4MI5A

Crystal structure of the ezh2 set domain
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
214
structure length
208
Chain Sequence
GSLQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADVSCKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Context of Disease-Associated Mutations and Putative Mechanism of Autoinhibition Revealed by X-Ray Crystallographic Analysis of the EZH2-SET Domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase EZH2
total genus 45
structure length 208
sequence length 214
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF18264 preSET_CXC CXC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4mi5A00
4NVQA 4O30A 4RZ0A 4IJ8A 3S7BA 1N3JA 1MVHA 4E47A 2RFIA 3F9ZA 4JDSA 4YNPA 5KJKA 4MI5A 4Z4PA 4IJDA 4QEOA 3CBMA 5ARGA 5JIYA 2F69A 3K5KA 5KJNA 1O9SA 3RQ4A 3DALA 3F9XA 5JINA 3CBPA 1MUFA 3RU0A 4WUYA 5HI7A 1ML9A 4J83A 3KMTA 3OXGA 2W5YA 3RIBA 4QEPA 3S8PA 4AU7A 2W5ZA 5TEGA 4FMUA 5EX0A 4NJ5A 3BO5A 5TTFA 5JJ0A 3IHXA 3M5AA 3OXLA 4JLGA 3SWCA 4I51A 3M56A 4O6FA 3OPEA 3FPDA 4H12A 2BQZA 4YPAA 3VUZA 3M55A 3RJWA 3S7DA 5TH7A 4LDGA 5T5GA 2QPWA 4QENA 2O8JA 1N6AA 3S7JA 5LSZA 5CCLA 1MVXA 2R3AA 3RAYA 3OOIA 4BUPA 4YPUA 5F6LA 1PEGA 3EP0A 4J8OA 5F6KC 3QWPA 4C1QA 3M59A 3KMJA 1MT6A 3QWVA 4YPEA 5F5EA 5JHNA 4MI0A 3F9WA 5CPRB 1N6CA 5KJLA 4J7IA 4J7FA 3S7FA 3PDNA 3TG4A 3F9YA 3DB5A 5T0MA 3MO5A 3M53A 5CCMA 3OS5A 3M54A 3MO2A 5F59A 3MEKA 4YNDA 1H3IA 3N71A 5T0KA 3VV0A 3MO0A 5LSXA 2IGQA 4YNMA 3SW9A 5EG2A 3QWWA 5EX3A 3OXFA 5AYFA 1XQHA 5HQ8A 3CBOA 3TG5A 3KMAA 3M58A 2JV0A 5ARFA 1ZKKA 2G46A 5KJMA 3HNAA 3M57A
chains in the Genus database with same CATH superfamily
4NVQA 4O30A 4RZ0A 4IJ8A 3S7BA 1N3JA 1MVHA 4E47A 2RFIA 3F9ZA 4JDSA 4YNPA 5KJKA 4MI5A 4Z4PA 4IJDA 4QEOA 3CBMA 5ARGA 5JIYA 2F69A 3K5KA 5KJNA 1O9SA 3RQ4A 3DALA 3F9XA 5JINA 3CBPA 1MUFA 3RU0A 4WUYA 5HI7A 1ML9A 4J83A 3KMTA 3OXGA 2W5YA 3RIBA 4QEPA 3S8PA 4AU7A 2W5ZA 5TEGA 4FMUA 5EX0A 4NJ5A 3BO5A 5TTFA 5JJ0A 3IHXA 3M5AA 3OXLA 4JLGA 3SWCA 4I51A 3M56A 4O6FA 3OPEA 3FPDA 4H12A 2BQZA 4YPAA 3VUZA 3M55A 3RJWA 3S7DA 5TH7A 4LDGA 5T5GA 2QPWA 4QENA 2O8JA 1N6AA 3S7JA 5LSZA 5CCLA 1MVXA 2R3AA 3RAYA 3OOIA 4BUPA 4YPUA 5F6LA 1PEGA 3EP0A 4J8OA 5F6KC 3QWPA 4C1QA 3M59A 3KMJA 1MT6A 3QWVA 4YPEA 5F5EA 5JHNA 4MI0A 3F9WA 5CPRB 1N6CA 5KJLA 4J7IA 4J7FA 3S7FA 3PDNA 3TG4A 3F9YA 3DB5A 5T0MA 3MO5A 3M53A 5CCMA 3OS5A 3M54A 3MO2A 5F59A 3MEKA 4YNDA 1H3IA 3N71A 5T0KA 3VV0A 3MO0A 5LSXA 2IGQA 4YNMA 3SW9A 5EG2A 3QWWA 5EX3A 3OXFA 5AYFA 1XQHA 5HQ8A 3CBOA 3TG5A 3KMAA 3M58A 2JV0A 5ARFA 1ZKKA 2G46A 5KJMA 3HNAA 3M57A
chains in the Genus database with same CATH topology
4NVQA 4O30A 4RZ0A 4IJ8A 3S7BA 1N3JA 1MVHA 4E47A 2RFIA 3F9ZA 4JDSA 4YNPA 5KJKA 4MI5A 4Z4PA 4IJDA 4QEOA 3CBMA 5ARGA 5JIYA 2F69A 3K5KA 5KJNA 1O9SA 3RQ4A 3DALA 3F9XA 5JINA 3CBPA 1MUFA 3RU0A 4WUYA 5HI7A 1ML9A 4J83A 3KMTA 3OXGA 2W5YA 3RIBA 4QEPA 3S8PA 4AU7A 2W5ZA 5TEGA 4FMUA 5EX0A 4NJ5A 3BO5A 5TTFA 5JJ0A 3IHXA 3M5AA 3OXLA 4JLGA 3SWCA 4I51A 3M56A 4O6FA 3OPEA 3FPDA 4H12A 2BQZA 4YPAA 3VUZA 3M55A 3RJWA 3S7DA 5TH7A 4LDGA 5T5GA 2QPWA 4QENA 2O8JA 1N6AA 3S7JA 5LSZA 5CCLA 1MVXA 2R3AA 3RAYA 3OOIA 4BUPA 4YPUA 5F6LA 1PEGA 3EP0A 4J8OA 5F6KC 3QWPA 4C1QA 3M59A 3KMJA 1MT6A 3QWVA 4YPEA 5F5EA 5JHNA 4MI0A 3F9WA 5CPRB 1N6CA 5KJLA 4J7IA 4J7FA 3S7FA 3PDNA 3TG4A 3F9YA 3DB5A 5T0MA 3MO5A 3M53A 5CCMA 3OS5A 3M54A 3MO2A 5F59A 3MEKA 4YNDA 1H3IA 3N71A 5T0KA 3VV0A 3MO0A 5LSXA 2IGQA 4YNMA 3SW9A 5EG2A 3QWWA 5EX3A 3OXFA 5AYFA 1XQHA 5HQ8A 3CBOA 3TG5A 3KMAA 3M58A 2JV0A 5ARFA 1ZKKA 2G46A 5KJMA 3HNAA 3M57A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NVQ A;  4O30 A;  4RZ0 A;  4IJ8 A;  3S7B A;  1N3J A;  1MVH A;  4E47 A;  2RFI A;  3F9Z A;  4JDS A;  4YNP A;  5KJK A;  4MI5 A;  4Z4P A;  4IJD A;  4QEO A;  3CBM A;  5ARG A;  5JIY A;  2F69 A;  3K5K A;  5KJN A;  1O9S A;  3RQ4 A;  3DAL A;  3F9X A;  5JIN A;  3CBP A;  1MUF A;  3RU0 A;  4WUY A;  5HI7 A;  1ML9 A;  4J83 A;  3KMT A;  3OXG A;  2W5Y A;  3RIB A;  4QEP A;  3S8P A;  4AU7 A;  2W5Z A;  5TEG A;  4FMU A;  5EX0 A;  4NJ5 A;  3BO5 A;  5TTF A;  5JJ0 A;  3IHX A;  3M5A A;  3OXL A;  4JLG A;  3SWC A;  4I51 A;  3M56 A;  4O6F A;  3OPE A;  3FPD A;  4H12 A;  2BQZ A;  4YPA A;  3VUZ A;  3M55 A;  3RJW A;  3S7D A;  5TH7 A;  4LDG A;  5T5G A;  2QPW A;  4QEN A;  2O8J A;  1N6A A;  3S7J A;  5LSZ A;  5CCL A;  1MVX A;  2R3A A;  3RAY A;  3OOI A;  4BUP A;  4YPU A;  5F6L A;  1PEG A;  3EP0 A;  4J8O A;  5F6K C;  3QWP A;  4C1Q A;  3M59 A;  3KMJ A;  1MT6 A;  3QWV A;  4YPE A;  5F5E A;  5JHN A;  4MI0 A;  3F9W A;  5CPR B;  1N6C A;  5KJL A;  4J7I A;  4J7F A;  3S7F A;  3PDN A;  3TG4 A;  3F9Y A;  3DB5 A;  5T0M A;  3MO5 A;  3M53 A;  5CCM A;  3OS5 A;  3M54 A;  3MO2 A;  5F59 A;  3MEK A;  4YND A;  1H3I A;  3N71 A;  5T0K A;  3VV0 A;  3MO0 A;  5LSX A;  2IGQ A;  4YNM A;  3SW9 A;  5EG2 A;  3QWW A;  5EX3 A;  3OXF A;  5AYF A;  1XQH A;  5HQ8 A;  3CBO A;  3TG5 A;  3KMA A;  3M58 A;  2JV0 A;  5ARF A;  1ZKK A;  2G46 A;  5KJM A;  3HNA A;  3M57 A; 
#chains in the Genus database with same CATH topology
 4NVQ A;  4O30 A;  4RZ0 A;  4IJ8 A;  3S7B A;  1N3J A;  1MVH A;  4E47 A;  2RFI A;  3F9Z A;  4JDS A;  4YNP A;  5KJK A;  4MI5 A;  4Z4P A;  4IJD A;  4QEO A;  3CBM A;  5ARG A;  5JIY A;  2F69 A;  3K5K A;  5KJN A;  1O9S A;  3RQ4 A;  3DAL A;  3F9X A;  5JIN A;  3CBP A;  1MUF A;  3RU0 A;  4WUY A;  5HI7 A;  1ML9 A;  4J83 A;  3KMT A;  3OXG A;  2W5Y A;  3RIB A;  4QEP A;  3S8P A;  4AU7 A;  2W5Z A;  5TEG A;  4FMU A;  5EX0 A;  4NJ5 A;  3BO5 A;  5TTF A;  5JJ0 A;  3IHX A;  3M5A A;  3OXL A;  4JLG A;  3SWC A;  4I51 A;  3M56 A;  4O6F A;  3OPE A;  3FPD A;  4H12 A;  2BQZ A;  4YPA A;  3VUZ A;  3M55 A;  3RJW A;  3S7D A;  5TH7 A;  4LDG A;  5T5G A;  2QPW A;  4QEN A;  2O8J A;  1N6A A;  3S7J A;  5LSZ A;  5CCL A;  1MVX A;  2R3A A;  3RAY A;  3OOI A;  4BUP A;  4YPU A;  5F6L A;  1PEG A;  3EP0 A;  4J8O A;  5F6K C;  3QWP A;  4C1Q A;  3M59 A;  3KMJ A;  1MT6 A;  3QWV A;  4YPE A;  5F5E A;  5JHN A;  4MI0 A;  3F9W A;  5CPR B;  1N6C A;  5KJL A;  4J7I A;  4J7F A;  3S7F A;  3PDN A;  3TG4 A;  3F9Y A;  3DB5 A;  5T0M A;  3MO5 A;  3M53 A;  5CCM A;  3OS5 A;  3M54 A;  3MO2 A;  5F59 A;  3MEK A;  4YND A;  1H3I A;  3N71 A;  5T0K A;  3VV0 A;  3MO0 A;  5LSX A;  2IGQ A;  4YNM A;  3SW9 A;  5EG2 A;  3QWW A;  5EX3 A;  3OXF A;  5AYF A;  1XQH A;  5HQ8 A;  3CBO A;  3TG5 A;  3KMA A;  3M58 A;  2JV0 A;  5ARF A;  1ZKK A;  2G46 A;  5KJM A;  3HNA A;  3M57 A; 
#chains in the Genus database with same CATH homology
 4NVQ A;  4O30 A;  4RZ0 A;  4IJ8 A;  3S7B A;  1N3J A;  1MVH A;  4E47 A;  2RFI A;  3F9Z A;  4JDS A;  4YNP A;  5KJK A;  4MI5 A;  4Z4P A;  4IJD A;  4QEO A;  3CBM A;  5ARG A;  5JIY A;  2F69 A;  3K5K A;  5KJN A;  1O9S A;  3RQ4 A;  3DAL A;  3F9X A;  5JIN A;  3CBP A;  1MUF A;  3RU0 A;  4WUY A;  5HI7 A;  1ML9 A;  4J83 A;  3KMT A;  3OXG A;  2W5Y A;  3RIB A;  4QEP A;  3S8P A;  4AU7 A;  2W5Z A;  5TEG A;  4FMU A;  5EX0 A;  4NJ5 A;  3BO5 A;  5TTF A;  5JJ0 A;  3IHX A;  3M5A A;  3OXL A;  4JLG A;  3SWC A;  4I51 A;  3M56 A;  4O6F A;  3OPE A;  3FPD A;  4H12 A;  2BQZ A;  4YPA A;  3VUZ A;  3M55 A;  3RJW A;  3S7D A;  5TH7 A;  4LDG A;  5T5G A;  2QPW A;  4QEN A;  2O8J A;  1N6A A;  3S7J A;  5LSZ A;  5CCL A;  1MVX A;  2R3A A;  3RAY A;  3OOI A;  4BUP A;  4YPU A;  5F6L A;  1PEG A;  3EP0 A;  4J8O A;  5F6K C;  3QWP A;  4C1Q A;  3M59 A;  3KMJ A;  1MT6 A;  3QWV A;  4YPE A;  5F5E A;  5JHN A;  4MI0 A;  3F9W A;  5CPR B;  1N6C A;  5KJL A;  4J7I A;  4J7F A;  3S7F A;  3PDN A;  3TG4 A;  3F9Y A;  3DB5 A;  5T0M A;  3MO5 A;  3M53 A;  5CCM A;  3OS5 A;  3M54 A;  3MO2 A;  5F59 A;  3MEK A;  4YND A;  1H3I A;  3N71 A;  5T0K A;  3VV0 A;  3MO0 A;  5LSX A;  2IGQ A;  4YNM A;  3SW9 A;  5EG2 A;  3QWW A;  5EX3 A;  3OXF A;  5AYF A;  1XQH A;  5HQ8 A;  3CBO A;  3TG5 A;  3KMA A;  3M58 A;  2JV0 A;  5ARF A;  1ZKK A;  2G46 A;  5KJM A;  3HNA A;  3M57 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...