4MIEA

Crystal structure of apo myo-inositol dehydrogenase from lactobacillus casei
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
339
structure length
339
Chain Sequence
MVVKVGVIGTGAMGRAHIDRLTNVLTGAEVVAVTDIDHEAAEAAVRDFHLNAKVYPDDTSLLQDPDIDAVFVVSFGGAHEATVLKALDTDKFIFTEKPLATTLEGAKRIVDKELTKSKKVIQVGFMRRYDQGIRALKEKLDTGIIGAPLVVRASHINPNVASNYSNEMAITDTLIHEIDEMHWLLDDEYTSIQITYPRQSAEVRNEGLHDPQLATLTTKKGTVIQVLVHVTAQYGYEVKLEVIGETGELQLPNYGLGPILRSNANQQTAVEMSWINRFIQAYNTEVQEFIDEVAKSEPPVGPSAWDGYIAAITAAAANRSQKDQETVLINVAGTPTFYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of apo myo-inositol dehydrogenase from Lactobacillus casei
rcsb
source organism Lactobacillus casei
molecule tags Oxidoreductase
molecule keywords Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
total genus 113
structure length 339
sequence length 339
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.18: Inositol 2-dehydrogenase.
pdb deposition date 2013-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4mieA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4mieA01
2WTBA 4QEDA 9LDTA 4FB5A 3JQAA 1SMKA 2J3KA 5BSFA 1HDCA 5JPIA 4PG7A 1IB6A 3NGLA 2WD7B 1XU7A 1WLYA 5K0ZA 4NQZA 5AXCA 3WG9A 1CF2O 3I5MA 1D1TA 1I10A 2QHXA 2RAFA 4DC0A 1ISJA 1HRDA 3D4OA 3EHEA 3MJVA 4JROA 1WDLA 5EMHA 1YONA 1E92A 1DC5A 3EAGA 3WGGA 1X14A 2ZB4A 4GX1A 1OZAA 1P45A 1U28A 1KC3A 1ZEMA 2PY6A 2VUSA 3WYEA 1PEDA 4BO8A 4QO7A 1I3MA 1HYHA 4OKIA 5G4KB 5B4TA 4OQYA 4QTZA 2UUPA 4CLOA 3SX2A 1ZK0A 2ZK7A 3ZZNA 2GD1O 3GZNB 4YVFA 4TKMA 4IY1A 1BHSA 4XYBA 4D43A 3OM9A 4IUYA 5TC4A 4Q3CA 3I3OA 3DDNA 3BMCA 4XR4A 2RIRA 1C0PA 2YW9A 3HHPA 4TKLA 1FDUA 5TT1A 1KERA 1LDGA 3RD5A 4W99A 1JKFA 3DZJA 3ZH2A 4RORA 3JQ9A 4BNGA 4L75A 2ZYDA 4WNIA 3OFSA 4FIZA 5LCXA 2CF6A 1M6HA 5M6DA 1QYDA 1YVEI 2BGLA 4XCVA 4DBVO 2DQ4A 3VPHA 4L4XA 4HNGA 4CMBA 3CEAA 4ILKA 3S55A 4R3WA 3UHAA 5BR7A 4J43A 4AFNA 5EL0A 3TL3A 1X15A 1NYTA 1NWCA 4TVBA 3SC4A 4JQCA 4CMIA 4UVGA 4CV1A 3CSDA 1MX3A 1GU7A 2AQHA 4NFSA 3LT0A 4IGEA 2CFCA 4FFOA 4CLDA 2C07A 2GDZA 1OAAA 3OEWA 1PWXA 4BNIA 1A72A 2DBQA 1R16A 1RPNA 5DDIP 2VWPA 4N7RA 4XIYA 4DWVA 3LF1A 2X22A 1P1JA 3BZUA 3NTQA 3K2EA 4HY3A 5CG2A 3KV3O 1VI2A 2EKLA 2R6JA 5H83A 4JIGA 1SEPA 4O6VA 4ZA2A 1E3IA 1YKFA 3C85A 4BL5A 3WNQA 4J16A 4RPGA 4GQAA 4EI2A 1C1DB 3QP9A 4CUKA 1H6DA 1E3LA 2Y05A 4RDIA 4R41A 4ZICA 1NFQA 3CMCO 5DBFA 3AU9A 3E6AA 3OQ1A 4A0SA 4DGSA 3GA0A 3WX0A 4DIFA 4FFMA 2RBEA 3RCBA 1UDBA 2FHSA 2Z95A 3AY6A 3DAPA 2YYYA 2VUUA 5T57A 5CG1A 3DEYX 1FXSA 1XIVA 4MDHA 5JAZA 3MJSA 5F21A 2FPGA 3IL2A 4BMSA 2RH8A 4YDRA 3GY0A 4FS3A 5FI5A 3M6IA 4Q3NA 4BO4A 2AQIA 3GNQA 4QX6A 3E9NA 3ROMA 5DP2A 2Y1OA 4CM3A 1JVBA 4TQGA 3NTRA 4YBZA 3NKLA 1SCUA 3I6QA 1IE3A 3WWZA 2O3TA 5EERA 2HKIA 3JQ8A 2JCVA 4YT8A 2AEFA 4DREA 2VTEA 3KEQA 3NT4A 5FEUA 4YJGB 3DZFA 5B4VA 3INRA 1P77A 2PD6A 1NQ5A 1XEAA 3JD2A 3V8BA 3QJ5A 3EGOA 2AG5A 1JA9A 2GERA 4RCVA 2GGSA 4ZQEA 2EHDA 4CLRA 4R9SA 2AW5A 2WJPA 3GGOA 3M1LA 4YJGA 1YS4A 4A10A 5I9MA 3UGKA 3V2GA 1HF3A 3JYOA 1ISMA 3FR8A 4MVJF 1N1EA 3CUKA 2FOIA 2P5UA 3OH8A 3PHIA 2I3GA 3JQBA 2AQ8A 1DO8A 2FR8A 5ICMA 1LSSA 2VZ0A 4NBWA 3ANNA 1X0XA 1BRMA 4K6FA 1W8DA 1QRRA 4DPLA 4KZPA 4GBJA 3KHUA 1X7DA 2NV6A 4BO2A 5KTKA 3AI1A 1ZK1A 1EEHA 4EEXA 4MKXA 1C3VA 3H2SA 1SBYA 4YJFB 5THKA 2ZB7A 3DBHA 3F1KA 1DRVA 4CM9A 3GEDA 4Q3EA 2ET6A 1KC1A 3F47A 4L73A 3DTYA 4ZQFA 1R37A 5C5IA 5L9AA 2IE0A 2B5VA 3JD4A 5C37A 3GOHA 3LU1A 4MKRA 1QSGA 3VDRA 2YV2A 2Q46A 3ENKA 1PS0A 5AXBA 5JS6A 2PH3A 2V6GA 3GG9A 2H63A 3GQVA 5BNIA 4LGVA 4W9NA 5IAAA 4E5YA 4XGIA 5EIOA 2VN8A 5TRTA 3H7AA 1B8PA 1E1NA 2XXBA 3G79A 4GGPA 5TQVA 4NBRA 5F1OA 1Z74A 1QYCA 4D41A 2Q2WA 2EP5A 3HDHA 3K2BA 3SLKA 2P2SA 4D79A 1X0VA 3GMDA 3TDKA 4BKOA 1ADGA 4MVJI 3TPCA 1SO8A 2DTDA 3BMQB 2C59A 2Q49A 5I7FA 5KVQA 1V9LA 3VH4A 1PTJA 5CDTA 3NTOA 4PLZA 3PQDA 2D5AA 5KKAA 4NU5A 5FI3A 2J5QA 2G17A 3TFQA 4WEOA 3DZKA 3X2EA 3W4IA 4EITA 3NDRA 4MIOA 4IDEA 3DFZA 3WGOA 1YWGO 3QA9A 3DTTA 3E8XA 3PFFA 2NTVA 2NVUB 5IDXA 3OP4A 1K89A 3T4XA 3FRJA 1DIHA 3ETGA 5COQA 2FPIA 1H93A 1E3SA 3K6JA 4DUPA 4R1TA 1F17A 3PYLA 4NJMB 1PJSA 5KJEA 1D3AA 2DVMA 2IZ0A 1CQIA 4BMVA 2OP0A 4E13A 4CM5A 1U9JA 4H15A 4XRRA 5JDCA 2VWGA 1OBFO 4IQ8A 1GZ3A 1Q0LA 4PVCA 2C2YA 4NNJA 4MP6A 1XG5A 2W2KB 3ZWYA 2NU8A 4E33A 1DLIA 4DLBA 1N1GA 5L3ZA 1KS9A 2GN6A 3IP1A 2O48X 1H9AA 2X5KO 1PJBA 1GQQA 3NEPX 2OO5A 3V2HA 1HDGO 8ADHA 2YY7A 3GMSA 6LDHA 1W73A 3I9JA 5GY7A 3O38A 4FCCA 4MP3A 1U7TA 1EK6A 2RHCA 1GYPA 3JD3A 4MVJG 1G0OA 5HS6A 3WNVA 4B79A 3SLGA 3KEOA 3ENNA 3OQBA 4ZHSA 4JNKA 4XRGA 3ROPA 2W90A 1P1FA 2Q1UA 2WEKA 1YB5A 2A94A 3L77A 1L1FA 3CINA 3DXFA 4AJKA 4J0FA 3GAZA 3OJOA 3X2FA 3BMNB 4XIJA 4M8SA 4FOOA 1EUCA 3R3JA 4IDBA 3MZ0A 2CVQA 3D5TA 3PJEA 1CQJA 3DBLB 3TZKA 4LN1A 5L4LA 4AJIA 4LSMA 4YCAA 1Y9AA 3TJRA 4RJTA 3WQQA 3QVWA 1L7EA 1Q0HA 5A9TA 3ZV6A 4RQUA 3V1YA 3PEFA 2I66A 3E03A 4II3A 4OHUA 3ZWXA 4I08A 4A26A 4YR9A 4Q9NA 3ZU4A 4E2ZA 5JDCC 5A9SB 1EVIA 5CDUA 4RZIA 5KIAA 4MOWA 3F5SA 1SEVA 4EJ0A 2DPGA 2NU9A 2QYTA 1TLTA 2W8ZA 4L9RA 4E3ZA 2BRUA 3GF4A 4EJMA 1DIRA 5AOVA 2WE7A 1H6BA 1PGOA 2PWZA 4ZGWA 5EJ2A 4BNVA 1YH3A 2X8LA 1VRWA 4G2NA 3AUTA 4RLHA 3PVZA 5JXWA 4JLWA 4JP3A 1WP4A 1Y5RA 1KVTA 2X58A 3PHLA 2QZZA 3E82A 1EVZA 4Q3BA 1LI4A 2Y66A 2DFVA 4GVLA 2H6EA 3ZNOA 3RIHA 5JYDA 2GSDA 4E2YA 1TB4A 4Q39A 4Z9XA 1RKXA 4FC6A 4PLPA 2R2GA 3DZGA 2DBRA 2PA3A 3UVEA 1M6WA 1T25A 3VPFA 4LW8A 4BO1A 1UXIA 1GDHA 2DU8A 4K9DA 1NFFA 3Q0EA 4AVYA 1KY5A 4EYEA 2D1YA 1H2BA 2O7QA 2V65A 4QT0A 4BO0A 2UUOA 4GX2A 1NR1A 4NG5A 1UP4A 2PH5A 5DT9A 3NDIA 4ZRMA 2YV3A 3GDOA 4B7CA 1P1RA 4Y6PA 3K73O 5KJFA 2AE1A 4IJVA 1BXGB 3BHIA 1IY8A 3HDYA 1LRLA 1E7MA 1NVMB 4DIOA 4YT2A 3R6DA 1MV8A 1YXMA 3BHMA 1F8FA 1ONPA 2YV1A 3I1JA 1E1LA 2ZTVA 3ZHBA 1LDYA 4NU6A 3PP8A 4QO8A 4J7CA 4GX0A 3PGXA 1HEUA 3W4JA 1VJTA 2RH4A 5G0SA 3I52A 4O0LA 4RPJA 3LQFA 2OGUA 2ZCVA 2YDYA 3AM3A 4PIVA 4IPTA 4WCFC 1BWSA 1E7SA 4RF4A 1WPQA 2I99A 4HFNA 1NTOA 4BGUA 4BNJA 2BGMA 3FN4A 3H6KA 2IZZA 3JQFA 3AU8A 4J91A 4II2A 5EQFA 4XYEA 1F06A 4I5FA 1UP7A 3D5QA 4IS2A 2O50A 3GNSA 2P9EA 2VRCD 5AYVA 4MP8A 3RI3A 5EESA 3MOIA 1ZSVA 2CVZA 1PS8A 3FTNA 4A7PA 3VTFA 4OOEA 1GYRA 1QR6A 3I6IA 5EINA 4WNCA 3IJPA 2XAAA 4WLUA 3ICPA 3WOHA 4XYLA 1JAYA 3KO8A 3KTDA 1LEHA 2JHGA 3ADPA 3MEQA 1XCBA 1OC2A 2VTDA 2YQ5A 2YHUA 5ITWA 3LT2A 4GPD1 4NMHA 4AG3A 1UDAA 2VWQA 3PLRA 1ENOA 3HUDA 4KQWA 4IJKA 2CDBA 3VPXA 4CODB 3DHEA 4DPMA 1H5QA 3PJFA 4MJLA 3IQDB 2DT5A 4PLFA 1ZKMA 1GUZA 4R16A 1AUPA 4DIBA 1YL6A 1F0YA 4XDZA 1DDOA 1T1RA 4UVHA 4HKTA 4P4GA 2ZQZA 1LC0A 5T8KC 4O63O 4IM7A 2NU6A 3U62A 1DJQA 3O9ZA 3WGYA 1CDOA 4D3DA 3ORFA 3D4PA 4G65A 4YB8A 5MGBA 5KWEA 2EGHA 4BKPA 1DFGA 4DQXA 3OEYA 3EUWA 4JJIA 1I2ZA 1A5ZA 1XWFA 2R00A 4JBGA 2IEDA 4FQ8A 5H82A 3GRPA 4R1SA 3WGIA 5A05A 1IPEA 3NGXA 5B1YA 3CIFA 4ITUA 2SCUA 3IDSA 1N7GA 3LC7O 4NI5A 4AJHA 3ZW9A 1CIVA 1TXGA 3WGTA 3MWEB 4OMUA 1LSOA 3U09A 4RPHA 3WTCA 3GHHA 3WFIA 3CZRA 4CLEA 5U1PA 2GN9A 1DSSG 2HCTA 1LXCA 2I65A 2TMGA 2FMUA 1I2CA 4HADA 3EDMA 4ND2A 5ES3A 1I5RA 3OA0A 2BFPA 3RQSA 2A9FA 3LSYA 1EQUA 4D46A 1WMBA 3HB5X 2HK9A 3WIEA 4DQUA 4D0RA 5CPFA 3HWRA 3KETA 3DOOA 3DZHA 2AE2A 4YT5A 3AUSA 3VZSA 1ZH8A 3BMCB 1PZHA 4ZQGA 1JQBA 1ORRA 1K5HA 5TJHA 1N9GB 1PL7A 1EZ4A 3H2ZA 1LLUA 2PNFA 5L53A 1E1KA 1GEEA 4MVJP 1Q7BA 4GKBA 5IN4A 3C3XA 3V5NA 1LSUA 5T8KA 3RKUA 1ZK4A 3QVXA 3V1UA 4Z0HO 1T2CA 1NWHA 2E48A 2FZWA 1PGQA 3TWOA 1QORA 2DUWA 3TZQA 4BQRA 4BB6A 4RO0A 5ILOA 1HLDA 4FFNA 4AJNA 3F5QA 2X4GA 2OORA 3Q9UA 4WPGA 2J3JA 4J3FA 4XR9A 2VYVA 3JD1A 2B36A 1BTOA 1YL5A 3K8ZA 1NAHA 1TEHA 4E5NA 1QP8A 3DFUA 1RWBA 4CR7A 1UXGA 1GQYA 1BW9A 3ZCXA 1U3TA 3PYMA 1E6EA 1WMAA 5KVVA 2YFHA 1T2EA 3MTGA 2P4QA 2FP4A 2PV7A 3DMTC 1R4NA 2C2XA 4HFMA 4I9HA 4ID9A 4E12A 1M67A 2F1KA 4BGEA 3ZDFA 3FWZA 1D8AA 4FJ1A 5JCJA 4CLRB 5FWNA 1EE9A 1V0JA 4YQZA 3ZWAA 4D7AA 4B4OA 1DLJA 5C7LO 1O8CA 4CLOB 3C1AA 2GN4A 4CM7A 1LTHR 5BSGA 3TZCA 3NV9A 2JFHA 3EVNA 1XELA 4XYMA 3NT2A 4FD3A 3CH6A 1U3WA 3HE3A 4WCFA 3WS7A 2Y1FA 4Z3KA 1U2DA 2PKQO 1EE2A 3FNFA 4WUVA 3IJRA 5CDYA 3L6EA 3ZU2A 6ADHA 2D4AA 4K28A 1O89A 3AK4A 4EUFA 1R12A 3JQ9C 2HRZA 1IZ9A 4JBHA 1VJ1A 1MLDA 4W6ZA 1FK8A 4CMGA 3Q11A 3FI9A 3U4DA 4S3MA 2OZPA 2JD1A 2EJVA 3ETEA 1TVEA 1Y9EA 4JGBA 1T24A 1RM0A 2CY0A 1HDZA 2H9IA 3I9MA 3PWZA 3SJ7A 4OJNA 3KUXA 4WECA 4FOSA 5DN9A 1RYDA 1C1XB 3VOSA 2DUUA 3LYLA 4WE3A 2E4AA 4HFJA 4UEOA 1I8TA 4Y98A 4Z9YA 5AXAA 4CV3A 4XB2A 3H5NA 4CM4A 3PWKA 1DOHA 1J49A 1Y5MA 4NH4A 1XHLA 4AJ4A 4D3SA 1ML3A 2JJYA 3WBFA 3FD8A 2B5WA 4RZHA 2C5EA 3ZU3A 5T5QA 3PTZA 2LDXA 1Y1PA 1NX6A 1VJ0A 1PJ4A 3OIFA 4PG6A 2IODA 2NNLD 2VHWA 4QECA 4Z9FA 3WYBA 1XA0A 1LDNA 2PFGA 4IZIA 2NLOA 1VL8A 3N74A 2AG8A 5AQ1A 1HT0A 2O2SA 5HM8A 1IL0A 2O7SA 1ZUD1 3ITDA 5KNLA 2OFPA 4WLNA 4H3VA 5BNTA 2EKQA 1CYDA 1FJHA 4RL6A 3UCEA 4YJDA 1VKNA 3JTMA 1IULA 2BI8A 3O8QA 2G5CA 3DONA 4IDGA 5JCJD 5JY1A 1CWUA 1KYQA 3BMQA 4DC1A 3FBGA 4CMCA 1DPGA 1FMCA 3AOGA 1EDZA 2O2YA 3QVTA 3H5RA 5T67A 3ZNNA 3AI3A 5HRUA 3FCOA 3KXDA 3AJRA 2CSUA 4XEHA 5A9SA 4IZHA 2HMUA 4J4HA 4WOKA 4BNWA 1AHHA 3HFSA 3E18A 4M49A 3ZV4A 1JWBB 3H5AA 3WLEA 3ONEA 1ADFA 2XOXA 1P3DA 4RVGA 3NX4A 2PTGA 1B3RA 1LDEA 5G2OA 4HX5A 3AM5A 2HJRA 3NYWA 3DZIA 3VTZA 1LU9A 3IP3A 3PPIA 4U5QA 4CMKA 5L7WA 3W8FA 3BMNA 2DTEA 3CTMA 4CLXA 1B14A 5CPBA 5IG2A 3NJ4A 4XJSA 4I5GA 3INGA 1WAMA 3HB4X 4QXMA 4WLVA 1NP3A 4OM8A 1U8XX 3I23A 3ABIA 1YJ8A 1Z82A 1JAXA 3Q3CA 3ZWCA 1ZMTA 1CETA 2JHFA 3G3EA 3OJLA 5BT9A 1GL3A 1DXYA 1YB1A 1S7CA 3JQAD 4YAKA 2I6TA 1U3UA 4BNUA 2CMDA 3GK3A 2VOEA 1GV0A 4KP7A 1JU9A 3QHAA 1Q2XA 4ALIA 2Q4EA 3H9QA 3GC6A 3GDGA 1P31A 4JJGA 1HDXA 3DBHB 3PXXA 2HSDA 1CRWG 5L4NA 1HXHA 5JC8A 2Y99A 1LJ8A 2BELA 1U4SA 1V3TA 4KWHA 1H0KA 3OA2A 1RM3A 1NVTA 1U2GA 3JYLA 4K26A 3SXPA 3AOEC 4J9VA 1WXDA 5KKCA 3RU7A 2B4QA 3JQCA 1LLQA 3RFVA 4XWYA 4CMEA 3RUFA 3DQPA 2GUGA 3DBLA 2J8ZA 2VT3A 2UVDA 3L4BA 5JYFA 2AEMA 5I7VA 1HYGA 3GGPA 4UAGA 2OUIA 3FBTA 3JQGB 3D64A 3BXXA 4LISA 5GMOA 3RFXA 5JW6A 4GLLA 5DP1A 4N54A 4GKVA 1MFPA 1ONOA 3PFWO 4R9RA 1X1EA 1YBVA 3WR5A 5ITVA 2GZ1A 3JQ8B 3GLQA 3R3SA 3ZWNA 4CR6A 2X0NA 2IEBA 3GN2A 1ISGA 2NWQA 1JWAB 4XZ3A 1R6DA 1ZZEA 2JAPA 4R51A 1B0AA 1SB9A 1D4FA 2LDBA 4UVIA 4FW8A 3ON5A 3IC5A 1EVYA 5BNFA 4E4YA 1LLCA 1X1TA 1Q0QA 3S2FA 1DFHA 4WCFB 1KEPA 1R4MA 1V3VA 3ZWMA 3C24A 1Y7TA 1FF9A 1O0SA 4EZBA 4JBIA 3HADA 1U5CA 2P68A 1FDVA 3AWDA 3OIGA 1E77A 2AEJA 3QQPA 4B3HA 4U8GA 4EBFA 1ZO8A 5CFZA 2WD8A 3NJ8A 3L6DA 3QRWA 2XXJA 1ISFA 2VHVA 2X0IA 1B8VA 4J0EA 2Y1CA 3AY3A 3TN7A 2X1HA 1HSZA 3KSZO 3DO5A 4CMJA 2WM3A 1Z45A 2JCYA 4Q3DA 3F9IA 2V6BA 3FSRA 1PJTA 4XJTA 5L51A 1VLLA 4BNYA 4DL9A 5FF9A 3AUUA 4B7UA 1GZ6A 1LRJA 1N7HA 4R69A 4BV8A 4Z6KA 1A71A 4CM1A 3O03A 3U4IA 1BW9B 4IMRA 2DLDA 3HSKA 1KY4A 3M2PA 5JDIA 3L4SO 3EYWA 1Z7EA 4PZDA 1E3WA 3NRCA 2NVBA 2Y1EA 3OBBA 3B1FA 3K30A 4UEJA 5TS3A 3RROA 1E7QA 4CPDA 3FF4A 2H5LA 4XA8A 4IMPA 2FSSA 2EW2A 2IRWA 1FDSA 1IUKA 1PL8A 2C0CA 4AJ1A 1XU9A 1MA0A 2Q99A 3CZMA 3LDHA 4ZQBA 1VL6A 4QFDA 1V35A 3H9EO 1WZIA 3P2OA 2AMFA 1EMDA 3D1LA 3CKYA 1ENYA 4BV9A 2OMEA 3WFJA 1I33A 4ZU3A 1BDBA 2HO5A 1WW8A 1HETA 1E6UA 3ZI0A 1IOLA 1NNUA 5G4LA 3EZLA 2OBNA 2NQ8A 1Z73A 1MC4A 1NBOA 5CHEA 4YXFA 4IXTA 3KLPX 4CM9D 1PJQA 3ZNQA 4PVDA 1UDCA 5CAEA 5CP8A 2PGLA 3ROQA 4FSHA 3NAQA 1ZNQO 3JQDA 5F5LA 1KETA 3I83A 3CPSA 1T2DA 4XB1A 1LNQA 4XYGA 4YAEA 3EK2A 4BNZA 2Z1NA 5JAQA 1O94A 1NVGA 4MPDA 4LVUA 4F3YA 1N92A 3G1UA 4BNTA 4YRBA 3QVSA 2QYSA 2PZKA 5L40A 3O8QB 4YTEA 1XQ1A 4MINA 2OXIA 1N5DA 1ADBA 4ALNA 1ISHA 4BNNA 4WLFA 8LDHA 3FNHA 2GN8A 2I3AA 1PSDA 1HSOA 1LQTA 3AY7A 4JJFA 4KQXA 1MB4A 4KDFA 3GDFA 5TX7A 4R1NA 1B26A 4BNHA 4HWKA 4Z0PA 1N9GA 1EBFA 2B69A 3MCVA 4YQYA 3UXYA 3MOGA 3GEMA 4OXNA 1P9LA 3GGGA 3ZHZA 2UYYA 2PKRA 2AXQA 1P0CA 1Q1NA 1RJWA 4NPCA 5JY6A 1HYEA 1RM4A 4MIYA 4MKZA 4B4WA 1I3NA 1XLTA 2OHXA 1E3JA 3KOUA 1OOEA 2GRAA 2O4UX 5A02A 2Q22A 4J2OA 3JQGA 2X9NA 4IDFA 1VSVA 3OJ0A 3RUDA 4KMSA 4O1MA 1HL3A 1M2WA 3S2EA 4E32A 4CM6A 1B16A 4RF5A 5BSHA 4PLGA 4AJPA 2NQTA 2ZJ0A 2PGJA 4GLOA 4F46A 4FFRA 2H1SA 2W2LD 1YB4A 1PQUA 1HDRA 3PHJA 3SC6A 7MDHA 2CVOA 1ZXBA 1HKUA 1P74A 2E49A 4W7HA 1E1MA 4UUOA 1C14A 1V8BA 4EW6A 3KSDO 2GPTA 1A4IA 1DHTA 4E5PA 2Y0DA 5FYDA 3W6ZA 2HMWA 4TSKA 3GEGA 3PZBA 1XYGA 4BKQA 3VPGA 5IDWA 1SOWA 3WSVA 1I32A 3F4BA 5TT0A 3RC9A 1YOVA 3FWNA 2VT2A 4WKGA 1B7GO 3ZHYA 1HZZA 3JQ7B 1UZNA 2DFDA 3BHJA 3UN1A 4CQMA 1YQGA 2BI7A 2ZATA 5IDQA 1UXJA 1U3VA 5CEEA 3B1KA 3DBVO 3RBXA 3UAGA 3WTBA 4CMHA 5B4UA 3NT5A 3WYCA 1UUFA 4ALJA 1ULSA 1X7GA 1K0UA 1YBAA 1F12A 4IDCA 4U6QA 3PJGA 3OJEA 1QYXA 1ENPA 4GGOA 3OSUA 4N18A 3FPCA 2C29D 2DPHA 3JD0A 4KDEA 4QUKA 2Q1TA 4LVCA 5A9RA 5G4KA 4KUHA 1ZK3A 3B20A 4Y6RA 4K6CA 3IUPA 3RUAA 2XF8A 3LZ6A 1QLJA 4OGWA 1PZGA 2GF2A 3H8VA 3AFMA 7ADHA 2VZ9A 4A03A 1H94A 2JD0A 3PQEA 5ICSA 5I8WA 4INAA 4LRSB 3F3SA 3T7CA 1B15A 3VVCA 4DA9A 4W7IA 5IJZA 1EUDA 1E3EA 5JDIC 3ITKA 2GZ2A 2P9CA 4BMNA 1LA2A 3GT0A 4AL4A 5FFFA 2IDZA 5MDHA 3ZW8A 4IQ0A 4UVEA 4E6PA 4ND1A 4C4OA 4ND4A 3TSCA 5KJCA 3BTSA 3R0IA 2B4TO 5I7EA 2CUKA 5JE8A 2DC1A 3RC2A 2G76A 5I9LA 1GV1A 3UW3A 3KVOA 3RWBA 4DVJA 2HAEA 5A3VA 2ZIZA 5KOIA 2QRKA 3OJFA 4W82A 1HWYA 3JQFC 3RUCA 4CM8A 1TT5B 1W4ZA 3H9GA 5CEJA 3WGZA 1OFGA 1GAEO 4QSMA 5TSDA 1ZFNA 1MG0A 2EEZA 2ZKLA 2EXXA 2PZJA 1GY8A 5T64A 3RKRA 3OHSX 2VZ8A 5L7YA 5TF4A 4D45A 2D59A 1YGYA 3AUAA 3FR7A 3TZHA 2BH9A 1P1KA 4GMGA 2UAGA 4YAIA 1XQ6A 3KBOA 2BFMA 4IDAA 4FJ2A 1KVRA 2OOSA 5CDSA 3KRTA 3EZYA 5A5EA 5C7OO 4JN6B 3TRIA 4OYRA 1T2AA 4LCEA 1GYQA 1G6KA 4PRKA 3NUGA 2HMTA 1LUAA 3PZRA 2WD7A 4I5EA 5IZ4A 1QLHA 1P1HA 4AJLA 1L7DA 4IJWA 5L45A 4E5KA 4J9UE 4XGKA 1PJ2A 3TFOA 1LQUA 3UOGA 2NUAA 3L0DA 2D0IA 2OBYA 2FY8A 4IDDA 1NASA 4R1UA 1PL6A 1GEGA 3GZNA 4LRTB 2BD0A 3AI2A 3L4BC 3VZRA 4YPOA 1GD1O 2QW8A 1SZJG 3GN1A 4MIEA 4B8ZA 4OSPA 5GZ6A 3RU9A 4DMMA 3QY9A 5COBA 1Z7BA 2GASA 4NJMA 1WVGA 1H6AA 3RUHA 3LK7A 2B0JA 5JNLA 4R5MA 3M1AA 3C7DB 4I5DA 1KOLA 4RPLA 2CNBA 4U6SA 4GI2A 1VKOA 2ZB8A 3SVTA 2J5RA 1O95A 4FR5A 4ALKA 1C1XA 4J6FA 3UCFA 3ANLA 3PWSA 2JD2A 1PGPA 2E82A 5H81A 4UUNA 2DBVO 3RJ5A 2CZCA 4OH1A 2CDCA 3GPIA 1RM5A 1VPDA 4J1TA 2GCGA 3AFNA 3QE3A 4FC7A 2W2LA 4BO3A 4HV4A 1M76A 4IQGA 4TRMA 5TLSA 4L76A 3GRKA 4BO6A 1XKQA 1VC2A 4J1SA 2P4HX 4RVSA 4MVJM 4TROA 5ILGA 4DLLA 2C20A 3VDQA 1BXGA 4NFHA 1SC6A 3L6OO 4X54A 5F1PA 4CV0A 2EW8A 1UAYA 2RHRA 3PGJA 1T4DA 3W1VA 3RC7A 5JFOA 2DM6A 1SOVA 3N58A 4G5HA 3A1NA 4U0KA 3WWYA 2IYPA 1JVSA 1LBEA 3DC2A 1E7YA 3KYDA 1P33A 4E2XA 5L95A 5G0TA 3GVXA 1GPJA 1Z6ZA 4OAQA 5LC1A 1EQ2A 3WBBA 5HWSA 5IDYA 1UZLA 4D44A 2GLXA 2UV8A 5DULA 3LVFO 4HNHA 3HN2A 1W0CA 4GSKA 1GFSA 1NHGA 4IIVA 3PRJA 4NBTA 3RSHA 3DMTA 4TWRA 1GQ2A 4BVAA 1FDWA 3GUYA 4M89A 3GVCA 2VNSA 5JAIA 2VQ3A 1DB3A 3PHHA 3GH3A 3A06A 3FPLA 3U4CA 2FR0A 3EW7A 1ZCJA 4RGBA 2VHYA 1GUFA 1ARZA 1PJLA 4BNKA 3H3FA 2EIHA 2JCXA 5AVOA 4O5OA 1BDMA 1C0KA 1G1AA 2BF7A 4G81A 4P4NA 3U0BA 1HE2A 3OF2A 1U5AA 1ID1A 1ZXLA 3KZVA 5GZ1A 4QQRA 2YDXA 3PHGA 1AE1A 2DBZA 1I30A 2VHXA 1AN9A 1LDMA 3V2UA 1XDWA 4OSOA 3HDQA 3FHLA 3DBRA 4LMPA 2Q1SA 4D42A 1PZEA 4NK4A 4R3NA 4CMIB 2IXBA 2O3RA 5T6BA 1Y8RB 4PG5A 1BMDA 4I9UA 4M1QA 1E5LA 4CJXA 4DQVA 3SEFA 5J23A 2NSDA 1PR3A 1BVUA 3TQHA 3LC1O 2HJSA 1GR0A 1KVQA 3ADOA 3QVOA 1JLLA 3RFTA 3PIIA 2X0JA 4ZD6A 1LSJA 3PQFA 2NTJA 4Y8VA 2BFOA 5TGDA 3GR6A 4DYDA 3WDSA 4EDFA 5U9CA 3WMXA 3DR3A 2J5KA 4CL3A 2EG9A 1E6WA 2HUNA 2G82A 4UEKA 4YAGA 4S1VA 1RYEA 1FDTA 4JP2A 4B7XA 4PG8A 4B3IA 4O59O 3RUEA 1OI7A 4M87A 3N7UA 2J6IA 3GHYA 3KB6A 3BMOA 1NQOA 3JYQA 4ESOA 4E0BA 5KJ6A 3P5SA 2CDAA 4IBOA 1DRWA 4NHEA 5HTOA 2VYND 1NHWA 2O3UA 3B6ZA 2AQKA 4URFA 4KTTE 4JXKA 3GVPA 3L9WA 4UREA 1R0SA 3D3WA 2O23A 1ISIA 4NR0A 2VHZA 1ZEJA 2YUTA 2ZQYA 1DBVO 2ZTUA 3JQ6A 4I1IA 3DBRB 4PLVA 4TZKA 1V6AA 3T4EA 3VC7A 3ZWBA 1A9ZA 3U49A 4YACA 3MJEA 2NVUA 3Q9NA 4EEZA 3JCZA 1PZFA 1XGKA 2CF5A 3P19A 3TOXA 2X7HA 5IXSA 2I76A 4OIMA 3KSUA 2C54A 3AOEA 4PZCA 4WGGA 3STHA 5DF1A 3UCXA 1YDEA 1YL7A 3E9MA 1IHYA 1VL0A 1GCUA 4YJHB 4TRNA 4XQGA 1DC4A 1JN0A 1LRKA 4FDAA 1OC4A 1UZMA 3FNEA 4PLYA 3OICA 1KEUA 1MG5A 1K3TA 4A5OA 2ZTMA 4C7KA 4WASA 3ST7A 4CV2A 1YQDA 3VH1A 3QWAA 1BSVA 1T26A 4JCOA 1TT7A 2Y0CA 3HDJA 2EJWA 1AXEA 2J3HA 1NQTA 4XQCA 2EF1A 1U1IA 3VH2A 5IZCA 1SAYA 4OXYA 3ONFA 4U7WA 1T1SA 1X7HA 3D3EA 1PWZA 4B4VA 3ZV5A 4B4UA 3P7MA 3IS3A 2GNAA 1NXQA 1R15A 4PRLA 1H2HA 4Q3AA 2DTXA 5JYAA 5IF3A 4RV9A 4PG4A 4B8WA 3U3XA 4BNMA 5BSEA 1PIWA 3IUSA 3DOCA 3JSAA 3S8MA 5A3JA 4BO5A 5B12A 4YEDA 4GMFA 5B37A 3OETA 1P44A 2NM0A 2PKQP 4K1LA 5JLAA 2BGKA 2ZYGA 4CUJA 3GG2A 4M86A 2GZ3A 4DYVA 3IKTA 3PYXA 3DAFA 4LCJA 4NJOA 4WJZA 3U5TA 3QV1A 2WSBA 1EFKA 2EGGA 3E5RA 4RLSA 2NVWA 4RPKA 3F1LA 4M55A 3ULKA 3H9UA 3Q2KA 5DNAA 4TZTA 1YE3A 4ZVVA 1MXHA 3KYCB 4F6CA 1NR7A 3EY4A 3JQEA 4KUGA 1CERA 4M54A 4KTVE 1NQAO 1E0DA 4FN4A 4FPXA 1NAIA 3G49A 4FGSA 2HK7A 3BTUA 3BIOA 4F6LA 3PK0A 1M75A 3K96A 4Y67A 1EK5A 4W9NC 5KVSA 1BVRA 4E31A 3WGQA 3UICA 2P5YA 3O26A 2ZCUA 3VAZA 3VH3A 4J1NA 3WQRA 1DAOA 4RVHA 4MO2A 4CM4B 1O6ZA 2ZJ1A 1DEHA 3UUWA 1F14A 3GFGA 2O3QA 3UKOA 2FWMX 3GVHA 1E7WA 1SB8A 3AW9A 3KYBA 3CXRA 3WSWA 1YDWA 1U4OA 1MFZA 3S2GA 2HK8A 3GVIA 5TIIA 1QMGA 2WYVA 1Q7CA 2Z5LA 4E30A 3C7AA 2HU2A 4EUHA 1H6CA 5EN4A 4U0JA 4ZJUA 3WB9A 2PD3A 1PR9A 4XQEA 3SJUA 1UJMA 2AA3A 3GFBA 2PK3A 4J4BA 3I9OA 1A7AA 3DB2A 4PGFA 4DMLA 3W4KA 4NZ9A 1DIGA 3DHNA 3QWFA 3ASUA 1ONNA 4N5MA 2WWRA 4CLHA 5K6AA 4GAEA 3MTJA 4RDHA 5IXYA 2VRBA 4HP8A 3ZWOA 3HQ4O 1UP6A 2WE8A 3EC7A 1EDOA 2TMDA 2YHIA 3HN7A 5JO9A 3RUIA 4HBGA 3ZWVA 3MWDB 1VSUA 4BNFA 5DZSA 1C1DA 2I9PA 3C1OA 4BQPA 2HMVA 3K31A 5AXDA 1QG6A 4DTIA 4BHTA 1R4NB 5F1KA 3IIEA 2BMAA 2X6TA 4MVJD 1NPDA 2NU7A 4PLHA 1WZEA 2YQ4A 2R00C 2QZ9A 4H7PA 4BO9A 1EFLA 4MVJE 3BTVA 4PN3A 1DRUA 2D3TA 3PI7A 2DKNA 1J5PA 4KUEA 3V1TC 1IHXA 4BOYA 1XR3A 3F6YA 2Y67A 1DIBA 1PJCA 4XD2A 1DFIA 3D7LA 5TNXA 1WDKA 4DRYA 2FZEA 1P1IA 2VOJA 3F46A 5HS4A 1PJ3A 4BKUA 1JW9B 3E48A 2YFQA 2Y68A 4GVXA 1ZJYA 1O5IA 4QFCA 2ILTA 4IINA 5THQA 4W4TA 1Y81A 3ETDA 2E6UX 5HBRA 4BB5A 4CMEC 3BTOA 5EQDA 3QWHA 3Q6IA 1BG6A 1GPDG 5JO0A 4IJUA 5K6AC 2GYYA 3OMLA 4RF2A 3RVDA 1MC5A 3COSA 5IZCC 4CQLA 2E37A 3FTPA 3KYCA 1TT5A 4HFRA 1A4UA 2NACA 3JYNA 1ZBQA 3A4VA 4NBVA 5ER9A 2V6FA 1GCOA 1LDBA 3I4CA 2B35A 3JQ7A 1V3UA 4FJ0A 3C8MA 1HTBA 2Y1GA 2P91A 2C7GA 3G1TA 4OXKA 1UXHA 4Z3DA 4P8RA 4CUZA 3IMFA 4ONEA 4ALMA 1B3BA 3TL2A 4PLWA 5DBIA 4YT4A 2G0TA 2FRDA 4IXWA 4F45A 1VE9A 4GSLA 1ZVMA 1B2LA 3SBOA 2BFAA 1LC3A 1KEVA 1J4AA 1T4BA 1AHIA 1JKIA 1ZK2A 3HZZA 3RASA 3I4FA 2PD4A 4FFLA 3RBZA 3VKUA 3A9WA 4J7UA 1K6XA 3ZNPA 4GX5A 1ENZA 1EUZA 1EBUA 4KWIA 3MJCA 4GWKA 1NFRA 4JX8A 4PFJA 4J90A 1TI7A 4ND3A 1MGOA 5A04A 2G1UA 3JQAB 5DOZA 2IXAA 1WDMA 1I3LA 4I9NA 4RVDA 5JSFA 4TVOA 4L74A 1I01A 1LLDA 3T7EA 4DBZA 2HDHA 1PS9A 3JV7A 1QXSA 2X0RA 1J6UA 4YJHA 1U8FO 1UAGA 2FR1A 3WLFA 5ADHA 4WCDA 3WICA 4N5LA 1N8KA 4GWGA 1QV7A 1B8UA 2C82A 3BAZA 3TOZA 4UULA 2VUTA 1P0FA 5HA5A 2EWMA 5COAA 1WWKA 4YJFA 3ICCA 1NPTO 4CM8B 1BGVA 1U7HA 2HQ1A 1R0KA 1XSEA 1SPXA 3VZQA 5DCYA 2A4KA 3WIDA 1K6IA 3WQSB 5G0VA 3VZPA 1PX0A 3INTA 3PLNA 4E21A 1LX6A 3F4LA 1R4MB 2XPCA 1YO6A 4C7JA 5ENVA 3G17A 3A28A 4A2CA 4LSWA 2WYUA 3O4RA 4P4LA 3I9NA 4NIMA 2V7PA 2WDZA 1IZ0A 2Q3EA 4YA6A 2HMSA 4WOJA 3QLJA 2Q4BA 4L8VA 3A14A 4TMFA 3S2IA 3JQBC 3K5PA 2Q1WA 4ROSA 1PQWA 2B83A 3DOJA 3W8DA 1HE5A 2VRCA 2EV9A 3U4HA 5KCZA 3C7CB 3U9LA 1EVJA 2PR2A 1Y8QA 3ZGYA 4YWJA 3TF5A 2BKAA 2WYWA 1H9BA 4XDYA 4BUCA 4E2WA 4TRRA 3RAJA 4R4JA 4NK5A 3G0OA 5EPOA 5C3MA 5JCXA 2PZMA 9LDBA 4EGFA 3ZHXA 4CR8A 4J1QA 4R68A 3RJ9A 2JAHA 4BO7A 4MVJA 3CE6A 4BKRA 2A35A 1Y8RA 1DC6A 3UFXA 4B3JA 1KVUA 1TA4A 3P2YA 2B4RO 4AJOA 4ALLA 3LT4A 3R1IA 2HLPA 1QKIA 4UUPA 1I2BA 4A27A 4RVUA 3DWFA 5U4QA 2QX7A 1PU2A 3UH1A 4BNXA 3MJTA 3QWBA 3HNPA 4J2HA 5T73A 2P9GA 2AHRA 3GUCA 3IAHA 2ZTLA 5JC1A 3MJ4A 2C7VA 5ER6A 5BQFA 3KYDB 2HRBA 2NADA 1YRLA 4KOAA 1IPFA 2A92A 2W4QA 4BIIA 3LT1A 1ZSNA 1OMOA 5J9GA 3PDJA 1BXKA 1T2FA 5G0WA 3H4VA 4L4SA 1S6YA 2YJZA 2X9VA 1HE3A 5JMWA 1C0LA 4HXYA 2JL1A 2PLAA 3HFGA 1ZW1A 3EMKA 4P22A 3QIVA 1I36A 2EKPA 1UH5A 1DIAA 5KJ1A 5JAMA 3Q2IA 2YHIB 2W98A 5JMPA 2VYVD 3BYZA 3I9KA 4GH5A 2POQX 4TRJA 3L07A 3LLVA 5I7SA 2QRJA 4R01A 4J7XA 4R5HA 4EJ6A 2X5OA 3L9XA 3GZ4A 4DXHA 5G0UA 4JK3A 5I8ZA 4NDNE 1D7OA 4ND5A 1YJQA 1I0ZA 4L0QA 4CL8A 3ROKA 3E5MA 5F3RA 1D1SA 1NM5A 2FPPA 5IFLA 4GL4A 3B1JA 3RC1A 1CJCA 1G0NA 1K6JA 2FN7A 5KVCA 3TZ6A 2PGDA 1GUYA 3VHRA 3TNLA 3GNTA 1JKJA 1X13A 3D4NA 1BXZA 2VNAA 1PGNA 4OOFA 5A06A 1GADO 1ADCA 3LLSA 2Q45A 1ZIDA 3ASVA 1JDJA 3M2TA 4OKNA 4RQTA 2EERA 4CQMD 3WMWA 3H3JA 3WGHA 2D2IA 1HLPA 3OECA 4NFYA 1K2WA 4ZRNA 2X86A 3BMOB 1J0XO 3WXBA 4J4TA 4PLTA 3ANMA 3ZV3A 5L7TA 1KEWA 2O4CA 1GZ4A 1YQXA 1SNYA 2W2KA 1E5QA 2F00A 1GTMA 5GZ3A 2I67A 4OO3A 3RBVA 5ENDA 4Y6SA 3ZWPA 1NPYA 4BS9A 4D0SA 3LC2O 2Y93A 2QIOA 3B70A 3W6UA 4H16A 2V6MA 4NBUA 1KVSA 2JFFA 1MUUA 1HE4A 3C1TA 2VCYA 4AJJA 4XGNA 3JYPA 3PIDA 4ZQHA 2RCYA 4IGFA 1F8GA 3PJDA 1A27A 3DL2A 2D5CA 2O3JA 3VVBA 2NTNA 1Q7GA 4Z0TA 4BNLA 4P38A 1MXFA 4PZEA 2Q2VA 3I9LA 4A73A 3E1KA 2Y0EA 4RVFA 4YRAA 4AJEA 2JFGA 5DOVA 2X23A 4LMRA 4DLAA 4OL9A 1PGJA 4Y9DA 3PDUA 2PZLA 4PCVA 1E7RA 2O3SA 3W8EA 2VWHA 1KIFA 1UR5A 4CQLB 4FBGA 4WLOA 3VKVA 4N5NA 3QWIA 5A4DA 3HJAA 3S1LA 1YBMA 4YAJA 5LDGA 1PQPA 1A7KA 2QRLA 4OQZA 2GO1A 5TJ9A 2OP1A 5L4SA 2EP7A 5CDGA 1HDOA 2BHLA 3OIDA 3OQ6A 4WK6A 1ZMOA 1QV6A 2D8AA 1VM6A 2I5PO 3QSGA 4YRDA 1JTVA 3NDJA 3EVTA 3WJ7A 4BGVA 5DBGA 3K9QO 2YZ7A 3ONDA 2J3IA 4WEQA 4UVDA 5DCWA 3BA1A 2Q50A 3WJAA 4UUMA 3GPDG 5I9NA 3HG7A 3Q1LA 3LF2A 4XX0A 5IN5A 3CMMA 5DCUA 1R66A 4RF3A 4XKJA 5A03A 4EUEA 2QQ5A 1ZSYA 3QW2A 1R0LA 3DMYA 3FNGA 3ZWWA 5F5NA 1ZJZA 4WLEA 2IZ1A 2ZYAA 1E3WB 1QYWA 2QG4A 3AM4A 5CEFA 1I3KA 2FSVA 4BGIA 4ZN6A 5JYEA 3DHYA 1DAPA 4J49A 2C5AA 4AJ2A 3D3WB 4CMAA 4LK3A 4CQMB 2VYNA 1IYZA 1ULUA 3DZBA 4XQ9A 2X9GA 1DJNA 4MVJH 1CEQA 2B37A 3K92A 2GR9A 1N2SA 1A9YA 3ZU5A 4PLCA 4AICA 5LDHA 1WNTA 1W6UA 2BLLA 1Y6JA 3H9JA 2UDPA 2DAPA 3IKVA 4IIUA 5C7IO 4HUJA 2OL4A 1KBZA 4I8XA 1MP0A 5A1TA 3UF0A 1HZJA 1HDYA 1C0IA 1UXKA 3DAGA 3D0OA 2JKVA 3IOYA 4YYZA 1DC3A 5JBIA 3KM0A 4FGWA 5K9ZA 4DPKA 3H65A 1AGNA 3KLMX 4FFPA 5A5FA 4R54A 1Z75A 1YOVB 3VPSA 1DHRA 4E5MA 4D3FA 1QYVA 1Y8QB 2IYOA 2ZB3A 1M66A 2Q2QA 1I24A 3ZN2A 2X5JO 2Y1DA 3E9QA 1O9BA 2WMDA 2Z1MA 2CD9A 1AXGA 3GAFA 4IS3A 4L4RA
chains in the Genus database with same CATH superfamily
1X92A 1J0CA 3MXOA 5G1OA 2I4TA 4MWDA 9LDTA 1HDCA 5JPIA 3F6CA 2XNDD 3NGLA 1L7PA 1YMVA 2WD7B 3B3JA 4FYYA 4Q9KA 2GEUA 4XPZA 2AJTA 1BE8A 3IP7A 1I10A 4DC0A 3D4OA 1U8CB 4HB0A 4JROA 5IWCA 3HRHA 3ZS9A 1GZ5A 3AR6A 4IXDA 4C3ZA 5EJ6A 1CCWA 2VFAA 3CU5A 4J0IA 2Q41A 4L02A 1AGXA 1KPIA 1TCCA 3TLKA 4GX1A 3KJIA 2CL6X 1U28A 2PY6A 4RIGA 4AJ9A 1OLSA 2VUSA 1J22A 2VPWA 3OX4A 1PEDA 4MWZA 4C78A 5EHGA 5HF8A 3O3NB 4ZPXA 2IYTA 5HCIA 3GAAA 4PYLA 2MSNA 3EIOA 6GPBA 3UK1A 5JD4A 2GD1O 1I79B 2WYIA 3ZE7A 4YVFA 4ZVSA 1JEYB 2WU0A 3QVJA 2W11A 1TL7C 4IY1A 4RFSB 1PLLA 1RRGA 3F6RA 4KODA 4XYBA 5E1MA 4ZKEA 3TTWA 3OTOB 1EUYA 3RYCB 1V6SA 2ZXUA 3I3OA 1XD2A 4DV0B 2VF2A 3DDNA 4D2IA 2RIRA 1C0PA 1P7WA 4E5UA 1DKMA 2FSPA 1ILWA 4CBVA 5BVGA 1DCTA 1PDWA 2ZS7A 2A9JA 2IW1A 2WHYA 4HWSA 4DJEC 4FIZA 3BKWA 3LUDA 4LRQA 1M6HA 2VR1A 1EXVA 1V7CA 2PYZA 1T0UA 3GA7A 4XCVA 2Z2YA 1ZUHA 4WSOA 3R8CA 1A0OA 3SHVA 3P9YA 3ZKWB 1W2WB 4O1IA 4HNGA 3X1MA 3IB6A 4U7GA 5JPCA 2Q6IA 3K2QA 2AMJA 3O0TA 3LDUA 2V59A 1MAHA 2AWOA 3B7PA 4AFNA 3I92A 1WUTA 3C3MA 4JLAA 1X15A 1K3FA 1RAHA 5IUNC 3BILA 2QS9A 3NHMA 1GU7A 4MPJA 3ECCA 3PNKA 3ADBA 4RKFA 3LT0A 3RS9A 2NTYC 2ERYA 4JKIA 2VPYA 4LF5B 2PSFA 4ZVNA 5CM8B 1XA3A 5CXSA 3MJDA 1RYFA 3HM9A 4I2NA 2LCIA 1QFXA 2C07A 3ASYA 3IEMA 5EP2A 1ULHA 3STWA 1QJCA 1TQ6A 1T3LA 1UZUA 3AFIA 3HL0A 1AM4D 4NV1A 3LYUA 3KWJA 4N7RA 2VWPA 1C3LA 1VHJA 2XDYA 2R6DA 2HHLA 3TAXA 2QRUA 2TECE 1T1GA 1IVNA 2V7QD 3HFJA 3NVAA 2HRQA 4FILA 3KV3O 4HY3A 1KMMA 4Y6GB 2VDWB 1VI2A 3M5PA 2IOFA 2V6IA 3VO8A 4C7BA 1WV1A 4EX6A 1PG2A 3ZGNA 5JMOA 4O6VA 4ZA2A 5IH3A 1JTFA 5AJZA 4BL5A 3R9WA 3V4FA 1SCBA 4EI2A 1T5HX 1ORTA 4UTNA 1KJWA 3HR4A 4CUKA 3H13A 1D0SA 4P0PB 3I64A 4R41A 4C2BA 1H2EA 3T9DA 4REMA 2FUG6 2YJ4A 3E6AA 3AU9A 3OQ1A 4JEIA 3WWEA 3GA0A 1RC1A 3WX0A 1ODFA 4P9NA 3RCBA 3HCPA 2H7VA 3GLGA 2NP7A 2R4UA 3R7LA 2FHSA 2ZPTX 4ZT4A 2BHTA 1YZHA 2YYYA 4LS3A 4WOCA 5CG1A 2EX1A 4BEJA 4WUTA 4B3CA 4UNIA 2DZDA 3ESCA 1OGIA 4CKBB 3IL2A 4YDRA 1WX1A 3GY0A 1H4VB 4GOJA 3CW2A 4PFKA 2JAOA 4B74A 4BO4A 2AQIA 2PPLA 3Q0TA 3ROMA 4HNTA 2Z5GA 4ZAVA 4PCLA 2UVQA 4BRUA 3NTRA 5J1SB 3T7DA 4WXMA 3WWZA 5EERA 2HKIA 3JQ8A 5AM0A 1E6KA 1HLGA 5K8TA 1JQAA 1RLIA 3KEQA 4N9WA 3EVDA 4YRZA 3AFHA 5DEIA 3C3DA 1ECCA 4AN1A 4YJGB 3ELDA 1J0AA 2FEMA 3A2NA 3KUCA 1SXJA 4NY1A 1A4RA 2H3HA 1P75A 4TYMA 5IWAB 3COJA 1P77A 4ENUA 3UMVA 1NBIA 1TYCA 3V4SA 4C04A 3LQ4A 1MO4A 1XDZA 4UHEA 3GRZA 3EGOA 4BZXA 4FE3A 1M1NA 4Z2AA 1SHZA 2GGSA 3NOOA 4ZQEA 4CLRA 5K8IA 1M5TA 2AW5A 2JGLA 2VP4A 1Q3TA 2WJPA 2N1MA 3EULA 3N8GA 4LOIA 3ZTTA 5FWNA 1E8NA 2SKEA 5DB4A 4A10A 3FTCA 1QPZA 1DUIA 3L2OB 3V2GA 1HF3A 3FJOA 2HIAA 4I1PA 2C4NA 1IEQA 1C30B 1QAQA 3FR8A 5E3JA 4F5EA 2P5UA 3OH8A 6Q21A 3PHIA 5KQLA 3VV3A 3JQBA 4TYQA 1U7UA 3IVXA 3F5MA 3SQLA 4CG2A 2WP8J 3N7AA 4YMVA 3NM5A 2VZ0A 4KH0A 2ZFUA 4YH1A 2LXNA 4ND8B 3A6FA 5EMHA 4B44A 2WZBA 5IJAA 3FYHA 1FTWA 4GBJA 3KHUA 2NV6A 1HMPA 4BJ6A 3AKEA 2VDMB 2R6CA 3L0ZA 2Q6OA 3COYA 4EEXA 4LHWA 3T1QA 4DMRA 4P3OA 3C8HA 2JC3A 4YRLA 1T15A 1UFOA 3H2SA 4JLPA 3LDAA 4D6XA 1QHFA 2OXRA 2R7LA 5THKA 1DRVA 2X1VA 3GEDA 4BRZA 5B1SA 2V7WA 4JV5B 1CB7A 4Q3EA 2ET6A 1CUCA 3F47A 5K99A 4P08A 4ZQFA 1KDTA 3LPDA 2V7BA 3O94A 1IBCA 4KQMA 5IASA 2B5VA 2Q2OA 3RG8A 3GOHA 3S70A 1QSGA 3UJPA 2R8XA 4UEQA 4LOHA 4FKZA 3VDRA 1SUCA 4OI2A 5AW8A 1PS0A 3IVMA 1CPYA 5AI0A 2V6GA 3M9WA 2FDRA 3ECAA 4JBWA 2R8EA 4G41A 1ZWKA 1J1ZA 1XJWA 2NYVA 5EJ8A 1CQIB 4Q1VA 4XGIA 5I7UA 4E15A 4QGAA 4KR7A 5EIOA 3OZUA 1X1CA 4A8JB 3C3PA 1VA5A 3H7AA 4X85A 1TVMA 1EGVB 3G79A 4KKVA 5FPYA 3RIGA 4CDMA 3SBXA 5HRAA 5K2MA 2DCMA 3BZWA 5F1OA 3OSZA 1JPVA 2Q2WA 3THRA 1T9KA 2VDQB 4PGHA 4RYDA 2DR2A 4ZIRB 2OCAA 2QT9A 3OCXA 3TDKA 3H2YA 2AMLA 3O90A 3FNBA 3LOQA 5EIBC 4MVJI 3EQ7A 3TPCA 4DM4A 2QNIA 3J7AC 3M8KA 1EXDA 4NF2A 5TQ0B 2C59A 4B7AA 4BY9E 1SXHA 2JAXA 3Q7IA 4LE1A 1HUQA 5DGCA 5CDTA 1IXSB 5KKAA 1JBQA 4NU5A 3TFQA 2G17A 4RLQA 1QK5A 1QIFA 4GYYA 3M4YA 3OG9A 3EBOA 4MUEA 3WJ1A 4YC7A 2ZRQA 3JALA 1A2KC 2GM3A 4Q15A 4YAFA 2OHHA 4YMWA 3IA7A 4LXIA 1JB9A 4FMCB 1RXIA 3DFZA 3OHMA 4R40A 3VC3A 4FDLA 4EEKA 1J8QA 3LW8A 1E5VA 3QA9A 3DTTA 3PD1A 4I8DA 1BH6A 2QVBA 3E8XA 2A9QA 2QW1A 3PFFA 4UMDA 4Y2QA 3PXAA 5HQTA 1X9IA 2QPTA 1K89A 3EN0A 3QBJA 3T4XA 1U5BA 4KXFB 2IZ5A 1J5EB 2JLVA 1WB6A 4Y1FA 4WFJA 2H5IA 4RU1A 3SC2A 1YS2X 3C4QA 4NJMB 3LY7A 1ZGGA 5BYJA 1D3AA 3ZY2A 2OCIA 3TW8B 4BMVA 4IIGA 4R8SA 1RI3A 2Q6TA 5EZQA 1H23A 4CIAA 2BKUA 4M0KA 1UAAA 1ADYA 3MQFA 4CM5A 5KX5F 4TN5A 4XRRA 1ULZA 1G59A 1OXXK 3WDLA 2O8DA 4ZRDA 2PFKA 4GL2A 4U2KA 1RRVA 3ANXA 1Q0LA 1J07A 4MP6A 1XG5A 3FYCA 1WQ3A 1KA9H 4HQLA 1EFRA 5ALHA 3EFHA 4MYTA 1N1GA 3GARA 3V6LA 1KS9A 5JT1A 2YJ6A 4QGBA 2GN6A 2ID7A 5EC8A 5DHRA 1T4CB 3LP6A 3NEPX 3V2HA 1MOSA 1QH0A 3H8JA 3UJCA 3W9SA 8ADHA 1X87A 4F11A 6LDHA 1OWLA 1W73A 3I9JA 3TN7A 1CSEE 5FBHA 3MG9A 4MP3A 4FCCA 1NVVQ 3FFAA 1EK6A 2YR0A 3KOWA 1J39A 3JD3A 4MVJG 2I78A 2P9QA 4IO0A 2WZDA 4I1RA 4B79A 3SLGA 3O8NA 3L7BA 4DDVA 2GZSA 4RTJA 3L7OA 3LPCA 4RETA 2I2BA 2BHSA 3ROPA 1RQNA 3T5CA 1SKAA 2YMPA 2Q1UA 4KR2A 2OV8A 2VF4X 3RAEC 1Y4AE 1G8JA 4UDOA 2YWEA 1S3IA 1X8JA 3GW8A 4D80A 1T5BA 4WINA 5G1NA 2CXRA 1AKMA 2JKZA 4WY2A 3VTKA 3DXFA 3AEQA 3BGWA 2O2IA 4P3NA 4TLEA 5AK4A 1NVAA 3NORA 3OJOA 1ZIPA 4UE2A 5BVHA 4C4AA 4M8SA 2HDNB 1E69A 3BFPA 3D1JA 2AC2A 5HZGA 3A1DA 3D5TA 3HZRA 3PJEA 3PS9A 1CR0A 1CQJA 1R8SA 3PXBA 4KEAA 5CD1A 3EFBA 4JI0B 5L4LA 2UU9B 4IOKA 4AJIA 1RPZA 4BV3A 2X8AA 4URVR 2YTZA 1Y9AA 2BSQA 4RJTA 1Z88A 3TLBA 1AUXA 2A7XA 3WQQA 1Q0HA 1BE1A 1XB2A 5A9TA 4RQUA 1H0HA 4JITA 2YS6A 4II3A 3ZWXA 3HKDA 2C3YA 4H17A 3WJ2A 5CA0B 3ZU4A 2Z57A 3FYTA 1EVIA 1D07A 4RZIA 4TUYA 3JZAA 4DDKA 2V96A 5LYJF 3VNUA 4QEZA 4JXZA 2YBEA 3K09A 4YRPA 1G2PA 2NU9A 4Y2SA 2VDLB 2QYTA 2BEWB 3PDIA 3GF4A 3IKJA 1SVWA 2W58A 4D8TA 3RSOA 2XUGA 2WE7A 1U0HC 2PRZA 2PWZA 4EA8A 1LS6A 4ZGWA 1KORA 1FRNA 4TV9F 2CLKB 2DSNA 4LXXA 4BNVA 3EVFA 5FUQA 3OF3A 5EJAA 4G2NA 5IX8A 3TUXA 1XRLA 4LG1A 4ICIA 4QOSA 1ZOSA 5CB0A 1W5TA 3NLLA 3URMA 4JLWA 3C6QA 5LNK6 2W6OA 4JASB 2QZZA 4BQOA 1EVZA 1YKSA 4HGZA 4ZANA 4MGYR 2C5HA 2H6EA 2GAJA 3ZNOA 1YCGA 3ETCA 1FXWA 3GRRA 2GSDA 5G41A 2DF8A 1EXMA 1Y7LA 4LMAA 4PLPA 1WCV1 2ETVA 2PRIA 3DZGA 3HMKA 3QLUC 4PO1A 2PWPA 3VPFA 1VRVA 3BJZA 1M6WA 1T25A 4FWBA 4LW8A 1GTG1 1RP1A 4DAOA 4X64B 3G2IA 4Z7NB 4EYEA 3BXGA 1OWMA 3EAQA 5AKXA 4BFXA 4BZWA 1MQSA 1UYJA 3MMSA 4GX2A 4DVGA 7GPBA 2PH5A 2P1ZA 2DQYA 4NYMR 1SVLA 5DT9A 3RYFB 1NVKA 3ABQB 1AHNA 2YV3A 3IPRA 4IKPA 1L1RA 1K66A 4MA0A 1BCRB 2VP6A 4B3RB 1N2GA 1VP9A 2XZPA 1BMTA 4RK6A 3HDYA 2O2XA 2WU8A 4S04A 2OXFA 4Y9UA 1E7MA 4KW7A 1S9DA 4CKCB 1BN7A 4PPQA 4R98A 3V00A 4YT2A 5KQGA 4Z7QB 1MV8A 2HV9A 3E15A 3QVMA 3N3AC 2ECKA 4QULA 4MYCA 3M6FA 1JL3A 3T6KA 2WYHA 3EASA 3INYA 1WZUA 2ZTVA 1UMKA 3ILYA 3SHOA 3UMBA 3ZHBA 4QGSA 3VJLA 4HB3A 4ARZB 5D84A 1KDVA 4DLRA 1Z4KA 2JK1A 3LM8A 5ABPA 1UC9A 2WJHA 3S2ZA 2ZZNA 2G9ZA 3LWBA 4RPJA 2FMHA 1J2JA 3CF4G 1E9VA 1ZBDA 3ZK7A 4ZVPA 5BUCA 2P2LA 3RJMA 1BWSA 2HCBA 5HW0A 2PZEA 5C32A 1Z2OX 1S8FA 1CDEA 1A1SA 1NTOA 1OAKA 4NYJR 2YOGA 2QRGA 4FZJA 2IZZA 3CZPA 3AU8A 3BDIA 4YDSA 5LDDC 2GTPA 4E11A 4F6RB 4CIXA 3JAWB 2C1ZA 2IC5A 4Z49A 2DKOA 5JATA 5M5BA 3LXMA 4IS2A 3BEDA 5H3HA 4IWNA 1U8EA 3WP0A 2JGFA 1NG1A 2CVZA 1M2VB 1ZC4A 2CL7X 3FOBA 1TQ4A 3FTNA 3OBIA 3JWGA 3K72B 2GXQA 1XZAA 1RPTA 1Q1AA 1SOAA 3ICPA 2W6JA 4QQFA 3WOHA 1H8ED 4DIKA 3H2BA 3MQ4A 5BN4A 2GJKA 2HXYA 3U7QA 3V32A 5ITWA 5TMDA 3BXOA 4V0KA 4DZRA 3LT2A 5HKKD 621PA 4GPD1 4AD8A 4FVTA 1D2NA 1I6LA 1JZQA 1A7JA 2VWQA 2MINA 4G5QA 4R8MA 1RXUA 3DZCA 3HUDA 4JUCA 5A0VA 4QYTA 3S5UA 1TQ8A 1D6MA 1P8AA 3IQDB 3IRUA 1NW5A 4B2LA 2BDUA 5I7OA 4RXUA 1MB0A 2TYSB 3CH4B 2W2XA 5E0OA 3UAYA 1ATZA 4O63O 1NJ8A 1QUEA 4U7JA 3R6GA 1NXSA 1CDOA 3KVNA 4RK0A 4YASA 4RANA 2A88A 4CEHB 3AUJB 3LX4A 5D85A 4Z4CA 1T3ZA 4JLUA 4F0JA 5MGBA 4ND8A 3NV7A 1U0GA 4QWMA 2EGHA 4BUJA 4YJ3B 5LB2A 4DQXA 1BS9A 2FYTA 3ISJA 3I45A 3EUWA 3OD1A 4OBXA 3U40A 5AH0A 4S12A 3HKCB 4TWJA 3NH6A 5FH9A 1EX6A 1TLFA 2BE7A 2OC4A 3H0KA 4N41A 2JZCA 2VIIA 3VYUB 3L7NA 3HA3A 5F76A 1C41A 3UPTA 3FVQA 1DG9A 4ITUA 1BAPA 5HFJA 1P5ZB 2SCUA 2XGSA 2P69A 4UMEA 3ZW9A 4NC9A 4YCSA 1F51E 2BFBB 4ZI3A 1YAHA 3BB4A 4OMUA 5F52A 3IEVA 5LYJB 1WU7A 4RPHA 1JIJA 2R6FA 1RLUA 2YHAA 3GHHA 3SS8A 2D7JA 1Y8CA 4ZOCA 5B3KA 4U7DA 3OQIA 2XCLA 3TRHA 2FMUA 3ZH9B 4OUDB 2IHVA 1YHZA 5HBGA 3OA0A 2FQQA 2LKDA 3LSYA 2CLIB 1OILA 5DI3B 1AU9A 3FYUB 2HSJA 1VL2A 4NJEB 4DQUA 5AW0A 3OQNA 5JJLA 3E8SA 1CRLA 3WVNA 1IBMB 3DZHA 4YT5A 5G3YA 3AUSA 2XCOA 1KY2A 2QLMA 3BSYA 2JI9A 2QENA 5KSOA 5E6UA 3HRIA 2AZXA 4UHCA 1QANA 2W6IA 3AEKA 4FMDF 1N9GB 2JGAA 4Z4EA 2HW8A 1V9SA 3IUQA 3H2ZA 3PC8C 1FFXB 4FYIA 1C1YA 3B1YA 3OZFA 3PIRA 1R27A 2DLNA 3KOOA 4P81A 5BRAA 5L53A 2XKKA 4A0RA 1AA9A 4LFCB 3C3XA 4F71A 1LSUA 5T8KA 5JCOC 1RC0A 1X38A 3V1UA 4Z0HO 5ELLA 2GI4A 1L8LA 5FOUA 4ZVQA 2E48A 3TWOA 4TKUA 4D82A 1J06A 2DT8A 3NHKA 4PC3A 3EPLA 1TCUA 3AVVA 4BB6A 5C46F 4FFNA 4AYWA 1II8A 4DCGA 1TIPA 3T1NA 1B41A 1SHLA 1RQGA 5TPZD 4ME6A 4G86A 2BTOA 2OORA 3CUEF 4IIJB 2J3EA 4FYHA 4HXGA 1T0PA 4RZSA 2HADA 2ZBQA 3QX7A 4EHLA 2VYVA 1CS0B 5ERYA 3HXKA 1MJGA 1BTOA 1YL5A 1EX7A 2B36A 3K8ZA 4NU0A 1RHKA 3IAFA 3IIKA 4DT1A 3DFUA 3L8ZA 1RWBA 4AO6A 4QT4A 3ZXYA 1GQYA 3Q3HA 5EWLB 1BW9A 3ZCXA 4FYMA 4KXNA 3G0BA 4QXQA 4R9VA 3VYVA 5KVVA 3NZEA 4JLBA 3TQCA 2P4QA 3KYJB 2B21A 3C4VA 4YQFA 2PV7A 1OT3A 2NG1A 4ID9A 2XYQA 2F1KA 1WBDA 3FWZA 4FJ1A 2UZ1A 4GS5A 1EE9A 1S96A 2B92A 4OLBA 1CUIA 1DLJA 4ZO7A 4BEWA 2G71A 4HAYA 2DB3A 1DOAA 1LPBB 3PGVA 2BGUA 4DLWA 4EA7A 1I5EA 2Q8PA 2JFHA 2HF7A 4RSHA 1R9GA 3EVNA 4K0RA 4XYMA 3WYNA 4EHBA 5CX1B 4FD3A 1U3WA 5JCPA 4Q7EA 3CNBA 2A5FA 1GP2A 4Z3KA 1U2DA 3LUGA 1PNOA 1V3QE 2AC7A 1Q6ZA 3BCRA 4UZFA 1G4HA 3CRNA 1Y7HA 3L6EA 4H7FA 4FFBB 2D4AA 4HEQA 1KMHA 1O89A 1FTSA 3AK4A 1R12A 1E9BA 4X6UA 1ZHHA 3D54D 3DOIA 5CXXA 4ZO9A 5DTJA 1VJ1A 3LUFA 3I5XA 2FUEA 4AMUA 4W6ZA 1FK8A 4CMGA 3Q11A 2FZLA 2NW6A 2OYRA 3M3DA 4IOMA 3SJCA 5IC6A 3U4DA 4EKYA 1E59A 2FA9A 4Q4DA 1N1DA 3KBBA 3QUAA 1O2DA 5F1YA 2CC2A 2FSIA 3K1TA 1DDIA 3LZCA 4EKEA 3AKZA 4ZTZB 2XYHA 2O59A 1HDZA 5TMEA 3JTEA 2AT1A 3R41A 1YS1X 4MWGA 2B3DA 4RELA 1RD4A 4LFAB 4XIGS 4KQEA 2ILVA 1ZOLA 4O4JB 1YJAA 4DILA 2QV0A 2DUUA 1Z5VA 3DL0A 5K09A 2E4AA 4UEOA 5AXAA 1I8TA 4Y98A 4D3YA 4GMKA 2UUAB 2MDTA 3TJZA 4DLSA 1JJVA 3KQVA 5CX4A 4YRJA 3QEAZ 3LPLA 5EMNA 1ML3A 1YMUA 2M6RA 2JJ2D 4RD4A 4Y2HA 3WRYC 2VQEB 1E1YA 1IQRA 1L7NA 3QKWA 3KQUA 1IVYA 2LDXA 3GUUA 3B3FA 4X90A 3WL3A 4E3WA 1GGFA 1VJ0A 5JMTA 4HNRA 4I3GA 3DG9A 3R0XA 4M6WB 3EIUA 2HQBA 1WSDA 2ISQA 4ZO8A 2YXDA 3G6WA 4GICA 4MLZA 5TQ2A 1LDNA 1MJNA 1IXZA 1ZGCA 3EUEA 1PK7A 1RI1A 1S2NA 2N42A 4G0XA 2PCJA 4ZCIA 3TE6A 2VDUE 1LFAA 5AQ1A 2QE6A 1H8HD 4MUNA 1EG7A 2O2SA 2YJ5A 3C0KA 1IL0A 2O7SA 3R5JA 3G0CA 2GQ0A 3NP9A 1EVLA 2JJ8A 5BWBA 5BNTA 5SZJA 5E2AA 3DYBA 4RL6A 2EFDB 3N6XA 1P0PA 2P5TB 2ZJYA 4MICA 2G1JA 1VKNA 3UC5A 1KQ3A 1WUHS 2CMFA 3AHHA 1D2GA 1XLVA 4IDGA 4U39A 4BFWA 4KAJA 5JCJD 5JY1A 4A82A 1W48A 5KOYA 3LDFA 2H0AA 2R9VA 3OC6A 2YV4A 2PMFA 2AFVA 3LFUA 2O2YA 2VJMA 3TR0A 2P0EA 2NTEA 1KU6A 1O96A 5HRUA 4MDFA 1COWA 1S01A 1W4BA 3ZD8A 1AMNA 3FCOA 3KXDA 1UDRA 4XUEA 4UOEA 2JDIA 2QE7A 4DV2B 2CSUA 4XEHA 2LBPA 3IGFA 4J4HA 2HMUA 4BX3A 4EKIA 4LHZA 5A9SA 1XTRA 4HQ0A 3D8SA 2LR0A 4M49A 2Q5JA 3WLOA 3M82A 3ZV4A 4NDZA 5JR3A 2W93A 2XOXA 1P3DA 1HEYA 3NX4A 1B3RA 2Q9CA 3VXKA 5AM1A 1PJ8A 3NYWA 2IUUA 4F7WA 1UMBB 1LU9A 3CT4A 1SKUA 2CB9A 1N34B 3PPIA 2F1IA 4GWLA 4ZV4A 1O54A 4IV0A 3W2FA 3U4QA 3VKGA 4EHKA 4H9GA 2ZR7A 3OX1A 2GNOA 1SIOA 2D2VA 4I5GA 3INGA 4H18A 1WAMA 3RIEA 5LP6F 5LPNA 4N65A 1QX4A 4ZZ2A 2MCFA 3BS4A 4GZ3A 3BJMA 3O8DA 3V55A 2VAPA 1Z82A 3I0NA 4ECEA 4QUHA 3Q3CA 1IIBA 3R75A 3K6SA 5BPFA 2VS1A 2WKQA 1P7VA 2R8ZA 3DOFA 4O2AA 3IDQA 5BT9A 3SZMA 1S7CA 1SUBA 3JQAD 4OX9B 2GZHA 3DTVA 2I6TA 3NHFA 3CX8A 3D4IA 1TCAA 4TXJA 2CMDA 3DE5X 3GK3A 2VOEA 4ZC1A 3ZOKA 3KU1A 2EWVA 1VYUA 1TIKA 1SUPA 1G42A 1GZ7A 3TGWA 5IPFA 3IDAA 1BGXT 4KVFA 1MAUA 4MV8A 5ALJA 4P4TA 3SQMA 1C4XA 2GHTA 4Z7OB 4JJGA 3UNXA 2Q9BA 1XQYA 2GVDC 1DBIA 1SD5A 3R9XA 5ESDA 1RXSA 1C7IA 4HN9A 2C77A 4MUKA 1XRRA 5L4NA 4DV1B 3K0BA 1LPMA 2QRHA 2AFIE 3A6ZA 3GH1A 5DW3A 1GPNA 4D0NA 5IVKA 3O4FA 4C06A 1H0KA 3V9PA 1SOUA 2VSQA 3VX3A 1U2GA 3JYLA 1PFWA 1W94A 1LPAB 3AOEC 3B85A 4J9VA 2NAPA 4PAQA 5KKCA 4GOXA 5BOVA 3RU7A 3GU3A 3I09A 1AN0A 2F43A 5K3FB 2PIDA 3TR6A 4D4HA 5CFPA 4JI8B 3QKSA 3EZ6A 5E6RB 1XCLA 2NT4A 4WERA 2ZSIA 4Z4QA 2Y1LA 2ZI9A 3RUFA 5ALWA 4QFBA 5TVGA 3EF3A 4LRXA 1VIVA 1HYGA 2F67A 2UZAA 3B1VA 2H8KA 2GBCA 3RS8A 3T4PA 3D64A 3V48A 1YZNA 4EPWA 3DEKA 2E5FA 4GLLA 5KUTA 3DZDA 3C6ZA 1MFPA 4GQIA 5FYQA 3BXEA 2OAQ1 2PSDA 1SUSA 2HNAA 2IJGX 2RHGB 3D7KA 3HJFA 1R4ZA 1A82A 4ATNA 1A69A 4D4KA 4X66B 3T1YB 3SQDA 4XPIA 2RGDA 4R8KA 3UWKA 2BMDA 4UPVA 4V0ME 1AT1A 4DEXA 3RRNA 2OO7A 3W3AH 1PG5A 1PWYE 1G5FA 4YRQA 1VHWA 4R51A 1WXWA 1B0AA 1DJLA 1Q16A 4IFEA 5DYYA 1U80A 3OE7A 4ZREA 1D4FA 4NLLA 3ZJVA 3NRBA 2O5CA 4Q4HA 2ZIGA 5BNFA 4FDUA 3R6TA 4YONB 3KOMA 2O52A 3GLIA 5GONF 4WCFB 4KITB 5E1DA 2PJRA 3C24A 4OBWA 2V8BA 4FOTA 5HTKA 4YJ3F 1KO4A 4QICA 1SVUA 1VHQA 4RZ2A 3GUZA 3AJ8A 5EJ7A 1UT8A 5LQSA 3MINB 3HADA 5F12A 1U5CA 1L1EA 3NFRA 1NLUA 1V11A 2AEJA 3QQPA 4NZYA 4DY4A 1N5IA 3JSXA 2F43B 1ZO8A 5K3FA 2F90A 2WD8A 3NJ8A 5CFZA 1NMYA 5HUQA 1RWVA 4WACA 4MWTA 3OFKA 3OM0A 1DU4A 2VXCA 2ORVA 2X0IA 5JZSA 4MEAA 3RHFA 1JLRA 1NXXA 3DE7X 1NMQA 1ZICA 1MQ8B 4RZUA 4AU1A 1Q95A 4P2BA 1E9FA 4RK4A 1R0RE 2JCYA 4MWSA 3F8WA 5GV7A 5KNBA 3UFXB 5L51A 1OZFA 2V7EA 5JALA 4DL9A 2CNDA 5FF9A 1G7SA 2NAFA 1GZ6A 1LRJA 7REQA 5FUMA 1SPBS 2FVYA 2P2YA 1VOTA 4RY9A 1UL1X 4BV8A 5KWSA 1D1QA 1Y6ZA 4JJKA 1MCZA 1KS2A 2WJ3A 4RM2A 3RF6A 3EG9A 5JSQA 3HSKA 1KY4A 2ARKA 3ORYA 4EWLA 1TU0A 5TY0A 3M2PA 3U81A 1GGJA 3DO8A 3EYWA 4JUAA 5B64A 3TGLA 4KJXA 4EMBA 3IUMA 4C0SA 1SZDA 5IK2D 1E3WA 4G56A 4OI4A 3RROA 5TS3A 2C1EA 3OI7A 3PNOA 3FF4A 2H5LA 1FY2A 3IFSA 4XA8A 2QM8A 1QHNA 2GXSA 2EW2A 2Q5OA 3SF8B 3EIXA 5D8DA 3LDHA 4NPAA 2HQOA 4QFDA 2KPOA 4JD5A 4H7IA 5H5JA 1WZIA 3ILVA 5F5XA 3D1LA 2GPAA 3ADCA 1TEVA 3TE7A 1T5TA 4KLCA 4BV9A 1PKXA 2OMEA 1N6LA 1COWD 3LTEA 1Y5IA 3AR4A 2P9FA 4KQCA 1IOLA 3DVQX 4BMCA 1L5QA 2Z6UA 4KN9S 4E6EA 3EZLA 2VDVE 1Z73A 1H0RA 1NBOA 2IYRA 3QIAA 4K2AA 4IXTA 4WGFA 4FFVA 3M4ZA 4YXFA 4QOEA 4CM9D 2AW3A 3SQWA 3DDSA 3TQQA 3G2LA 1PT7A 3E9YA 3LO8A 3OY7A 4WZAE 5DK4A 3NHJA 4YCNA 1DBRA 3B5JA 2NXWA 3QMPA 1ZW6A 5CRIA 2OCDA 3RRZA 5LP1A 4W1SA 1YVPA 4KQIA 1CUXA 3I83A 2AF4C 4MVYA 2BKEA 4EYGA 1K2VN 1OI4A 1V7PC 4ARCA 5KOJA 1MHPA 1JHXA 3RIYA 3FZGA 3TSOA 2Q07A 1G8SA 2ZI4A 3KQNA 3AFGA 3R5TA 4RUKA 4US0R 5LMUB 2VHJA 5JAQA 5KREA 3V1MA 2VYFA 4MPDA 4LVUA 3WY9A 4N1AA 1Y80A 3G1UA 3T9AA 1VA4A 3QVSA 3CR7A 3SHFA 3IWCB 1G2QA 1SXJD 1GPKA 5L40A 2WZQA 5EZYF 4R9UC 3KXPA 1XP5A 1L6RA 5KINB 4JJEA 4TLAA 3MM4A 3BT7A 1CUAA 4CCYA 4ZV7A 5DIZA 4HTAA 2RGNA 4RCZA 2D8MA 3L0CA 4JX9A 1CNEA 4H7EA 2DGDA 4N7JA 4BNNA 3UT5A 1U02A 3FNHA 3FPAA 2UYHA 3IKMB 2ODAA 4XGQA 3L0OA 1HSOA 5BVGB 4KYUA 4RBNA 2JH8A 4YLGA 3LVQE 4DMUB 4R1NA 4BNHA 2QX9A 3PQCA 4MQ4A 5EJ9A 121PA 3MCVA 3A58B 3W8RA 3QELA 2EZ4A 4OXNA 4QA9A 1P9LA 1VDZA 4RA6A 4UQOA 3U3KA 3GEHA 4UUQA 3VR4A 1Q1NA 4NPCA 3SVZA 5JY6A 1RM4A 4MIYA 2KHZA 3OQPA 1TQHA 4N0QA 3ZBUA 4AKSA 1XLTA 4B71A 4HLUA 4HVTA 1BXRB 1NF9A 3RANA 1A9SA 3KOUA 5FFMA 1Z0ZA 2GRAA 2H7CA 5A02A 3RVNA 2Q22A 1YD7A 4J2OA 3VR0A 3CUSA 3NANA 4Q6BA 5EKTA 1G41A 5FPHA 2B9VA 3A10A 1U9CA 3CLRD 5BOSA 1B16A 2K5UA 1LI7A 4CTKA 1T91A 2WU4A 3NTVA 2JKYA 3ZJUA 1KBOA 2YOFA 2O0MA 5AVZA 3V4VB 1VGVA 1XZEA 2H1SA 4FDMA 4C0QC 4B32A 4MITA 5KSWB 4M1WA 3RVMA 5DKFA 1HDRA 1TTHA 2PLNA 2CKMA 2W6PA 5FL7D 3M1IA 2OWEA 4M1KA 2BONA 4UCWA 3U2QA 1UBOS 2VNIA 2YIVX 3ABZA 1MT0A 4C0AC 3E4CA 2I33A 1W5SA 3FSJX 2PO5A 4HDNB 4K9MA 4W7HA 1E1RD 3RVQA 1HFWA 4UUOA 1MEJA 5D3MB 5TVOB 4EF5A 1C29B 5T41A 4EW6A 1X7YA 3JWPA 5K3SA 3IVCA 4E5PA 2Y0DA 2CK3A 3GNLA 3TD9A 3ZVKA 3IBGA 2WUVA 1JP7A 4LJ7A 4PPGA 5CT4A 3V8NA 3TCNA 2IYSA 3L0PA 1I32A 1Y3BE 3F4BA 5TT0A 3RC9A 3U7GA 2IYQA 4WKGA 1B7GO 2PBZA 2QTWB 3JQ7B 5EFZA 1UZNA 3RRBA 3VVMA 3BHJA 3IAUA 5BR1A 3UKJA 6CHYA 3OE4A 1ADJA 1UQTA 3FPSA 3HO8A 4BECA 1U3VA 2CNOA 5AW2A 5ALTA 1SHJA 5LMZA 3DBVO 5BSRA 3WTBA 5CDFA 3OM8A 3WYCA 3DO6A 4AY5A 4JDPA 3AVXA 4QXAA 2XCUA 1K0UA 1F12A 1BIFA 4Y2YA 3UWPA 4JFRA 1TYEB 3H0EA 4O25A 3ZWQA 4EFMA 2X15A 1HQYE 2CJFA 4MV7A 3FPCA 4L1KA 4UHBA 4FP9A 3U7EB 1DWPA 4GRAA 2A0UA 4CF5A 2AB0A 2DFPA 3L41A 5KNBH 1NI4A 5EZ6B 5AP9A 1CJMA 4L9AA 5L8VA 3AX6A 4D9JA 1TADA 4K6CA 3MBOA 4Y6RA 3T1TA 4TKUB 2BM9A 2BZ1A 2WSLA 3LZ6A 5JSZA 4DRZA 1C9EA 2KI5A 2GF2A 4KVGA 3AFMA 5HQJA 4EPRA 5FTLA 2QQEA 1S2GA 2VDKB 4KBFA 1U5BB 1H94A 1MRZA 2JD0A 5ITZA 4EY4A 5LQRA 3RK1A 1ELOA 3U16A 3T7CA 1B15A 4G0WA 3ZY4A 4YIHA 1GCIA 2QUHA 4IIHA 1Y3DE 4NPHA 1TZ2A 1JIQA 3ZBPA 2P9CA 4FMCF 5EZYB 3TM5A 4PZYA 2AYXA 1LA2A 1PJAA 1SFRA 4MI9A 1Z36A 2R6ZA 4IQ0A 4Q9AA 2BBTA 4C4OA 5LNK1 3CLTC 1GSOA 1YOBA 3ACBA 2B4TO 2FKAA 4JBYA 4FCVA 3U3MA 5DI3A 3CV3A 1FQOA 1KKUA 3NKVA 4Q03A 4D57A 4DEVA 5JXHA 4N8EA 3RC2A 2P0YA 3H4TA 2F17A 2WWGA 5I9LA 5JECA 4N6OA 4P5DA 1J2TA 2HHAA 4GBMA 1P5HA 2HAEA 4G0UA 3R09A 2QRKA 1ZVKA 4C0LA 1TRHA 1TJ3A 3RUCA 5C1OA 3H9GA 2FPSA 5ARBA 1PLKA 4UJ3A 1OFGA 4EJSC 1GSHA 3T52A 2H52A 2ZXEA 5IKOA 2SCUB 3NEJA 4MK4A 1QCYA 1GY8A 3KWMA 5T64A 4HS9A 1FYVA 4JL5A 2IIQA 3G8DA 2C7PA 3MCTA 1IHUA 3MCWA 2ATXA 2IEAA 3SS9X 2O54A 1APBA 1YGYA 4IH4A 3T38A 2OXEA 1BMFA 1L5YA 1F0NA 3HCOA 4K6OA 2V1XA 4RTLA 3QKRB 4W1QA 4NCKA 3KVVA 5ECDA 1WB5A 1P1KA 3P45A 1GGEA 3P97A 5EXDA 3UG6A 4AN0A 4D4JA 4ENSA 4MKIA 4IDAA 3EISA 5JPDA 1ISPA 1N9KA 2FEOA 2H2WA 2OOSA 3BA6A 1Q1QA 2JCBA 3EIEA 3FDJA 3IX7A 3KSRA 3EZYA 1ZCAA 4IQFA 4C22A 1ZD3A 1ILEA 2I1QA 1ZHFA 4LCEA 3OCCA 4PRKA 1Y5LA 2QF7A 3K0EA 4TXLA 5BSVA 1P1CA 2I2WA 1A5AB 1KJ9A 1QGYA 1R8QA 3MYRA 3QA3E 4I50A 3W9UA 4ZYZA 2IPMA 1YF3A 5C53B 3HBNA 2GFQA 1P1HA 3OE5A 4DM7A 1VMEA 4KH1A 5L45A 4ZI7B 1Y33E 4HPXB 4Q4HB 4E5KA 2UXBB 4OHCA 2OY0A 2DLCX 1ACMA 2QUIA 3N76A 1GTZA 3JPYA 2CHVA 2NUAA 4LYEA 2IF2A 2ZWMA 4HNUA 4N47A 3U1BA 3IT0A 2MSCB 4MGIR 5AI8A 2OT3B 3X2SA 4Q18A 3UAZA 3O8CA 4GDMA 4R1UA 1MENA 1YRAA 1EDEA 2N47A 4LRTB 3GZNA 4YBRA 3SF0A 4YPOA 1GD1O 1YJ5A 1ZRHA 2QW8A 2UYQA 3N9IA 5EEGA 3B5EA 5GZ6A 4YRCA 4AZ3B 2GTIA 4DMMA 1G4UR 2BM8A 2XNKA 5COBA 1UKZA 4ISBA 4J3NA 3LK7A 1P4GA 2XWBF 3WMGA 1M1YB 1DG1G 2R8RA 5FV7A 4I5DA 4NMMA 3P2EA 1KOLA 3VMFA 1UADA 4U5XA 2BBSA 4G8JA 4H0NA 3TNDA 4F60A 4Q4AB 1E2MA 3KHTA 1VKOA 1R0YA 3M6WA 3SMVA 3F6EX 4X1IA 1QG2A 5GV8A 3OPXA 3A7DA 1AUQA 1CRZA 1WL8A 4HUTA 3FTDA 4ZYUA 1TF5A 2QN8A 3JRWA 5IU6A 2VEOA 1I3OA 4HOYA 1SQ0A 3J80A 3QFRA 3RJ5A 3HY6A 2IS4A 1HDEA 4BO3A 3CCBA 3QE3A 4FC7A 5TXGA 1JQDA 3VO1A 5JYBA 4TRMA 4L76A 1QWOA 3CN9A 3RS7A 5AVXA 3GLUA 2ZJ6A 3HNRA 4B3GA 4V2UA 3LBFA 4J1SA 5JZ9A 2VXBA 3EFOB 3OWHA 4G0QA 2V55B 1C7ZA 1EJ0A 2P4HX 5DSZA 5FPSA 2O19A 1PEAA 3WQHA 1KYVA 4IIBA 1RRFA 3CLSD 5ECWA 5EE9A 5ILGA 4Y2VA 4AN4A 5JD5A 2Q3MA 1SC6A 3PHCA 1AX9A 3SOPA 3FRIA 1UAYA 1EU1A 5JSZB 1DAMA 4WA8A 1XTTA 2G72A 2M6KA 3W1VA 5JFOA 2DM6A 3OLQA 3N58A 3JZFA 2EQBA 3WWYA 1JVSA 1D5WA 1RR6A 1T13A 3KYDA 4E2XA 1L4BA 4YAOA 5MN4A 4HATA 2V7GA 4OJTA 4ZHQF 4RTRA 1JR6A 1Z0FA 1TM2A 5LIRA 1Z6ZA 3UUFA 2VJBA 3WBBA 1BCRA 3IQXA 2DY1A 1UZLA 4D44A 3I5AA 1XNQB 5FOSA 3KWLA 1CUSA 1LV8A 4YP1A 4KQHA 1A1VA 4K9OA 1W0CA 4BMYA 1NHGA 2GRJA 1B00A 3N59A 2W6MA 4NBTA 4NABA 3F49S 3THOA 4TWRA 4LYHA 1GQ2A 5EVCA 1QGED 3GUYA 4AUKA 3GVCA 3D8NA 1NN5A 1JHPA 2HDOA 2HH9A 3ELBA 1GPH1 1BDHA 1XPOA 3NH9A 5IRCD 2QLLA 1SG9A 4QM6A 2IW3A 1CEEA 2FR0A