI A;  3PDN A;  5CPR B;  3F9X A;  5KJL A;  3M58 A;  5T0K A;  1N6C A;  4O30 A;  2RFI A;  5F6K C;  3CBM A;  3OPE A;  5JJ0 A;  4MI5 A;  3S7J A;  5ARF A;  5F59 A;  4E47 A;  3DB5 A;  3FPD A;  3CBO A;  3M59 A;  1N6A A;  1XQH A;  4YND A;  2F69 A;  5JHN A;  3VUZ A;  4J83 A;  1H3I A;  2W5Y A;  5HI7 A;  2O8J A;  4J7I A;  3F9Y A;  3QWW A;  3OXF A;  2BQZ A;  4MI0 A;  4QEO A;  3QWV A;  4IJD A;  5EG2 A;  5TEG A;  3MO5 A;  1MUF A;  4I51 A;  1PEG A;  4YPA A;  3S7B A;  3M54 A;  1ML9 A;  3M55 A;  4H12 A;  4JLG A;  4YPU A;  3F9Z A;  4RZ0 A;  5HQ8 A;  4BUP A;  4Z4P A;  4NVQ A;  3OXG A;  5AYF A;  5KJN A;  3RAY A;  3MO0 A;  3M53 A;  4QEP A;  3HNA A;  2JV0 A;  3OXL A;  5EX0 A;  1N3J A;  3BO5 A;  4YNP A;  2QPW A;  5F5E A;  5F6L A;  3OS5 A;  3SWC A;  3M5A A;  3MEK A;  3S7F A;  4IJ8 A;  5KJM A;  4AU7 A;  3RJW A;  4O6F A;  5CCM A;  3N71 A;  3VV0 A;  4YNM A;  5TTF A;  3TG5 A;  4JDS A;  4NJ5 A;  4YPE A;  3IHX A;  4J8O A;  2IGQ A;  1MT6 A;  5JIY A;  3K5K A;  3RIB A;  3S7D A;  5TH7 A;  3DAL A;  3EP0 A;  3KMJ A;  1ZKK A; 
#chains in the Genus database with same CATH topology
 4LDG A;  3F9W A;  3KMA A;  5ARG A;  3MO2 A;  3RQ4 A;  3S8P A;  3TG4 A;  1MVX A;  1O9S A;  4QEN A;  5T5G A;  3M56 A;  5T0M A;  3M57 A;  5LSX A;  3RU0 A;  5LSZ A;  2W5Z A;  3KMT A;  2G46 A;  1MVH A;  5JIN A;  4FMU A;  5CCL A;  4C1Q A;  2R3A A;  5EX3 A;  3CBP A;  4J7F A;  4WUY A;  3SW9 A;  3QWP A;  5KJK A;  3OOI A;  3PDN A;  5CPR B;  3F9X A;  5KJL A;  3M58 A;  5T0K A;  1N6C A;  4O30 A;  2RFI A;  5F6K C;  3CBM A;  3OPE A;  5JJ0 A;  4MI5 A;  3S7J A;  5ARF A;  5F59 A;  4E47 A;  3DB5 A;  3FPD A;  3CBO A;  3M59 A;  1N6A A;  1XQH A;  4YND A;  2F69 A;  5JHN A;  3VUZ A;  4J83 A;  1H3I A;  2W5Y A;  5HI7 A;  2O8J A;  4J7I A;  3F9Y A;  3QWW A;  3OXF A;  2BQZ A;  4MI0 A;  4QEO A;  3QWV A;  4IJD A;  5EG2 A;  5TEG A;  3MO5 A;  1MUF A;  4I51 A;  1PEG A;  4YPA A;  3S7B A;  3M54 A;  1ML9 A;  3M55 A;  4H12 A;  4JLG A;  4YPU A;  3F9Z A;  4RZ0 A;  5HQ8 A;  4BUP A;  4Z4P A;  4NVQ A;  3OXG A;  5AYF A;  5KJN A;  3RAY A;  3MO0 A;  3M53 A;  4QEP A;  3HNA A;  2JV0 A;  3OXL A;  5EX0 A;  1N3J A;  3BO5 A;  4YNP A;  2QPW A;  5F5E A;  5F6L A;  3OS5 A;  3SWC A;  3M5A A;  3MEK A;  3S7F A;  4IJ8 A;  5KJM A;  4AU7 A;  3RJW A;  4O6F A;  5CCM A;  3N71 A;  3VV0 A;  4YNM A;  5TTF A;  3TG5 A;  4JDS A;  4NJ5 A;  4YPE A;  3IHX A;  4J8O A;  2IGQ A;  1MT6 A;  5JIY A;  3K5K A;  3RIB A;  3S7D A;  5TH7 A;  3DAL A;  3EP0 A;  3KMJ A;  1ZKK A; 
#chains in the Genus database with same CATH homology
 4LDG A;  3F9W A;  3KMA A;  5ARG A;  3MO2 A;  3RQ4 A;  3S8P A;  3TG4 A;  1MVX A;  1O9S A;  4QEN A;  5T5G A;  3M56 A;  5T0M A;  3M57 A;  5LSX A;  3RU0 A;  5LSZ A;  2W5Z A;  3KMT A;  2G46 A;  1MVH A;  5JIN A;  4FMU A;  5CCL A;  4C1Q A;  2R3A A;  5EX3 A;  3CBP A;  4J7F A;  4WUY A;  3SW9 A;  3QWP A;  5KJK A;  3OOI A;  3PDN A;  5CPR B;  3F9X A;  5KJL A;  3M58 A;  5T0K A;  1N6C A;  4O30 A;  2RFI A;  5F6K C;  3CBM A;  3OPE A;  5JJ0 A;  4MI5 A;  3S7J A;  5ARF A;  5F59 A;  4E47 A;  3DB5 A;  3FPD A;  3CBO A;  3M59 A;  1N6A A;  1XQH A;  4YND A;  2F69 A;  5JHN A;  3VUZ A;  4J83 A;  1H3I A;  2W5Y A;  5HI7 A;  2O8J A;  4J7I A;  3F9Y A;  3QWW A;  3OXF A;  2BQZ A;  4MI0 A;  4QEO A;  3QWV A;  4IJD A;  5EG2 A;  5TEG A;  3MO5 A;  1MUF A;  4I51 A;  1PEG A;  4YPA A;  3S7B A;  3M54 A;  1ML9 A;  3M55 A;  4H12 A;  4JLG A;  4YPU A;  3F9Z A;  4RZ0 A;  5HQ8 A;  4BUP A;  4Z4P A;  4NVQ A;  3OXG A;  5AYF A;  5KJN A;  3RAY A;  3MO0 A;  3M53 A;  4QEP A;  3HNA A;  2JV0 A;  3OXL A;  5EX0 A;  1N3J A;  3BO5 A;  4YNP A;  2QPW A;  5F5E A;  5F6L A;  3OS5 A;  3SWC A;  3M5A A;  3MEK A;  3S7F A;  4IJ8 A;  5KJM A;  4AU7 A;  3RJW A;  4O6F A;  5CCM A;  3N71 A;  3VV0 A;  4YNM A;  5TTF A;  3TG5 A;  4JDS A;  4NJ5 A;  4YPE A;  3IHX A;  4J8O A;  2IGQ A;  1MT6 A;  5JIY A;  3K5K A;  3RIB A;  3S7D A;  5TH7 A;  3DAL A;  3EP0 A;  3KMJ A;  1ZKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...