4MIEA

Crystal structure of apo myo-inositol dehydrogenase from lactobacillus casei
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
339
structure length
339
Chain Sequence
b'MVVKVGVIGTGAMGRAHIDRLTNVLTGAEVVAVTDIDHEAAEAAVRDFHLNAKVYPDDTSLLQDPDIDAVFVVSFGGAHEATVLKALDTDKFIFTEKPLATTLEGAKRIVDKELTKSKKVIQVGFMRRYDQGIRALKEKLDTGIIGAPLVVRASHINPNVASNYSNEMAITDTLIHEIDEMHWLLDDEYTSIQITYPRQSAEVRNEGLHDPQLATLTTKKGTVIQVLVHVTAQYGYEVKLEVIGETGELQLPNYGLGPILRSNANQQTAVEMSWINRFIQAYNTEVQEFIDEVAKSEPPVGPSAWDGYIAAITAAAANRSQKDQETVLINVAGTPTFYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
publication title Crystal Structure of apo myo-inositol dehydrogenase from Lactobacillus casei
rcsb
source organism Lactobacillus casei
molecule tags Oxidoreductase
total genus 113
structure length 339
sequence length 339
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.18: Inositol 2-dehydrogenase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4mieA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4mieA01
4BNUA 3HHPA 4J9UE 2B37A 3DOJA 4Z0PA 3GHHA 1M76A 3OECA 4QTZA 5ES3A 3E1KA 1S6YA 3ZW9A 4MVJF 3HDYA 3KYBA 4TRJA 5IDYA 1B16A 2JAPA 1M6HA 1YKFA 4EBFA 4E31A 5CG2A 1X0XA 1NXQA 2E48A 4IZHA 5CHEA 1TI7A 4S3MA 1Y8QB 1P0FA 2C5AA 1I3LA 1UZMA 2PA3A 3MJTA 1ZCJA 3JYNA 3OJEA 4RF5A 4WPGA 4K28A 1U2DA 1Z73A 3TPCA 4R9SA 5CPFA 3RQSA 2XF8A 3D1LA 5JW6A 2VZ9A 3L6DA 1ADCA 1LXCA 4XIYA 5KJEA 1GEGA 3FNGA 1W73A 3EVTA 3OJOA 5CFZA 1C1XB 1N7GA 4WCDA 2V6BA 3H9GA 4FFMA 5DOZA 1N1EA 1HDZA 3C3XA 1ENOA 1DC5A 2NV6A 2Y1DA 3UGKA 3VZSA 3W4JA 1ADFA 1H6AA 2PKQP 3BTSA 1UAGA 2DVMA 3LDHA 3ZV4A 3VTZA 4Q3CA 4U6SA 1HZJA 3QLJA 5TRTA 4JK3A 4YCAA 1HDXA 1PJLA 3AU8A 4QX6A 2Y68A 5TLSA 1JVSA 3H9JA 2WWRA 3GEMA 4Z9YA 1BTOA 1DIGA 1E92A 1BHSA 2G76A 3I5MA 4AJ1A 5I9LA 3ST7A 4RVHA 1E1NA 3V2GA 4UUNA 4FDAA 5FWNA 3BTUA 4RVSA 4RF3A 4ALJA 1AXGA 2H9IA 5A04A 2EKQA 2JKVA 1HDYA 2GRAA 1QV7A 2PZKA 3GDFA 3ADOA 1NPDA 1UAYA 1KEUA 1LSSA 4HWKA 2Q50A 4OYRA 1I3MA 4BO4A 1XGKA 4BNWA 4CODB 5L7WA 3MOGA 3SC4A 3LZ6A 3ZWPA 4W9NA 1YVEI 1NM5A 2W2KB 1DC4A 3QQPA 4B3JA 5ITVA 2BELA 1H93A 3EK2A 3JQDA 3NT2A 1KY5A 2HRBA 4BO5A 3LC1O 4E13A 4R41A 1J49A 4CMIB 4H3VA 2VNSA 4B7XA 4BGUA 2IRWA 5CP8A 2X8LA 4O63O 3DQPA 4MP8A 3ADPA 2HAEA 5GY7A 3Q1LA 4QSMA 1E7SA 2NM0A 1GL3A 1DRUA 2E6UX 4YACA 1BXKA 2PZLA 3K5PA 2WYWA 4MVJP 2UAGA 1K6XA 4R9RA 5DCUA 1A72A 5FI3A 4CLOB 3NDJA 4IMRA 4TKMA 2J3HA 2PKRA 3F1LA 2Q4EA 1JU9A 3FNHA 2VT2A 5JFOA 4KTVE 2GNAA 2PKQO 3JQ8A 3E5RA 1EBFA 1WMBA 2CF6A 1JW9B 3JYPA 1E6UA 4FJ0A 4J1TA 4PRKA 3WGGA 3MJ4A 3S2FA 5F1PA 2C54A 3TF5A 4PLTA 3LT1A 1VL8A 3K8ZA 5I8WA 5JDCA 3HWRA 3Q6IA 5KVVA 4LRSB 2P5UA 2AW5A 2VQ3A 1NWHA 3ZU2A 1GPDG 3CXRA 4NFSA 3KLMX 3E9QA 4NQZA 5KIAA 3C8MA 1DIHA 4IXWA 3T7CA 1B26A 3HDHA 3L0DA 5IN5A 5JSFA 1LDGA 4XIJA 3NTOA 5FFFA 3ZDFA 3MCVA 3RWBA 4YAGA 1L7EA 2NWQA 2BF7A 3RBZA 2VT3A 5IZ4A 1MUUA 4FJ1A 5A03A 3WJ7A 3AU9A 2A92A 4FS3A 3BAZA 2XXBA 3UKOA 3G79A 1HF3A 4UVEA 4LW8A 3WLEA 1A71A 2C7GA 4KOAA 5DP1A 4MVJA 1H5QA 3KSDO 3H5RA 3GGOA 4GL4A 4I5EA 3JSAA 5A06A 3GA0A 1ADBA 4AJHA 1ZSVA 2VNAA 1EE9A 3WGZA 2CY0A 2ZJ0A 4R5MA 3RSHA 3WIDA 4NNJA 4AICA 4RCVA 4A73A 3JQ9C 3VH3A 4WOKA 4MVJI 3EW7A 4PLYA 4HFRA 4QUKA 4L73A 1KETA 5A4DA 3QWBA 3HADA 4ND1A 4BS9A 3WYEA 3DBRB 1ZK3A 3RUIA 4E5PA 1I8TA 5TGDA 1L7DA 4N5NA 4BUCA 2O3SA 3FF4A 4IM7A 5G4KB 5TC4A 3Q3CA 4YYZA 2DTEA 4FW8A 1ISGA 2EF1A 5A02A 2YUTA 3ICPA 4G5HA 4I5DA 2EHDA 1HYHA 3VKVA 2EWMA 5TX7A 4IGFA 4L4RA 4BKPA 4JN6B 4D41A 3JYLA 4B4OA 4EEXA 4YAIA 3PLNA 3KO8A 4GWGA 4ILKA 4YT4A 4QFDA 5DNAA 2LDXA 1BW9B 3D5TA 3GVCA 1R4MB 4R3NA 1LUAA 3VZQA 4EEZA 3L4SO 5G0VA 1TT5A 2UUOA 3AJRA 1CETA 3PJDA 2CUKA 3JQCA 3BTVA 3D0OA 2POQX 2OGUA 1MFZA 4KMSA 1KS9A 5IJZA 4E2XA 2QZZA 4DPLA 4Y98A 4WLFA 1C0KA 1FJHA 3JTMA 2A35A 2IZZA 3OF2A 2PD3A 4RORA 1GV0A 1CQJA 1SAYA 2ET6A 1MLDA 1PWZA 2GUGA 3CEAA 3ANMA 4FC6A 4WCFB 1UXGA 1H94A 1C14A 4BO9A 2AQHA 1GQ2A 3QIVA 1ZJZA 4DBZA 1HDOA 1Q0QA 4HV4A 3IAHA 4ZICA 2PH5A 1PS0A 3LLVA 3HE3A 5K0ZA 3ITKA 4CL8A 4M49A 4D7AA 3KEQA 2I9PA 4M1QA 1LDMA 1VKNA 3KYDB 4IUYA 3V1TC 4Y8VA 1LDNA 1BDMA 3SLGA 3D5QA 3GRKA 1HE2A 2Q49A 3U62A 1P1KA 4BOYA 3RCBA 4UUOA 1ZH8A 1XR3A 5IN4A 4FSHA 2O2YA 3KETA 2Z95A 3BMOA 4Z3DA 3NAQA 2BGLA 2VWHA 2GZ2A 3OJFA 3QY9A 2IODA 3UCEA 1XSEA 3GMSA 3NT4A 1Y8RB 2RBEA 4E3ZA 3DFUA 2ZATA 3TDKA 3L4BA 5FI5A 1VJ0A 4RVFA 2X7HA 1E6WA 5FYDA 1NVTA 2IZ0A 4QO7A 2IYPA 2Q1UA 4J4TA 2DUUA 2BFPA 5JE8A 1SPXA 1DDOA 4KUEA 4FOOA 1FDSA 5KVQA 4W6ZA 5DT9A 3AOEA 3WGIA 2ZTVA 1CDOA 2Y67A 1Z74A 3WIEA 1UZNA 3UH1A 4U7WA 3ROKA 3PQFA 3DC2A 2Y93A 4CMEA 4F46A 2NQ8A 4YJDA 1EVZA 4YXFA 2CVZA 3RASA 2CD9A 4ID9A 2NACA 3B1JA 4LCEA 4DYDA 1F12A 2X58A 4IXTA 3PYMA 1GQYA 1E77A 4BNXA 3ONEA 3RUFA 2PLAA 4Y6SA 4PN3A 4ZJUA 4MKXA 5DZSA 3ZV3A 3QHAA 3I9OA 4BNHA 2JD2A 3D4PA 4BKUA 2GO1A 3PZBA 1NHGA 2GN9A 3S55A 1XU9A 3A9WA 5HBRA 1AHIA 5JY1A 1WP4A 5F1KA 1I3KA 3I6IA 2X9NA 1OC2A 4DWVA 1X15A 1CQIA 3VTFA 2VRCD 1M75A 4TRNA 2EP5A 1X0VA 4BNIA 4DGSA 1LNQA 1NAHA 2HQ1A 2WTBA 1DJQA 1EVYA 3VH2A 3KXDA 3WGHA 1DLJA 2Q2QA 3ZI0A 4J1NA 4AJNA 2RH4A 5CDUA 3ZWNA 3Q9UA 3LQFA 2Q46A 2Q4BA 2QYSA 6ADHA 2WD7B 4E5YA 1LRLA 2JHFA 4GBJA 4M86A 3OICA 4RVDA 1GZ3A 1AE1A 1R0LA 1LDYA 2RHCA 1L1FA 5DF1A 3RD5A 5CG1A 1GU7A 3HFGA 3VVBA 4R1UA 4YTEA 4A27A 3RBVA 3NKLA 5DBIA 4NBVA 2CSUA 4OKIA 1YJQA 3QVOA 4P4GA 1MA0A 3Q11A 1GQQA 1EUZA 3PK0A 4IS3A 1GYQA 2HK8A 2OMEA 3DAFA 4I5FA 2A4KA 1XQ6A 3GUCA 4M8SA 4EGFA 3NT5A 1GZ4A 2YDXA 3C24A 3H6KA 4UUPA 4ND2A 3GT0A 4ALKA 1BSVA 1Y1PA 3ORFA 1DRVA 2E82A 4QQRA 3IL2A 4LK3A 3CSDA 4R54A 3IKTA 2YV1A 4PLPA 4WE3A 3RU7A 2XXJA 2J5RA 3U0BA 1VC2A 4WJZA 5JYAA 3GR6A 4BO7A 1HYEA 1KC1A 1LDBA 4RJTA 4RQTA 4Q3DA 4R16A 3TZ6A 3TJRA 3PPIA 3GF4A 1E3LA 2Y1GA 2E37A 4NG5A 2Q22A 3WFIA 4PG4A 3BTOA 4KDFA 3TZHA 4YPOA 1Q7CA 2JJYA 2QIOA 3FD8A 4YRAA 4FCCA 3QP9A 3BHJA 4KQWA 4RGBA 1Y9EA 4R1SA 4Q9NA 1I24A 3KBOA 3OA2A 1VJTA 2Y0DA 1E7RA 1DFGA 3RKUA 3ZHXA 1PGNA 1X7DA 1E6EA 1PL8A 3WSVA 4YT8A 2QZ9A 5I8ZA 4K1LA 4F45A 1UDBA 1ZSYA 3WBBA 1B3BA 5CEFA 3DAPA 4IDGA 3RFTA 3RI3A 5JO0A 3K2EA 3DONA 1HTBA 4J7CA 3SLKA 1XQ1A 3MTGA 4DLBA 3QVXA 1XLTA 1NVMB 1MGOA 1P1IA 2FZEA 2P4HX 2IZ1A 4QXMA 3DHYA 1LQTA 1NNUA 1JA9A 4FFLA 1DLIA 3TOZA 2O3JA 4DC1A 4CR6A 2ZTUA 1LSJA 2G0TA 4JBIA 3KZVA 1LJ8A 4PLVA 3OSUA 1B3RA 4ND3A 5C7OO 3EC7A 4DIBA 4MPDA 4YAJA 1VM6A 4A10A 3EDMA 4CV1A 4UAGA 2AHRA 2DBZA 2YFHA 3IIEA 3TWOA 1E3EA 2AE1A 5JO9A 3WSWA 4HXYA 1OOEA 5H81A 2PNFA 1T2AA 3GEGA 3OIGA 3VZPA 3EYWA 5TJHA 4GSKA 1E5QA 1PJ2A 5TF4A 1BVUA 4X54A 1EUDA 4RV9A 3INRA 4CLXA 2NVUA 1P1RA 5JYDA 4FFNA 2O7QA 3D3WA 1UJMA 4OSPA 3ULKA 4ZHSA 5H82A 4BGEA 3RUHA 1TT5B 4DPKA 1PS9A 3WGTA 1JKIA 5KJCA 1Y6JA 2V6FA 3GDOA 4PCVA 1U7TA 3W6ZA 5H83A 4YJHA 4Z6KA 5C3MA 1U8XX 2C5EA 4NU6A 4P4NA 4ONEA 4NR0A 5T67A 1EQUA 4QT0A 3GVXA 4BNVA 4O59O 4JQCA 2CZCA 2G82A 1ONOA 4CM3A 1HLDA 1DIAA 1VLLA 3RUCA 3TL3A 1I5RA 2PGLA 1NP3A 1R16A 2Y1OA 2YW9A 4JJIA 4WASA 1PJ3A 2QHXA 5B4UA 4E5NA 2ZQZA 1T4DA 2VUUA 1AHHA 3BHMA 3CTMA 1A27A 1YL7A 3P5SA 1TEHA 1UXHA 4UUMA 2FZWA 2W4QA 3F9IA 2EERA 2FSVA 3PRJA 3UCXA 3VPGA 1HL3A 4R1TA 3L6EA 3AFMA 4JIGA 1O5IA 1LLCA 4ZGWA 2JAHA 4PLCA 1R4NA 1UZLA 3PDJA 4OXNA 4IQGA 1J4AA 5HTOA 1R37A 2JHGA 5C7IO 3BIOA 1ISIA 3QWFA 4J9VA 1PJ4A 1YOVB 4ZD6A 3KTDA 1IZ0A 4J7UA 3WOHA 3TFOA 3B6ZA 3PXXA 4BVAA 4RVUA 1H6CA 2GR9A 1ENPA 2B69A 2V6GA 4Q3BA 3SC6A 4OQYA 2X0RA 5EESA 4YAEA 3GN1A 3GGPA 4J3FA 3I9JA 3GN2A 4HX5A 3K31A 3F4LA 2HSDA 2I5PO 3TZKA 1JKJA 3IKVA 2OFPA 4AJIA 5AVOA 2VZ0A 5CDYA 2FP4A 4EUFA 4B4UA 3C7AA 4MJLA 5T64A 1RWBA 1VE9A 1F8GA 4OXYA 4MOWA 3TRIA 1EEHA 5LC1A 2EJVA 2FN7A 2OO5A 3WQQA 3IQDB 4GX2A 1T24A 1PZGA 2AEJA 3AM4A 3MOIA 3UN1A 3INTA 3U4DA 1FDWA 1B8VA 3I3OA 3ETEA 3FWNA 3WLFA 4B4VA 4C7JA 5EQDA 1ZW1A 1RKXA 2HCTA 2EXXA 1I2ZA 3OM9A 2J3JA 4TZTA 2GASA 3AM3A 4FOSA 3M2PA 2IXBA 2ZTMA 3WTBA 3KOUA 3GNSA 4XB1A 3ETGA 3RROA 4AL4A 5F21A 1E3WB 4E32A 3HFSA 3ZWBA 2G1UA 3DZKA 3JQ9A 2NQTA 3BMQB 4N5MA 1Z6ZA 4CM9D 5B4VA 3AUSA 4I9NA 2OUIA 5G4LA 1OZAA 1RM5A 3H9EO 4UEKA 3K6JA 5T5QA 1GEEA 2D59A 1KERA 5IF3A 1BXGA 1D4FA 4JP3A 2C07A 3WS7A 5KVCA 2ZTLA 2PGJA 3Q2IA 1CERA 2E4AA 3HJAA 4OXKA 4CLRA 2GF2A 4BNKA 1YDEA 4NU5A 2H6EA 3AK4A 3DZIA 4ZQGA 1DFHA 1UP4A 1VL0A 2HMWA 5K9ZA 1GUYA 1S7CA 3BZUA 1GTMA 3DZHA 4CQMB 3V5NA 4OQZA 3RAJA 1YB4A 3JQAA 2D2IA 1RM0A 2FR8A 3SJUA 4TROA 4E12A 2CDCA 5KJ6A 2Y1CA 5KKAA 1LBEA 3AY6A 4E2ZA 1EDOA 4R3WA 2G17A 5K6AC 1ZO8A 1WDKA 1ZXLA 1YBAA 5BR7A 3PEFA 4WLNA 1JDJA 5G0UA 4RDHA 3U4CA 3G49A 1TVEA 2PD4A 5L9AA 1U7HA 3QE3A 3TZCA 2VUSA 4WECA 1CWUA 3R6DA 1T25A 4JBHA 2R00C 1YONA 4AJ2A 4CPDA 3WMWA 3GC6A 5BSEA 3F5SA 4D45A 4QO8A 4TZKA 1MG0A 4OOFA 1MP0A 3C7CB 4XR4A 1SEVA 3CZMA 4GKBA 3CZRA 3PJEA 4QFCA 2NU8A 4PVDA 3AW9A 3OQ1A 4GSLA 4II2A 3DZJA 3I4FA 1CIVA 2HK7A 1HDRA 3IUSA 3R1IA 3RUEA 2DBRA 1G0NA 1W0CA 3OA0A 4J43A 5EL0A 1J0XO 4KUHA 4EJ6A 2NVBA 1E1LA 1HXHA 3MWEB 3FI9A 4IJWA 1QLJA 4BNTA 4FD3A 2UVDA 3PHJA 5ITWA 1U3WA 1T2CA 5JCJA 1XU7A 2X86A 2VHXA 3HN2A 3U09A 4CLEA 4K26A 4AJ4A 4CMGA 2AXQA 3V1UA 1I33A 1ULUA 3GFGA 1X13A 5JMPA 1V9LA 2CF5A 5HS4A 4BO3A 4L0QA 4YDRA 4M54A 3GY0A 4ZQBA 1DAPA 2PR2A 3BMNB 3GVHA 4YT2A 1V3TA 3CMCO 4MVJM 3KRTA 3ZH2A 4BB6A 4DRYA 1XHLA 4WGGA 4MO2A 2C2YA 4XKJA 4JROA 3G3EA 3KM0A 3DZFA 2AG8A 1ENZA 4MIEA 3FPCA 1EMDA 4U0JA 3RJ5A 1SBYA 4PG6A 1W6UA 3NX4A 1DFIA 5HWSA 1AN9A 1ARZA 2EJWA 3WXBA 1YE3A 3UOGA 1YBMA 1YJ8A 1YGYA 2C2XA 4EUHA 5B12A 2DQ4A 4NI5A 3C85A 4IY1A 3BXXA 4IDDA 3M2TA 1C1DA 2ZKLA 2VYNA 1BDBA 1I30A 5KVSA 1PWXA 4WCFC 1YS4A 4M55A 5ILOA 2GN8A 1NQOA 4RLSA 2W2LD 1QYXA 4IDEA 4E2WA 4EDFA 1H0KA 3DOOA 5BT9A 3WMXA 1LC3A 4M87A 2VWQA 4ZQEA 4CMKA 4OSOA 1LC0A 1PGJA 1V0JA 4J0FA 1GZ6A 2X5JO 2X0IA 1WDMA 1NFRA 1FDUA 4WNIA 3O38A 3OQ6A 5A5EA 4YT5A 1RM3A 4W7HA 2DKNA 1O89A 4GLLA 3VHRA 5EINA 3DB2A 2D1YA 4BV8A 4DLAA 2FR0A 3VKUA 1GADO 1U9JA 1OMOA 2OBNA 4HUJA 4LMRA 4XGNA 2X0JA 1LSUA 2C20A 5TSDA 3PDUA 5A9SA 4CMBA 4I9UA 3DMYA 3BMCB 1GCOA 3JD3A 3LC2O 4WLEA 2HO5A 3JQBC 4D3SA 2Y1EA 5KWEA 5F5NA 3FRJA 4XYBA 3WBFA 1XIVA 2NTVA 5A1TA 3NTRA 1F8FA 1IYZA 1WDLA 2Q2WA 3TNLA 2VRBA 3ZWWA 4XDZA 2C82A 1C0LA 8LDHA 1LRKA 2Q2VA 4IQ8A 3R0IA 2X5KO 4Z0HO 4HNHA 4PFJA 3DBLA 3HDQA 2J3KA 2JL1A 4L74A 2Q1WA 5MDHA 3QW2A 4CMAA 4BGIA 1R4NB 1G6KA 3RIHA 3ZW8A 2V6MA 2PZMA 3S8MA 1EZ4A 2QRJA 3W8EA 1NFFA 4GVXA 1P44A 2ZCVA 4JGBA 2AG5A 4J1SA 3KUXA 4BB5A 4LVCA 2FR1A 4AJEA 4CLDA 2WYVA 4BO6A 3E6AA 3GQVA 1PX0A 2C7VA 1DRWA 1VKOA 3SBOA 4WKGA 4XB2A 3D4NA 2BH9A 1SEPA 3Q9NA 3S1LA 2P4QA 1T1SA 1QR6A 1P0CA 4BQPA 2I99A 4L75A 3EY4A 4XDYA 5EERA 4CM8A 5GZ3A 3QSGA 2CDAA 4XQ9A 1UDCA 1Z45A 4E4YA 3PGJA 5JXWA 3ITDA 3O26A 8ADHA 2YHIA 3TQHA 4II3A 1BVRA 1B7GO 1O8CA 1YB5A 2WE7A 3ZWYA 1PTJA 4XGKA 3KV3O 1Q2XA 4HFJA 3FSRA 4IIVA 2A9FA 4B8WA 4WLVA 1WPQA 1M66A 1NPYA 2AMFA 2GN4A 2VYVD 4OAQA 4W9NC 3OJLA 1ZEMA 2ZIZA 4B7CA 1U28A 2BFAA 2OL4A 3D7LA 4MVJE 5F1OA 3DEYX 1ZK2A 1HWYA 4EUEA 1Z7EA 1QMGA 2DM6A 3MTJA 5L53A 2QW8A 4AJJA 4LGVA 3KB6A 1NQTA 4KWIA 1P74A 3IJRA 3PHIA 4N54A 4OHUA 2O50A 4CLHA 5HRUA 1QV6A 1YQDA 4TKLA 4DQVA 2I3GA 1U1IA 4BNZA 1B15A 1RM4A 4E33A 2GPTA 1PEDA 1PJTA 1EVJA 1ISMA 3GFBA 2GSDA 3WGOA 1H6BA 3P2OA 1RPNA 1GPJA 4OKNA 3A1NA 1ZK1A 3IUPA 3G17A 1FDTA 3UVEA 5L4SA 4XJTA 1DBVO 5AYVA 4YAKA 1YB1A 4F6LA 1GAEO 2J6IA 3N58A 4W99A 5JYEA 3JQAB 3SX2A 1UH5A 3A28A 2CNBA 1I10A 4CM5A 2ZK7A 3ZWCA 1B8PA 2PD6A 4J0EA 1E7WA 1LQUA 5I7FA 3G1UA 3W1VA 4Y6PA 1NBOA 4Y9DA 1UP7A 1IE3A 2DC1A 2OOSA 2HDHA 3WYBA 1O95A 4IDAA 4PRLA 5COQA 3JQGA 4TRRA 2YYYA 5G0WA 2ZB7A 1U3UA 5DOVA 3QVSA 2NNLD 2VHYA 1JWAB 1R0SA 4JCOA 3GG2A 3VDQA 3JD1A 5JAZA 1NQAO 3JD4A 1HLPA 1LU9A 4U8GA 4Z3KA 1PJQA 1N1GA 3FNEA 2VOJA 3SEFA 1EVIA 4CQLA 5IXYA 2Y1FA 4BV9A 3GNQA 1DPGA 3C7DB 4NBWA 1PR9A 4K6FA 1N92A 3ZZNA 3F1KA 2PH3A 4BKOA 1EQ2A 3P7MA 5KOIA 2GD1O 4NPCA 4XRRA 4DC0A 3ZN2A 5J23A 1F14A 4YQZA 1P9LA 4XRGA 4INAA 5HA5A 1C1XA 4PG5A 2GLXA 1PQUA 2VTEA 3TOXA 5CDSA 4NJMA 4OGWA 3RC7A 2R6JA 5U4QA 2FSSA 1MXFA 2BGMA 2UV8A 3NV9A 4O1MA 4Q39A 1M67A 4KQXA 2YFQA 1P1HA 4HFMA 3F47A 2NTJA 3I9NA 5AOVA 2EGGA 1MFPA 4MDHA 5JAMA 2B36A 4L9RA 1JWBB 3OJ0A 2FY8A 1Q7BA 4BO8A 3IMFA 4W82A 3WJAA 5JMWA 5J9GA 5TJ9A 4GI2A 2J5QA 3I9MA 2XAAA 3JQ8B 2D4AA 4J6FA 4XYLA 4CMCA 2O4UX 1YQGA 3UCFA 1D3AA 2HMSA 4BMVA 1MB4A 4D79A 1BG6A 4NMHA 3WG9A 1DIRA 4RZIA 1ENYA 3MJSA 3W6UA 1JAYA 3ZGYA 4BO0A 2AQ8A 1I0ZA 2B4RO 1ZK0A 3ASUA 3FCOA 4FGSA 4AFNA 2HKIA 2OP0A 4DQUA 3HB4X 4J49A 5BNIA 3U3XA 3JV7A 1YQXA 3DFZA 1K3TA 1YBVA 5GZ1A 1AXEA 3ZU5A 4J16A 1KEWA 1KVQA 5KTKA 1I2BA 1KVSA 4NDNE 3DTYA 3KVOA 3PYLA 3GVPA 2PK3A 4D0SA 3I6QA 4RPGA 3DAGA 3RJ9A 4ZQHA 4OO3A 3EGOA 3BHIA 2BI8A 4ZQFA 1C1DB 5IXSA 3F46A 1RJWA 1R0KA 3VC7A 4BKQA 3N74A 1HDCA 4ALMA 4RPLA 3E9MA 3JQ7A 1TB4A 2C0CA 2JCVA 2Y05A 1NPTO 4NFHA 1GY8A 3JQEA 5T57A 7ADHA 5T8KC 4CMIA 1D7OA 1F0YA 3AUTA 3ZCXA 2DBQA 1QXSA 4PZEA 3L9XA 4UVDA 3AI3A 1SC6A 1EUCA 4XQCA 4WLOA 1Y5RA 4J7XA 1FF9A 1LX6A 2C29D 3INGA 5JNLA 2D5CA 2V65A 4RVGA 1Q1NA 1E3SA 3M1LA 5TS3A 5B1YA 5KNLA 3WGYA 1LRJA 3WB9A 3AI2A 3D64A 4DBVO 1PJCA 4D3FA 1GYRA 4CLOA 1U8FO 3ZWAA 4RLHA 1JVBA 2ILTA 3H3JA 3E48A 2PY6A 3ICCA 1RYEA 1FDVA 5IFLA 2D5AA 3HB5X 3P2YA 4CV2A 2NVWA 4Y67A 2Z5LA 1NQ5A 1WZIA 4YB8A 5A05A 5A5FA 2E49A 3X2EA 4HADA 2W8ZA 1PGPA 1U5CA 1SMKA 3JQFC 1LA2A 1QLHA 1IHXA 4LVUA 4HFNA 4PLFA 1T2EA 4B4WA 3LT0A 2LDBA 5A9SB 6LDHA 1ZMTA 2BKAA 4EJ0A 4DA9A 2PWZA 4TMFA 2NU9A 3ZV6A 5DCYA 3GDGA 5JC8A 2VCYA 5K6AA 2VUTA 1EFKA 4HP8A 3WNQA 2EEZA 1XELA 3HNPA 3BA1A 3OETA 4GX1A 1R15A 3ONFA 4RZHA 4CR7A 2BGKA 3DTTA 1SNYA 3IP1A 3QWIA 3I1JA 2Y0CA 3FHLA 5L7TA 4EI2A 2R00A 3V1YA 5CDTA 5CEJA 1D1TA 4D0RA 3OHSX 1O9BA 3E8XA 4BMSA 5JYFA 4Z0TA 3O9ZA 2DPGA 1DAOA 2FPPA 4IPTA 1TXGA 3K92A 1KC3A 1H9AA 3E18A 3VPXA 2EIHA 1LLQA 3DBHA 2JFHA 3NYWA 3O4RA 5MGBA 2QX7A 4IDBA 2JCYA 1F17A 2IEBA 3NDRA 5GMOA 1GV1A 3PIIA 3B70A 4ND4A 4CM1A 1KVRA 3LT2A 4R68A 1NYTA 2BHLA 4R5HA 5ER6A 3CINA 4CM8B 3PYXA 3A06A 3C1AA 1IZ9A 1VRWA 2RCYA 3RC2A 3DBRA 5AXCA 2PV7A 4J4BA 5BQFA 4WUVA 3LYLA 3Q2KA 3VPFA 4XQGA 1Z7BA 4PIVA 5ICMA 2IE0A 1Q0HA 3ZHBA 4E5KA 4PGFA 4O5OA 3TZQA 4A5OA 4WEQA 3I23A 4BNGA 5G4KA 2B5WA 2D3TA 1MC5A 1ZKMA 3ANNA 4UREA 3S2IA 1T2DA 3FNFA 4YVFA 4B3HA 4LRTB 2F1KA 1OI7A 2EGHA 4JJGA 2HRZA 2CVOA 2FPIA 2HLPA 3BMOB 3JCZA 3LSYA 4PVCA 4TWRA 1PS8A 2VRCA 3I83A 1ZXBA 4PZDA 3PGXA 1XG5A 1UXKA 1P45A 3B1KA 2B4QA 2QRLA 2YY7A 4ESOA 4J91A 2PGDA 1DB3A 5CPBA 5KCZA 1XEAA 1BW9A 4J1QA 1U2GA 4R69A 1R4MA 3DR3A 4Y6RA 1D8AA 5CEEA 3PI7A 3UHAA 3H3FA 1U5AA 2WEKA 4XGIA 1ISJA 1P31A 1J6UA 3CMMA 4EW6A 4GPD1 3PWKA 4KP7A 4LN1A 4MKRA 1GFSA 2Y99A 3ZWOA 3WTCA 3U4IA 5A9RA 2HMTA 1E3JA 2DTXA 4AJPA 1DIBA 1TA4A 4OOEA 1PZEA 1OAAA 5ADHA 2WD8A 3DBVO 1M2WA 3I9KA 3GMDA 1LEHA 2NUAA 3DOCA 1PGOA 4YWJA 4IGEA 4DUPA 1H9BA 4G81A 4FJ2A 3RUDA 1UR5A 1ML3A 2VTDA 3DMTC 2A94A 5G0SA 4IDCA 1ISHA 4RPHA 2CFCA 2CMDA 3AM5A 4B3IA 2VWPA 4RO0A 4PG8A 1PZHA 3KEOA 4YQYA 4GX5A 5JAIA 4D46A 4BMNA 5F3RA 1MV8A 1ZJYA 3F4BA 4LSMA 1AUPA 1DO8A 1X7HA 4BNFA 1NASA 2UYYA 2TMDA 3B1FA 1I32A 3STHA 5I9NA 3NTQA 5BNTA 1K6IA 3JQGB 3GNTA 2YZ7A 3B20A 1VPDA 2Q99A 3CUKA 3JD0A 3ON5A 4ZU3A 3ZHYA 3PP8A 4GKVA 2FRDA 2YV2A 4QECA 3ZU4A 4IZIA 9LDBA 4XZ3A 1YXMA 1QYWA 3QWHA 4W7IA 1Y8RA 3HSKA 2YV3A 2I66A 4BO1A 3JQBA 1ORRA 3PJFA 1Y81A 3W4IA 3PQEA 4B8ZA 3OQBA 1PIWA 5LDHA 5U1PA 4CQLB 1A7AA 2FPGA 1PJBA 1KBZA 1V6AA 2H1SA 2OHXA 1K6JA 1Y7TA 1HE4A 3EZLA 3HUDA 3M6IA 2RIRA 4NBTA 4UULA 3SXPA 3WQRA 1NR1A 1ZSNA 1G0OA 3OIFA 2HMVA 3JYOA 1DC3A 4PLGA 2Q3EA 4XWYA 4FFPA 4KZPA 1SOWA 1MX3A 3C1OA 1T4BA 3O8QA 1QYDA 5IG2A 1D1SA 1HEUA 4NJMB 1PL7A 2VHWA 4UVIA 1IPEA 5LDGA 1E7MA 1E7YA 1HDGO 1VSVA 4GMFA 3PHHA 3ZU3A 1SZJG 4FFOA 1E1KA 3H2SA 4FQ8A 4R4JA 3SVTA 4TSKA 1ZMOA 4RL6A 2R2GA 4ALLA 5JY6A 3SJ7A 2HK9A 4I5GA 1KVUA 1YRLA 4CM4A 3E82A 1XDWA 4MP3A 5C5IA 5L45A 1KOLA 3UW3A 2I6TA 1M6WA 4G2NA 5IAAA 3A14A 1IUKA 1W8DA 4E5MA 2AA3A 2HJSA 4GQAA 1WMAA 2GZ1A 5IDXA 3GHYA 4YJFA 1RYDA 2P5YA 5LCXA 3IS3A 1XYGA 2F00A 1N2SA 3DDNA 2O3QA 4LISA 3T7EA 4JBGA 4RPJA 4BIIA 5T73A 4YJGA 2PZJA 2NLOA 3U5TA 4YEDA 1X1EA 5CAEA 4J2HA 4CV0A 5AXBA 1KVTA 3TL2A 1HT0A 1I01A 2O4CA 4I9HA 1O94A 3HZZA 4CUKA 5BSFA 3KYCA 4J90A 2WD7A 3HDJA 1BWSA 2O3TA 3OH8A 1T1RA 1A7KA 3JQ7B 5THKA 1LTHR 1UUFA 4GMGA 3FBGA 4AVYA 3QA9A 3ZV5A 1A9YA 2RHRA 3IC5A 4K6CA 1DHRA 1UXJA 2PFGA 1WXDA 3D4OA 1CF2O 4IQ0A 1JLLA 2C59A 4I8XA 1Z82A 4DPMA 2Y0EA 2GCGA 1PZFA 3GAZA 1I3NA 1DOHA 4C7KA 3PZRA 1LDEA 2BD0A 4O0LA 4MIOA 2DUWA 3OIDA 3VPSA 3ZWVA 4YBZA 3JYQA 5JBIA 4UVHA 2VOEA 1P33A 2I76A 2FHSA 4BL5A 4XCVA 3DZBA 3AY3A 4BKRA 3AWDA 2WE8A 3GEDA 3E5MA 3IDSA 3DO5A 2EKPA 2BRUA 1VI2A 3GG9A 4RF2A 3UICA 3H5NA 2XOXA 2GERA 3AUUA 3KSZO 1DEHA 1ULSA 2Q1TA 1Y9AA 1P1FA 5IDQA 1N8KA 2DAPA 4DXHA 1CJCA 1NTOA 1BXZA 1QYCA 2CVQA 4LMPA 2AEFA 3WNVA 4L4XA 1O0SA 2ZYAA 9LDTA 4GVLA 3H5AA 4DIOA 5DN9A 5JDIC 3GH3A 2NVUB 4Z9XA 2ZB4A 5EQFA 3T4EA 5IZCC 3D3WB 1I2CA 4Z9FA 3EZYA 5T8KA 1TLTA 3MWDB 1B8UA 4CQMD 4E21A 2P68A 1HKUA 5COAA 5DP2A 4IIUA 3ZNNA 1YWGO 4R1NA 3PHLA 1B2LA 1A5ZA 2OXIA 3WX0A 3P19A 3ROQA 1PU2A 3Q0EA 3CE6A 2PTGA 5A3JA 4YJHB 3G0OA 2EKLA 4Q3AA 3GAFA 1FMCA 1VJ1A 3LK7A 2EV9A 4XYGA 2VZ8A 1AGNA 2DTDA 3NGXA 2GYYA 1WVGA 3DBHB 5FF9A 4FBGA 2DFDA 1O6ZA 1WLYA 2DFVA 4ITUA 1FXSA 3IJPA 1P77A 1QRRA 2GGSA 3R3JA 4WOJA 1E5LA 4NH4A 1DC6A 3PFWO 3K9QO 3V2HA 1WNTA 4JX8A 2YDYA 5A3VA 2WMDA 4XR9A 3E03A 5EJ2A 2JD1A 2H5LA 1WZEA 4M89A 4CM7A 4GH5A 2HMUA 3W8DA 4CM9A 3L77A 4Q3EA 2O7SA 2RAFA 4P38A 4TRMA 3ZWMA 1NWCA 1XWFA 1U4OA 4WK6A 4R01A 1NVGA 5JCXA 1YH3A 5CDGA 3CKYA 4CL3A 1EDZA 3H2ZA 2YHUA 2JFGA 3WYCA 2ZQYA 3AUAA 2QYTA 5I7SA 1U3TA 4ZVVA 3RFVA 1Z75A 4TVBA 4AJLA 2X0NA 3K73O 1QYVA 4DYVA 5U9CA 4PLHA 4PLWA 4ALNA 4RQUA 3GGGA 4EJMA 4XEHA 3ETDA 3H7AA 1GCUA 4ZRNA 4GAEA 3ZNQA 5L7YA 1N9GA 3IP3A 2B83A 3GLQA 4I08A 2JCXA 4LSWA 3UFXA 3NUGA 3ZNPA 2B5VA 4IMPA 5I9MA 1SB8A 4EZBA 2Z1NA 2ZYDA 3ENKA 2OZPA 3EHEA 2IXAA 1EFLA 5ENDA 3WDSA 1DSSG 5AXAA 5DULA 1YO6A 1ONPA 4OH1A 4CV3A 1JKFA 1A4UA 2I3AA 2QG4A 1DJNA 3M1AA 2W90A 3MJEA 4CUJA 3NDIA 1BRMA 2Q1SA 1N7HA 5THQA 1LLUA 1CEQA 2BFMA 1Q7GA 3U49A 4F3YA 3AOGA 1PQPA 3AY7A 2EW2A 1GYPA 2DU8A 4WNCA 1DXYA 2BMAA 2W98A 3GZNA 1SOVA 1H2HA 2OBYA 3I9LA 4H7PA 4XD2A 5G2OA 1ADGA 2ZYGA 2IEDA 3VAZA 5TIIA 1C0PA 5HS6A 5TT0A 1G1AA 2JD0A 3ANLA 4JLWA 1YL6A 1E1MA 4O6VA 3V2UA 4P4LA 2J8ZA 1C3VA 3I52A 2O23A 3U9LA 1YL5A 5BSGA 1X7GA 3E9NA 4IINA 4ZRMA 3ZWXA 1QP8A 1UP6A 1V35A 3C1TA 3H65A 3GPDG 1BXGB 1PJSA 3MJVA 3O03A 2XPCA 2ZB8A 4NK4A 3WWYA 3CH6A 3JQFA 4CMJA 2O3UA 2O48X 2B35A 2EG9A 1MG5A 3OFSA 3GK3A 3OP4A 1GR0A 1YOVA 4A7PA 4C4OA 5JS6A 4UVGA 1VL6A 4CLRB 3UAGA 3K2BA 5FEUA 3H9QA 2VHVA 4K9DA 3MEQA 2GDZA 4ND5A 1EK5A 2DLDA 4IBOA 3RC1A 4DTIA 1KYQA 4KTTE 2YQ4A 4HBGA 3L6OO 2QRKA 1IHYA 1KIFA 2GZ3A 4NHEA 3BYZA 3FWZA 2UUPA 5JDCC 2DPHA 2BFOA 3O8QB 1KEVA 1PQWA 3T4XA 1IB6A 1LSOA 3LLSA 1HSZA 3WICA 4KWHA 4RPKA 3WQSB 3D3EA 3DHEA 5EIOA 3L9WA 2V7PA 4E2YA 1I36A 3RBXA 1V3UA 4DREA 3QVTA 3NJ4A 1MXHA 3G1TA 4E0BA 4CM6A 5JC1A 3WWZA 2AEMA 1U4SA 4L76A 2FWMX 1EE2A 1LLDA 1NHWA 1R12A 2X9GA 4PG7A 1E3WA 4CM4B 5COBA 2X23A 3EMKA 4FGWA 4FC7A 1BGVA 5C7LO 2X1HA 1BMDA 4DMLA 3BMQA 4FB5A 1Y8QA 2X6TA 5C37A 1P3DA 3HQ4O 4BNJA 2Q45A 4UEJA 3PIDA 4YRBA 4GLOA 3OEYA 3IOYA 2B4TO 4HKTA 4FN4A 4YJFB 3VPHA 3DL2A 1R6DA 3PFFA 1WWKA 3GRPA 1GUZA 5TQVA 3PTZA 2W2LA 2BI7A 4YJGB 1N5DA 3VVCA 4DLLA 2HUNA 2X4GA 4S1VA 3W4KA 3FR8A 4A2CA 2YJZA 4L8VA 1MC4A 4HY3A 5DCWA 3V8BA 4MVJH 2B0JA 1KY4A 5DBGA 3KYCB 3MZ0A 5L51A 4CQMA 1EK6A 1HYGA 4J2OA 3QJ5A 4ALIA 3EAGA 4KDEA 2H63A 2WYUA 3VOSA 3DXFA 1K89A 1X14A 1HZZA 3FR7A 3R3SA 1ZBQA 5B37A 1WAMA 4NK5A 5ER9A 5L3ZA 2X22A 3KHUA 3VDRA 2BLLA 3PWSA 5L4NA 1U3VA 3WGQA 5EPOA 3TFQA 1H6DA 1E3IA 3RC9A 2NU7A 2UDPA 3RUAA 1XKQA 4OIMA 4D44A 3RFXA 1ZZEA 1B0AA 4NBUA 4JXKA 1PSDA 2IYOA 4U5QA 3NRCA 4NIMA 4Q3NA 4PLZA 4CMHA 3FTPA 2D0IA 1WW8A 3H8VA 2WJPA 1ID1A 5EMHA 1PR3A 1NR7A 4XA8A 1T26A 1K2WA 1JQBA 4NFYA 4OL9A 2HU2A 3JQ6A 3ROMA 5BSHA 3KLPX 2Y66A 2J3IA 2W2KA 3DMTA 2P9EA 5BNFA 4QEDA 2OORA 3OEWA 4NJOA 4YR9A 1B14A 4HNGA 1ZEJA 2VN8A 2AE2A 4XJSA 2G5CA 1PL6A 4XX0A 1NFQA 2ZCUA 2SCUA 4TQGA 4TVOA 1E0DA 5KJFA 3UXYA 2NADA 3GZ4A 3JD2A 1ISFA 3RU9A 4U0KA 5L4LA 3EVNA 3DHNA 3I4CA 1ZNQO 4YRDA 5ENVA 4D42A 3AI1A 1C0IA 4N18A 1PGQA 3ENNA 3PHGA 3VH4A 3EUWA 4NBRA 1SO8A 3JQAD 1GUFA 5L40A 3FBTA 1IOLA 1CRWG 3MJCA 3VZRA 1Q0LA 2IDZA 4RF4A 5F5LA 3U4HA 2WSBA 3F3SA 2HJRA 4OJNA 3ZNOA 4D43A 1YDWA 3QWAA 4A26A 3BMNA 4IJUA 4ROSA 1J5PA 1SCUA 2VWGA 3CPSA 4EITA 5B4TA 3PWZA 1QSGA 2I67A 1SB9A 2OP1A 3QVWA 4OMUA 3VH1A 7MDHA 4PZCA 1A9ZA 3L4BC 3ASVA 5EN4A 4AJKA 4B79A 4XYMA 4DL9A 4MINA 3GPIA 1OC4A 4JJFA 3FN4A 5DBFA 1ZVMA 4XQEA 2VYVA 4CJXA 4GGPA 1W4ZA 1HE5A 3LF2A 3LT4A 1XCBA 1GDHA 3N7UA 1TT7A 2O2SA 2YQ5A 3AOEC 3RVDA 4I1IA 3COSA 2DT5A 3DBLB 4DVJA 1R66A 1OBFO 5TNXA 3NEPX 4DMMA 4DQXA 1ZFNA 3S2EA 2P9CA 5ILGA 4CR8A 4CMEC 3QV1A 1KEPA 2CDBA 2X5OA 4JNKA 1IL0A 4U6QA 2RH8A 5A9TA 1ZK4A 1Y5MA 3DZGA 1IY8A 3UUWA 4MIYA 5IDWA 3PLRA 3OBBA 3ZHZA 3HN7A 3PVZA 2AQIA 3H9UA 4BHTA 3A4VA 4H16A 1IPFA 1F06A 1IULA 2ZJ1A 1K5HA 4NZ9A 4J4HA 3QRWA 2VHZA 4P8RA 4IDFA 1QORA 3HG7A 5JCJD 4D3DA 2NSDA 1N9GB 3DWFA 2I65A 3FTNA 4IS2A 1K0UA 1HETA 4F6CA 3L07A 4CUZA 2GN6A 4R51A 1HRDA 2Z1MA 1HSOA 4A0SA 2FOIA 2P9GA 4BNNA 5TT1A 5GZ6A 2YHIB 3WFJA 4P22A 2WDZA 2NU6A 1UDAA 1JN0A 2EW8A 3OMLA 2WM3A 4JP2A 4BNMA 5HM8A 1VSUA 4FR5A 4N7RA 3BMCA 4WLUA 5KJ1A 5JPIA 3H4VA 3CIFA 1HE3A 1H2BA 3GOHA 4RDIA 3GZNB 3AFNA 1T2FA 5I7VA 4L4SA 3ONDA 2ZB3A 3LU1A 5JAQA 2P2SA 5ICSA 5L95A 3F5QA 3LF1A 2QQ5A 4UEOA 4A03A 4YA6A 3X2FA 4WEOA 5DDIP 1X1TA 4OM8A 4ZA2A 4AJOA 3GUYA 5KKCA 2VYND 2AQKA 3RKRA 3S2GA 1V3VA 4AG3A 4G65A 1QKIA 2NTNA 1UXIA 4FIZA 2JFFA 2O3RA 4W4TA 3GVIA 3TSCA 1XA0A 4DIFA 3ABIA 4MP6A 2DBVO 4MVJD 1LI4A 4E6PA 4ZN6A 3KSUA 4IJKA 1CYDA 3PJGA 4LCJA 4KUGA 4GX0A 2TMGA 3K30A 1ZUD1 1E7QA 2D8AA 4WCFA 1ONNA 3W8FA 3UF0A 1NAIA 1P1JA 1A4IA 3K96A 4XYEA 4B7UA 4BNLA 5I7EA 5AXDA 4BO2A 3NJ8A 1DHTA 3WR5A 1GD1O 3FPLA 4EYEA 4H15A 1JAXA 5JDIA 2EP7A 3ROPA 1QG6A 2P91A 5IZCA 2X9VA 1NX6A 1FK8A 3F6YA 4E30A 4MKZA 3PQDA 4N5LA 5G0TA 5JLAA 3LVFO 4FPXA 4GWKA 1OFGA 3KYDA 3TN7A 3LC7O 1ZIDA 3NGLA 1V8BA 4FFRA 5AQ1A 4BGVA 4MVJG 4BNYA 2FMUA 4URFA 4GGOA 4BQRA 5M6DA 4IJVA 5T6BA 1EBUA 2J5KA 1JTVA
chains in the Genus database with same CATH superfamily
1WUJS 1AURA 1YZFA 3G7SA 4AG5A 1R27A 4DCSA 1A5BB 3GHHA 3KTAA 1M76A 2QE7D 4O4IA 4Q4DA 1L5HB 2DQSA 5ES3A 3SKYA 1SVMA 5IX8A 4IIJA 4AIRA 1BE1A 4YR7A 4UFNA 1WUHS 4NAHA 1KK0A 5JV5A 1B16A 1D0IA 4TN1A 1ECJA 1YKFA 4E31A 2HPAA 3CGGA 1DBRA 4IZHA 4PAGA 4K9MA 1TI7A 4DR2B 1U0RA 2LCIA 2C5AA 4IEIA 2DCMA 4RF5A 1Y8CA 2BMDA 3MJTA 4XQ0A 3CR3C 3BKXA 2VZ9A 2BFBB 2IUFA 4IH9A 4XIYA 3R6LA 1W88B 2VK1A 1FNCA 3DW1X 1U1FA 4L27A 3EVTA 4HDSA 5ERYA 1P73A 1G3MA 1QTNA 4RTLA 4G41A 3GFVA 2P9JA 4IOMA 4ZT3A 1Y82A 3TJMA 3ELYA 3TW8A 1WVMA 5E8RA 1G8SA 3DZ4B 3BRQA 3EGWA 3EBLA 4BP1A 5LYJB 4G2TA 4MUYA 2P2CA 2JIRA 2WSSD 4HMQA 3C3XA 1C41A 4Q4CA 1MPTA 4OX9Y 1DMSA 4GI7A 3W4JA 1UAGA 1GGHA 2J0SA 4FVTA 2EW1A 3R4CA 2XGSA 2BMJA 1YIOA 1W4LA 3U7QB 2FHPA 2QPAA 4CTJA 2H5JA 3NKVA 3QLJA 2PR7A 4JK3A 1HDXA 1H4VB 4QX6A 1QCCA 3GEMA 3T0FA 2F3RA 3F5MA 5GGYA 2E1PA 3ROTA 1Z13A 3K09C 1AGPA 1BHSA 4U39A 5JS7A 2TSYB 3I5MA 3R5XA 4MWZA 4CGYA 3N39C 3MUOA 1VSBA 2X8AA 4H6WA 3ZHOA 5DNVA 5DGCA 1U0HC 4RVSA 1Z2CA 4RF3A 2I1LA 3TX2A 4DQLA 3T3HA 5IAKA 2D5LA 2EKQA 2JKVA 2QUHA 5DGTA 2PWYA 3U4QB 1QV7A 5FIUA 1ECGA 3GDFA 3WY9A 4G0QA 2IPNA 3AVWA 2NUPB 4LZZA 4QOGA 1OXSC 1UAYA 3CNNA 3ITEA 5HW0A 1LSSA 4MUAA 3MINB 4PO9A 1E8MA 3N3AC 4YIHA 4GGMX 1Z5PA 1XAHA 1Z0DA 1FY2A 2Q6TA 4XIGS 2XT9A 1IHOA 2RH9B 4BBZA 4POOA 1XGKA 4JIMA 1KHHA 3K0AA 5CRIA 4CODB 2DB3A 1DEOA 3SC4A 4W9NA 1ZIYA 1NNI1 2A57A 5EJGA 4NZOA 3TTSA 1H93A 1CFZA 1RLTA 2C5FA 4GW3A 2HRBA 3RVSA 4BO5A 3NIDB 2A78A 4ZT2A 2D00A 3KDAA 3HL0A 4X44A 2B1GA 4EKGA 1MB2A 1TYEB 3AESA 3HACA 2FK8A 1G20B 3QKTA 1Z07A 4QNMA 5ECWA 4YONB 821PA 4RPCA 3W2GA 5HJEA 2A6PA 2X15A 2GFIA 2X8LA 1RCFA 5CP8A 4ANFA 3DQPA 4NULA 4PRZA 1MOSA 2O52A 1OB2A 1SC3A 2QORA 2C4TA 1TGYA 1WUKS 1UMCA 1DRUA 3JR3A 5F52A 5KTMA 4ABTA 2I71A 4TWAA 1Z4PX 3KQNA 4D4MA 1H3EA 4MVJP 2UAGA 4FKMA 3UJ6A 4PX9A 4C4SA 4CLOB 5FI3A 4YGXB 2FSVC 4IMRA 3E1GA 2J3HA 2PKRA 3L79A 3MWLA 4TKMA 3TNYA 3EZ9A 2CHUA 2OENG 5JFOA 2WJYA 2ZSFA 3FGZA 3RRYA 4RAQA 4A8HA 2PKQO 2A8YA 1FUKA 3RDPA 1EBFA 3M6UA 4HTFA 1JW9B 2I1VB 4DA4A 5ERXA 1F2TA 2PAFA 4EHIA 2AUNA 2P0EA 3KDPA 4JFRA 1JMYA 1U98A 2ZPAA 4BPBA 3WGGA 1O95D 1RPJA 5A7FA 1UEIA 5E7JA 1MAHA 3LDUA 5HKBA 1T9KA 2C2HA 2YYSA 2C54A 3RNOA 1ULAA 5IJWA 3LT1A 4ZVUA 4U7DA 5JDCA 3TV1A 3Q6IA 1W5AA 2O05A 1LBIA 2P5UA 4UHFA 3RU3A 5KVVA 2AW5A 2EX4A 2HXYA 1Y33E 2EWWA 4YCNA 2HF7A 4IICA 3N0WA 1Z4LA 3FCXA 4UARA 3OVMA 2E55A 3QM1A 4NFSA 4UBNA 3B9BA 5AKJA 3DZ8A 4NQZA 3K2IA 3QX7A 3C8MA 1DIHA 2H5EA 2XZPA 2CBXA 2ZT7A 2NN3C 3CN7A 1E6MA 3HDHA 3M1IA 4K3VA 5IN5A 3WHKA 1IM5A 4AL4A 1LDGA 4M37A 4XIJA 4YAGA 1DJLA 3MCVA 1L7EA 5KOJA 4I4TB 2NWQA 4CIYA 1FRVA 2AK3A 3PQ2A 5A03A 1R0RE 1SPBS 1Y63A 1YR6A 3AU9A 1WXEA 2OO5C 1U6IA 3HDVA 4KVAA 4QBGB 4C3VA 2GJ9A 5I8PA 2ZJ5A 3TQFA 1MW8X 2FPPB 4MUJA 1SQ5A 1A71A 1U90A 4FLMA 1XJ0A 4CF7A 4KOAA 1KYWA 4MVJA 3BC1A 4TXLA 1T6XA 1H5QA 5DP1A 3UKJA 1AGRA 4D9HA 1YR7A 1Q3KA 1KQNA 4B73A 2YJNA 2WUFA 2H51A 4TS1A 4WY5A 1Z06A 3GA0A 1DEKA 1ADBA 4DMRA 1HE8B 2I87A 1KDRA 5IVHA 4J07A 2VNAA 4EI8A 4G5YA 2CY0A 3TQIA 4R5MA 4NNJA 1A82A 2IY7A 2QJFA 5LZ9A 5IARA 1XDUA 3JQ9C 5HIKA 1SA0A 3EW7A 3UJ3X 3SBDA 4M46A 4MDEA 4B3CA 4MW0A 3NM5A 3OOJA 5BSMA 3KZCA 4BS9A 3DBRB 3DJYA 3RUIA 1TIPA 3ZX5A 4E5PA 5TGDA 3WK4A 1L7DA 1YVUA 4N5NA 4Y3UA 3AZPA 3HMKA 4GM1A 1GARA 4QASA 4MR9A 4RXUA 4V0MA 5E4JA 3FF4A 4IM7A 4M7RA 5B3JA 1JDBB 1U0EA 5G4KB 4Z53A 3Q3CA 1QHGA 3I2JA 4XUDA 4PSAA 2I7DA 3GLHB 2HMYB 3LWZA 4IIFA 5A02A 1WV1A 3ICPA 2ZJ2A 5FBZA 1YR8A 2IKSA 2QUAA 1MT3A 1SY7A 1U0NA 2R4UA 3TQSA 5KOYA 3DDWA 4WFQA 2AUTA 1TZCA 1XF9A 2FPIB 3F8TA 2ZT8A 3VKVA 5J4HA 4U2KA 1TA0A 3TD2A 2JASA 2GPJA 4MS1A 1WUTA 4E5SA 4EEXA 2FR8C 1SUSA 2IFTA 2HJ9A 4GWGA 4ILKA 1WSWA 3FBWA 2XNDD 2LDXA 2IP2A 4G63A 4HWSA 4Q7KA 3CYFA 5G0VA 3QVJA 1HEIA 3VYRB 2DX7A 3PRYA 3FUVA 1TT5A 3E5NA 3AJRA 3PD1A 1CETA 3DEHA 4IV0A 3PJDA 4L7VA 5FWYA 4MYRA 4F85A 2C9YA 3D0OA 1T4CB 3EFHA 1GNLA 1PT9A 2VQDA 2W43A 2QTVB 3BREA 3EQ6A 4Q66C 1K98A 3RK0A 4CEIA 1QIJA 1GKUB 3T12A 3EPBB 4JCCA 1NW9B 5K0EA 3U39A 4WLFA 1UFVA 5KWSA 1U1CA 1SXJA 3OF2A 1AY0A 1ULTA 4RORA 4KN8A 3M70A 3HXKA 1LW7A 5LNK1 1UXGA 3I8SA 4CCYA 1GQ2A 3KUCA 3L0IB 2JIDA 1ZJZA 3IP9A 3PC8A 4DBZA 4KQCA 5B6JA 3IAHA 2ZRPA 3QNMA 1R0WA 3NMUF 2LKCA 1PS0A 2ZCJA 2NSLA 3MRXA 2C4VA 2Q1XA 3VR4D 3NBKA 5D1HA 1W36C 5CNMA 2IS6A 2YICA 1WRBA 2FEKA 4GEKA 4D7AA 1SU6A 3TQOA 4O2BA 1UC4B 1LDMA 1VKNA 1OLSA 1G4AE 2ATVA 2XYGA 4QPNA 2Q7XA 4Y8VA 1AG9A 3K53A 2OB1A 3FLAA 1HE2A 2J07A 3GRKA 3KEMA 3WZLA 3IDZA 1WZCA 4JH0A 2BV3A 4I6GA 1TAQA 1LY1A 1YQQA 3OE4A 2C7BA 1RXCA 3RTDA 1GKYA 4REQA 5JPCA 2ZR7A 4UCXA 2JGNA 4QPJC 3Q15C 5M29A 3RLIA 2C4WA 1G60A 1NN0A 2BEVB 2F1JA 2IODA 3R3ZA 3S1AA 3UCEA 3PNVA 4AO6A 4HDKA 4I3FA 3DO8A 1Y8RB 2RBEA 3HP1A 3W2TA 3DFUA 1VBMA 2ZATA 1R5JA 4PBRA 4WSOA 3M6XA 4TLAA 1L5YA 3L4BA 4HN2A 1E6WA 2D13A 2I4IA 4QO7A 2O6LA 4WXRA 2FPGB 3BK7A 1DT5A 4QU8A 4QD3A 5C0OE 1P5HA 1M0SA 2PWBA 5FLKA 1O6FA 5ALVA 2VSOA 3EMDA 2OQ2A 3NVMB 3PLAE 1CR0A 1Y5NA 3HLKA 5IYZB 4AX8A 2W2XA 3AOEA 5FXMA 3WGIA 3H87A 1YCFA 1Z74A 4LBYA 4NBNA 2V59A 2B4AA 3PDIA 3DYVA 3WIEA 5CGZA 2QAIA 1QR2A 1RI5A 1G17A 1X8LA 5E7QA 3RYCA 4V0ME 3UY4A 2V3VA 3RASA 1GCIA 1L5ZA 4AZVA 4ID9A 3B1JA 2X9LA 3GEEA 2YIJA 2X58A 1EFUA 1S02A 1OAOC 2IYWA 4IXTA 2OZEA 1E77A 1E9DA 3BFJA 2OPHA 4ZDJA 1P91A 2PLAA 3COWA 1DJOA 4MQ4A 4Y6SA 3OFVA 3VDMA 1JPJA 4DDKA 3LX5A 3JR7A 2RI1A 1EGAA 2VJPA 1Q84A 4Q1EA 2WAXA 2G5PA 5DHFA 4MPRA 5ARCA 3KUKA 3K3PA 2GO1A 3HVRA 4Q24A 2O8EA 1NHGA 3IT0A 3PC3A 2Z8XA 1LJUA 2QTBA 5HBRA 4B81A 4F1KA 1AHIA 1NC1A 3FUCA 3NVDA 621PA 5F1KA 1I3KA 3UHJA 1YSCA 1ZX1A 2A86A 3I6IA 1D8TA 2BR4A 1A8QA 5AI0A 1YZ3A 3A6JA 3ILHA 1M75A 2GETA 1MORA 2CLFB 2X6QA 1HGXA 1ZRMA 1PF7E 1DLJA 2XB8A 4RCYA 2H29A 1OTHA 3SNKA 3TLEA 3HXMA 1P81A 1J20A 1SXJE 2QRPA 2Z43A 4IX1A 5F2KA 4M22A 1AKUA 4RBNA 2FCAA 3GPCA 3Q9UA 3QUBA 2I0FA 1T2NA 4KYIB 3ZC3A 2Q46A 1W4CA 1KKUA 4CKYA 5B2FA 4US2R 2V1UA 2RGRA 1DCTA 1YBFA 1SOAA 3U44A 4RYLA 1LGYA 1U0JA 1AE1A 1OT5A 2F8TA 4OBWA 1ZIOA 2GRUA 2RHCA 4N6NA 1ZLYA 3SOZA 1GU7A 1UPCA 4PX2A 4PM4A 3HY3A 1SGWA 2IU3A 4RMJA 5A6SB 2IUEA 3DQZA 1NW6A 3EG9A 4HB4A 5KCMA 3ZZ0A 2WILA 3QVOA 1GQQA 1JLLB 1KFBB 4QL3A 3CUVA 4IJQA 1O8BA 4YGYA 4IS3A 3S8EA 3DAFA 4QUGA 4NBLA 5EHXA 2R8ZA 2C7RA 1FTSA 1XQ6A 3AR3A 3EIEA 3EP3B 3MRSA 4UBKA 5KBYA 2VAVA 2ZSKA 4FZ3A 4M8SA 2PH1A 4RIHA 3ZWKA 1GCAA 4EGFA 1K4KA 3PFBA 4RK6A 5K0NA 4B3FX 1B1AA 3IVAA 1Y1PA 1R4AA 5F7JA 3DCJA 2E82A 4QQRA 1C30B 5EC8A 1OA1A 1TMKA 4IOKA 4IZOA 5ERGB 1JEQB 3UQZA 1DBIA 4BEVA 1V4NA 2A9PA 3RU7A 2J3EA 1PRYA 2HTEA 1G8JA 1UBFA 4CKCB 5LA6A 1W30A 3WWOA 7MHTA 2GH1A 2VJBA 2NXEA 4RIFA 4RJTA 2N47A 4ACAA 1PJAA 1V48A 2X3YA 2Z58A 3TZ6A 4R16A 2HJWA 3SDZA 1U04A 2D5BA 2E37A 1HKHA 1RHMA 4HUQA 4LYYA 4MLCA 4PG4A 3N6VA 4HDOB 4YMWA 3BTOA 4KDFA 4CT0A 3TZHA 2Z6AA 4OB7A 1QO7A 4DZZA 4EMUA 4Y2YA 2QIOA 5E9WA 1L9KA 1VJRA 4K9NA 3QP9A 2IOFA 4KQWA 4RGBA 2M6SA 5J59A 4M60A 1Y9EA 2CLSA 1QFXA 1TQDA 3O95A 4HUTA 1P8JA 3PD7A 1JQKA 3GQBA 4Q9NA 1T1GA 4C43A 1RWWA 4RLQA 2R48A 3LYUA 1ODJA 1XCJA 1PTJC 3I76A 3LS2A 3R2JA 4MVYA 1PSZA 3RKUA 3V4LA 3M9LA 2A9VA 1GTZA 3W3AH 5BUQA 1E6EA 2HQSA 4QDOA 3A9SA 1PL8A 1CU1A 5FOVA 4LUCA 1HM5A 3OJCA 4UMDA 1UDBA 5IABA 1UBSB 5CEFA 3RFTA 1SQ6A 1NX9A 2X2FA 3NHBA 5DEOA 4MDYA 3ILSA 3RS8A 2VAXA 4DLBA 4F60A 1JQJC 1XLTA 2V7WA 5AVYA 3ZLJA 2ZVQX 1NVMB 2JS7A 5HKLA 2RHLA 1HE1C 3PBKA 3ISVA 1G5QA 4PYMA 3CX8A 2YXLA 3X1JA 2Z6QA 3DHYA 3DL0A 1ZGJA 3QXSA 2UZ3A 3PUYA 4DC1A 1YNSA 1TQHA 1XTIA 1LSJA 4CDMA 4JBIA 1TMGE 3A6ZA 3IOCA 1N3BA 2ZDQA 2C57A 4Y30A 3VDXA 3E3AA 4W5TA 3OIVA 2R8BA 1W7AA 2JFQA 1B3RA 1G55A 3BFXA 3WGMA 1QH8A 1AN0A 1RWQA 1QCZA 2IV3A 1YULA 1T8SA 4HNRA 4UAGA 3ZE1B 4CV1A 5A3RA 1G3QA 3IIEA 2VEDA 5IKOA 4FYYA 1R0ZA 4ZEXA 2CMFA 1KZ4A 2A84A 1JDUA 5CLGA 2AE1A 2CL6X 4JDUA 4MWGA 3V4OA 4UM7A 4PPQA 4DADA 2A33A 2OLEA 1EWYA 4QVGA 2IZOA 4S1OA 1F7VA 2VP5A 2QZPA 5TF4A 1X7ZB 3T7RA 5DYIA 6AT1A 5KWIA 1QIKA 3M8KA 4PR0A 2VLBA 5DYNA 1JDPA 1TQ6A 1AD2A 3V80A 3STYA 2R62A 4IH1A 2VC2B 1LZKA 2BTEA 1YZHA 4OSPA 1P19A 2EU8A 4PHTA 3ML1A 2O0HA 3C87A 5EFZA 1M9NA 3RUHA 2QRVA 2ZBRA 3AUYA 3C4JA 4OUDA 1R10A 1A1VA 1JKIA 3O83A 3DUFA 4C2TA 3GGDA 4BMOB 4PCVA 5IJ9A 1O95C 1U7TA 3W6ZA 1Z6TA 5H83A 1UADA 4RTKA 2BFNA 3FSJX 1S9DA 1IXZA 5F33A 2YKGA 2WMYA 5ED0A 4NU6A 2PEZA 3EGIA 4WXYB 5J5VA 3EP7B 1BCSB 3N8HA 3ZE0B 4J29A 4HNVA 1RZRA 2JG3A 4E08A 2BJVA 2WNSA 4JQCA 5AW5A 1E2JA 1NOIA 3WQBA 2HUPA 1TW3A 2MHCA 1F51E 3DMRA 1Y4UA 5AM2A 2VYQA 1I5RA 1EFTA 3DEZA 3HDGA 3QKWA 4DW8A 4QGSA 3QX3A 2XVAA 4LHEA 1R16A 2LNDA 1C50A 3ONNA 4JJIA 5E4TA 3UMBA 1PJ3A 4RQBA 4C04A 2OC4A 2VUUA 4U7JA 1QRDA 1N6KA 3DVAB 2I3DA 1A27A 1YL7A 1K9VF 1X86B 1XAIA 2G88A 2YXPX 5H1YA 1B2RA 2X0KA 3PFIA 4OHOA 4EWLA 1LTKA 5C5CA 5LMUB 4JYZA 1I51A 3CVWA 2ZSUA 2X0EA 3ZK7A 4AM8A 4GOMD 1Y1RA 4BVKA 1GR1A 1KIMA 3EN0A 4KKXB 4RA9A 5I7WA 1LLCA 1ZC3A 4ZGWA 4AY6A 1PT5A 2XA1A 2JAXA 1WSDA 4KG7A 2M2IA 4HMPA 4AYXA 4F7DA 5IULC 1ECFA 1QV9A 3DE1X 1NBMD 2R8OA 1U2RA 2C03A 4P82A 5D86A 1PEKE 4O4HB 5AW3A 4ZZ2A 3R7LA 3S27A 2XZLA 3DPUA 1FU4A 3QMVA 5A1JA 1YOVB 3GPLA 3AVXA 3JVEA 4G4GA 3TFOA 3A6GA 5K20A 3PXXA 2KBEA 4OJTA 2RGXA 3CWZA 1LBHA 4U2EA 2ZUFA 2V6GA 2RHBA 2YWCA 2WA2A 4UPDA 1Z6GA 4ZODA 2HQRA 2X0RA 5EESA 4Y2UA 3GGPA 3W2HA 3BFKA 4G97A 2GYWA 3QH4A 4GWLA 2JAQA 2IVFA 3E7DA 3R3WA 1UT8A 4ODIA 4MPJA 1WW3A 3TN7A 3TZKA 5F1YA 3MLAA 1P2TA 4N3CA 2WRZA 1GAWA 1W1IA 3JU3A 2VZ0A 4LY3A 4AJIA 2CJFA 5CDYA 5HPYB 1OIXA 3ZQ4A 5IC4A 4TM8A 2JFYA 4FMDB 4NTZA 1B4DA 3VYWA 2B8EA 4UNNA 3CRQA 3ZGLA 4TWBA 3TR5A 4BQEA 3QI2A 1LFDB 1S2GA 1E1CA 3AM4A 4J0QA 4CKEA 4DLYA 3UN1A 2XECA 4W5RA 3FWNA 1QGED 4C14A 2ZRLA 4K6OA 1Y4DE 2ZUSA 3L0PA 2FJUA 2OCDA 1RKXA 1LV8A 2HCTA 1U9IA 1Z6XA 3MT9A 1I2ZA 3OM9A 2J3JA 4TZTA 2GASA 2WM8A 3DV0B 3BOSA 5IUNC 4N3BA 4D9BA 1HPLA 4E32A 2CCKA 7REQB 2O2XA 1V3QE 1R0CA 3ZWBA 3KQQA 3L7BA 1V43A 1DWPA 2NQTA 1REQB 1JB1A 1LS1A 4D6YA 1E9FA 3CT4A 1VL2A 1QDLB 2V0CA 4UU7A 2ZXEA 1RHUA 5LOVB 3LFUA 1XNJA 4NYJR 2HHLA 3QBTA 2FOLA 4UEKA 4KQFA 3AZOA 4KI7A 4V1CI 1OLXB 2Y9MB 4GC9A 4JP3A 2JLYA 3EEFA 2WAOA 3P9ZA 4V38A 1S5PA 2FSPA 2PGJA 5FUVA 3IUNA 1KGDA 4QULA 1B6SA 1Q7RA 2QGZA 3KAJA 1FFAA 2IYLD 2E4AA 4I36A 3GEPA 3QKUA 5IH7A 1RKQA 2H6EA 4U2FA 4ZQGA 2AOWA 1DFHA 2HMWA 2P5SA 3KJFA 3I62A 1L4LA 1I3OA 4E3WA 3F6PA 1Z47A 3GNLA 3IQZA 3FDZB 4JEHA 4EL5A 1GTMA 2BTQA 3DZHA 1FSGA 5GONF 1RM0A 4FGZA 4JYMA 1A50B 1RYYA 3D3JA 3HRHA 3HNOA 2IELA 1SK8A 1LBEA 3ZVLA 3DWEX 1W581 2HNBA 3SFTA 4E2ZA 5B7GA 1ZXXA 3LXUX 3OX2A 5JZVA 5B58C 3QMPA 4HS4A 5K6AC 4C2UA 1WDKA 4MARA 2B8TA 3VFDA 1YBAA 2MU1A 4OK6A 4PTLA 3I1FA 5BR7A 3PEFA 2QX8A 1JDJA 3FVVA 3DE3X 1FNDA 8MHTA 2YIDA 5DGDA 4PHHA 2VUSA 2OQVA 1B00A 3FE2A 1GNVA 4WECA 3GLRA 3THRA 3THYA 4S05A 3R6DA 3OX4A 1T25A 2JGAA 1NT4A 1W75A 3VYUB 5AP9A 1ND6A 2WF6A 2ZSDA 1R8QA 3IULA 3H5WA 1N2BA 4LOIA 3FVQA 4NCXA 4QO8A 1P1BA 4OOFA 3W2IA 4M0FA 2G9UA 3PJEA 1C4KA 2ZSIA 4HDRA 1M5TA 2A0YA 3H5LA 4XTRA 2QL6A 3QUQA 4KYVA 5JVDF 5CJPA 4AK1A 2JLCA 3JALA 3BT7A 3OQ1A 2IHZA 4FMBB 1L7NA 5I47A 3DZJA 3ND7A 4PZYA 3HABA 4RE5A 1PR4A 1XJ5A 1M7GA 4JLKA 1MKYA 2ETVA 2F4NA 5KYUA 1COWA 1PD0A 2J9RA 1RAEA 2JIZD 2W5UA 2EZUA 3MRVA 5SY4A 4R7TA 2Q0SA 1W0CA 3M6VA 2HJVA 4B82A 4QA9A 5BVGA 1OH5A 3BCRA 5DB4A 3OA0A 1H85A 2Y0BA 4GR5A 4DB2A 3LBHA 3TAUA 1QHXA 4TTAA 1JSZA 3TLKA 2C98A 1JDVA 4OREX 1E1LA 1HXHA 1M0WA 1DI0A 2AFRA 3TIGA 3MWEB 5AW8A 4IJWA 4UBOA 5BN3A 1VKJA 1SKQA 2VJCA 5ADVA 2UVDA 5EE5B 4K46A 1U3WA 5JCJA 1JDBC 1USGA 1R6UA 3QIAA 1XU7A 4F8EA 2VHXA 3IUYA 3QUAA 3HP7A 1ETUA 4K26A 2XWSA 4E1BA 1KYYA 4HB2A 4S1PA 1I33A 1X13A 3LUPA 5JMPA 1QG0A 2RH5A 1SG9A 4YDRA 2Y27A 3L06A 3GY0A 1QYIA 5LR6A 1KPGA 3BMNB 3KRTA 3V3KA 4JGIA 4BB6A 1R5BA 1GPKA 2VDWA 4RD4A 5J2UA 1ZNXA 4MO2A 1H66A 2C2YA 2WB2A 4XVUA 1C9EA 4HNAA 4C0LA 4EG0A 2OBFA 2XD9A 3QPDA 1P4AA 4JL5A 3RJ5A 2ZAIA 3FCEA 1J9GA 1E61A 4PG6A 1SBYA 1W6UA 1WX1A 2F48A 3TQQA 1N5MA 3G2MA 3M34A 2EJWA 5HWSA 2H85A 4TXNA 3WXBA 4M0UA 3PPXA 1YE3A 3C3CA 5FNZA 3VU9A 1DAGA 4P3PA 5KTOA 1YGYA 3TKAA 3E9ZA 3S81A 4LE1A 2ZR0A 5H7XA 1L7OA 4NLLA 2FW7A 2FPMA 3O7WA 3P1JA 4MUBA 3AETB 2D0OB 3IIIA 1G5IA 4ZV4A 4Q9HA 1UFQA 3A37A 2XY4A 2H9AA 3M2TA 2Z2JA 4GOKA 4QBFA 4CCSA 1OBHA 2ZKLA 1HR0B 3MM4A 1PWXA 4HS9A 2QLNA 3KQUA 1YS4A 4N1AA 4K2AA 3UK1A 3N8IA 1E3MA 4PGGA 4ZXPA 3KZKA 3O8OA 2QN8A 2X76A 4R9NA 2XDWA 3KPWA 4WNYA 5EXEA 5KO2A 3C43A 4FDMA 4C4YA 5EUBA 5L3SB 4WN3A 2QRUA 3KEGA 1BXRA 2XQIA 4F3KA 5AI9A 4J0HA 4WTOA 4EDFA 4IIXA 1H0KA 2ZSJA 3NALA 5BT9A 1OT3A 4ETWA 4XWOA 2WKSA 1FVXA 1E2UA 1D09A 5CUQA 2AZTA 2FSHA 2QGFA 3LY5A 3ESYA 2WQ6A 3AP1A 1KAGA 5HF8A 4JQZA 1FDUA 2MYNA 1T34A 1TUBB 1L8LA 2IP4A 2WWWA 2VF5X 4GPBA 4PX3A 3IALA 4TVKA 4QG3A 4YT5A 1C29B 4DV4B 1II8A 1O89A 1QKJA 2FEXA 4UAUA 3AVOA 3DB2A 1MN6A 4DLAA 2CMGA 4CIBA 2XQFA 4OYYA 5DM0A 1GADO 1IBMB 3OZCA 1WV0A 4DJ5X 4O4LB 2VJMA 4ADSG 3DVRX 5BO5A 5I7UA 1APBA 2AOXA 2YMMA 2FRDC 1YE8A 1TJYA 1LSUA 2C20A 2CMHA 2X0JA 1UWCA 5EWJB 4I1UA 2LD4A 4P9NA 1KSHA 3IBYA 1BGWA 1PNTA 4JP8A 3OCWA 4CMBA 1GCOA 2VJQA 1U3CA 4NPHA 2YOGA 4JUDX 5EUMA 721PA 1L4NA 2XTAA 4ID3A 1L3IA 3CJQA 4UDYX 4D4HA 3ZDXB 2C4KA 1W2HA 1FTWA 2GS9A 1XIVA 1C3OB 4MW7A 4NYJQ 2JFVA 1VA4A 4FI3C 3L46A 4YREA 2VRBA 1WB5A 4M8IA 2QLLA 1BS9A 3U3DA 1FYWA 4COKA 4BMYA 2C82A 4G9BA 4MGZR 4HRXA 1T8TA 1LRKA 4RPIA 1XPJA 1Y89A 1P4HA 2E7ZA 3KVNA 1KSFX 3PR2B 1O5OA 1KORA 2FW8A 1TCAA 2F1HA 3DBLA 1QQ5A 1DBPA 1Z7GA 3HDQA 3ND9A 2JL1A 1QAMA 5LYJF 5AKLA 2O7VA 2IY9A 3H2GA 1RYMA 4LDZA 3EIFA 5E1MA 2WK1A 5MDHA 4CMAA 4IJ6A 3ACBA 1P2FA 2JJ2A 3IUBA 4H1VA 1Q7TA 2QRJA 3S8MA 2PZFA 4GPEA 2IPMA 4DA6A 3IERA 3FOWA 1CRZA 5G3ZA 5KNBA 3IPXA 3OPVA 1L6IA 5TGZA 1W44A 2FR1A 4Y2GA 2HREA 4IYRA 4AJEA 4B84A 4RFSA 4DGQA 1EXDA 1DINA 3ZUGA 4BN4A 1C5KA 2C7VA 1P0QA 2I22A 3G02A 3HK2A 3DE7X 4WKGA 3H04A 4GZ6A 1HT1E 3S1LA 1GZSA 3NPAA 1VJCA 2BGJA 3HL4A 2KBFA 4L75A 3D6JA 2FG7C 3EY4A 1W76A 1AQIA 4NZYA 4RA6A 4V02A 1EAMA 5EERA 2LPMA 3CFYA 3FMVA 4CM8A 1VE3A 1UDCA 4MWCA 4K6HA 2JCSA 4TTSA 1F3LA 3PGJA 2XIJA 3WLTA 3DL7A 2HYIC 2B78A 3HY6A 2FP4B 3TQHA 3T1HB 3H1FA 3Q85A 1O8CA 1RLMA 2G0AA 3MSCA 1CY8A 4ZTZB 1X7YB 4YXWD 2HLDA 3R5HA 1K86A 1A7JA 3PNPA 2XB9A 1Q2XA 1P4JA 3UJNA 4PO8A 3BILA 4ZOCA 2PU5A 3BXZA 4NNOA 4B8WA 3KTFA 3GJQA 5P21A 1FUYB 4B40A 1N9ZA 2GM9A 4ENWA 1NPYA 2JVIA 4YP1A 3WDMA 2ZIZA 1DAEA 4YUYA 3ZGOA 1SVSA 1BNCA 1XRRA 2L18A 2OL4A 3R0ZA 2J0EA 1FFHA 2JFBA 2M98A 5F1OA 5HGJA 3A2LA 3COVA 4H7IA 3B6JA 1Q1GA 2BEUB 2P3SA 3P9XA 1Z08A 4NCIA 4HH3C 4S12A 2M1XA 3RRNA 1LFAA 1QMGA 4RTNA 4UTXA 3MTJA 1CHDA 2ZXUA 4EY3A 7YASA 4AJJA 4LGVA 1QOQB 2Z08A 1U0TA 3DP7A 3PHIA 3FWPA 4L2IB 8ATCA 1U9CA 3GJTA 4OHUA 2O50A 1QGZA 1YIDA 1QV6A 3CWQA 4TKLA 3AIOA 5HRUA 5DSXA 3OP1A 3HJFA 3ES9A 5H5JA 1VE1A 3H17A 4WH0A 4QG7A 2OAQ1 2OQIA 5AM3A 1GZVA 4DF3A 1QE3A 2ECQA 3ZV7A 3U1TA 5KVAA 3CPHA 5K0FA 1KJZA 3AR5A 4XASA 1H4SA 2VQFB 5EVJA 3CVVA 4K9PA 3SC3A 1W49A 2PQMA 3WLHA 1SULA 2G9NA 3MB8A 4JC5A 1Y9ZA 3A1NA 1ZK1A 1W4AA 4U6NA 5AI8A 4BVJA 5L4SA 3M82A 3L8HA 4REMA 1DBVO 3AF0A 5AYVA 4D9GA 1EM6A 1YB1A 4LX0A 2F64A 2J6IA 3EXEA 5KQRA 2BRUC 2NZYA 4OF4A 2PGAA 2ZANA 3AEZA 3QE2A 3FTDA 4KODA 4HAYA 4CDNA 1XL1A 2CNBA 4NXNB 1I10A 4EYOA 3ZWCA 4F0JA 1PJ8A 2H59A 2NT3A 3UB4A 1V96A 3DTVD 4D0NA 4CCYB 4IKEA 5JJIA 3D7MA 4C4AA 1AK1A 2AN9A 2DMRA 5IEBA 2QP4A 4LDQA 4YC7A 2GVDC 5JSZA 3F8WA 2DC1A 1UINA 1BX3A 2MSLA 2OOSA 2ZYWX 1BEUB 3KC2A 4MKFA 1C9NA 4QLOA 3WYBA 1SU8A 3THYB 2FPOA 1NJ2A 4I4TF 4QLBA 3E9YA 1VE5A 2YYYA 2G80A 4CFSA 3AJDA 1XA3A 1H2RS 2IF0A 5LB2A 2VHYA 3GJ5A 3FFAA 2PVPA 3IA2A 1M74A 3ZE6A 1FJGB 5JAZA 3K1TA 1JL3A 1RQPA 2DCUA 3A1SA 5F64A 1QB7A 2ATXA 1UPTA 3DE6X 3JD4A 4GI3A 2JA2A 3VYVA 3IEVA 4L8FA 3FNEA 3CGWA 4O25A 1TGVA 4DWOA 3GZTB 2Y1FA 1EIWA 1V6CA 1Z0KA 1DPGA 1LH0A 2HH9A 2W00A 3HUTA 4LVNA 4X6UA 1PR9A 3GLGB 1N92A 5KUTA 3F1KA 4LZWA 4BKOA 1EQ2A 3P7MA 4YQFA 5KOIA 4MRMB 4NPCA 1I1OA 4W8OA 3ETCA 3P9KA 1Z26A 3SU8A 3ZN2A 1O7JA 4M1MA 3ER9A 3OUUA 2IPOA 1P9LA 1NV9A 5AOCA 4XSHA 4INAA 1KDPA 3U2QA 1WMEA 4UJ3A 4PG5A 1F8XA 2VTEA 4WY8A 1ADYA 4NJMA 4OGWA 2R6JA 3L04A 3GLUA 1XB2A 1W1UA 4GQIA 4FWIB 1QS0B 3LPMA 1T6YA 1JEYA 3CF6R 2BEWB 2YXNA 4HFMA 1QUFA 1EXNA 4EIWA 2G67A 5LXTB 4KV7A 2EGGA 1MFPA 5JAMA 3V7UA 4QXRA 2IEGA 3NHAA 5BV0A 6ABPA 4N5DA 4O5AA 4R2WA 1AQUA 1MABA 2VF2A 2JFUA 3W8RA 4DUGD 5HVNA 1IM8A 1Q7BA 2J41A 3CW2A 1NRIA 3IMFA 3F7NA 3N28A 3RABA 1J22A 3EWNA 4KCGA 3ZY4A 3I9MA 3RV3A 3ZK9A 1PVOA 4UNIA 3UB2A 1XQ9A 4P08A 1D3AA 2HMSA 3RYHB 3G9TA 4ARBA 1Z28A 4MLPA 4YAWA 1EXMA 4D8TA 3WG9A 5CH8A 4EAAA 2QR5A 2GAOA 1ENYA 3KJHA 1JAYA 4ZYZA 1ZK0A 3ASUA 4AFNA 4DQUA 1TYZA 5EUQB 2QQEA 3U3XA 3JV7A 3WNDA 4EY5A 4NSNA 5KNCD 4P34A 1E66A 3OQOA 3LVBA 5IKXA 1Z8NA 4J16A 1KEWA 4G86A 3WIOA 2DKOA 2ZVPX 1I2BA 3RF6A 1IEXA 4NDNE 1B0ZA 1XNHA 3GVPA 3UWOA 3CX4A 1BYIA 4EAQA 1JG3A 2QR2A 3NG1A 5JASA 1OYWA 4XLLA 1BVHA 3FCCA 4UATA 4G5RA 5EKTA 2E4XA 5IXSA 1RJWA 3MRTA 4GBMA 4MR8B 5C8YF 3N74A 1N2CA 1T5SA 3B1XA 5EI5A 2PA0A 4ZEWA 3RVOA 2P6MA 4PICA 3UYKA 2GXSA 3JQ7A 5FEMA 4EHHA 3VR0A 2C0CA 3C6KA 2Y92A 4DSTA 5JU6A 4R1MA 4NFHA 1GY8A 4FBLA 4BVGA 2I6FA 7ADHA 5T8KC 3GLIB 2I8AA 2P78A 4E1VA 2PZBA 2DBQA 3MELA 3TAXA 4EBBA 3RIXA 1S8AA 3A10A 4D2IA 1Y5RA 2Q3BA 2ZI3A 4J7XA 2CK3D 5HKOA 1LX6A 2C29D 2BY4A 3INGA 1I9CA 5AJWA 2D5CA 5EWMB 3AVYA 1Q1NA 4TX1A 4URXR 3D3QA 4K0KB 3DMNA 1RPTA 5E1OA 4BATA 3WB9A 3AI2A 3R0XA 5IW8A 4YRIA 1G21B 1PJCA 2J4DA 5HJ2A 4D3FA 1Y3IA 1WXWA 1U8FO 1UOOA 3ZGXA 2CFOA 1JVBA 3ICCA 4MQFA 3E48A 2PIAA 5G40A 4UTZA 1WHTB 3E4DA 2NVWA 1SVLA 4Y67A 1CJMA 5ADUS 3K9CA 2Z5LA 1NQ5A 1BDJA 5A05A 4G5SA 2H1OA 3X2EA 3THSA 1T36A 2GA8A 2GM3A 3RSSA 4RGVA 2ONKA 4ZI3A 2DKFA 3IUJA 2KB0A 1RYZA 4LDAA 3WLAA 1F2UB 2QV0A 3LPDA 4HFNA 4PLFA 4OHVA 3LT0A 1Z5WA 3A0RB 3CW9A 4KVGA 1EX1A 1CG6A 4FILA 5EZYA 4DA9A 2PWZA 2PT6A 2OAEA 2NU9A 2XHZA 3HJNA 1QZXA 4FI3F 4K9OA 4NOMA 3EUFA 3OZVA 3UAZA 3LUKA 5LLTA 3T9AA 3QSYA 2R2AA 2VUTA 5DX8A 5IYZF 1WPXA 3BWEA 2XCRB 4TL6A 1JIUA 1HDIA 3EP9B 1L5RA 2BGTA 3LWDA 3QITA 4RABA 4EKNB 1Y8ZA 1QIHA 4YASA 3KKKA 1O94D 4HR7A 1SNYA 4LC1A 5D01A 1NJ8A 3IP1A 1HG0A 5BRAA 1NMXA 3I1JA 2XBUA 2Y0CA 4W8GA 4ZK2A 5L7TA 3W1WA 3V1YA 1U7OA 5KYVA 5CDTA 3PC2A 3X3HA 3WIUA 3WOVA 1TE2A 4C7OB 2X5XA 5D6NA 4A36A 3OIYA 1KQOA 3OZFA 1DAOA 2I3ZA 1IMJA 3BGDA 1RWVA 4IPTA 1TXGA 4LX8A 4ND7A 3VSBA 2P9ZA 1KC3A 2XGMA 3SE7A 2XVZA 3PXCX 3VQTA 1H22A 2HT6A 3HRKA 4OHFA 2QM0A 4OP3A 2IXGA 2QX7A 4IDBA 3LUFA 1NVDA 2NAFA 4UDOA 3B70A 1VOTA 1XHEA 1KZYC 3HU5A 4LZJA 2CLKB 2EKBA 3G8BA 2IOYA 2BHLA 4R5HA 2ZRNA 3IH5A 4G23A 4KXWA 4MSUA 4OBEA 3TXAA 5JI3E 1U7XA 4I55A 3K71B 4RESA 5B1IA 3RM3A 3NEJA 4HD8A 3OCZA 2FZKA 4U3JA 4EJFA 4LQ4A 4WUVA 2Z8ZA 3LYLA 4D92A 3Q2KA 3LBFA 1KDOA 3LX6A 3VPFA 1VDZA 3V42A 3ICQB 1GUDA 3DOEA 2PMKA 5HBGA 4BUZA 2FQ1A 1UBRS 1XZQA 4MAAA 3ZHBA 4O5OA 4FDLA 4CQJA 4WEQA 4QOEA 4QODA 5TQ0A 3RO7A 1GZHB 1NIPA 3DUWA 1JSXA 3GLKA 4R9UC 4RETA 3E9DA 3FSEA 1T2DA 1XTQA 3FNFA 1AK9A 3K5HA 2NVOA 2EGHA 1N2CE 5CFLA 5K45A 3MTQA 2XNCA 3IEUA 1Y3CE 1OLUB 3BMOB 4KW7A 4P80A 4TWRA 2EWVA 4KR7A 3D6MA 3AB7A 1N6LA 1XNRB 5BN5A 1XVIA 2G07A 4L72A 4RNCA 4CDGA 3C3WA 5M2QA 1XG5A 5J58A 1P45A 5G53C 2QRLA 2YYAA 1BE8A 2ZIXA 1HZZC 3P9NA 3KSAC 5KX5A 4J1QA 5J2TA 2BKXA 5J1SB 2J33A 3B8HA 4Y6RA 4WAUA 3DBIA 3HO6A 3AF4A 3H99A 3FCUB 1A8PA 3Q87B 1U5AA 4XGIA 3PE3A 4ZI7A 5BSWA 5KYGA 2WHXA 3U5ZB 1UCFA 4AS1A 3KV1A 3BB3A 3VUFA 4YMTA 3PWKA 2HXSA 1JFFB 1YRBA 3U4IA 1RQNA 4GICA 7AT1A 3DEIA 1DXQA 1KO8A 2BFEB 2HMTA 1BE0A 3PC7A 1W59A 5FUXA 1AS0A 3U48A 1E1RA 2B1JA 3R0QA