4MIEA

Crystal structure of apo myo-inositol dehydrogenase from lactobacillus casei
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
339
structure length
339
Chain Sequence
b'MVVKVGVIGTGAMGRAHIDRLTNVLTGAEVVAVTDIDHEAAEAAVRDFHLNAKVYPDDTSLLQDPDIDAVFVVSFGGAHEATVLKALDTDKFIFTEKPLATTLEGAKRIVDKELTKSKKVIQVGFMRRYDQGIRALKEKLDTGIIGAPLVVRASHINPNVASNYSNEMAITDTLIHEIDEMHWLLDDEYTSIQITYPRQSAEVRNEGLHDPQLATLTTKKGTVIQVLVHVTAQYGYEVKLEVIGETGELQLPNYGLGPILRSNANQQTAVEMSWINRFIQAYNTEVQEFIDEVAKSEPPVGPSAWDGYIAAITAAAANRSQKDQETVLINVAGTPTFYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of apo myo-inositol dehydrogenase from Lactobacillus casei
rcsb
molecule keywords Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
source organism Lactobacillus casei
molecule tags Oxidoreductase
total genus 113
structure length 339
sequence length 339
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.18: Inositol 2-dehydrogenase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4mieA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4mieA01
1Z7EA 4YWJA 1YDWA 4WOKA 1XYGA 5A03A 1F8GA 4PLCA 4YAGA 3O26A 4K6CA 3K73O 1MV8A 1KEUA 4ZN6A 1VJ1A 3C1TA 2CMDA 3EDMA 4LW8A 4IPTA 3KRTA 2ZQYA 1K0UA 3SVTA 3LC2O 1T2FA 4NPCA 5G0VA 4QECA 2GD1O 5DCUA 4KUEA 5IJZA 3UHAA 4ILKA 2W98A 4HFMA 1U8FO 3RUEA 4D45A 2ZCVA 1IULA 2CY0A 1QYVA 3T7CA 4N54A 3KBOA 3JQ7A 2GNAA 1H93A 1EFKA 5HM8A 4IDDA 3UGKA 1VJ0A 1X7GA 4IS2A 3BMNA 3UKOA 2Q4EA 3F5QA 4II3A 4BQRA 3F5SA 2Y1EA 4JROA 2QQ5A 3T7EA 3CIFA 2NVUA 5L7YA 3RUHA 4XJSA 4BNUA 3OQBA 5GZ6A 1CETA 5ICSA 2CF6A 3BZUA 3I1JA 4BV9A 3GG9A 4R68A 3WYBA 2RCYA 3AM4A 4CUKA 4OKIA 4AJ1A 3DTYA 3RI3A 4B4VA 1OZAA 3U5TA 3V8BA 4YJFA 4K1LA 3ENNA 1PU2A 5F21A 3ICCA 1T25A 4GL4A 5DOZA 4DC0A 4E5NA 5TX7A 4HBGA 4B7UA 4M54A 3I9OA 4MVJP 1K5HA 4CODB 4K9DA 2CD9A 3NT5A 5DCYA 1GU7A 1XWFA 1NWHA 4XGKA 4Y8VA 1A5ZA 3PI7A 3Q11A 1PR3A 4JJIA 4BV8A 2YFHA 1GYRA 4L75A 3WFJA 1MXHA 4IXWA 3UCXA 3WNQA 1NFQA 4M86A 4PVCA 4EITA 3W8EA 2PD6A 3WIDA 2F00A 5CFZA 4FGWA 4EBFA 1JTVA 3JQ6A 4NZ9A 4Z9FA 4NHEA 5TJ9A 4BNLA 1KETA 1NYTA 3RVDA 2J5RA 3GAZA 4NH4A 3F4BA 4RO0A 5IN4A 4F6CA 4MVJG 1P9LA 3V1YA 2ILTA 4E2XA 4XYBA 3TN7A 1E3JA 3G49A 5EN4A 1ZMTA 3IJPA 4EEXA 3C24A 1I36A 2FSSA 2PKQP 1ISMA 3KVOA 3K5PA 3A9WA 1D8AA 2ZB8A 1W4ZA 4BNYA 3RUDA 4MVJD 1BVRA 1M2WA 4J1TA 1A9ZA 3P2OA 5CPBA 4A0SA 1AHIA 5KTKA 4XRGA 4OM8A 4N5MA 3GVPA 4IM7A 2F1KA 5A04A 3DWFA 1NHGA 3OA0A 3ASUA 3TWOA 6ADHA 1UXIA 1Q7GA 2PA3A 3IOYA 4BO3A 1DIHA 4TROA 4QQRA 4E13A 1BSVA 4NBTA 4J6FA 1LEHA 1B3RA 1OI7A 2VNSA 4TKLA 4XRRA 4BHTA 1DPGA 4EZBA 4BO0A 2NWQA 1WW8A 2XAAA 1P74A 4F45A 4ZHSA 4S3MA 3TRIA 1UDCA 4QT0A 4DPKA 3RFXA 1HEUA 1HDXA 2JHGA 1KOLA 1AHHA 3GDFA 4ID9A 3HFSA 3B6ZA 4GX2A 3N7UA 2I65A 1ADFA 1GL3A 4KDEA 5L3ZA 2NVWA 1YDEA 4E6PA 1DC4A 3U0BA 4W7HA 4B4UA 5IAAA 2FZWA 5ER6A 3IL2A 5TQVA 1U5AA 2IXAA 2NVBA 1YL7A 3WG9A 1X0VA 3PJEA 4PZDA 4UAGA 3UAGA 4FW8A 4BL5A 3OJOA 4R41A 1DAOA 3WLFA 4WLUA 4LSMA 3WIEA 4WJZA 5BSEA 1R4NB 1H9BA 3WGGA 1B26A 4IY1A 5HWSA 1NR1A 2YYYA 2NM0A 4IQ0A 1E1MA 3KYCB 3WBFA 3P5SA 1NAIA 3B1KA 5K6AC 1LSSA 1P0CA 1KVTA 4GSKA 4BGEA 4MIEA 4YT2A 1U3VA 5JO9A 3VH1A 1LDNA 5F5NA 3OETA 3DDNA 1HDCA 5G4KA 4O1MA 1P1IA 1SB9A 4W4TA 1NXQA 2DTXA 1MFPA 2D59A 1ZUD1 4FC6A 2W90A 1I2CA 3GMDA 1PS0A 1Y8QB 5FYDA 4CLOB 1VL8A 4OHUA 4E5MA 2VRBA 2HJSA 2SCUA 1KS9A 3C7CB 4YJGA 3LYLA 4WCFB 3H5RA 3VVBA 2X86A 4CR7A 2BFPA 4RQUA 1ORRA 3KM0A 1QXSA 2QG4A 1Z45A 2DFDA 2DM6A 2FN7A 4M8SA 1PZGA 3U09A 1SPXA 2ZK7A 3DTTA 3PIIA 1I24A 1QRRA 5TT1A 3I6IA 5CDYA 5JDIC 3PYLA 3BHIA 4HWKA 3DZBA 3QRWA 4MIYA 4GLOA 1V9LA 5CHEA 1HF3A 1UH5A 2E49A 4RGBA 4DA9A 3X2FA 3WGIA 1DFHA 1HTBA 2DU8A 2DAPA 4MOWA 4FJ1A 1F0YA 3D3WB 5H82A 4DQUA 1V3VA 1HDRA 5TT0A 4O6VA 4EDFA 1EE2A 4IINA 4MDHA 3GRKA 4OOFA 1DHRA 2GUGA 2V6MA 1IHYA 5JS6A 2OHXA 4YYZA 2PGJA 4DTIA 3JSAA 1C0LA 3ZWBA 4CLDA 2C5EA 1WXDA 1VSVA 3HN2A 5L95A 1UZLA 1PIWA 1CWUA 2GN8A 4BNXA 3DZGA 3PJFA 2QZZA 1WDKA 2OMEA 1MGOA 4TWRA 1VM6A 4QFDA 3DOCA 3EVTA 5J23A 3VDRA 5IN5A 3GY0A 4YJDA 2D1YA 1NAHA 2BKAA 5K6AA 2C07A 1DXYA 1KVSA 3VPHA 4R9RA 2D8AA 3IKVA 3WXBA 4QFCA 2EP7A 3WYCA 3E5MA 5KJ6A 3AUTA 1QP8A 2BGLA 3KOUA 5JAMA 1AGNA 4WEOA 3AY6A 5U9CA 1FDSA 3DBLB 4LGVA 4KUGA 2G82A 4AVYA 4CM3A 8ADHA 3OICA 4O63O 1KVQA 4L74A 2YJZA 3LLVA 2O7QA 2Q45A 4IDCA 1YOVB 4KQWA 1HYEA 4X54A 5EL0A 4BO9A 4IDBA 1FXSA 3AU9A 1NVMB 1LQUA 2DPHA 4XYLA 1GD1O 4D43A 4WLOA 3R1IA 1DC5A 2VCYA 1YS4A 5IF3A 1GTMA 3JQGA 3ZDFA 4KWHA 3WMWA 1TXGA 5TSDA 3F47A 4Y6SA 5JDIA 3EHEA 3KTDA 1U5CA 3WX0A 2FOIA 1YBAA 3E5RA 4R5HA 2JAHA 4PG7A 2Q1TA 2J3IA 4LCEA 4KOAA 5A02A 1M66A 1S6YA 5C7IO 3E82A 3D0OA 4PLGA 3TFOA 1LDGA 2O2SA 1SCUA 4OL9A 3K2BA 1R6DA 3M2PA 1I0ZA 2AQ8A 3ETDA 1OBFO 5DDIP 3MWDB 5TIIA 1E7WA 5FI3A 1C0KA 1ULSA 4UVDA 3GEGA 5BNFA 3R3SA 2VZ0A 2P5YA 3DFUA 3OIFA 3LT4A 4CMGA 1E6UA 1AXGA 4UUMA 2GN4A 4GGOA 2C7GA 4DPLA 1L1FA 4CMBA 4DMLA 1ZK0A 2JCVA 1J0XO 1I3KA 2NLOA 4O59O 3LT1A 1P33A 2QIOA 4AFNA 4L8VA 3PRJA 2NADA 3H9QA 4JCOA 2ZYAA 3NTOA 4O5OA 4TRMA 4EYEA 4B4OA 1KVRA 3K2EA 4S1VA 3GZ4A 3RC7A 2Z5LA 1R4MA 4NMHA 3DO5A 4U0JA 4TVOA 4BKQA 5C5IA 4ZD6A 2Q99A 1U3UA 3BTOA 3LT2A 2EKQA 3VTFA 1H94A 2BFAA 3QIVA 4OJNA 4PIVA 4ND1A 4YJHB 3ZWYA 7ADHA 2WYWA 5T5QA 1A71A 3EY4A 1V8BA 4YDRA 3PHGA 2FWMX 4JJFA 1DIAA 3KLMX 2GZ1A 3PYXA 4WGGA 1N5DA 1PSDA 1X13A 3DB2A 4LSWA 2GRAA 3QHAA 2BLLA 4Z0TA 2LDBA 1ZSYA 5EIOA 5LCXA 3RUCA 3DONA 5DBIA 5I8ZA 1A27A 3BMOB 5EJ2A 2RHRA 2DT5A 1TT5A 4MIOA 4I1IA 3TZCA 3TL2A 2Q3EA 3JTMA 3HNPA 1YQDA 2PNFA 3RU9A 4BO1A 3L0DA 4KZPA 5TC4A 2Y1GA 4OKNA 1GQYA 2XPCA 4IGFA 4O0LA 4OGWA 2BFMA 3IUSA 4J4HA 4MP3A 4PFJA 5TJHA 2I6TA 3W6UA 4XDZA 2DC1A 4I5FA 4UEJA 4EUEA 3FHLA 3GZNB 4H15A 4NU5A 4AJIA 2X0JA 1B7GO 2B0JA 4FOSA 4U7WA 5TS3A 4GX5A 5A05A 4BGUA 5A9RA 4ZQHA 3W8FA 3OJLA 3GLQA 5CAEA 2WM3A 4DBVO 4WLNA 4D7AA 1BGVA 5F1KA 4ZVVA 4WUVA 1GZ6A 1N9GA 4TMFA 1MP0A 1SZJG 2AQHA 2PV7A 5F1PA 4AL4A 4DIOA 4RZHA 3PFFA 1X15A 3ZNNA 1YJ8A 4CV0A 5CG1A 3WGQA 1O9BA 2X9GA 4Y67A 3GNTA 3AI2A 3NAQA 2J3JA 4KUHA 4P4NA 3MOGA 5H81A 1Z82A 4DQXA 1NHWA 2NTNA 1GUZA 1Q7CA 4YQYA 2ZQZA 1QV7A 4URFA 3S8MA 5G0UA 3A28A 1QG6A 9LDBA 4NBUA 3IKTA 1C0PA 1DRUA 1JA9A 3B1FA 3AY3A 3G79A 3SX2A 5JCXA 3AUSA 2C2XA 4BMSA 2Y0DA 3IIEA 2Q2VA 4RDIA 1DJQA 3DOOA 3KXDA 2EIHA 2WD7B 3I6QA 3JQ8B 1QYCA 2VHVA 1U4OA 5DOVA 1XR3A 3WR5A 2HLPA 5T6BA 3NT4A 3IUPA 1ZO8A 4IDGA 1KERA 1YJQA 3VC7A 3RC9A 2G17A 2P4HX 2IODA 3INRA 3I9LA 3R3JA 2YV3A 1PL8A 2W2KB 2CZCA 4IJUA 1R66A 4NDNE 4E5PA 4YAIA 5ICMA 4JJGA 4PZCA 4Y9DA 2E37A 3T4EA 2BGMA 2WTBA 4MKZA 2I9PA 3AU8A 1KIFA 3CH6A 4LMPA 2D2IA 3WS7A 1N8KA 3JD1A 3L9XA 2HK8A 3PGXA 1H2HA 2EHDA 1R12A 1DB3A 3JD2A 3DMYA 1N7GA 4GQAA 5F1OA 4AJJA 2HUNA 4GX1A 3GUCA 1D3AA 1DBVO 3PZRA 2Y93A 3N74A 4ROSA 5A4DA 1D1TA 1B14A 4MP8A 2TMDA 4UULA 4CMCA 4DLAA 5JAIA 1NNUA 4DIFA 1ONPA 3BMQA 1E3EA 4LVCA 1E1LA 4JXKA 4OOEA 4Q9NA 4FJ2A 1K3TA 4OSOA 1E0DA 3LC1O 2HK7A 3WGYA 5T67A 1TB4A 3AOEC 2BH9A 4EUHA 3UCFA 1I3LA 5AYVA 5EPOA 3M2TA 1ZK1A 3L77A 3N58A 3GDGA 3FSRA 4JGBA 4ALKA 4ND4A 1EDZA 5DT9A 3FCOA 3NDIA 4CMHA 2PZJA 2VT2A 4FFLA 3L6DA 4WEQA 3ZNOA 3ZU4A 2EW2A 4IGEA 3V2HA 1BHSA 5ENVA 5ILGA 3PLNA 1HLPA 1LNQA 1MA0A 2IEDA 3HFGA 3GVXA 1R0KA 1Y5MA 2CVQA 4JP3A 4PZEA 4R3NA 4DREA 3NGLA 4U6QA 1LSUA 1PJTA 2X23A 3BMCA 2UUOA 1XQ6A 2NQTA 1F14A 2G5CA 3NGXA 1PWXA 4U0KA 3F4LA 3TSCA 1FDVA 1ZKMA 3PXXA 1RM4A 1HSOA 2NU8A 1H6CA 5JMPA 2AEMA 1PZHA 1E77A 2HMWA 4NI5A 2HU2A 2UVDA 4JP2A 1IHXA 3DBRB 4IIVA 1A7KA 4PLZA 1E1KA 3RUFA 3A14A 4FB5A 2GCGA 5HRUA 4NJMB 4IJWA 3QWBA 2XOXA 5U4QA 2JFGA 3CTMA 2WDZA 3RBVA 4IUYA 3PWKA 1ONNA 3FWZA 2P2SA 4BNKA 4CM1A 9LDTA 1A4UA 1EUCA 4RDHA 1V35A 4PN3A 4DC1A 2VOJA 4I08A 3AOEA 1PS9A 3Q2IA 2I3AA 3AFNA 5L45A 1YE3A 1I3NA 3H8VA 4NNJA 4RPLA 5KVCA 3OEWA 5JC1A 1ADBA 1SAYA 5L7WA 1ISIA 3E18A 3L4BC 3TFQA 4YEDA 2IZ1A 4GH5A 4J3FA 1H0KA 1C0IA 4XR4A 1PTJA 3JQAB 2VUUA 3I83A 3D4OA 5T8KC 2NTVA 4B3JA 3O38A 1ENYA 2AW5A 4WKGA 4W6ZA 1GZ4A 2ZIZA 4XYMA 2JJYA 2DPGA 1YO6A 3ZNPA 4PVDA 1Y6JA 2XXBA 2CDBA 1DFIA 3I5MA 4IZHA 4FQ8A 5FFFA 2FR1A 1B2LA 5F5LA 2JAPA 1J5PA 5I7VA 2WMDA 1DOHA 4E5YA 5KOIA 3NJ8A 3KUXA 3JV7A 1ISFA 3I9MA 5THQA 2TMGA 3RJ5A 3WTCA 4TZTA 4AJHA 1NASA 4B8ZA 1ZJYA 5COQA 4D44A 4IDEA 5H83A 1TT7A 2OOSA 3FPLA 4PLFA 1BW9B 1PJSA 3BTSA 1PJ3A 1LU9A 1T1SA 1YQGA 1JAYA 1ZW1A 2NUAA 4E12A 3VHRA 5A9SB 2Y99A 2GZ2A 3E9QA 2UYYA 4FJ0A 1VJTA 4OH1A 1ZFNA 2YHIB 2VWPA 2Y1OA 4ZICA 3PP8A 4CLRB 3QW2A 4YCAA 1OOEA 3ZWCA 3NKLA 1U1IA 1DLJA 3HUDA 2O50A 1OC4A 1ML3A 4DGSA 4GI2A 3WYEA 1ZJZA 2VHYA 4WASA 4B8WA 4L0QA 1SO8A 4IDFA 2AE1A 1LRLA 4IS3A 1O95A 4YT5A 4FFMA 3ZV5A 1DEHA 3I9KA 1GZ3A 3JYLA 4FS3A 2BHLA 3LF1A 1PX0A 4UUPA 4OXKA 4JQCA 4GSLA 1YB5A 3ZZNA 4GKVA 4D0SA 4J4TA 3IJRA 5T8KA 5CDSA 5BSGA 4XR9A 4JK3A 2HRZA 3VZQA 3GHHA 1JLLA 2AHRA 1FMCA 1BXKA 1E3LA 3MJEA 3PEFA 3TZ6A 1LDMA 5FI5A 4PLWA 4A03A 3AI1A 3PHLA 4ZQEA 5ENDA 5KVSA 1HDYA 2J6IA 5T64A 2EF1A 1H9AA 2Y1DA 2FZEA 1WWKA 4WCFC 2AEFA 3DZIA 2O4UX 5EMHA 5CG2A 1I3MA 3BTVA 4BO2A 2QHXA 1B8VA 2H63A 4E33A 2EJVA 4KMSA 1B16A 1K2WA 3EC7A 2EERA 4ZQBA 4OSPA 3QE3A 3MEQA 1NR7A 4UUOA 1PQUA 3RSHA 4R69A 1UZNA 1GFSA 4J16A 2RAFA 1PQWA 1QYDA 4P4LA 3RCBA 3GR6A 1I8TA 4AJPA 4CMJA 3D3EA 1ZXLA 2VYVA 1PQPA 4R16A 3L6EA 4BO6A 4HKTA 1U8XX 2V6GA 1Z74A 1V6AA 4MJLA 1KEWA 1WDLA 2DTEA 2JFFA 3KO8A 5A06A 4NR0A 3DZJA 4LCJA 4GKBA 3SJ7A 3SLGA 3TJRA 1EVZA 1LA2A 1WMBA 1XU9A 4DVJA 3HSKA 5EQFA 2RHCA 2JCXA 5ITVA 1S7CA 4AJ2A 5HTOA 2NNLD 3VKVA 2J3KA 5JBIA 4CM8A 4TKMA 3MTGA 5A9TA 3QV1A 3KYCA 2VUSA 3WTBA 5JFOA 2VRCA 3NT2A 3DL2A 1PGOA 3QVOA 1LDYA 1KC3A 1XSEA 1Y9EA 1E3IA 5BQFA 5KCZA 5AQ1A 4CM9A 1SBYA 1QYWA 3GPIA 5JCJA 4BNFA 1CJCA 1R0SA 2D0IA 4EJ0A 1RYEA 4R1UA 2YQ5A 4LK3A 3ICPA 1ISJA 2GYYA 1R0LA 3C7DB 2PLAA 4BMVA 5B4VA 1IYZA 4B79A 1T2AA 5IFLA 1MG0A 3R6DA 1LSOA 4FFRA 1E7YA 4CLOA 1LSJA 4MVJM 1NPDA 2Q2WA 5ADHA 1E92A 2O3SA 1GPDG 1XQ1A 1EQUA 4WCFA 1C1XB 1MB4A 3HHPA 1GQ2A 2Q50A 2RBEA 1RJWA 1NPTO 1JVSA 3UUWA 4RQTA 3PWSA 4JX8A 4MVJH 1O0SA 4U5QA 4L4RA 2ZB7A 3T4XA 3WQQA 4QSMA 3F3SA 1ZEMA 1HE5A 3H4VA 4Y6RA 1JWAB 2VT3A 1YQXA 4B3IA 3SEFA 3NYWA 5CP8A 3WICA 1L7EA 5DZSA 1FDWA 1HKUA 1BDMA 1V3TA 1BXZA 5GZ1A 3PJGA 1XKQA 4CQMB 3MZ0A 4XB2A 3DHYA 2P5UA 3U4HA 5C7LO 4TRNA 1ZH8A 1NFRA 1WPQA 5IXSA 3G3EA 2EEZA 3RUIA 2POQX 1JVBA 3QWFA 1QSGA 4GWGA 1HDZA 2VUTA 2BD0A 3LF2A 3OSUA 4Y98A 4BGVA 3Q1LA 3FWNA 3CPSA 3D64A 1R37A 3MJCA 5JSFA 4TRJA 4GGPA 3UICA 1PGNA 3RQSA 3ASVA 4IZIA 2WYVA 4IQ8A 2FSVA 3KLPX 3LDHA 3I3OA 4ND5A 2Y0EA 5BSFA 2PZMA 1BWSA 4RVDA 4ND3A 1HE3A 3OFSA 4Q3EA 3ON5A 2FHSA 4IDAA 3F6YA 4CV1A 2O3QA 5C37A 2PGDA 4R1NA 1I30A 4MPDA 3GFGA 4FC7A 1LLQA 1YRLA 3DBLA 4GBJA 3WSVA 3HDQA 4Z3DA 4BB5A 4FD3A 4YXFA 3FNHA 4PGFA 4UVEA 2FMUA 3HWRA 2B35A 4RF2A 1HXHA 1YOVA 3DBHB 4BOYA 1UAYA 3RC2A 1DIBA 3LC7O 4RORA 2X4GA 4BUCA 2BELA 3FTNA 5TF4A 1NVGA 5JPIA 5L53A 3CEAA 2NTJA 2V7PA 1N1EA 4G5HA 3PJDA 2VHZA 2D5CA 2JL1A 2H5LA 2W8ZA 5KVQA 3U9LA 2XF8A 2YV1A 5DBFA 1CIVA 4LRSB 1E7SA 4Q39A 5I9NA 4M87A 2X5JO 3WOHA 3GAFA 4INAA 1K89A 1LLUA 2P9GA 4CUJA 1XGKA 1N1GA 2FRDA 2VWHA 1E5LA 4XQEA 1LX6A 2D3TA 4YRDA 1WZEA 1WVGA 2YV2A 2C0CA 2PD4A 2QYSA 1VC2A 2C7VA 4ZU3A 4E2WA 4NBVA 3B20A 1NQTA 3GC6A 4TRRA 2YZ7A 3INTA 4J43A 3ITKA 4NG5A 4NQZA 3K8ZA 3G17A 1BXGB 2DBVO 4YJGB 3H5NA 4D0RA 3OBBA 4J1QA 4ZRNA 1Z6ZA 2RH4A 3FRJA 4Q3DA 4A10A 1GUYA 1UDBA 1JKIA 3V5NA 4H16A 5THKA 2Y0CA 1OFGA 2B4RO 1PS8A 2AE2A 2VHXA 4IQGA 3WGTA 4RL6A 1BVUA 1PJBA 5G0WA 1JW9B 1EVIA 4IJVA 2ZTVA 1ADCA 3NJ4A 4OAQA 4PLPA 2OBYA 1XCBA 1YVEI 5CEEA 4GMFA 2Q49A 2R2GA 3LQFA 1JKJA 1GAEO 1HDGO 4OXNA 3KEQA 3FNEA 1LDEA 5AXBA 3KYDA 2B4QA 2QRKA 4YJHA 4F46A 2X8LA 2R6JA 3TL3A 2JD1A 1H5QA 3H7AA 1M6HA 3EMKA 1FK8A 3FBGA 2QRLA 3ZV4A 1GCUA 3GN1A 1F17A 2OP1A 3B1JA 5JYEA 1EUDA 4LISA 5BSHA 1Q7BA 1PEDA 2PKQO 2O3TA 1C1DB 2O48X 3CMCO 2FY8A 1VKOA 3LK7A 2Q22A 4ZQGA 1SEPA 4J9VA 2IZ0A 5JDCC 3WQSB 3IS3A 1P45A 3EGOA 3IDSA 2WE7A 5I8WA 2Y1FA 2X5KO 2EJWA 5AOVA 2JHFA 4MP6A 1WLYA 3QVSA 2X9VA 3OJ0A 5L9AA 4RPKA 3NDJA 3GMSA 3VZPA 5JLAA 3ST7A 1ZIDA 3RC1A 4L4XA 3RBZA 1TA4A 1GADO 2AG8A 1VKNA 2E82A 4XD2A 1ZZEA 2OORA 3DAFA 2HRBA 1ZEJA 2H1SA 2YUTA 4L73A 4YAKA 3FNFA 2NSDA 5F3RA 1J49A 3QJ5A 1P0FA 1IY8A 3WLEA 3RIHA 1EK5A 1E3WB 1DFGA 3GEMA 3INGA 3ADPA 4DPMA 4B7CA 2O3RA 4GVLA 1VSUA 4E21A 1ARZA 4RZIA 2QZ9A 4G81A 4YAEA 4DIBA 1K6JA 1ZSVA 5K0ZA 3D4PA 1HYHA 2Z1MA 3ETEA 2I3GA 3CSDA 3ROQA 4CR6A 2HMTA 3CKYA 1UP4A 2OFPA 3PQEA 4UUNA 3WSWA 1HE4A 4PLVA 2DUUA 2CUKA 5CDUA 3KZVA 2X0RA 1E6WA 3QWHA 2HMUA 3JCZA 3RU7A 1DIRA 4BO4A 1QLHA 4BNHA 5IG2A 3QWAA 2OO5A 3EW7A 4QXMA 5U1PA 1QR6A 4OQYA 2BMAA 3F9IA 2D4AA 3EVNA 1O8CA 1I01A 1PGJA 1B8PA 3I9JA 5JDCA 1XDWA 2CFCA 1W6UA 3ZU5A 1BDBA 3WGOA 3NEPX 2WD7A 4BO7A 2VYVD 3JQ8A 3H5AA 2GSDA 3KYBA 3CXRA 1NPYA 4HUJA 5BT9A 3GHYA 4XCVA 5JMWA 2O3UA 5FWNA 1B8UA 1MLDA 1E7MA 2UDPA 3Q6IA 1P1HA 1DO8A 2YDYA 1PJCA 4GLLA 2ZTMA 1UR5A 3I4CA 3ENKA 5CDTA 2Y05A 2OGUA 4PLTA 1LQTA 2A94A 2G1UA 2BGKA 3S2IA 4HADA 3E9NA 3MJTA 3L9WA 4IJKA 5B4TA 1BRMA 1HETA 2EKLA 3IMFA 3K92A 2VRCD 4R4JA 1XA0A 3BXXA 2I66A 4UVGA 5A5FA 3NV9A 2FPGA 4W82A 2I5PO 3EUWA 4R5MA 4CM9D 4Q3NA 1PGPA 2ZB3A 5JCJD 2PY6A 1VRWA 3VH2A 3WB9A 1NFFA 3V1TC 5BNTA 2E48A 1LLCA 4CMIA 1E5QA 1JAXA 3GG2A 2VTEA 1VPDA 1GCOA 2CVZA 1EZ4A 1NQOA 4ZRMA 3KSZO 1A7AA 4XKJA 1D1SA 2X0NA 4NJOA 5KJCA 4D3DA 4NU6A 4Z9YA 3ZWXA 3O8QB 1M75A 4XDYA 3DZHA 1DJNA 3W4JA 2A9FA 4BB6A 2EP5A 1IL0A 2JFHA 1D4FA 4KTVE 3WNVA 4CJXA 4DYDA 3K31A 5DULA 3OHSX 1G1AA 4Z0PA 1GDHA 3H2SA 4IMPA 4QO8A 1CF2O 3WJ7A 4BKRA 5GMOA 4HV4A 5KJFA 5B4UA 1SEVA 4ALNA 3PHIA 3OECA 4J1NA 2I99A 4DBZA 3DBVO 3PYMA 5LDGA 2HCTA 1Y8RB 3COSA 3VPXA 4D79A 1NQAO 4J0FA 3HB5X 4BNWA 3JQBC 5AXAA 1Z75A 1HZZA 1R16A 4IBOA 3U3XA 3PQFA 1GEGA 1NM5A 4D3FA 1Y9AA 1EEHA 3BHJA 3RAJA 1IB6A 3QVWA 1KY4A 1IPFA 1MXFA 1X1EA 4QX6A 3P2YA 4II2A 4A27A 3DMTC 3NRCA 3DBRA 3IAHA 1DRVA 1ULUA 1O5IA 4FIZA 4LVUA 2A92A 3CZRA 3L6OO 1PJ2A 2CDCA 2CF5A 3WQRA 4CMEC 2Q1SA 4J4BA 1B3BA 3SC4A 4NJMA 3RASA 4G65A 3OJEA 1EVJA 2FPPA 1LDBA 3NTQA 1CDOA 3GVCA 3ADOA 5GZ3A 4J1SA 1GV0A 3JD4A 4BO5A 6LDHA 2B5VA 2VWGA 3IC5A 5ER9A 3RUAA 4L9RA 5LDHA 3GRPA 3TDKA 1C3VA 3HB4X 4PG6A 5TLSA 2X5OA 4R1SA 4Z9XA 1A4IA 1T24A 4WPGA 4L76A 4B7XA 3FR7A 4D41A 2EWMA 2P4QA 2PWZA 5CEFA 3GF4A 4E31A 3IP1A 4J7XA 2WYUA 2PR2A 4FR5A 1UAGA 3F1KA 4OMUA 1UXHA 1YB4A 4JBGA 2I76A 4CUZA 2AG5A 4CM6A 3JQAA 1NVTA 2CSUA 1BTOA 4J90A 3AW9A 3HZZA 4MO2A 3HE3A 4QTZA 3RJ9A 3GUYA 1RPNA 4EJ6A 4JLWA 1YBVA 2WSBA 1U2GA 1T2EA 3TZQA 4YACA 3PHJA 2RH8A 4MVJE 2DKNA 1I5RA 3BMQB 4N5LA 1UDAA 3DHEA 5AXDA 1XELA 2FP4A 4BNNA 5JYFA 3JQBA 1JDJA 2E4AA 3H9JA 3ONDA 2P9CA 2WE8A 2C54A 3ZU2A 3UN1A 5M6DA 2YDXA 4YVFA 4RPJA 3JQ9C 5JNLA 1G0NA 1CQIA 3FF4A 2ZTUA 1NQ5A 2X58A 1JWBB 3G1UA 2ZJ0A 3DEYX 3DMTA 4FFOA 4FSHA 4E5KA 1N7HA 1PGQA 4J91A 1PR9A 4CL8A 1O6ZA 4HNGA 2P91A 1EUZA 1U9JA 3H9EO 2R00C 3OM9A 3W4KA 2NU7A 4PCVA 2YY7A 4I5DA 3FPCA 1X14A 4GX0A 4A7PA 1WZIA 4BNVA 3KB6A 1Y7TA 2CVOA 3X2EA 3GVHA 4U8GA 4QUKA 3TZHA 3OJFA 2YHIA 4UVIA 1K6IA 1EK6A 4CLRA 1GY8A 3VPSA 2HMSA 1JKFA 1EFLA 4CQLB 3NDRA 4BKPA 1QORA 1UJMA 3Q9UA 5L7TA 4PLYA 5TRTA 3HJAA 4CM7A 3ZI0A 4DYVA 3RFVA 4ND2A 1PZEA 1VL0A 1X7HA 3QY9A 3WJAA 3A1NA 1Y1PA 1HWYA 4CM4B 3QP9A 1KEVA 4NBRA 1PJQA 5L4SA 1TEHA 5FEUA 3VZRA 2HO5A 5KKCA 1IE3A 1KBZA 4AJKA 2AQIA 3TF5A 1WP4A 4BVAA 1ADGA 1R15A 4RF3A 8LDHA 2LDXA 2OP0A 4LN1A 2VZ9A 1I33A 2Z95A 3ANMA 4FPXA 4J49A 3ZWMA 2QYTA 5G2OA 4MVJI 1T26A 3EAGA 1QV6A 3GH3A 3JQCA 4WCDA 2PKRA 3K30A 3C1OA 4GAEA 3DAGA 3C3XA 5J9GA 3VZSA 3DAPA 3ZCXA 5G0TA 5TGDA 4AJOA 4DLLA 4YR9A 3R0IA 1Z7BA 3JQ9A 3RKUA 3KETA 1GYPA 4HFRA 4J2HA 3ZWPA 4N5NA 5B12A 5I7FA 4CV3A 4BNJA 2DBQA 2JKVA 2NV6A 5DBGA 1AXEA 2X9NA 1Z73A 3SBOA 3M1LA 2JD0A 2VYNA 5DNAA 2DVMA 3D5QA 1TI7A 2VNAA 1P3DA 2GASA 4HP8A 2BI7A 1PJ4A 2R00A 3L4BA 4EI2A 2QRJA 2FPIA 3CUKA 4KTTE 1U3TA 3PDUA 3E8XA 4TQGA 4AG3A 1C14A 3GVIA 3STHA 3ZU3A 1ZSNA 3AI3A 1KEPA 4YA6A 4N18A 3JYPA 3JQ7B 4RPGA 1EVYA 4EGFA 3AM5A 5IDQA 4RVHA 2IE0A 3P19A 4BO8A 4PRKA 3BMNB 1SB8A 1ZK2A 2C59A 3PK0A 4TZKA 3PVZA 5DCWA 2C82A 2Y68A 2ZYDA 1GUFA 4K28A 2J3HA 5DN9A 2NU9A 3BAZA 3DC2A 2B5WA 1DLIA 1W8DA 3V1UA 1AUPA 3TOXA 4YRBA 1PL6A 1E3SA 2NVUB 3UOGA 3GEDA 3TPCA 2WD8A 5JY1A 4M89A 4ALIA 1YL6A 4B4WA 1ZK3A 4DXHA 2ZB4A 4AJLA 1SNYA 1H6BA 4FDAA 4YQZA 2J5KA 1DSSG 4GVXA 4HNHA 1PZFA 3CMMA 1YXMA 3SC6A 1YGYA 1XEAA 2P9EA 3S1LA 1W73A 4YJFB 2HQ1A 3D4NA 3S2EA 1FDTA 3ITDA 1QLJA 5JE8A 2ZATA 3F46A 4NBWA 4F3YA 1YONA 5I7EA 2H9IA 1C1XA 3B70A 3K6JA 5DP1A 5L40A 3TZKA 4XA8A 4KDFA 3ZWOA 2VOEA 1N92A 3JYQA 4OYRA 3S2GA 1BMDA 3JD3A 3HQ4O 3FBTA 2HMVA 3JYNA 1R4NA 3NX4A 4RF5A 3PLRA 5HS4A 4IIUA 4P22A 4RJTA 7MDHA 1H6AA 1T2CA 3IP3A 4E32A 1U3WA 1SMKA 1ONOA 3ZHBA 4CQMA 1JQBA 1GEEA 2B69A 2XXJA 3E03A 2PK3A 1U4SA 1YB1A 4M49A 3PFWO 2FR8A 2AMFA 2B36A 1YL5A 4AJNA 4XEHA 4P8RA 3KV3O 5LC1A 4AJ4A 2WJPA 3I4FA 2C29D 4NFSA 4CLXA 1EBFA 1NTOA 2UUPA 1Y8QA 2G0TA 3DFZA 2O7SA 1B15A 3H9UA 4BS9A 1GQQA 1ZK4A 2GF2A 4AJEA 1W0CA 4W9NC 3KSUA 4A73A 4UEKA 2CDAA 1SC6A 2Q46A 4UEOA 4TVBA 4E2ZA 4K6FA 1LTHR 2B4TO 3GN2A 1J6UA 4LMRA 4BKUA 1DRWA 3AFMA 4DLBA 2JD2A 1UP6A 2OUIA 3JQFC 3UH1A 4D3SA 3A4VA 5JYDA 2X7HA 4I5GA 3VPFA 3U4CA 4ONEA 3D3WA 4BMNA 4XGIA 5JYAA 3ZV6A 3OIGA 4LRTB 2Y1CA 3JQEA 3ORFA 3DBHA 3H3FA 3O03A 3PWZA 4D46A 4WNCA 3AK4A 3QWIA 5CEJA 1LXCA 2FR0A 2DQ4A 2QX7A 3MCVA 1U2DA 3I9NA 3ETGA 3LZ6A 4RLHA 1LI4A 4A26A 2Q2QA 4CM8B 1YKFA 2PZKA 4CL3A 1HZJA 3ROPA 1X7DA 4H3VA 4RPHA 4JN6B 2Q4BA 4R54A 4FN4A 3MJ4A 4XYGA 4W99A 2X6TA 4CMKA 1I2ZA 1P44A 1EMDA 5I9LA 4OQZA 1EBUA 1LRKA 5JW6A 1P77A 4NFHA 3H3JA 1CRWG 4XGNA 3S2FA 3LT0A 3FD8A 5HS6A 3L07A 3MOIA 5L4NA 2C2YA 4H7PA 3HDYA 1CEQA 4BNMA 3QLJA 4EW6A 4QEDA 4CLHA 3ZHXA 3ONEA 4YB8A 1EQ2A 1T4BA 1BXGA 4J0EA 3WWZA 3C1AA 5T73A 3GQVA 4C4OA 2W2LA 5B1YA 5I9MA 3ABIA 1WMAA 2Q1UA 2HKIA 1HYGA 1B0AA 4NIMA 1UUFA 1XIVA 3OIDA 1LJ8A 4W9NA 2Z1NA 2OBNA 2O4CA 4R51A 3RWBA 3DHNA 2QW8A 3BHMA 3JQAD 2GZ3A 3UW3A 4N7RA 4MVJF 4KWIA 3ZH2A 1DC3A 3V2GA 4FFNA 2Y67A 2EG9A 2VWQA 1LLDA 3W4IA 2I67A 3OQ6A 3FI9A 3ZHZA 2IXBA 4YPOA 3JQFA 2O23A 2VHWA 1N2SA 2D5AA 1BG6A 1F8FA 3LLSA 1LC3A 3OQ1A 3PHHA 3Q3CA 2AEJA 5G4KB 1QKIA 1DC6A 1NP3A 3LSYA 5KWEA 3H65A 3FNGA 2HJRA 1P31A 4YAJA 1HSZA 3GOHA 2GN9A 1GR0A 1V3UA 4HFNA 2GR9A 3AUAA 4PRLA 1M76A 3VDQA 2EGGA 3VKUA 2AQKA 1C1DA 4OXYA 3V2UA 2Y66A 3S55A 1RYDA 2PGLA 3SJUA 4R01A 2UV8A 3K96A 2GN6A 1QYXA 1G0OA 5G0SA 4DQVA 2C20A 4RF4A 2WEKA 3HDHA 4XJTA 3ZGYA 1EE9A 3ZWAA 4P4GA 5KJEA 3JYOA 5IDXA 2B37A 4RVSA 3DZFA 1O89A 3QSGA 2B83A 2ZKLA 1M6WA 5ITWA 5EINA 3MJVA 4RV9A 5C3MA 2HAEA 2HSDA 3G1TA 1P1JA 2V6BA 3UF0A 5A5EA 4QO7A 3O9ZA 1VLLA 4DL9A 3VVCA 4BNGA 1HT0A 1ZXBA 4XIYA 5A1TA 1E3WA 5KJ1A 3RROA 4OIMA 3Q9NA 5GY7A 3IQDB 2GDZA 3BMOA 3AUUA 3C85A 3JQDA 1LC0A 1PJLA 2OL4A 3UCEA 3WDSA 4YT8A 4XQCA 4MINA 3L4SO 1UXJA 1RM0A 1P1KA 5COBA 1KYQA 4I5EA 3EZYA 1TVEA 1Q1NA 1IUKA 1V0JA 3A06A 5BR7A 5HBRA 1TLTA 4XQGA 1T1RA 1MG5A 2O3JA 3CZMA 3OMLA 5ES3A 3DR3A 2G76A 1Q0QA 4BKOA 4CPDA 1PL7A 1KC1A 3G0OA 5T57A 4RCVA 4NK5A 4M1QA 1A9YA 4I9UA 4WLVA 2H6EA 2NU6A 3OEYA 3AY7A 3AM3A 3P7MA 2ZTLA 1HE2A 1O94A 3GZNA 5DP2A 1L7DA 3VPGA 3EYWA 3SLKA 3GGPA 4FBGA 3WWYA 1IPEA 1HL3A 3GNSA 1I2BA 1GYQA 4WLFA 2ZCUA 2VYND 2E6UX 5IDYA 1Q2XA 5K9ZA 1WDMA 3F1LA 3OF2A 5BNIA 1T2DA 5IZ4A 1ENPA 1ENOA 4IXTA 3GFBA 2NQ8A 1FJHA 3JQGB 1DAPA 1G6KA 1OAAA 4P38A 1I32A 3OH8A 4ZA2A 4C7KA 5IXYA 1U7TA 2AXQA 3PZBA 4YT4A 2YHUA 4WLEA 2UAGA 4ALJA 4RLSA 4E2YA 3ULKA 1RKXA 3KYDB 1Y81A 3C7AA 4WOJA 3ZWNA 4FFPA 3KSDO 3BYZA 3PIDA 5JAQA 5EESA 3DOJA 1MX3A 3D5TA 4G2NA 5I7SA 3RKRA 2PH5A 1NBOA 1HLDA 3PQDA 4J2OA 5FF9A 4ESOA 1D7OA 1XLTA 5KVVA 1Y5RA 4HX5A 3WGZA 4I9HA 4WNIA 3MWEB 2BF7A 2DTDA 3MTJA 2DLDA 4KQXA 4Z6KA 1VL6A 5MGBA 3BIOA 4FCCA 1ZCJA 3PDJA 3RBXA 3U62A 3UXYA 4WK6A 4FOOA 4UREA 2VQ3A 1F06A 4XWYA 4RVGA 2YW9A 1XHLA 2OXIA 5A3JA 4JBIA 3FTPA 5ILOA 5IDWA 4ALLA 2PTGA 1J4AA 1R4MB 1MC5A 4R1TA 1X1TA 3HDJA 3GDOA 4BNIA 4ITUA 4ZJUA 1GV1A 2JCYA 4YRAA 1HDOA 1MFZA 2PH3A 3CINA 1RWBA 2W4QA 4JBHA 1M67A 4EUFA 2A4KA 2W2KA 3ZWWA 4CV2A 5KKAA 1YBMA 1NWCA 1E1NA 4GPD1 2AA3A 3AOGA 1IZ9A 1ZBQA 3O8QA 2VN8A 5A3VA 3TQHA 1DDOA 4RVFA 3ROMA 3WGHA 3VOSA 1YH3A 3GK3A 1RM3A 1ISGA 5B37A 3GNQA 1P1RA 3AWDA 4R9SA 4JIGA 3VH3A 5G4LA 1TT5B 2J5QA 1UZMA 2EW8A 3ANNA 2IZZA 4I8XA 1SOWA 4C7JA 4CQMD 3H9GA 4DRYA 4PG4A 2VZ8A 4MVJA 4XIJA 3C8MA 1Y8RA 4D42A 5JXWA 4B3HA 3D7LA 2IYPA 3OP4A 1IZ0A 5JY6A 1F12A 3E6AA 3I23A 1GPJA 3GGOA 3NTRA 3EZLA 4DWVA 4DUPA 4ZGWA 1Q0LA 1XU7A 1AE1A 2GLXA 4YBZA 3QA9A 5EQDA 3LVFO 5JO0A 2PFGA 3O4RA 1T4DA 2GERA 3JD0A 4Q3AA 3OA2A 3PTZA 3E1KA 4XZ3A 3QVTA 2DBRA 4J7CA 4ALMA 2Q1WA 3WFIA 2RIRA 3GT0A 4Z0HO 3M1AA 4CR8A 5AVOA 5L51A 5KIAA 5JC8A 1MC4A 3FR8A 4OO3A 4FGSA 1N9GB 1UXGA 1WNTA 2DBZA 2BFOA 1LUAA 3KEOA 2NACA 3LU1A 3PGJA 1JN0A 3ZNQA 1NX6A 3K9QO 1VE9A 3TNLA 2C5AA 4W7IA 4NK4A 2YFQA 1PWZA 2PZLA 3DQPA 3RD5A 1E7QA 3W6ZA 5KNLA 3Q0EA 3H2ZA 1ZVMA 3VH4A 1LBEA 4I9NA 1K6XA 3VAZA 4E0BA 4BIIA 3NUGA 1ISHA 3GA0A 4EJMA 1E6EA 4A5OA 1QMGA 4Z3KA 3ZW8A 4R3WA 4E30A 5EERA 2ET6A 3HG7A 5IZCC 3UFXA 2ZYGA 4Y6PA 5CPFA 4Q3CA 2GPTA 2IYOA 4M55A 4XQ9A 1HRDA 5C7OO 4GWKA 3ZW9A 5MDHA 3U4IA 3HADA 1H2BA 2X0IA 4RVUA 2IDZA 4CMIB 5L4LA 4IMRA 2WWRA 2GGSA 3AJRA 3GGGA 3ONFA 3UVEA 5JAZA 3MJSA 2P68A 3ZHYA 1ZMOA 3BA1A 3DZKA 4E3ZA 4YTEA 3QQPA 4A2CA 2W2LD 4PG5A 1VI2A 4AICA 2V65A 1P1FA 3M6IA 3Q2KA 4JNKA 3D1LA 1H6DA 2V6FA 1A72A 4TSKA 5CDGA 3CE6A 4BNZA 3SXPA 4MKRA 3WBBA 4MKXA 2X22A 4L4SA 2IRWA 4PG8A 1MUUA 2OZPA 4BNTA 2DFVA 4E4YA 1DIGA 4XX0A 2EXXA 2X1HA 1ZNQO 1RM5A 2BRUA 4NFYA 1ENZA 3H6KA 1JU9A 3ROKA 3TOZA 3E9MA 1CYDA 2VTDA 3ZN2A 3WMXA 2EGHA 4KP7A 1OC2A 1WAMA 3W1VA 4F6LA 4CLEA 3BTUA 4XB1A 4BQPA 1Q0HA 3PPIA 1I10A 1KVUA 1LRJA 3GPDG 3ANLA 3KHUA 5TNXA 4WECA 4CQLA 4ZQFA 4BGIA 3DXFA 2YQ4A 3RFTA 5HA5A 4HXYA 1U28A 3VTZA 1SOVA 2GO1A 4HFJA 4Q3BA 4CM4A 3HN7A 4XYEA 4DMMA 1DHTA 4GMGA 1FDUA 4PLHA 3ZWVA 2HDHA 4EEZA 1E7RA 3QVXA 5COAA 5DF1A 1AN9A 2IEBA 5AXCA 3U49A 1ID1A 2CNBA 1EDOA 4CM5A 4J9UE 4U6SA 2A35A 3ZV3A 1FF9A 4UVHA 1XG5A 5IZCA 1OMOA 3FN4A 3U4DA 1CQJA 4CMEA 1BW9A 1IOLA 3E48A 5A9SA 2O2YA 2DUWA 2J8ZA 3EK2A 1X0XA 1U7HA 3W8DA 1KY5A 1YWGO 1UXKA 4WE3A 2BI8A 4HY3A 1CERA 4J7UA 1UP7A 2EV9A 2ZJ1A 4K26A 3I52A 2PD3A 3BMCB 4CMAA 2HK9A 2EKPA
chains in the Genus database with same CATH superfamily
1ZJ5A 3HCEA 2AOUB 1GM5A 2HGSA 3Q7RA 3FM9A 5EJ9A 2GEVA 4PLCA 1UZUA 3FCSB 5ESXA 2WUGA 3TJZA 1W581 5LP6A 4Q1EA 3RRJA 2VHQA 1N2IA 1MKYA 3R20A 3CE9A 4MRMA 2CMDA 3HUFA 3HZHA 5BQOA 4OG2A 4AN4A 2PT9A 2JI4A 5BR1A 2QS9A 4QZVA 3SKYA 4IPTA 1MJFA 3UATA 2ZT7A 1K3UB 4WUTA 5IAGA 4KNVA 1M3SA 1RFLA 5DCUA 3TQSA 4RZUA 2VC2B 5CUQA 4KUEA 5FLXA 3REQB 3UHAA 5D3MA 2J08A 3I6BA 4HFMA 4V2UA 5B53A 1D9ZA 5JXHA 4ND8A 2F43B 1G9XA 4N5HX 3T7CA 2OXCA 4N54A 4MQBA 2A1TS 3ZY6A 1JBEA 3GUVA 4HNVA 2NZUG 3ICWA 1SBQA 5FT9A 3SSNA 1G41A 1CHNA 3C87A 3SDBA 5E6SB 4IDDA 1UBLS 3AETB 4IS2A 3UGKA 4FCVA 4LTNA 4UM8B 5E3IA 3UKOA 3LY8A 4KO4S 3ED5A 5CDFE 3SZOA 2JFNA 3MTEA 1Y9JA 2OHHA 3QLUA 1XI2A 2JJ2A 3R77A 2QLTA 1HYQA 3NANA 4S1OA 4IVPA 3LL7A 1GNSA 3LQQA 5GM2A 2QQ5A 1HMYA 3NH9A 3NDBB 3T7EA 5HOQA 1DV1A 2JGJA 3G89A 2HTEA 4V1CB 1I5OA 4ZT7A 2NVUA 4XJSA 5GZ6A 3KJHA 4YONB 3BZUA 1CDEA 1UPBA 3PC2A 4H0CA 4BV9A 2R11A 1BE1A 3AM4A 5EFZA 1G8YA 1BX0A 2QTBA 5AK6A 1ZGZA 3TV1A 4TSFD 3U5TA 5FA5A 3V8BA 3GDHA 1LD3A 4G5XA 4K1LA 4P32A 1U94A 3SGLA 3LPNA 1PU2A 1RQ2A 1XDGA 1CUDA 2VSOA 3NTXA 5DMXA 4KE7A 3HCFA 1T25A 2H1WA 3ICCA 5F21A 4GL4A 5C80A 1FMFA 5DOZA 5ADUS 4S04A 4DC0A 3ZJVA 3KKKA 4E5NA 2C7QA 4PZPA 5KTYA 1JP7A 5TX7A 3BL8A 4Z1MD 5CD1A 2GBFA 4Y1FA 4M0DA 2B78A 1V16B 3JPYA 3V34A 2ORED 4MVJP 2FSPA 2XDQA 1L9KA 3QPWA 1Q17A 4DNXA 4K9DA 1U7ZA 3C5WP 5KPJA 4BLVA 4W5QA 1NWHA 2RG1A 5HILA 1SXJE 6AT1A 3IX7A 1CUCA 1PR3A 4XSGA 3ABZA 4RY8A 4F2GA 1XPOA 4NH0A 4IKOA 3ND5A 4TYYA 1A8UA 1MXHA 3CNQS 3LXRA 1NFQA 4EITA 4NCIA 2Y4NA 4PCLA 2HWWA 5BR8B 4ZCIA 4INOA 1YR9A 1Y5LA 2O06A 2HU7A 3P2JA 3VUFA 2NUAB 4DCJA 4D26A 1V47A 4Q7JB 1M5UA 4Z9FA 3CF0A 3KJNA 4EYKA 4DJ5X 4CKBB 1RI1A 3RVLA 1SQFA 3UNXA 3FRHA 1ZI8A 1NYTA 3RVDA 5ITSA 4BYGA 1KBQA 3I4LA 4KPUB 2J3EA 4NH4A 2X5XA 1OFIA 1E1CB 2XTAA 1W29A 5DLDA 3KQMA 4Q1CA 4F6CA 1E0SA 2WABA 3C70A 4RZ3A 3GELA 4RMGA 1I72B 4E2XA 3RIGA 2X3YA 1U1GA 4MUBA 3SJAA 1EUQA 1C4XA 4WBXC 1TCCA 4XTRA 3G49A 3O2NA 3UIEA 3RFCA 1S8OA 2H4FA 4KQMA 3C24A 2HRDA 1KR2A 3F9CA 4MR7B 2ZJFA 3O47A 5DWQA 4BIMA 1WABA 3DXYA 3A9WA 2YJ5A 1D8AA 2NQ2C 2XWQA 3NWJA 1REQA 3EXG2 1BA2A 5FNVA 4BNYA 3LPAA 4RM2A 2WKRA 1BVRA 3IEKA 3ZDEA 1KI6B 2FGJA 3LT5A 4P9NA 4HOYA 4J1TA 4RETA 1JEOA 4FOTA 5CPBA 1IUOA 1AHIA 3E1SA 2GCNA 2FPOA 4G67A 4L57A 1QRTA 4XRGA 1MQ9A 2VJLA 5HCIA 4IM7A 2O59A 1II9A 5CIQA 1SFRA 2F1KA 2R84A 4WZBB 2QSZA 2JIOA 1J23A 3S99A 2WFLB 4MQUA 3OA0A 3ASUA 1Q0TA 5FOTA 5KNDH 2B4KA 2VBCA 2AT1A 2VT6A 4PYLA 4P33A 3IOYA 4X8LA 4BKMA 1NVEA 2ATIA 5ALOA 4E4TA 2ZJ4A 3OQHA 5BV0A 3W5JA 6Q21A 1BSVA 4R1OA 5JPDA 2JW5A 4UTRA 3EC2A 4DQLA 2ZZNA 1LEHA 4TKLA 1ZJJA 4BHTA 4CTMA 4UPEA 3SHOA 2AD1A 2F59A 5F7ZA 3OD1A 4MKIA 3Q5GA 4IR7A 4X45A 1FRFS 4F91B 2WTXA 2O52A 3KKEA 3IMKA 2B94A 3FPSA 4QT0A 2OFXA 3RFXA 1C30B 4FFDA 4WADA 2V0GA 3TW3A 1CXZA 5E0OA 1BHJA 3ROXA 4CKXA 2IU0A 1AHHA 1NJ8A 5ERGB 1RXVA 1AX9A 2A5DA 3PQ4A 4ID9A 3RAGA 3REGA 3TLXA 2M1XA 3HFSA 4HDMB 4ESEA 3B6ZA 1QG2A 1E6CA 1RXEA 3AJEA 4LY9A 3T9CA 1DUSA 3LHFA 3R76A 3L7IA 2BKXA 4KDEA 1AS2A 2C5BA 1YDEA 1A3CA 4NE9A 1P6XA 4N5DA 4B4UA 4GOOD 3O5AA 4PO9A 1SVSA 2O7RA 3ET5A 3OURA 2BGJA 5EJ5A 1ORHA 2QW0X 2ZSDA 5EJ4A 4Q7EA 3WA6A 1HX7A 1Z6PA 2GD2A 3I2GA 2VJMA 1J25A 2X2EA 3OJOA 4FW8A 3EVDA 4LYGA 5IUNC 4ISBA 2PT6A 3QEMB 4GMKA 4LSMA 3Q9LA 3HZOA 1OWLA 3SNHA 3WIEA 4D8UA 5BSEA 5LQMA 5ALIA 5JSQA 1R4NB 1A9SA 5HWSA 1B26A 1W9MA 4MVXA 4JJ6A 3WO0A 4AUKA 4Q7QA 1GUAA 5I9IA 4OQXA 2CHQA 2DFLA 1CY7A 4IQ0A 2MTBA 3GROA 2V9PA 3NKVA 1KORA 3FVRA 4OYLA 5K6AC 2OR3A 3AL0C 2BBTA 1LSSA 1P0CA 1ATIA 1KVTA 2ZAOA 1FNSA 4GSKA 4NJEA 4ZVPA 1G3QA 4BGEA 4QBGB 1JFTA 1NVVR 1F0PA 3OE7A 1IPHA 4X91A 2I4TA 4L8FA 1ZOSA 1SD1A 5F5NA 5FI1B 3DDNA 3QLEA 3KGDA 1QP0A 4TZ0A 3CKMA 1HDCA 3DG9A 5G4KA 2CKMA 3GFFA 4O1MA 1P1IA 3ZXSA 1E0AA 1KMCA 4E14A 2P90A 1MFPA 1ZUD1 1GT91 2ZRBA 3WV5A 3OO0A 3GMDA 4CL2A 4HB3A 4O33A 4ZVQA 5FYDA 4PXAA 1VL8A 4OHUA 3GLFB 2R7AA 2HJSA 5GAJA 1VYTA 3DDUA 4BDTA 2SCUA 4O89A 2BW0A 1GAXA 5DTJA 3LYLA 4WCFB 3HWSA 1A5SB 1TO2E 1C3LA 1QCZA 2AMYA 4IX9A 3ZXUB 5B1DA 3S27A 1TM5E 2A3RA 2MMGA 2WIBA 3VVBA 4CR7A 2BFPA 1CKEA 4LXTA 5CA0B 1QXSA 4RNCA 2QG4A 1Z45A 4OFZA 1NOIA 1FYDA 4I55B 1I24A 2BDUA 1R00A 5IWAB 1L7XA 1QRRA 2P77A 3N2LA 3SM9A 3EULA 1UC5B 3I6IA 3DXXA 3PYLA 2C4VA 1U0LA 4LRXA 1YE8A 2JGRA 2YHBA 1V9LA 4RMHA 4OI4A 2ZWOA 1UH5A 4RGQA 5CHEA 4E11A 4F1KA 3CGGA 2DU8A 3PXUA 4EARA 4RSRA 3D3WB 1QOQB 1RHRA 1UMBB 1S2MA 2CNWD 4FZ5A 2JIDA 5DE3A 3DDHA 3KSMA 4MDHA 1Q0RA 1Y3HA 3GRKA 2Q7XA 2X8BA 2RGYA 2G71A 3G8BA 2JGDA 5DGIA 1NKSA 2QE6A 5JS6A 3IQWA 4YYZA 4BLUA 2PGJA 1YZVA 4IFEA 5MN5A 2VF8A 2RJ3A 3JSAA 1L4FA 4QLBA 1SK8A 3EF0A 2C5EA 4QYWA 2CV0A 5CDHA 1OA1A 1FS5A 3HN2A 1L5FA 1PIWA 1CEXA 1XRLA 1OJ7A 2C88A 5EZYF 1KQNA 3UENA 4XUDA 2OMEA 1DUIA 3FLMA 3G88A 4TWRA 1FMJA 4IEEA 5H3CA 3B5JA 4PBTA 3FPBA 4RYDA 5CBPB 1A76A 2JVIA 1W9HA 4NS1A 2GDJA 1B1CA 4FMBB 3STVA 3GY0A 2X0FA 4YJDA 3KXIA 1NLMA 2BKAA 3HCCA 4HZUA 3WIOA 1IZ8A 2YS6A 1F20A 5CB4B 1N2CE 3VPHA 3IQHX 3NASA 1A7UA 4L22A 1QFJA 4GNKA 2XITA 4HZGA 4ZI7F 1GA6A 4QFCA 3WL7A 4TL7A 3CLUC 4LI0A 1QP8A 3GMIA 2IGBA 4O2BA 1TA0A 4BE4A 3U4GA 4D0GA 5HJEA 4RMIA 4TV9B 3DBLB 7ABPA 2G82A 4CM3A 2ATVA 3M7IA 4COOA 1KFEB 4C76A 1AA6A 1EFHA 3S1SA 4RE5A 5HUQA 1XDZA 3OAAA 4RHUA 1NXXA 4HF7A 4IIHA 5PGMA 1DCMA 1UC8A 4IDBA 3W2EA 4W9MC 1KSJA 2Y9MB 4KLAA 5CB0A 1RLMA 5M5BA 2DPHA 1LQUA 2C42A 4BTVA 4XYLA 4DSUA 3NEJA 4WY2A 4D43A 1NI4B 4DSNA 1DC5A 1QMIA 4EF5A 2YCBA 2VCYA 4I19A 3I32A 3ZDFA 1C4KA 3A6HA 1EXNA 7REQB 5TSDA 2OK8A 3RKSA 5BPHA 1Q91A 4FNMA 5FL3A 4BVKA 2NSLA 4QGFA 3E5RA 1B1AA 1YBAA 3L8FA 3PQ5A 1Q7RA 3AERB 1M9NA 4JB8A 4W5HA 5JBQA 5KYUB 2Q8PA 3OTOB 4KV9A 5EHGA 1EX7A 1M66A 3D0OA 5C7IO 2A0FA 3HY4A 5SZKB 2AC4A 1SCUA 4HNRA 4LZPA 4X65B 3K2BA 1LB1B 2Y1XA 4MW0A 5JRJA 3WB2A 3OF5A 5DDIP 5DXAA 3IPLA 4CKEA 1FW6A 5I8PA 1GZHB 1S4MA 1C0KA 2NUBA 5E9JA 3WLLA 1ULSA 3U4QA 2J3LA 4IFTA 1G2IA 4N01A 2JJ2D 4A5SA 3HGQA 3PA8A 4B46A 5DHRA 4NULA 4CMGA 2BN4A 4WY5A 3KKZA 4CN8A 3FTQA 5ILQA 2ZRNA 2VJKA 1GNRA 8AT1A 4DPLA 2G9VA 2XB4A 3NOXA 1RXYA 1H2EA 5AVVA 2ACWA 5DW3A 1ZK0A 3FF1A 3F98A 1JSCA 4I99A 3HU3A 4LNAA 1YUBA 2FLKA 4ML3A 3LT1A 5I4KA 3BERA 2H1RA 2QIOA 2E21A 1K9SA 4KVAA 2HK6A 1Q21A 4JCOA 2F64A 2ZYAA 3NTOA 3I37X 1YS9A 1Z8DA 4S1VA 3HSYA 2GF0A 3GZ4A 1Y4SA 2Z5LA 3ILHA 4I50A 1V8FA 4REQB 4D82A 1PVOA 3DO5A 3L18A 4HWOA 4BKQA 2UXDB 2PUWA 1JKJB 4ZD6A 3BTOA 4AROA 4TQUS 3E9YA 1YZUA 1P6UA 4PIVA 3HNRA 2LPMA 3OFVA 2B1QA 4HDRA 2WYWA 4H1TA 3I8XA 1M6EX 3IELA 4N8SA 1P4JA 2BMWA 2PWYA 1RCUA 4WNYA 1V8BA 4L9AA 5BOSA 4CEIB 4P86A 4WGGA 2JLQA 1ULHA 2KMLA 5IM4F 4UM9B 4FMCF 2ESRA 4Z0TA 2WUEA 5TQ0A 3ZXXA 1OR8A 1H4SA 5EYPB 2QYHA 1ZSYA 2IF0A 5FXMA 1HTWA 1SZDA 5CCXA 4FDVA 3BSSA 4CEJA 3BMOB 1EUDB 3A4TA 4EG0A 1USIA 1OLUB 2DT5A 5DGCA 2AFVA 2ODPA 1I94B 4I4TA 4OK5A 1ZH2A 3TZCA 1XRSB 4UDNA 1YQDA 4BMPB 1N77A 2QL7A 1A8QA 1QBGA 1ZZGA 3BRWA 4LQLA 4N9WA 4CEHA 4PPFA 4XQ0A 3D2CA 3QF4A 2Y1GA 5IH3A 2BH2A 3IMGA 3I0ZA 1F2UB 2QEQA 2XF2A 3QPVA 4IGFA 4G5OA 2OE2A 3HBAA 1IDOA 1Q1EA 1OX4A 2O5CA 1C4WA 4I14A 2B8NA 1P2GA 1ST3A 3W6UA 5AW4A 1EH5A 4XDZA 2DC1A 1CEYA 1PD1A 2C4KA 3PQ3A 1MOPA 2FX3A 2HDWA 1DX6A 4UEJA 3NPAA 4CCYA 1GXSB 1V5IA 3GZNB 3HJGA 4NU5A 2HA3A 1WVMA 3O8LA 4C9BA 3FOBA 1KE1A 2BFDA 2B0JA 3HBMA 4HRAA 4JSRA 3AUKA 1P5RA 4GX5A 4HAYA 4LBYA 1NBAA 4B48A 4BGUA 1LBSA 4P3YA 5A9RA 4ZQHA 3Q7QA 4OLAA 1I1QB 1JEDA 3OJLA 1G60A 2RGAA 2G36A 1Q3KA 4PF1A 4C78A 3KT3A 1USVA 4WLNA 4D7AA 3R7WB 1MT3A 1WLSA 1XVUA 4UTPA 4WDQA 4E88A 4WUVA 4ZVUA 1E59A 5JROA 1LVUA 2F6RA 2PV7A 3CT6A 4ZTBA 4TKUB 3UMGA 1CG6A 1X15A 4J29A 3IPAA 2ONJA 1K7EB 1ZGGA 1G8HA 1SPBS 3HCWA 3IA7A 2HZBA 4B6EA 4EPYA 1FRZA 1TJPB 2G77B 2J3JA 4KUHA 2WW8A 5B2EA 3MOGA 2PMFA 1M1ZA 5E4JA 4GPBA 4KO3S 1LS1A 3RADC 1ISPA 1RRFA 2IZ7A 2V54A 3O94A 3OOYA 4MARA 4DQXA 2NTNA 2HNAA 1WHSA 4JDPA 1TECE 3I04A 3T34A 4DMUB 4EA8A 1JQ5A 2RHGB 3D81A 3FG9A 1QV7A 3MCTA 4FWIB 3KZKA 3V1NA 1LPNA 1NXSA 2UZ1B 2XIQA 3KB2A 3IUQA 4ETIA 3RLIA 3PL5A 4G9EA 1KZGB 1O0CA 1JI3A 3ZVLA 1WUYA 2QB5A 5BW4A 3I2FA 2YMMA 3LGAA 4R8LA 1DRUA 3W9UA 4DCOA 4EWLA 3VU1A 1NJSA 3VC3A 3LGXA 3QVVA 2WVHA 4U7JA 2FQYA 3MT9A 2BPOA 2IOFK 3IE2A 4M0EA 2YZ2A 5C31A 3A6GA 3DOOA 1DBQA 3KXDA 1ATZA 4EHHA 3I6QA 1S2DA 4FHDA 1ZGBA 3MBKA 4PC2A 3RWOA 2IH4A 5DOVA 2YMQA 5EHNA 2HLPA 1H3NA 2PUHA 4FLEA 4HHEA 3SYKA 3LYUA 4HB4A 3RC9A 2P4HX 4LDNA 2IODA 3KVNA 1RQGA 3PUXA 4MITA 5F2OA 3ZD8A 5CTJA 1FFXB 2I54A 2PEYA 2QJRA 2VLIA 3AEUA 2CL6X 3PC7A 3R3JA 3RJZA 4M98A 4IJUA 2E2WA 4NDNE 3CR3C 1X77A 4JJGA 1OT5A 4PZCA 4EGQA 3S2YA 1QH8B 2WTBA 1Q12A 2LKCA 3FLEA 4H3SA 2C4NA 4ECEA 4MKZA 1IN8A 2CK3A 2I9PA 3AU8A 1KIFA 4UNQA 3KQHA 3CH6A 1UFKA 3UHJA 2D2IA 3LQYA 1HY3A 2PBRA 4B45A 3L9XA 5F9FA 3PGXA 2CBXA 5KBYA 1R12A 1U31A 4BZZA 1AKYA 3EZNA 3JAWB 5FWYB 4RVOA 1OYYA 2FPGB 2JGAA 1G7RA 5F1OA 4PGMA 2IV7A 3HLYA 4KAJA 3RTCA 3FFAA 3VR4A 4B33A 1RZVA 3LA8A 3OE7D 2LD4A 4B76A 4DLWA 4BEWA 1TTHA 2H8KA 2YN0A 3ZWKA 1EXWA 4ICIA 4CMCA 1QX3A 2M9MA 2TMDA 1OBCA 2IK8A 2WAAA 2JHPA 4DLAA 2C8JA 5BMOA 5KTMA 4KHPB 1ONPA 3BMQA 2AG0A 4PM4A 4OX9B 4N12A 1IJEA 3K1AA 4JXKA 3UG6A 3HK2A 2YOGA 3CKLA 3WL8A 1JHMA 2MHCA 3OKAA 1K3TA 4OHWA 4UW9A 5IAOA 1A82A 2B20A 3WGYA 5T67A 5H59A 1PFUA 1VMEA 4F6RA 1I3LA 1T0PA 5AYVA 4QUHA 3N3AC 2H11A 1ZK1A 1T9BA 2GPBA 3L77A 3HO8A 4UJ5A 3QX3A 3LWZA 5A3RA 5D7NA 1THTA 1PR1A 5J3JA 2CJWA 2JGIA 4TOIA 1BS2A 3CH7A 4ZFNA 1PI3A 1JHUA 2JCBA 3FCOA 1XZCA 1Y4AE 3NDIA 4CMHA 2PZJA 3M70A 2XTNA 4NYMR 1QIFA 5EJFA 3MA0A 3T7SA 3L6DA 3O2QB 4RIGA 3ZNOA 1G5IA 2EW2A 3WVNA 5JNVA 1RS0A 3G9XA 1KZ6A 3V2HA 5ILGA 5DLPA 3WLRA 4KXYA 1L5SA 1ULAA 1GPKA 3HFGA 1DGQA 1PT5A 1W5AA 3GVXA 4CTJA 1R0KA 1NDUA 1RYMA 4XB6B 4PZEA 4R3NA 2DH6A 1L7BA 2PSHA 4WQMA 2VVTA 4JFRA 4EK9A 5KTRA 2SBTA 2Z2KA 1LSUA 1PJTA 3VSBA 1XXHE 3BMCA 3HA3A 1TQDA 1F14A 1UM9A 2CUZA 2G5CA 2O2EA 2AOUA 3SSOA 4LGMA 1KRHA 3F4LA 4URUR 4MLPA 1FDVA 5FFMA 2I2FA 4QXQA 2IXFA 1NRWA 3II6X 3TNFA 4JB0A 1E77A 4QPCA 1UFOA 2UVDA 2QMHA 5BWLA 5BXYA 1A0OA 3EBPA 1CUUA 1DJOA 3I39X 3LPCA 3TQQA 1KARA 1YZTA 3MS4A 1Z63A 4OJKA 2LCQA 2G72A 1ZA2A 2YCLA 1L3CA 3BWEA 3REQA 3ECCA 2XOXA 4FMPA 4D9HA 4BPBA 3WIUA 1QYIA 3VR6A 4MR8B 4DABA 2F43A 5DIZA 4IUYA 3ZTYA 1XA3A 3RVMA 1H5NA 3FWZA 3FDJA 1PX2A 2RC6A 3Q1KA 4BFUA 2P2SA 3GLHE 5E6SA 9LDTA 4DWWA 4D96A 3ESQA 3AETA 1V35A 1UDRA 2B25A 2QTRA 2XLCA 3OAAD 3WK5A 5D5HA 4DC1A 2VOJA 1P73A 4E15A 1PS9A 5EEHA 1ES9A 4F4JA 2WMYA 4EP1A 1YE3A 2I6QA 1IN6A 1I3NA 1ZBDA 2VFAA 1PD0A 3D3KA 3ROFA 4EI8A 5B7GA 4MK4A 4ENVA 4HWPA 2P8SA 3LP5A 4QE3A 3ORYA 2QU7A 3G5MA 4OFXA 4I3FA 4V1CA 5KVCA 4DRZA 1ISIA 3PTLA 5CXUA 4PPNA 2D5BA 2XQGA 3V7WA 2OHGA 4FLMA 1OHHA 4YEDA 2IZ1A 4J3FA 3H5IA 3R5HA 4N3NA 4LECA 3D4OA 1H2FA 1SOUA 1WCYA 4GQIA 2C96A 3UXHA 2Z43A 3CLHA 3VGJA 3WE7A 5LIPA 4X62B 1JJ7A 1FSSA 1IXZA 2AW5A 4XUEA 5CLQA 3SFZA 4NICA 4BFCA 4BWVA 1GZ4A 4N0EA 1N36B 3WKAA 1ZIPA 3EZGA 3IV9A 3ZNPA 4PVDA 1Y6JA 2FN3A 3HI4A 2ILVA 1D0VA 4O2AF 4IZHA 2IHYA 2ARKA 1V16A 3W2FA 1FE8A 3MLBA 1JT2A 4EYGA 4GOMD 3C4JA 4FHCA 5I7VA 4JB2A 2ZE5A 1TK9A 2WMDA 4JVLA 2ZUEA 1J1ZA 3E58A 1M6YA 1CQIB 5KREA 1SU4A 2MDTA 1U99A 4HI0E 1GGMA 1CE8B 1AJEA 1T5DX 1ISFA 3RJ5A 3FTFA 3AIOA 1NASA 1ZJYA 5K0CA 4C22A 4IDEA 4Z2YA 4E5DA 3GFOA 4D6XA 2BMFA 3GA7A 1IJFA 1JHRA 2GXSA 1R0YA 3EUAA 3KZXA 4PLFA 3RAFC 2J33A 3BTSA 3OEHA 1LU9A 1T2NA 1JAYA 2NUAA 1K06A 3TRFA 1Q6ZA 1EFVB 1WDWB 1FSFA 1EHYA 3FJ1A 4J2TA 3T99A 3VHRA 1JEJA 3AJAA 4CI0B 2GZ2A 2UYYA 1N6RA 1WW2A 3IDOA 3SQLA 2RAVA 5D00A 4OH1A 2VWPA 2FOXA 4P93A 1XJCA 2J41A 5LA6B 2PUGA 3NOOA 4KPUA 4CQNA 2AF3C 1FFHA 3UB2A 3W6OA 3ZWCA 1ZISA 1E1CA 3EPBB 2P2LA 4ZO9A 2NV0A 1W1UA 2LNDA 3WYEA 2NX2A 1MX5A 3NMUF 4L0QA 1SO8A 7GPBA 1MJ5A 1U8UA 1LRLA 2AE1A 4JZYA 4IS3A 3ZQKA 3TG2A 4FFMA 4BMZA 3ZV5A 2X77A 3I9KA 1GZ3A 1Z2EA 3JYLA 4MR7A 2BHLA 4BUJA 3RT9A 3EDRA 1QO9A 3R2JA 4BLOA 3KKOA 2HL6A 3SM3A 1U04A 3BRWD 4GSLA 4JQCA 3H5TA 2JLRA 1YB5A 1XZKA 4HH0A 4GKVA 3U37A 1A2QA 3WK6A 4LEIA 2FZGA 3ZZNA 5FDFA 5EJEA 2P6UA 4D0SA 3R7AA 4QJ4A 5CDSA 1P2TA 5JTUA 1I4LD 4MGZR 2FR8C 1MAVA 4YYEA 2CZGA 2E3JA 2ZBGA 1P4RA 2AHRA 5EWMA 3TLZA 1RWMA 1FMCA 1XA4A 1UWVA 2WQZA 1WHTB 2WWGA 2HU5A 3CG0A 3QFCA 4TMKA 4WZBA 2WFLA 3T9DA 2FFAA 4FU0A 4HH1A 5FI5A 5BV1A 1F3OA 1RE1A 4KFTA 5I6DA 5KVSA 1HDYA 2EF1A 2RI1A 1H9AA 3P9KA 4MMZB 1T0JB 2FZEA 5AWFC 1OKKA 1VP3A 2FPKA 1QANA 2WBLC 4HZIA 2AEFA 5EUMA 4F04A 2O4UX 5EMHA 1D7AA 2C2KA 3I5AA 1IOZA 3BQNB 3KJQA 1I3MA 5EPEA 4E33A 1XALA 2H48A 4PBRA 1EXVA 1SQ0A 3IURA 4MMYB 1QIMA 1D2GA 1C9DB 2EERA 1FVFA 2C9YA 1VBKA 4REOA 1C30A 1RAIA 3CEPB 4MI6A 1KPIA 2ECKA 3N6VA 4ERNA 4JD5A 1PQUA 5DM60 3HP4A 3NB0A 1YQQA 1UZNA 5G02A 5IC5A 1Q16A 4ZYZA 3H13A 4AS2A 4HDMA 1K66A 2FPIB 2O8BB 1QYDA 1G7SA 2DCUA 3RCBA 2MYPA 3GR6A 4OHVA 4AJPA 3O8OB 4QUDA 1WE2A 4CMJA 3D3EA 2VYVA 1PQPA 1KFBB 4R16A 4YMLA 1U8XX 1IZYA 2IYNA 1V6AA 2V6GA 4ZAFA 3RNOA 3AHDA 3WQBA 4DMGA 1WDLA 3W2TA 3K1ZA 5IHPA 4L51A 2A30A 3IEUA 4NR0A 3SJ7A 3SLGA 3F73A 1EVZA 3HSSA 5F51A 1VHJA 1XU9A 3TBKA 5KWIA 3QEMA 4K87A 3BUSA 3HSKA 3DLAA 3V3KA 4DVJA 2JCXA 4ZVSA 5HTOA 1DCKA 3LTEA 3ME5A 4AJ2A 3LDUA 1LQ2A 2NNLD 3RWMB 1WUJS 1NW4A 4EKEA 5JBIA 4KIJA 3PCXA 3QXCA 3MTBA 4TKMA 1IY0A 4F3RA 5A2GA 3QV1A 3DAYA 1JEEA 2XD9A 3SQOA 4HB2A 2VRCA 3NT2A 3OTIA 3WISA 2FPUA 3O6VA 3PUWA 4F56A 3OCCA 5JZVA 4GP9A 3H11B 3O9MA 5BQFA 4PGGA 2RJOA 5KCZA 3HXKA 1GT6A 5AQ1A 4L6IA 5IUJC 1UJNA 5JQGF 1U3DA 3BICA 5E7MA 3K05A 4IH1A 1RYEA 3TIXB 4ER5A 5IX8A 1QRUA 3EQ6A 2Y2VA 3ICPA 2DOKA 4FOPA 3VNVA 1X42A 2GYYA 1R0LA 5MFZA 1R4ZA 1TVKB 4E94A 4RTLA 2PLAA 1XWIA 2XYPA 5IFLA 3LS2A 1HEIA 3GLFA 3OQJA 1NPDA 1KJNA 4UBMA 1E92A 5CCBA 2C1XA 4RABA 1GPDG 2J67A 1XQ1A 1EQUA 4WCFA 1C1XB 3ZD6A 3RTDA 2CK3D 1DKOA 1GA1A 1D8TA 1RJWA 4DNQA 4FCWA 2Z3VA 3WRYC 4B17A 4S35A 2R48A 3T4XA 3WQQA 5CA0A 5E2AA 1VIYA 2ZB7A 3KZOA 4L4RA 5FTWA 2BGIA 1V5FA 3N75A 4N4AA 1EVKA 4X7PA 3U3MA 2R8RA 821PA 4I55A 1N6KA 1I1HA 3UK2A 1YQXA 3UAYA 5CP8A 5DZSA 3BORA 3VR4D 1FDWA 1HKUA 1BDMA 1RAHA 2PUJA 4QYXA 5EHZA 4C4SA 2ICAA 1MX1A 3QENA 1QIKA 1Y4DE 3MZ0A 4XB2A 1SCKA 1NBIA 1FRQA 1OF1A 1UMBA 2A3NA 2KLBA 3DHYA 1KQGA 1U2ZA 1ZH8A 1VKHA 1R74A 2B2NA 3FWHA 3G3EA 4GWLA 1YB6A 4RIEA 3EA5A 1P4HA 2POQX 1JVBA 5K03A 3B1XA 1ZVQA 4BEBA 3AIKA 4URVR 1O58A 4EVIA 2OESA 4BGVA 3M82A 4J0KA 1Z15A 3Q1LA 2CHGA 4WHMA 2RD2A 4IF6A 5FUXA 3LDAA 2VSFA 1R37A 3OOSA 5IABA 4LDJA 4TRJA 4R2WA 2H85A 1C9NA 1MAAA 1PGNA 1FLAA 2FEPA 3FKSA 3OCVA 1LLFA 2IXDA 3OKFA 3AV3A 4UBJA 4LFCB 3VOAA 1R8YA 3P9YA 8OHMA 3IAFA 2ZEJA 1DAFA 3DMFA 1G59A 1W4CA 2H1IA 1KRWA 5CB4A 1N8NA 4ND3A 1HE3A 3OFSA 5I4CA 4QGAA 3NHPA 2YYZA 3UXMA 1CZUA 4IDAA 3A9TA 4HN9A 5ESWA 2O6LA 1MRNA 1M1UA 5C37A 4URHA 4RHCA 4R1NA 1YCGA 1I30A 3PRHA 4TQAA 3ET4A 3HLKA 2E7ZA 3GFGA 4UZFA 1YF3A 4TV9A 3DBLA 4EQZA 1L7MA 1ICIA 1WXQA 3ANTA 3HDQA 4JLSA 1Y4ZA 5CIWA 5AKJA 2FMUA 3LP6A 2B35A 3K8QA 4RF2A 4I2NA 4PYJA 1P0PA 3QF7A 1H2XA 3V32A 5I51A 1ZD4A 2P9QA 1DIBA 3CLKA 1NG1A 4RORA 1YFLA 4BUCA 1XDDA 4HLCA 4PO8A 5TF4A 5BWCA 3OESA 3CEAA 1IN7A 3PJDA 1SUDA 1TZ2A 1SBTA 1DBSA 2DECA 2UVPB 1I14A 1NI4A 2VHZA 2XE6A 3QQ5A 3NOVA 4LQ4A 2H5LA 2PYIA 3A1WA 4O4JF 4OMFG 3VR1A 4WBNB 4RIIA 2OGSA 2VQFB 4FIDA 4GU5A 1LFAA 5EKDA 1IXYA 1CIVA 4LRSB 3MRVA 4Q39A 4D4JA 7REQA 5I9NA 3WZMA 3ILXA 4WRRA 1UODA 3SXUB 2FPLA 3GJRA 5KYUA 4LDRA 4INAA 1K89A 2XYVA 3AERA 3VR6D 2P9GA 1X9IA 1BQEA 2QL6A 2WI8A 2XCUA 4QQ8A 3JARB 1L5LA 4YRDA 1KHTA 3VHXB 1BAPA 1ZYUA 2ZE7A 4LHEA 2OAEA 3B5IA 3OZ7A 4JITA 2IW1A 3SFTA 2IYAA 2GZRA 4MPRA 1MC1A 1RYBA 2A8YA 3ENQA 4J43A 3MWFA 2UXBB 5CR9A 2RGRA 1AT1A 3WNBA 2HYDA 3OLWA 5FORA 3DSRA 4J1QA 4PE5B 1Z6ZA 2DETA 4RH3A 1T35A 4UBKA 4RD1A 3PE3A 1FXUA 3CLSC 4LVNA 2J32A 3IV7A 4Q3DA 3ZHQA 5KDOA 2KBEA 2V7UA 2VF2A 3A2LA 4RX1A 1UDBA 1JKIA 1OHHD 1JUDA 3D8HA 3DZ4B 2WT9A 4H16A 1T9ZA 2J0EA 1BWRA 4JMLA 5THKA 3STWA 1GGVA 2Z6AA 1PS8A 1T8TA 4CWAA 2PL3A 1YJAA 4B3CA 3VI3B 1Z4NA 5G0WA 5B6PA 5IH7A 1CY1A 4ND6A 3E15A 2DHEA 4OAQA 3NJ4A 2CVHA 2QAIA 1KJWA 1XCBA 1YVEI 4N82A 2XNKA 5CEEA 1Y5NA 4JUAA 3LQFA 1IHUA 4E70A 2CN1A 2HRRA 1JKJA 3AR5A 4MUGA 2J9YB 3FUTA 1JMKC 1WMFA 3FNEA 2B7BA 3KEQA 5AXBA 5B1EA 2EEPA 2LVBA 2PFSA 2BFCB 2ZRIA 4GBED 4Y2SA 4F46A 4DW8A 5KPDA 2X8LA 1AH2A 1E4EB 3TL3A 1H5QA 1SH7A 1W94A 2BM0A 3MWGA 3RIMA 4JJAA 4RTPA 2D6FA 3EMKA 1EB8A 3JALB 1QM5A 4OB6A 1DKPA 3Q3GE 5EYPA 2OP1A 2IV2X 5KSZA 3IAM6 1EUDA 1XWWA 4YO7A 3DZ6B 1CR1A 221PA 1OLUA 2CJYA 3M4YA 2PKQO 2O3TA 4RD4A 4LXQA 3SYRA 3VYSB 2AFHB 3FDFA 4U02A 2PH1A 1U2EA 5LZ7A 2FY8A 2QXYA 1VKOA 2Q22A 2QLMA 1SEPA 4J9VA 1N25A 3OEHD 4L02A 4Q3OA 4LMAA 3I8OA 2XEDA 5CVJA 1E0JA 2EFCB 5I8WA 2Y1FA 1RFGE 1NU8A 3RFUA 2JHFA 5AIBA 1WLYA 5CYPA 3HABA 3X1MA 2GLUA 4RPKA 1BXRB 4E08A 3U7HB 2IY7A 5BN3B 1TA4A 1GXSA 1JZTA 1W96A 1XRMA 1TADA 4XD2A 2WICA 3GRVA 4N40A 3TX2A 5LBUA 5BMVF 4BVJA 1ZEJA 2H1SA 5J2UF 3RSOA 4RH1A 1RJFA 5F3RA 3IAEA 3QJ5A 1RXCA 1IY8A 1PW5A 2BR5A 5U4XA 1DKNA 3FHTA 2WT8A 1EK5A 2YIVX 1BGXT 4XJXA 3TSZA 3INGA 1MOZA 4RSHA 4E7PA 2O7NA 1Y98A 1LW7A 4P3OA 4YRKA 4B7CA 1L4HA 1JAIA 3C98A 3B51X 4L3WA 5AM5A 3R7WA 2D1QA 2PUTA 3CXUA 4E21A 2EU8A 2ZRHA 2GX6A 4YAEA 4TKUA 5DX0A 4RFVA 4DIBA 1Z68A 3CNLA 2R7KA 5C7YA 1JZQA 1P4AA 2YICA 2XYRA 3FPJA 4N7JA 3GP8A 2XMGA 2RGWA 2O8CB 3QXXA 2ORVA 1HYHA 3ETEA 4IJQA 4V0KA 2HMTA 5CFRA 1ZL0A 4Y7DA 2O5RA 1R4AA 1YOBA 3IVRA 1OKKD 1Q11A 2O14A 3GEBA 3PFHA 2G5PA 1XB2A 5MFPA 3WSWA 5J58A 1HYBA 4LGCA 1HE4A 4EG3A 3OUUA 3Q7IA 4X8MA 4CFZA 1Y8CA 2P7IA 2WHRA 4WX2B 3C45A 3IAM1 3QOYA 4UTZA 4ER6A 3QWHA 4JZKA 3ADCA 3VBEA 5JS7A 4OJTA 3GEEA 2OO5A 4UHFA 4Q24A 3SX4A 3SX0A 1AUOA 2P5SA 1G3MA 1RAEA 3LCMA 4Q18A 1PGJA 2X4LA 1I01A 2EYQA 1B8PA 1F48A 5JDCA 1UT6A 3VU0A 4D3XA 1L4GA 1G21B 1TCVA 1BDBA 3LK6A 3NHSA 1HG1A 3K9LA 2VYVD 1JB9A 3SYMA 2NO9A 3KYBA 5BV7A 3W7BA 3CXRA 4CIBA 2FZLA 2IYVA 3V4VB 4HQKA 4BVGA 3GB9A 3NEYA 1A88A 3NTLA 5AOAA 3GHYA 5BT9A 1XK7A 3GWZA 5C0OE 5CYGA 3RABA 1JDBB 3O1JC 1B8UA 1MLDA 2UDPA 1TO6A 2HNBA 1FFXA 3TEJA 4HRYA 3I4CA 1NM5C 4OQQA 3EIWA 3ENKA 3ZHSA 1RPJA 2OGUA 1QH8A 3NYIA 1O3YA 2K7ZA 3TE6A 4OGKA 2G1UA 2JA1A 2J5BA 2I6UA 3SNKA 3E9NA 5KWVA 4IJKA 5B4TA 3KSAC 2EKLA 2ZULA 1VB5A 2R44A 2VRCD 2WLTA 2C1ZA 4Q9DA 3ONNA 4FINA 3UOAB 2REBA 2ZWMA 2B61A 3JAWA 5A5FA 3NV9A 5FWYA 2FPGA 4W82A 2I5PO 3EUWA 2BE7A 1WEHA 4MW1A 2QTVB 4QSHA 1AM4D 1PGPA 5LD2B 2J4FA 2F8SA 5IKMA 4GMHA 3NKFA 3ABOB 1S5PA 1QH9A 2PEZA 4HB0A 4IV8A 3H4TA 5AXDA 4TM7A 5LIRA 4R6XA 4H31A 4KAXA 4ZARA 5LR6A 1SVIA 5JS8A 3UOWA 5DLQC 2VSQA 2A1UB 4ZYWA 5ANRB 1JAXA 4HNTA 3GG2A 2VI5A 4LZWA 3FETA 1JQ3A 2Z58A 2CVZA 1NQOA 1NVWQ 4YAFA 3SIXA 4U2FA 4DLSA 4JQZA 1Y80A 4GYWA 1D1SA 1TJ5A 1M5RA 1CUSA 1IU9A 3C74A 4FYIA 4YS6A 3MSCA 1KS2A 2GJ8A 3UY4A 3G5AA 3LPDA 4N0PA 1WV0A 4OUDB 3ZWXA 4ZYUA 2FCRA 1M75A 2G08A 4XDYA 1QQ7A 2OK7A 2XMZA 2ZT6A 1DJNA 1FEZA 3DZHA 4XGRA 4ZVLA 4AN0A 3KLNA 5DHFA 2DBYA 4ARBA 5K3SA 4L0CA 1D4FA 1DQRA 5KB3A 1M34E 4L95C 1N6PA 2AKEA 3K0SA 3ORRA 1G1AA 4O8CA 2VO1A 3EDYA 3FZYA 1G8MA 2DQSA 2IUTA 2WJGA 2KQUA 3H2SA 4FILA 4Z0PA 1SHUX 3ROEA 1MA3A 2MWMA 2O9JA 1ZMRA 4C87A 2M2IA 4HV4A 1F3LA 1ZA1A 2O2HA 1Z5PA 1SQ6A 4RQBA 4DBZA 3TIVA 3DBVO 4WMLA 1Y8RB 4UASA 3IP7A 4I81A 1NQAO 4J0FA 3QHQA 1Q1ZA 3UXEA 2QRHA 1RYYA 3D8UA 4BNWA 4UTNA 3JQBC 4U39A 4OY3A 5H68A 2IXEA 3T94A 1JJAA 2EQAA 3KE9A 4JT4A 4W5JA 3C43A 4X6XA 4D3FA 1CF4A 3I0NA 2GM9A 3BHJA 3Q6NA 3A32A 1T9GR 3FKSD 5D7BA 1U8EA 4CEIA 2CLDX 1TQHA 3P2YA 1ECCA 2YJ6A 2ZXEA 4G0OA 1O5IA 4MJXA 3I2HA 1YQEA 2A92A 2WC1A 5F7XA 4O1HA 3WQRA 1U2QA 3B2NA 1DJLA 2Q1SA 4HJXA 4UQOA 3WGVA 4RTKA 3RASA 4C3ZA 1U2RA