4MIJA

Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
302
structure length
302
Chain Sequence
TEFRSADTHNADDYPTVAAVKYMGELLEKKSGGKHKIKVFNKQALGSEKETIDQVKIGALDFTRVNVGPMNAICPLTQVPTMPFLFSSIAHMRKSLDGPVGDEILKSCESAGFIGLAFYDSGARSIYAKKPIRTVADAKGLKIRVQQSDLWVALVSAMGANATPMPYGEVYTGLKTGLIDAAENNIPSFDTAKHVEAVKVYSKTEHSMAPEILVMSKIIYDKLPKAEQDMIRAAAKESVAFERQKWDEQEAKSLANVKAAGAEIVEVDKKSFQAVMGPVYDKFMTTPDMKRLVKAVQDTKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Polaromonas
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
total genus 116
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2013-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mijA00
4P1EA 4PC9A 5I7IA 4N8GA 4PBQA 4OA4A 4X04A 4MMPA 4PDHA 4XFEA 4MAGA 4PGNA 4NG7A 4PCDA 4DI4B 4XF5A 4MNCA 4N4UA 4PF8A 4DI3D 5IM2A 4NX1A 4PE3A 2ZZVA 4N6DA 4O7MA 3FXBA 2XWKA 5LTCA 4N17A 4P9KA 2XA5A 4PETA 4NN3A 3GYYA 4XEQA 4P56A 4MNPA 4PFRA 4OVSA 2WYKA 4P8BA 4YICA 2XWIA 4NGUA 4N91A 4O8MA 4O94A 2VPOA 4PDDA 4MHFA 4OVPA 2XWOA 4MIJA 4N6KA 5IGAA 4PAKA 2CEXA 4OVRA 5I5PA 2XWVA 2HZKA 4UABA 2ZZXA 4N8YA 4PFIA 4X8RA 2VPNA 4MX6A 4PFBA 4PAFA 4P3LA 2CEYA 2HZLA 4PGPA 4P1LA 5CM6A 4OANA 4N15A 4NHBA 4OVQA 4NF0A 3U65A 2HPGA 2PFZA 4NAPA 4NQ8A 2XXKA 4MCOA 4PF6A 5IZZA 4MEVA 4LN5A 4MNIA 2V4CA 4PAIA 4OVTA 4YZZA 3B50A 2WYPA 2ZZWA 2WX9A 4PBHA 2PFYA 4P47A
chains in the Genus database with same CATH superfamily
3M3KA 3K6UA 4OFLA 1SDXA 4R6KA 4TOZA 4PDHA 4G68C 5AA2A 3PU5A 4IO6A 1XC1A 1UTBB 4DXUA 3LC8A 5IM2A 4PE5B 3TEPA 2XXTA 4N6DA 4QHQA 1TT1A 1ANFA 5KDTB 1NUXA 3N6TA 3FVOA 3TMGA 2HHMA 4KCDA 3AXFA 3CFZA 5I2NB 1FSAA 2NVUB 2DVCA 1NMUA 3OO9A 4PFTA 4MLQA 4I1DA 3OSQA 3K00A 4GFRA 1BP5A 4N91A 2NXOA 3CHGA 4BDNA 1Y1MA 3UGWA 1FPJA 1FPGA 4ZZAA 2GQ1A 1NKXA 4OVPA 1Q35A 1MXXA 2KLFA 2ONKE 1FQAA 1FQBA 2HZKA 4UABA 4OQOA 1NV5A 3ECRA 3ZKLA 5DTBA 3SERA 4H45A 5HPQA 1L5TA 1FTOA 1RDZA 1BIYA 4PTKA 5I2KB 4ELPA 4U21A 4XKNA 4GWOA 1JW4A 4GL0A 5H8HA 3E3KA 3KSJA 4ZDMA 1SYHA 1DPPA 1RYXA 2CZIA 1EH3A 2UVJA 5DEXA 2Y7KA 4PAIA 2F8DA 1OVTA 4FAJA 3CRBA 3FVNA 4R2BA 1FW0A 3I6VA 2JJKA 4Z7EA 4JDFA 4MMPA 1RDXA 1VDWA 4ISUA 3TTRA 3HSTA 2GFEA 1MY3A 4RXLA 5IZ3B 4H6DA 5DW8A 4BDMA 4AQ4A 1UTHB 3MP8A 2X26A 4I3EA 1INPA 1FTMA 3IB1A 4KYEA 4MNPA 1ZU0A 3IK6B 4I3YA 2HXRA 1H43A 3MYUA 4GD5A 2XWIA 3PD9A 4BDOA 1IITA 4O94A 4MHFA 3WAEA 3IOTA 4ESWA 2GH9A 1EZOA 4FORA 4RK9A 1I6BA 2FA7A 4N8YA 2KR0A 1FPBA 3IOVA 3MJNA 2Z8FA 3H6TA 3KC1A 3PUWE 4P1LA 5I58A 4R75A 3E79A 1MDP1 2H25A 2XXRA 2P0SA 3EN3A 1LAHE 3IX1A 3EHUA 4F22A 2O68A 3THIA 2DWHA 2ZNUA 4YZZA 1J1NA 1QUJA 2B3FA 2OX3A 3ILTB 5TP9B 2WKYA 3PD8A 3IORA 1B3FA 1M5EA 5CC2A 3FVKA 1JP4A 1LFHA 3IOUA 4ZEIA 3G3JA 4FJPA 1B1XA 3OEMA 4GWXA 3OEKA 4PQJA 1YYZA 4HE0A 2UVGA 3N94A 4PF8A 4QSCA 1SQYA 2HAUA 4I9DA 1P1NA 2V3QA 5I57A 5EQ9A 1R6ZA 3FJGA 4JBZA 3T9UA 3TTKA 1H44A 4NF4B 1SI0A 3KC0A 4OEUA 2DSFA 1MM7A 1M5FA 3V83A 4KXPA 2ONSA 3W9WA 3PPOA 5CMMA 3FXUA 1FRPA 1OQGA 3RGYA 2XXPA 3KZGA 1IMAA 3DP8A 4F31B 3TCHA 1Y1ZA 1WODA 2D21A 3V89B 1KWHA 1ZIUA 4ECFA 4MIJA 2XXVA 4XXUA 3BIGA 4JVDA 1MPCA 1O7TA 4JB7A 4C0RA 4JWOA 1PC3A 2ZZXA 2IEEA 1BKAA 4GBVA 3IB0A 4QRZA 4YKPA 4JSOA 3TKDA 3RT8A 4PGPA 5ICTA 5CM6A 4XKPA 2CMOA 2V25A 2I0BA 3IFCA 4NF0A 4YKIA 2QS3A 4G8HA 4U4XA 5CMCA 3MQ9A 4WXJA 2GHBA 4KHZE 1JNFA 3VXBA 1URSA 2B65A 3MVZA 4MAGA 4R2FA 5EYFA 4WEDA 1XOCA 2DE2A 2UVHA 2R71A 3PUYE 5FTHA 1UTHA 3HV1A 4HS7A 3PUXE 1TFAA 4ZEKA 3VE1B 2QVVA 1FQFA 2OLBA 4PETA 2XA5A 5ET8A 4NN3A 3R7XA 5TU0A 2HCAA 3GYYA 3C32A 3HHFA 3S4UA 4ZEDA 4YAHX 3MPKA 4QF9A 1LBYA 4LQ2A 3K6VA 4O3BA 2AYSA 2WEFA 4F1YA 1NNTA 5DVJA 3H6WA 2ZNSA 1K9ZA 1IMCA 1B9JA 2VOZA 3PGFA 1FQDA 4QFNA 3PPRA 4MLVA 5L9SA 2DYXA 4ELOA 4UACA 4Q0CA 3B6QA 1ZBMA 2PT2A 4IO3A 2YJPA 1A8FA 3CG3A 4X9TA 4U1ZA 3CVGA 5I84A 4BDRA 4H8IA 4KCCA 5AA1A 3QUJA 2Z8DA 4LN5A 3UP9A 1O64A 1D4NA 1GV8A 5H8QB 4YB6A 1Y3NA 2F34A 1NNKA 5AA3A 3MUQA 1SBPA 1QW0A 1VFEA 1B5JA 3IJXB 4OFOA 1DBZA 2VHAA 5J16A 2ZYOA 3C9HA 2F5XA 4WKMA 1FBHA 3PMWA 4FIMA 4R9GA 3CSGA 4PFUA 3P7IA 4RPNA 4JVIA 1GR2A 4AS5A 1FPKA 4FBPA 3GZGA 2AL5A 5ET6A 1UTBA 3HN0A 1Y3QA 3SEUA 2OZZA 4HW8A 4R9FA 1UIUA 3B6WA 1FBGA 4Q8RA 1NUWA 3C34A 1N3XA 4LUBA 4QBAA 3U92A 4HE2A 4YKKA 4NGUA 2RCAA 3C35A 1NV3A 3K4UA 2VPOA 1PB9A 1RDYA 3RPLA 5KDTA 1MDQA 3MVYA 4GWUA 1DTGA 4JWYA 4NF8A 4C1UA 1JVXA 1IXGA 4HCWA 1NV1A 5AE4A 4GRKA 1POY1 2CZHA 4HE1A 3QAXA 3O97A 3IOWA 2O1MA 4X48A 5LOMA 4LVQA 3OSRA 5EHSA 5ET7A 3EQ1A 1YZ0A 2HFBA 2XXKA 3JV9A 4G2ZA 2OBGA 1M5BA 4PFWA 5F1QA 1G0IA 4RPOA 1MPBA 1FTKA 2WYPA 2QMWA 2QPQA 2D5WA 4R72A 1XT8A 2W7YA 4IO4A 4GWZA 4MJOA 5A5XA 1ZLQA 1NUYA 3Q27A 4PBQA 2ZMBA 2H4IA 5L9MA 3GXAA 1GTKA 1MQDA 4G8MA 3KSXA 2ANJA 4MFIA 3MPLA 2PYYA 2I4BA 1QULA 1ZKBA 2DDKA 3H6UA 1B0HA 4DI3D 3LSXA 4EUOA 2ZZVA 2A5TB 5B7DA 4F3PA 3RT6B 5I59A 1MM6A 1HSEA 3FXBA 3KJTA 3T0JA 3QMFA 4OYVA 3C4MA 4LP2B 4F19A 1B3EA 3E4RA 3H06B 1H3DA 1NV4A 1LB8A 5ICQA 1FBCA 2XHDA 2XD2A 3BKIB 1NL5A 4E0XA 3NOHA 3VVEA 3PMXA 4LA9A 4PDDA 1O63A 2DOJA 1NFTA 4LZ5A 1NV2A 1Q9DA 2V84A 1FQEA 3LR1A 3I3VA 3SEXA 3LSLA 3T1BA 1LBWA 1LCTA 4LQ5A 4FE8A 4PFIA 5CMKA 2RC7A 4NWDA 3PUZE 4PAFA 4DE8A 3QXMA 1MY4A 2DWIA 1B7HA 1EU8A 4U23A 1LFIA 4IGTA 1LAGE 3N5LA 1B40A 1AMFA 2QVRA 4M4GA 4GXSB 5CMBA 2V3TA 5L8DA 4RJZA 4F39A 1MS7A 4U4SA 2Q8JA 2I4CA 3KJ7A 4NG7A 4JSDA 4I40A 1B1HA 4X1BA 3U94A 1US5A 4NX1A 4PE3A 4WEPA 1B46A 3MP1A 4P0IA 2I6EA 1P1UA 3KBRA 4ND9A 4O7MA 3S9LC 2F6PA 1F9BA 2ALUA 5B70A 4Q30B 4YU0A 1LBXA 3VVDA 1P1QA 1PB7A 2Y7PA 1ZTYA 4IY5A 1USYE 1MRPA 1B58A 3HO7A 1M5DA 4QFPA 2LAOA 2H9BA 1JW5A 4RK2A 1DSNA 4ZE8A 2H99A 2XWOA 5EYHA 3FJ7A 3G7WA 1JVYA 3JYRA 4ZS9A 4GWWA 4BDQA 3MP6A 3T9XB 1MPDA 3QSLA 3A3UA 1B51A 4P3LA 4F3BA 4KPTA 2R9JA 1II5A 2DE4A 1G0HA 4N15A 3FUZA 1MXVA 3TYHA 5H8NA 3MWBA 3RNNA 4NAPA 4NQ8A 4MCOA 1QVSA 5CBSA 3PPQA 3FXQA 3B50A 2P3VA 3UN6A 4G8NA 1Y9UA 5EHMA 4O3CA 2F7BA 3O6GA 3L6GA 2FBPA 3OO8A 1MG1A 2NUVA 3PUVE 4PCDA 4POXA 3KFMA 3K02A 4XF5A 1NI9A 1B5HA 3UIFA 4N4UA 5KZTA 3DP6A 4YMAA 2MKZA 1LBZA 2RKMA 3PMVA 4NEDA 2AIXA 2RC8A 4UA8A 1B4HA 2O6AA 1R1NA 2Y7IA 3R26A 4GL8A 3TPAA 4DIGA 2ZXTA 1B0LA 4OFJA 3OENA 4E0WA 4OERA 1SVXB 2XXWA 4OVSA 4YKJA 1QUKA 2QFLA 1AWBA 1OQHA 3H4ZA 4EF2A 2P1SA 1SW2A 3FD3A 3IL1B 4YB7A 3ONMA 2L5VA 1I6QA 2QMXA 3FJMA 4O7IA 2G93A 4RNSA 3M3LA 4IB2A 2F35A 2FIEA 3CR9A 4X8RA 3TTLA 5IZ1A 2WBBA 4PFBA 3CIJA 3FIRA 3SEVA 2Q89A 4XKRA 5AA4A 4BDLA 4HTGA 4MF3A 4OESA 2QSXA 5F24A 2XXHA 3OOAA 3QYTA 1MXYA 4U2RA 1N7XA 3ZSFA 5KCJA 2ZZWA 4AS4A 2Y5KA 1MXZA 2HXWA 5IZ3A 3EHTA 1OIBA 1MQHA 4OXVA 1XHYA 1OVBA 2X7PA 2RC9A 1DCUA 4H5FA 4DI4B 3TQLA 4MNCA 3I5OA 4EDPA 3KG2A 1MY0A 1EYJA 1MQGA 4KQPA 3KEIA 1FPEA 4GX3A 3KBZA 1LB9A 3C33A 5L9OA 3G3IA 3VLVA 4F2OA 5CRYA 4N17A 4YMBA 4OEVA 2Q74A 4LZ7A 3FGSA 2XX9A 5T3JA 1JETA 2F7AA 1GVCA 4JVCA 2WYKA 5BWJA 2RCBA 1MY1A 3S9NC 3OELA 3Q26A 1YPNA 1JEUA 4N6KA 2HQ0A 3FV2A 1D9VA 4GWSA 3B7DA 3DELB 2XWVA 1ATGA 4H5GA 3FV1A 4DLDA 4EQ9A 3U72A 2HZLA 2D3IA 1S7YA 4F2QA 5ET5A 1RKMA 1Q1KA 5IKBA 2X7QA 5H8FB 1GGGA 1MH3A 5DT6A 5FBPA 1D9YA 3K01A 2WX9A 4QSDA 4R6YA 4LONB 4P1EA 2B4LA 2GRVA 4U1OA 2A5SA 2XX7A 4KYSA 3OO6A 1LBCA 2XXQA 3RTFB 1LBVA 3LUZA 3SESA 3UORA 3BBRA 5AA2B 3GBBA 4L17A 2I49A 2DE3A 3MC2A 1LEVA 3B8BA 3HFUA 3DP4A 5TPAB 4P9KA 3R6UA 3ODBA 3D4GA 4ONYA 3HPIA 4RY1A 3T22A 1IMFA 1FBEA 3QIMA 1RYOA 3B6TA 3G3KA 2HAVA 4JXIA 4F3GA 3QUFA 1B3GA 2O7UA 1P1OA 2KQZA 4TQUQ 3D4CA 4QSEA 1P1WA 5F7VA 2NOOA 4F1VA 2DWJA 3GLBA 3S9MC 1DK4A 3U8QA 5IGAA 4PAKA 5I5PA 1URDA 4C1TA 4TLLB 3TODA 1IXIA 3KN8A 5DEXB 4OMBA 2REGA 4FATA 1WVJA 1SW5A 1LAFE 4OVQA 2UVIA 1NNPA 3U65A 1FPFA 2FVZA 1I6AA 5IZZA 1DPEA 4K3FA 1N04A 3IO4A 1FTLA 3RY3A 3N6UA 5HM4B 3U93A 3K2DA 4PC9A 1PBPA 4OA4A 1VSOA 5TPAA 3O6HA 2G29A 2Z22A 4EQ7A 3H7MA 3TCGA 3G3FA 3KGCA 3TFLA 3RPWA 3KOTA 4GF8A 2QS4A 1Z7ME 1N7WA 2FNCA 4R74A 2DWAA 2BJIA 2F36A 2QRYA 1IXHA 1Z7NE 4FEBA 2XXYA 3OMBA 1B05A 1YXIA 1QUIA 5BUUA 3O2AA 4GOTA 2Q8MA 3MZBA 2PMSA 4ZE9A 2OWSA 4XKQA 3OXNA 5DYHA 4PFYA 3FATA 4FEDA 2F6GA 2R6GE 5M2VA 3DM0A 1YAEA 3RQTA 1N76A 1FTJA 2CZLA 1BTJA 3CSBA 2Q88A 3K1MA 4QXDA 5K2YA 4ESXA 3EHSA 3GBAA 3RN8A 2VPNA 1DOTA 1SW4A 3SDFA 1Y3PA 3USDA 4I8CA 1B2HA 3ZKKA 3VXCA 2P2AA 1IQ7A 2UYEA 1B4ZA 2VT5A 3IFAA 1QKAA 3KOSA 1IIWA 4F1UA 4GWYA 3V5AA 3TTMA 4GIZA 4N8GA 1LGBC 3O9PA 2Y7WA 3KN3A 4NWCA 1KZ8A 2YPNA 4NE4A 1IZ1A 5DVFA 1IMEA 3K6XA 4RYAA 1HSJA 4H67A 4ZEBA 1SD3A 1ZMGA 2E1SA 2Q2AA 5H8FA 1ELJA 4XTCQ 2H98A 1XI6A 2CZKA 3N26A 5LTCA 3MVXA 2B4MA 4KD5A 5I56A 3A09A 2VP1A 3IJOB 1H76A 4M1VA 5I2KA 1IMBA 3H6VA 3LUYA 2H5YA 5KCJB 5K2XA 1M5CA 4P8BA 5FHNA 5FHMA 2O84X 1IEJA 2I3WA 2I58A 5JEIA 1A7LA 3IR1A 3FBPA 1IXCA 1KA1A 3LBSA 4TLMB 4NF6B 1B32A 2VD3A 4NMYA 3PPNA 4GLIA 3SETA 3PV0E 4MX6A 4I62A 1US4A 3Q29A 2OWTA 2QS2A 3CFXA 4PP0A 1FBDA 2PX1A 1A55A 2HPGA 2PFZA 1NH8A 4OTEA 4DDDA 1UIVA 2F3BA 1SI1A 3M3FA 4MBPA 1PB8A 5H8SA 4DCXA 3O29A 1LCFA 3PPPA 3G3HA 1LBBA 1FQCA 4H8JA 2ZYMA 3D1RA 2RINA 1FJ9A 3FXRA 1JEVA 3A29A 4X04A 4ELQA 1R9LA 1VE4A 4N6PA 1OLAA 4LZ8A 4Q5TA 3SZPA 3K1PA 4R73A 4GQOA 4R6HA 2F3DA 3T9VA 4H1XA 2FYIA 1TXFA 3FZVA 4XIGQ 4G77A 1VFDA 2O69A 4GX4A 4ZECA 1FCKA 5ISUA 4G68B 1PEBA 1MQIA 2AL4A 1P99A 1B52A 3BIHA 3LSFB 5CI5A 4PFRA 2NWJA 1USYH 2P3NA 4IO5A 3IB2A 4DCYA 3V8XB 3C36A 2Q9TA 4H65A 3O28A 5I2NA 2Y84A 2V3UA 3ISPA 3RTWB 1B3HA 1S9TA 1AH5A 4OVRA 4EXKA 2ONRA 3S9EA 1DTZA 3IAZA 3Q25A 1N0TA 4G4PA 2GHAA 1POTA 5AA4B 3LSWA 3O66A 4NHBA 3HCQA 4X1DA 4MH5A 3VVFA 2BJJX 1S50A 3E9XA 4P0GA 1CE2A 2Y7RA 4DXBA 1XVYA 4QFLA 4IGRA 3TELA 4EQBA 4PBHA 2XD3A 3ILUB 5EQ8A 4GVOA 5LDZA 3MBPA 4F29A 2XXXA 2IA4A 1FBFA 5I7IA 4FECA 3TCFA 4H0WA 1MXWA 5AA2D 4NTLA 1Y4CA 1FPLA 4N07A 3H03A 2Q2CA 2ZNTA 1MXUA 3VLUA 1N84A 4P11A 1IUDA 1OMPA 2YLNA 1JQFA 5A5XB 2OJTA 3HHGA 4NF8B 1PDAA 1B7UA 4KI0E 4YICA 2ESNA 1N3WA 5ITPA 4BLAA 4F3SA 2QJEA 3IO6A 4ELRA 1MH4A 3EPEA 1B7ZA 3MVWA 1B6HA 2FHYA 1UQWA 5H8NB 3FASA 3RYDA 1FPDA 1NH7A 5EQ7A 3SEWA 1IMDA 1CB6A 4KFQA 3L6HA 1LLSA 4F18A 1LFGA 3MAMA 3UA8A 1SYIA 4IO7A 4OWDA 3U1OA 1AOVA 1H45A 4OVJA 2OWZA 3G3GA 4EXLA 2WBDA 2V4CA 3VDFA 3K6WA 2F78A 3OD7A 5I56B 3EKIA 1DMBA 4DZ1A 3QK6A 4RA1A 2DXYA 1NV7A 5IAIA 4AB6A 1EYKA 5I59B 4XFEA 3DLNA 4PGNA 4QFOA 2Y5LA 4EF1A 2ZYNA 5FHOA 1XVXA 3TUSA 1MY2A 3KN7A 1NV0A 3TAJA 1B3LA 4HXVA 3T96B 3K0VA 2UYFA 1SW1A 4ZEFA 5JTYA 2F97A 4GXAA 3MSTA 3TQWA 2VGQA 2XWKA 2PBWA 4POWA 1CNQA 1NV6A 2FIXA 2REJA 3OO7A 3F11A 3FVGA 2I0CA 4AB5A 2THIA 3CG1A 2XXUA 4P56A 4OZ9A 3O6IA 1EZ9A 4YB5A 5I3SA 1FBPA 1D9QA 5H8QA 1NNFA 2XX8A 1FJ6A 3C31A 1TFDA 1A8EA 1SPIA 4N81A 2DQVA 1I69A 5H8HB 1K9YA 2V93A 3VLWA 5I57B 2O51A 4OETA 3RUMA 3MZ1A 2CEXA 4Z0IA 1FPIA 3TTNA 2QL3A 1QJMA 3Q28A 1XS5A 3VV5A 2DP8A 1Y4TA 5I58B 5EYGA 1YTVA 1YCJA 3SKPA 5CBRA 1ZJLA 2O7IA 2OK2A 3RPLB 5ELVA 3PTYA 1PBQA 3H3GA 5DVIA 1Y20A 4IO2A 3E13X 4H46A 4NF4A 3UK4A 5TP9A 4MNIA 5FTIA 3WAFA 4OENA 1VR5A 1EZPA 5JTYB 4P47A 1B5IA 4ZZEA 2E0SA 3LV0A 2VD2A 1EYIA 3SEYA 4KYDA 4N13A 3MZ9A 3W9VA 1LSTA 2DS9A 4NF6A 3T66A 2HEUA 4JWXA 3T93B 4DXCA 3M8UA 1A99A 3TDJA 2PT1A 4IR8A 3CI8A 2QS1A 1WDNA 3JZJA 3MW0A 4GX6A 2OCUA 3T9HB 5JK4A 5ITOA 2R8TA 2DXRA 5J1DA 1A54A 2B3BA 1JW1A 4G61A 4NF5B 4XEQA 4G68A 2PVUA 3E78A 1AL3A 2RF1A 4NF5A 3ROJA 3VFJA 2Z8EA 5HBCA 1D3KA 4LATA 3RLFE 1FTAA 5ESYA 2UXAA 4THIA 1MQJA 2ZYKA 4O8MA 5A5LA 1HSLA 2QVUA 2ABHA 1BK4A 3BFTA 2Z23A 2F7CA 2A5TA 5EQAA 3CFLA 3W15C 4O3AA 1QGXA 1URGA 1KA0A 2XXIA 3A3CA 2O1LA 4GBWA 1LAXA 1NUZA 1AIVA 2CEYA 4QFKA 2DVZA 1A40A 3TZAA 2PCRA 4KR5A 4OANA 2I3VA 1BLFA 2I48A 3EF7A 1TWYA 1QKBA 1OLCA 3BFUA 4PF6A 3ZS6A 4IY6A 4MEVA 3K1NA 4OHNA 2M8CA 4HCYA 4OVTA 1T0KA 1R9QA 3S2VA 2PFYA 4U22A
chains in the Genus database with same CATH topology
5EQ8A 5LDZA 4GWYA 4MJOA 3D1RA 2Y5KA 4GWZA 2B4LA 4P1EA 3LV0A 1FJ9A 4PC9A 1EYIA 1FBFA 1NUYA 4N8GA 4PBQA 4OA4A 5IZ3A 2FBPA 1DBZA 2JJKA 3A29A 4X04A 1NV7A 4MMPA 3W9VA 1LBVA 1EYKA 4PDHA 4XFEA 4MAGA 5J16A 1RDXA 1KZ8A 3LUZA 2F5XA 1DCUA 4PGNA 4GWXA 4NG7A 4PCDA 4DI4B 5I7IA 1FBHA 1VDWA 1YYZA 2Y5LA 4HE0A 4I40A 4XF5A 3SZPA 1NI9A 4MNCA 1IMEA 4N4UA 2F3DA 1NV0A 1EYJA 2DE2A 4PF8A 2DDKA 2MKZA 4DI3D 1LBZA 4HXVA 1FPEA 4IR8A 2DE3A 4GX3A 5IM2A 1FPLA 1LEVA 5IZ3B 4NX1A 4PE3A 3KBZA 5DW8A 3MSTA 4GX6A 2ZZVA 4JVIA 3B8BA 4N6DA 3HFUA 5JK4A 2R8TA 4O7MA 4AS5A 2BJIA 3FXBA 5LTCA 1FPKA 1XI6A 2CZKA 2QVVA 2XWKA 4GX4A 1INPA 2V3QA 1CNQA 2B4MA 3QMFA 1NUXA 4FBPA 4N17A 1NV6A 2FIXA 4P9KA 5EQ9A 2XA5A 4PETA 2Q74A 4G61A 1LBXA 4PBHA 4NN3A 5ET8A 5ET6A 5J1DA 2HHMA 3GYYA 4M1VA 3KC0A 4XEQA 4F19A 1IMFA 4P56A 4MNPA 1FBGA 1IMBA 1FBEA 1FSAA 1NV4A 3BIHA 4KXPA 1NUWA 5T3JA 4PFRA 5I3SA 1FBCA 1YXIA 3E78A 4I3YA 1FBPA 1D9QA 2HXRA 4JVCA 4OVSA 3ROJA 2P3NA 2WYKA 3MYUA 4I3EA 4QBAA 4P8BA 4HE2A 2Q8MA 2QFLA 3W9WA 1FJ6A 1FRPA 1AWBA 3NOHA 1FTAA 4YICA 2XWIA 4NGUA 5ESYA 1SPIA 4N81A 4N91A 2Q9TA 1NV3A 2KQZA 3CHGA 1IMAA 4O8MA 1LBYA 4O94A 2VPOA 4PDDA 5A5LA 1FPJA 1RDYA 1FPGA 1K9YA 2QVUA 2GQ1A 4MHFA 4OVPA 3RPLA 3ISPA 2XWOA 2WEFA 1NV2A 5EYHA 4F1VA 1BK4A 1Q9DA 3T0JA 4GWUA 4MIJA 1DK4A 2L5VA 3FBPA 4N6KA 5IGAA 4PAKA 3BIGA 5EQAA 4JVDA 4GWSA 2CEXA 1K9ZA 4O7IA 1KA1A 1IMCA 4OVRA 2XWVA 2FHYA 2HZKA 4UABA 3T1BA 5I5PA 4HCWA 1FPIA 1NV5A 2ZZXA 4N8YA 2KR0A 1NV1A 4QXDA 1QGXA 1LBWA 4GBVA 1FPBA 4GWWA 4H45A 3RYDA 1FPDA 4PFIA 5EQ7A 1RDZA 1IMDA 1KA0A 2FIEA 2CZHA 4HE1A 4X8RA 2VPNA 4MX6A 2WBBA 4GBWA 1NUZA 4PTKA 4PFBA 5IZ1A 4PAFA 5EYGA 3KC1A 2CEYA 2HZLA 4P3LA 4PGPA 2DVZA 4F18A 4P1LA 4X9TA 5CM6A 3E79A 2PCRA 4OANA 2DE4A 1G0HA 3IFCA 4N15A 4NHBA 1FBDA 4OVQA 3RPLB 5ET5A 5ET7A 4NF0A 3PTYA 3U65A 1FPFA 2HPGA 2FVZA 2PFZA 1YZ0A 4NAPA 2VT5A 4NQ8A 2XXKA 4MCOA 5F24A 3IFAA 2OWZA 4PF6A 4H46A 2WBDA 5IZZA 4MEVA 2F3BA 2CZIA 4LN5A 4MNIA 1G0IA 4HCYA 2QVRA 2V4CA 4OVTA 2OX3A 4PAIA 3B50A 2P3VA 4YZZA 5FBPA 2WYPA 2ZZWA 3EKIA 2WX9A 2QPQA 4F1UA 1JP4A 4AS4A 2PFYA 4P47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P1E A;  4PC9 A;  5I7I A;  4N8G A;  4PBQ A;  4OA4 A;  4X04 A;  4MMP A;  4PDH A;  4XFE A;  4MAG A;  4PGN A;  4NG7 A;  4PCD A;  4DI4 B;  4XF5 A;  4MNC A;  4N4U A;  4PF8 A;  4DI3 D;  5IM2 A;  4NX1 A;  4PE3 A;  2ZZV A;  4N6D A;  4O7M A;  3FXB A;  2XWK A;  5LTC A;  4N17 A;  4P9K A;  2XA5 A;  4PET A;  4NN3 A;  3GYY A;  4XEQ A;  4P56 A;  4MNP A;  4PFR A;  4OVS A;  2WYK A;  4P8B A;  4YIC A;  2XWI A;  4NGU A;  4N91 A;  4O8M A;  4O94 A;  2VPO A;  4PDD A;  4MHF A;  4OVP A;  2XWO A;  4MIJ A;  4N6K A;  5IGA A;  4PAK A;  2CEX A;  4OVR A;  5I5P A;  2XWV A;  2HZK A;  4UAB A;  2ZZX A;  4N8Y A;  4PFI A;  4X8R A;  2VPN A;  4MX6 A;  4PFB A;  4PAF A;  4P3L A;  2CEY A;  2HZL A;  4PGP A;  4P1L A;  5CM6 A;  4OAN A;  4N15 A;  4NHB A;  4OVQ A;  4NF0 A;  3U65 A;  2HPG A;  2PFZ A;  4NAP A;  4NQ8 A;  2XXK A;  4MCO A;  4PF6 A;  5IZZ A;  4MEV A;  4LN5 A;  4MNI A;  2V4C A;  4PAI A;  4OVT A;  4YZZ A;  3B50 A;  2WYP A;  2ZZW A;  2WX9 A;  4PBH A;  2PFY A;  4P47 A; 
#chains in the Genus database with same CATH topology
 3M3K A;  3K6U A;  4OFL A;  1SDX A;  4R6K A;  4TOZ A;  4PDH A;  4G68 C;  5AA2 A;  3PU5 A;  4IO6 A;  1XC1 A;  1UTB B;  4DXU A;  3LC8 A;  5IM2 A;  4PE5 B;  3TEP A;  2XXT A;  4N6D A;  4QHQ A;  1TT1 A;  1ANF A;  5KDT B;  1NUX A;  3N6T A;  3FVO A;  3TMG A;  2HHM A;  4KCD A;  3AXF A;  3CFZ A;  5I2N B;  1FSA A;  2NVU B;  2DVC A;  1NMU A;  3OO9 A;  4PFT A;  4MLQ A;  4I1D A;  3OSQ A;  3K00 A;  4GFR A;  1BP5 A;  4N91 A;  2NXO A;  3CHG A;  4BDN A;  1Y1M A;  3UGW A;  1FPJ A;  1FPG A;  4ZZA A;  2GQ1 A;  1NKX A;  4OVP A;  1Q35 A;  1MXX A;  2KLF A;  2ONK E;  1FQA A;  1FQB A;  2HZK A;  4UAB A;  4OQO A;  1NV5 A;  3ECR A;  3ZKL A;  5DTB A;  3SER A;  4H45 A;  5HPQ A;  1L5T A;  1FTO A;  1RDZ A;  1BIY A;  4PTK A;  5I2K B;  4ELP A;  4U21 A;  4XKN A;  4GWO A;  1JW4 A;  4GL0 A;  5H8H A;  3E3K A;  3KSJ A;  4ZDM A;  1SYH A;  1DPP A;  1RYX A;  2CZI A;  1EH3 A;  2UVJ A;  5DEX A;  2Y7K A;  4PAI A;  2F8D A;  1OVT A;  4FAJ A;  3CRB A;  3FVN A;  4R2B A;  1FW0 A;  3I6V A;  2JJK A;  4Z7E A;  4JDF A;  4MMP A;  1RDX A;  1VDW A;  4ISU A;  3TTR A;  3HST A;  2GFE A;  1MY3 A;  4RXL A;  5IZ3 B;  4H6D A;  5DW8 A;  4BDM A;  4AQ4 A;  1UTH B;  3MP8 A;  2X26 A;  4I3E A;  1INP A;  1FTM A;  3IB1 A;  4KYE A;  4MNP A;  1ZU0 A;  3IK6 B;  4I3Y A;  2HXR A;  1H43 A;  3MYU A;  4GD5 A;  2XWI A;  3PD9 A;  4BDO A;  1IIT A;  4O94 A;  4MHF A;  3WAE A;  3IOT A;  4ESW A;  2GH9 A;  1EZO A;  4FOR A;  4RK9 A;  1I6B A;  2FA7 A;  4N8Y A;  2KR0 A;  1FPB A;  3IOV A;  3MJN A;  2Z8F A;  3H6T A;  3KC1 A;  3PUW E;  4P1L A;  5I58 A;  4R75 A;  3E79 A;  1MDP 1;  2H25 A;  2XXR A;  2P0S A;  3EN3 A;  1LAH E;  3IX1 A;  3EHU A;  4F22 A;  2O68 A;  3THI A;  2DWH A;  2ZNU A;  4YZZ A;  1J1N A;  1QUJ A;  2B3F A;  2OX3 A;  3ILT B;  5TP9 B;  2WKY A;  3PD8 A;  3IOR A;  1B3F A;  1M5E A;  5CC2 A;  3FVK A;  1JP4 A;  1LFH A;  3IOU A;  4ZEI A;  3G3J A;  4FJP A;  1B1X A;  3OEM A;  4GWX A;  3OEK A;  4PQJ A;  1YYZ A;  4HE0 A;  2UVG A;  3N94 A;  4PF8 A;  4QSC A;  1SQY A;  2HAU A;  4I9D A;  1P1N A;  2V3Q A;  5I57 A;  5EQ9 A;  1R6Z A;  3FJG A;  4JBZ A;  3T9U A;  3TTK A;  1H44 A;  4NF4 B;  1SI0 A;  3KC0 A;  4OEU A;  2DSF A;  1MM7 A;  1M5F A;  3V83 A;  4KXP A;  2ONS A;  3W9W A;  3PPO A;  5CMM A;  3FXU A;  1FRP A;  1OQG A;  3RGY A;  2XXP A;  3KZG A;  1IMA A;  3DP8 A;  4F31 B;  3TCH A;  1Y1Z A;  1WOD A;  2D21 A;  3V89 B;  1KWH A;  1ZIU A;  4ECF A;  4MIJ A;  2XXV A;  4XXU A;  3BIG A;  4JVD A;  1MPC A;  1O7T A;  4JB7 A;  4C0R A;  4JWO A;  1PC3 A;  2ZZX A;  2IEE A;  1BKA A;  4GBV A;  3IB0 A;  4QRZ A;  4YKP A;  4JSO A;  3TKD A;  3RT8 A;  4PGP A;  5ICT A;  5CM6 A;  4XKP A;  2CMO A;  2V25 A;  2I0B A;  3IFC A;  4NF0 A;  4YKI A;  2QS3 A;  4G8H A;  4U4X A;  5CMC A;  3MQ9 A;  4WXJ A;  2GHB A;  4KHZ E;  1JNF A;  3VXB A;  1URS A;  2B65 A;  3MVZ A;  4MAG A;  4R2F A;  5EYF A;  4WED A;  1XOC A;  2DE2 A;  2UVH A;  2R71 A;  3PUY E;  5FTH A;  1UTH A;  3HV1 A;  4HS7 A;  3PUX E;  1TFA A;  4ZEK A;  3VE1 B;  2QVV A;  1FQF A;  2OLB A;  4PET A;  2XA5 A;  5ET8 A;  4NN3 A;  3R7X A;  5TU0 A;  2HCA A;  3GYY A;  3C32 A;  3HHF A;  3S4U A;  4ZED A;  4YAH X;  3MPK A;  4QF9 A;  1LBY A;  4LQ2 A;  3K6V A;  4O3B A;  2AYS A;  2WEF A;  4F1Y A;  1NNT A;  5DVJ A;  3H6W A;  2ZNS A;  1K9Z A;  1IMC A;  1B9J A;  2VOZ A;  3PGF A;  1FQD A;  4QFN A;  3PPR A;  4MLV A;  5L9S A;  2DYX A;  4ELO A;  4UAC A;  4Q0C A;  3B6Q A;  1ZBM A;  2PT2 A;  4IO3 A;  2YJP A;  1A8F A;  3CG3 A;  4X9T A;  4U1Z A;  3CVG A;  5I84 A;  4BDR A;  4H8I A;  4KCC A;  5AA1 A;  3QUJ A;  2Z8D A;  4LN5 A;  3UP9 A;  1O64 A;  1D4N A;  1GV8 A;  5H8Q B;  4YB6 A;  1Y3N A;  2F34 A;  1NNK A;  5AA3 A;  3MUQ A;  1SBP A;  1QW0 A;  1VFE A;  1B5J A;  3IJX B;  4OFO A;  1DBZ A;  2VHA A;  5J16 A;  2ZYO A;  3C9H A;  2F5X A;  4WKM A;  1FBH A;  3PMW A;  4FIM A;  4R9G A;  3CSG A;  4PFU A;  3P7I A;  4RPN A;  4JVI A;  1GR2 A;  4AS5 A;  1FPK A;  4FBP A;  3GZG A;  2AL5 A;  5ET6 A;  1UTB A;  3HN0 A;  1Y3Q A;  3SEU A;  2OZZ A;  4HW8 A;  4R9F A;  1UIU A;  3B6W A;  1FBG A;  4Q8R A;  1NUW A;  3C34 A;  1N3X A;  4LUB A;  4QBA A;  3U92 A;  4HE2 A;  4YKK A;  4NGU A;  2RCA A;  3C35 A;  1NV3 A;  3K4U A;  2VPO A;  1PB9 A;  1RDY A;  3RPL A;  5KDT A;  1MDQ A;  3MVY A;  4GWU A;  1DTG A;  4JWY A;  4NF8 A;  4C1U A;  1JVX A;  1IXG A;  4HCW A;  1NV1 A;  5AE4 A;  4GRK A;  1POY 1;  2CZH A;  4HE1 A;  3QAX A;  3O97 A;  3IOW A;  2O1M A;  4X48 A;  5LOM A;  4LVQ A;  3OSR A;  5EHS A;  5ET7 A;  3EQ1 A;  1YZ0 A;  2HFB A;  2XXK A;  3JV9 A;  4G2Z A;  2OBG A;  1M5B A;  4PFW A;  5F1Q A;  1G0I A;  4RPO A;  1MPB A;  1FTK A;  2WYP A;  2QMW A;  2QPQ A;  2D5W A;  4R72 A;  1XT8 A;  2W7Y A;  4IO4 A;  4GWZ A;  4MJO A;  5A5X A;  1ZLQ A;  1NUY A;  3Q27 A;  4PBQ A;  2ZMB A;  2H4I A;  5L9M A;  3GXA A;  1GTK A;  1MQD A;  4G8M A;  3KSX A;  2ANJ A;  4MFI A;  3MPL A;  2PYY A;  2I4B A;  1QUL A;  1ZKB A;  2DDK A;  3H6U A;  1B0H A;  4DI3 D;  3LSX A;  4EUO A;  2ZZV A;  2A5T B;  5B7D A;  4F3P A;  3RT6 B;  5I59 A;  1MM6 A;  1HSE A;  3FXB A;  3KJT A;  3T0J A;  3QMF A;  4OYV A;  3C4M A;  4LP2 B;  4F19 A;  1B3E A;  3E4R A;  3H06 B;  1H3D A;  1NV4 A;  1LB8 A;  5ICQ A;  1FBC A;  2XHD A;  2XD2 A;  3BKI B;  1NL5 A;  4E0X A;  3NOH A;  3VVE A;  3PMX A;  4LA9 A;  4PDD A;  1O63 A;  2DOJ A;  1NFT A;  4LZ5 A;  1NV2 A;  1Q9D A;  2V84 A;  1FQE A;  3LR1 A;  3I3V A;  3SEX A;  3LSL A;  3T1B A;  1LBW A;  1LCT A;  4LQ5 A;  4FE8 A;  4PFI A;  5CMK A;  2RC7 A;  4NWD A;  3PUZ E;  4PAF A;  4DE8 A;  3QXM A;  1MY4 A;  2DWI A;  1B7H A;  1EU8 A;  4U23 A;  1LFI A;  4IGT A;  1LAG E;  3N5L A;  1B40 A;  1AMF A;  2QVR A;  4M4G A;  4GXS B;  5CMB A;  2V3T A;  5L8D A;  4RJZ A;  4F39 A;  1MS7 A;  4U4S A;  2Q8J A;  2I4C A;  3KJ7 A;  4NG7 A;  4JSD A;  4I40 A;  1B1H A;  4X1B A;  3U94 A;  1US5 A;  4NX1 A;  4PE3 A;  4WEP A;  1B46 A;  3MP1 A;  4P0I A;  2I6E A;  1P1U A;  3KBR A;  4ND9 A;  4O7M A;  3S9L C;  2F6P A;  1F9B A;  2ALU A;  5B70 A;  4Q30 B;  4YU0 A;  1LBX A;  3VVD A;  1P1Q A;  1PB7 A;  2Y7P A;  1ZTY A;  4IY5 A;  1USY E;  1MRP A;  1B58 A;  3HO7 A;  1M5D A;  4QFP A;  2LAO A;  2H9B A;  1JW5 A;  4RK2 A;  1DSN A;  4ZE8 A;  2H99 A;  2XWO A;  5EYH A;  3FJ7 A;  3G7W A;  1JVY A;  3JYR A;  4ZS9 A;  4GWW A;  4BDQ A;  3MP6 A;  3T9X B;  1MPD A;  3QSL A;  3A3U A;  1B51 A;  4P3L A;  4F3B A;  4KPT A;  2R9J A;  1II5 A;  2DE4 A;  1G0H A;  4N15 A;  3FUZ A;  1MXV A;  3TYH A;  5H8N A;  3MWB A;  3RNN A;  4NAP A;  4NQ8 A;  4MCO A;  1QVS A;  5CBS A;  3PPQ A;  3FXQ A;  3B50 A;  2P3V A;  3UN6 A;  4G8N A;  1Y9U A;  5EHM A;  4O3C A;  2F7B A;  3O6G A;  3L6G A;  2FBP A;  3OO8 A;  1MG1 A;  2NUV A;  3PUV E;  4PCD A;  4POX A;  3KFM A;  3K02 A;  4XF5 A;  1NI9 A;  1B5H A;  3UIF A;  4N4U A;  5KZT A;  3DP6 A;  4YMA A;  2MKZ A;  1LBZ A;  2RKM A;  3PMV A;  4NED A;  2AIX A;  2RC8 A;  4UA8 A;  1B4H A;  2O6A A;  1R1N A;  2Y7I A;  3R26 A;  4GL8 A;  3TPA A;  4DIG A;  2ZXT A;  1B0L A;  4OFJ A;  3OEN A;  4E0W A;  4OER A;  1SVX B;  2XXW A;  4OVS A;  4YKJ A;  1QUK A;  2QFL A;  1AWB A;  1OQH A;  3H4Z A;  4EF2 A;  2P1S A;  1SW2 A;  3FD3 A;  3IL1 B;  4YB7 A;  3ONM A;  2L5V A;  1I6Q A;  2QMX A;  3FJM A;  4O7I A;  2G93 A;  4RNS A;  3M3L A;  4IB2 A;  2F35 A;  2FIE A;  3CR9 A;  4X8R A;  3TTL A;  5IZ1 A;  2WBB A;  4PFB A;  3CIJ A;  3FIR A;  3SEV A;  2Q89 A;  4XKR A;  5AA4 A;  4BDL A;  4HTG A;  4MF3 A;  4OES A;  2QSX A;  5F24 A;  2XXH A;  3OOA A;  3QYT A;  1MXY A;  4U2R A;  1N7X A;  3ZSF A;  5KCJ A;  2ZZW A;  4AS4 A;  2Y5K A;  1MXZ A;  2HXW A;  5IZ3 A;  3EHT A;  1OIB A;  1MQH A;  4OXV A;  1XHY A;  1OVB A;  2X7P A;  2RC9 A;  1DCU A;  4H5F A;  4DI4 B;  3TQL A;  4MNC A;  3I5O A;  4EDP A;  3KG2 A;  1MY0 A;  1EYJ A;  1MQG A;  4KQP A;  3KEI A;  1FPE A;  4GX3 A;  3KBZ A;  1LB9 A;  3C33 A;  5L9O A;  3G3I A;  3VLV A;  4F2O A;  5CRY A;  4N17 A;  4YMB A;  4OEV A;  2Q74 A;  4LZ7 A;  3FGS A;  2XX9 A;  5T3J A;  1JET A;  2F7A A;  1GVC A;  4JVC A;  2WYK A;  5BWJ A;  2RCB A;  1MY1 A;  3S9N C;  3OEL A;  3Q26 A;  1YPN A;  1JEU A;  4N6K A;  2HQ0 A;  3FV2 A;  1D9V A;  4GWS A;  3B7D A;  3DEL B;  2XWV A;  1ATG A;  4H5G A;  3FV1 A;  4DLD A;  4EQ9 A;  3U72 A;  2HZL A;  2D3I A;  1S7Y A;  4F2Q A;  5ET5 A;  1RKM A;  1Q1K A;  5IKB A;  2X7Q A;  5H8F B;  1GGG A;  1MH3 A;  5DT6 A;  5FBP A;  1D9Y A;  3K01 A;  2WX9 A;  4QSD A;  4R6Y A;  4LON B;  4P1E A;  2B4L A;  2GRV A;  4U1O A;  2A5S A;  2XX7 A;  4KYS A;  3OO6 A;  1LBC A;  2XXQ A;  3RTF B;  1LBV A;  3LUZ A;  3SES A;  3UOR A;  3BBR A;  5AA2 B;  3GBB A;  4L17 A;  2I49 A;  2DE3 A;  3MC2 A;  1LEV A;  3B8B A;  3HFU A;  3DP4 A;  5TPA B;  4P9K A;  3R6U A;  3ODB A;  3D4G A;  4ONY A;  3HPI A;  4RY1 A;  3T22 A;  1IMF A;  1FBE A;  3QIM A;  1RYO A;  3B6T A;  3G3K A;  2HAV A;  4JXI A;  4F3G A;  3QUF A;  1B3G A;  2O7U A;  1P1O A;  2KQZ A;  4TQU Q;  3D4C A;  4QSE A;  1P1W A;  5F7V A;  2NOO A;  4F1V A;  2DWJ A;  3GLB A;  3S9M C;  1DK4 A;  3U8Q A;  5IGA A;  4PAK A;  5I5P A;  1URD A;  4C1T A;  4TLL B;  3TOD A;  1IXI A;  3KN8 A;  5DEX B;  4OMB A;  2REG A;  4FAT A;  1WVJ A;  1SW5 A;  1LAF E;  4OVQ A;  2UVI A;  1NNP A;  3U65 A;  1FPF A;  2FVZ A;  1I6A A;  5IZZ A;  1DPE A;  4K3F A;  1N04 A;  3IO4 A;  1FTL A;  3RY3 A;  3N6U A;  5HM4 B;  3U93 A;  3K2D A;  4PC9 A;  1PBP A;  4OA4 A;  1VSO A;  5TPA A;  3O6H A;  2G29 A;  2Z22 A;  4EQ7 A;  3H7M A;  3TCG A;  3G3F A;  3KGC A;  3TFL A;  3RPW A;  3KOT A;  4GF8 A;  2QS4 A;  1Z7M E;  1N7W A;  2FNC A;  4R74 A;  2DWA A;  2BJI A;  2F36 A;  2QRY A;  1IXH A;  1Z7N E;  4FEB A;  2XXY A;  3OMB A;  1B05 A;  1YXI A;  1QUI A;  5BUU A;  3O2A A;  4GOT A;  2Q8M A;  3MZB A;  2PMS A;  4ZE9 A;  2OWS A;  4XKQ A;  3OXN A;  5DYH A;  4PFY A;  3FAT A;  4FED A;  2F6G A;  2R6G E;  5M2V A;  3DM0 A;  1YAE A;  3RQT A;  1N76 A;  1FTJ A;  2CZL A;  1BTJ A;  3CSB A;  2Q88 A;  3K1M A;  4QXD A;  5K2Y A;  4ESX A;  3EHS A;  3GBA A;  3RN8 A;  2VPN A;  1DOT A;  1SW4 A;  3SDF A;  1Y3P A;  3USD A;  4I8C A;  1B2H A;  3ZKK A;  3VXC A;  2P2A A;  1IQ7 A;  2UYE A;  1B4Z A;  2VT5 A;  3IFA A;  1QKA A;  3KOS A;  1IIW A;  4F1U A;  4GWY A;  3V5A A;  3TTM A;  4GIZ A;  4N8G A;  1LGB C;  3O9P A;  2Y7W A;  3KN3 A;  4NWC A;  1KZ8 A;  2YPN A;  4NE4 A;  1IZ1 A;  5DVF A;  1IME A;  3K6X A;  4RYA A;  1HSJ A;  4H67 A;  4ZEB A;  1SD3 A;  1ZMG A;  2E1S A;  2Q2A A;  5H8F A;  1ELJ A;  4XTC Q;  2H98 A;  1XI6 A;  2CZK A;  3N26 A;  5LTC A;  3MVX A;  2B4M A;  4KD5 A;  5I56 A;  3A09 A;  2VP1 A;  3IJO B;  1H76 A;  4M1V A;  5I2K A;  1IMB A;  3H6V A;  3LUY A;  2H5Y A;  5KCJ B;  5K2X A;  1M5C A;  4P8B A;  5FHN A;  5FHM A;  2O84 X;  1IEJ A;  2I3W A;  2I58 A;  5JEI A;  1A7L A;  3IR1 A;  3FBP A;  1IXC A;  1KA1 A;  3LBS A;  4TLM B;  4NF6 B;  1B32 A;  2VD3 A;  4NMY A;  3PPN A;  4GLI A;  3SET A;  3PV0 E;  4MX6 A;  4I62 A;  1US4 A;  3Q29 A;  2OWT A;  2QS2 A;  3CFX A;  4PP0 A;  1FBD A;  2PX1 A;  1A55 A;  2HPG A;  2PFZ A;  1NH8 A;  4OTE A;  4DDD A;  1UIV A;  2F3B A;  1SI1 A;  3M3F A;  4MBP A;  1PB8 A;  5H8S A;  4DCX A;  3O29 A;  1LCF A;  3PPP A;  3G3H A;  1LBB A;  1FQC A;  4H8J A;  2ZYM A;  3D1R A;  2RIN A;  1FJ9 A;  3FXR A;  1JEV A;  3A29 A;  4X04 A;  4ELQ A;  1R9L A;  1VE4 A;  4N6P A;  1OLA A;  4LZ8 A;  4Q5T A;  3SZP A;  3K1P A;  4R73 A;  4GQO A;  4R6H A;  2F3D A;  3T9V A;  4H1X A;  2FYI A;  1TXF A;  3FZV A;  4XIG Q;  4G77 A;  1VFD A;  2O69 A;  4GX4 A;  4ZEC A;  1FCK A;  5ISU A;  4G68 B;  1PEB A;  1MQI A;  2AL4 A;  1P99 A;  1B52 A;  3BIH A;  3LSF B;  5CI5 A;  4PFR A;  2NWJ A;  1USY H;  2P3N A;  4IO5 A;  3IB2 A;  4DCY A;  3V8X B;  3C36 A;  2Q9T A;  4H65 A;  3O28 A;  5I2N A;  2Y84 A;  2V3U A;  3ISP A;  3RTW B;  1B3H A;  1S9T A;  1AH5 A;  4OVR A;  4EXK A;  2ONR A;  3S9E A;  1DTZ A;  3IAZ A;  3Q25 A;  1N0T A;  4G4P A;  2GHA A;  1POT A;  5AA4 B;  3LSW A;  3O66 A;  4NHB A;  3HCQ A;  4X1D A;  4MH5 A;  3VVF A;  2BJJ X;  1S50 A;  3E9X A;  4P0G A;  1CE2 A;  2Y7R A;  4DXB A;  1XVY A;  4QFL A;  4IGR A;  3TEL A;  4EQB A;  4PBH A;  2XD3 A;  3ILU B;  5EQ8 A;  4GVO A;  5LDZ A;  3MBP A;  4F29 A;  2XXX A;  2IA4 A;  1FBF A;  5I7I A;  4FEC A;  3TCF A;  4H0W A;  1MXW A;  5AA2 D;  4NTL A;  1Y4C A;  1FPL A;  4N07 A;  3H03 A;  2Q2C A;  2ZNT A;  1MXU A;  3VLU A;  1N84 A;  4P11 A;  1IUD A;  1OMP A;  2YLN A;  1JQF A;  5A5X B;  2OJT A;  3HHG A;  4NF8 B;  1PDA A;  1B7U A;  4KI0 E;  4YIC A;  2ESN A;  1N3W A;  5ITP A;  4BLA A;  4F3S A;  2QJE A;  3IO6 A;  4ELR A;  1MH4 A;  3EPE A;  1B7Z A;  3MVW A;  1B6H A;  2FHY A;  1UQW A;  5H8N B;  3FAS A;  3RYD A;  1FPD A;  1NH7 A;  5EQ7 A;  3SEW A;  1IMD A;  1CB6 A;  4KFQ A;  3L6H A;  1LLS A;  4F18 A;  1LFG A;  3MAM A;  3UA8 A;  1SYI A;  4IO7 A;  4OWD A;  3U1O A;  1AOV A;  1H45 A;  4OVJ A;  2OWZ A;  3G3G A;  4EXL A;  2WBD A;  2V4C A;  3VDF A;  3K6W A;  2F78 A;  3OD7 A;  5I56 B;  3EKI A;  1DMB A;  4DZ1 A;  3QK6 A;  4RA1 A;  2DXY A;  1NV7 A;  5IAI A;  4AB6 A;  1EYK A;  5I59 B;  4XFE A;  3DLN A;  4PGN A;  4QFO A;  2Y5L A;  4EF1 A;  2ZYN A;  5FHO A;  1XVX A;  3TUS A;  1MY2 A;  3KN7 A;  1NV0 A;  3TAJ A;  1B3L A;  4HXV A;  3T96 B;  3K0V A;  2UYF A;  1SW1 A;  4ZEF A;  5JTY A;  2F97 A;  4GXA A;  3MST A;  3TQW A;  2VGQ A;  2XWK A;  2PBW A;  4POW A;  1CNQ A;  1NV6 A;  2FIX A;  2REJ A;  3OO7 A;  3F11 A;  3FVG A;  2I0C A;  4AB5 A;  2THI A;  3CG1 A;  2XXU A;  4P56 A;  4OZ9 A;  3O6I A;  1EZ9 A;  4YB5 A;  5I3S A;  1FBP A;  1D9Q A;  5H8Q A;  1NNF A;  2XX8 A;  1FJ6 A;  3C31 A;  1TFD A;  1A8E A;  1SPI A;  4N81 A;  2DQV A;  1I69 A;  5H8H B;  1K9Y A;  2V93 A;  3VLW A;  5I57 B;  2O51 A;  4OET A;  3RUM A;  3MZ1 A;  2CEX A;  4Z0I A;  1FPI A;  3TTN A;  2QL3 A;  1QJM A;  3Q28 A;  1XS5 A;  3VV5 A;  2DP8 A;  1Y4T A;  5I58 B;  5EYG A;  1YTV A;  1YCJ A;  3SKP A;  5CBR A;  1ZJL A;  2O7I A;  2OK2 A;  3RPL B;  5ELV A;  3PTY A;  1PBQ A;  3H3G A;  5DVI A;  1Y20 A;  4IO2 A;  3E13 X;  4H46 A;  4NF4 A;  3UK4 A;  5TP9 A;  4MNI A;  5FTI A;  3WAF A;  4OEN A;  1VR5 A;  1EZP A;  5JTY B;  4P47 A;  1B5I A;  4ZZE A;  2E0S A;  3LV0 A;  2VD2 A;  1EYI A;  3SEY A;  4KYD A;  4N13 A;  3MZ9 A;  3W9V A;  1LST A;  2DS9 A;  4NF6 A;  3T66 A;  2HEU A;  4JWX A;  3T93 B;  4DXC A;  3M8U A;  1A99 A;  3TDJ A;  2PT1 A;  4IR8 A;  3CI8 A;  2QS1 A;  1WDN A;  3JZJ A;  3MW0 A;  4GX6 A;  2OCU A;  3T9H B;  5JK4 A;  5ITO A;  2R8T A;  2DXR A;  5J1D A;  1A54 A;  2B3B A;  1JW1 A;  4G61 A;  4NF5 B;  4XEQ A;  4G68 A;  2PVU A;  3E78 A;  1AL3 A;  2RF1 A;  4NF5 A;  3ROJ A;  3VFJ A;  2Z8E A;  5HBC A;  1D3K A;  4LAT A;  3RLF E;  1FTA A;  5ESY A;  2UXA A;  4THI A;  1MQJ A;  2ZYK A;  4O8M A;  5A5L A;  1HSL A;  2QVU A;  2ABH A;  1BK4 A;  3BFT A;  2Z23 A;  2F7C A;  2A5T A;  5EQA A;  3CFL A;  3W15 C;  4O3A A;  1QGX A;  1URG A;  1KA0 A;  2XXI A;  3A3C A;  2O1L A;  4GBW A;  1LAX A;  1NUZ A;  1AIV A;  2CEY A;  4QFK A;  2DVZ A;  1A40 A;  3TZA A;  2PCR A;  4KR5 A;  4OAN A;  2I3V A;  1BLF A;  2I48 A;  3EF7 A;  1TWY A;  1QKB A;  1OLC A;  3BFU A;  4PF6 A;  3ZS6 A;  4IY6 A;  4MEV A;  3K1N A;  4OHN A;  2M8C A;  4HCY A;  4OVT A;  1T0K A;  1R9Q A;  3S2V A;  2PFY A;  4U22 A; 
#chains in the Genus database with same CATH homology
 5EQ8 A;  5LDZ A;  4GWY A;  4MJO A;  3D1R A;  2Y5K A;  4GWZ A;  2B4L A;  4P1E A;  3LV0 A;  1FJ9 A;  4PC9 A;  1EYI A;  1FBF A;  1NUY A;  4N8G A;  4PBQ A;  4OA4 A;  5IZ3 A;  2FBP A;  1DBZ A;  2JJK A;  3A29 A;  4X04 A;  1NV7 A;  4MMP A;  3W9V A;  1LBV A;  1EYK A;  4PDH A;  4XFE A;  4MAG A;  5J16 A;  1RDX A;  1KZ8 A;  3LUZ A;  2F5X A;  1DCU A;  4PGN A;  4GWX A;  4NG7 A;  4PCD A;  4DI4 B;  5I7I A;  1FBH A;  1VDW A;  1YYZ A;  2Y5L A;  4HE0 A;  4I40 A;  4XF5 A;  3SZP A;  1NI9 A;  4MNC A;  1IME A;  4N4U A;  2F3D A;  1NV0 A;  1EYJ A;  2DE2 A;  4PF8 A;  2DDK A;  2MKZ A;  4DI3 D;  1LBZ A;  4HXV A;  1FPE A;  4IR8 A;  2DE3 A;  4GX3 A;  5IM2 A;  1FPL A;  1LEV A;  5IZ3 B;  4NX1 A;  4PE3 A;  3KBZ A;  5DW8 A;  3MST A;  4GX6 A;  2ZZV A;  4JVI A;  3B8B A;  4N6D A;  3HFU A;  5JK4 A;  2R8T A;  4O7M A;  4AS5 A;  2BJI A;  3FXB A;  5LTC A;  1FPK A;  1XI6 A;  2CZK A;  2QVV A;  2XWK A;  4GX4 A;  1INP A;  2V3Q A;  1CNQ A;  2B4M A;  3QMF A;  1NUX A;  4FBP A;  4N17 A;  1NV6 A;  2FIX A;  4P9K A;  5EQ9 A;  2XA5 A;  4PET A;  2Q74 A;  4G61 A;  1LBX A;  4PBH A;  4NN3 A;  5ET8 A;  5ET6 A;  5J1D A;  2HHM A;  3GYY A;  4M1V A;  3KC0 A;  4XEQ A;  4F19 A;  1IMF A;  4P56 A;  4MNP A;  1FBG A;  1IMB A;  1FBE A;  1FSA A;  1NV4 A;  3BIH A;  4KXP A;  1NUW A;  5T3J A;  4PFR A;  5I3S A;  1FBC A;  1YXI A;  3E78 A;  4I3Y A;  1FBP A;  1D9Q A;  2HXR A;  4JVC A;  4OVS A;  3ROJ A;  2P3N A;  2WYK A;  3MYU A;  4I3E A;  4QBA A;  4P8B A;  4HE2 A;  2Q8M A;  2QFL A;  3W9W A;  1FJ6 A;  1FRP A;  1AWB A;  3NOH A;  1FTA A;  4YIC A;  2XWI A;  4NGU A;  5ESY A;  1SPI A;  4N81 A;  4N91 A;  2Q9T A;  1NV3 A;  2KQZ A;  3CHG A;  1IMA A;  4O8M A;  1LBY A;  4O94 A;  2VPO A;  4PDD A;  5A5L A;  1FPJ A;  1RDY A;  1FPG A;  1K9Y A;  2QVU A;  2GQ1 A;  4MHF A;  4OVP A;  3RPL A;  3ISP A;  2XWO A;  2WEF A;  1NV2 A;  5EYH A;  4F1V A;  1BK4 A;  1Q9D A;  3T0J A;  4GWU A;  4MIJ A;  1DK4 A;  2L5V A;  3FBP A;  4N6K A;  5IGA A;  4PAK A;  3BIG A;  5EQA A;  4JVD A;  4GWS A;  2CEX A;  1K9Z A;  4O7I A;  1KA1 A;  1IMC A;  4OVR A;  2XWV A;  2FHY A;  2HZK A;  4UAB A;  3T1B A;  5I5P A;  4HCW A;  1FPI A;  1NV5 A;  2ZZX A;  4N8Y A;  2KR0 A;  1NV1 A;  4QXD A;  1QGX A;  1LBW A;  4GBV A;  1FPB A;  4GWW A;  4H45 A;  3RYD A;  1FPD A;  4PFI A;  5EQ7 A;  1RDZ A;  1IMD A;  1KA0 A;  2FIE A;  2CZH A;  4HE1 A;  4X8R A;  2VPN A;  4MX6 A;  2WBB A;  4GBW A;  1NUZ A;  4PTK A;  4PFB A;  5IZ1 A;  4PAF A;  5EYG A;  3KC1 A;  2CEY A;  2HZL A;  4P3L A;  4PGP A;  2DVZ A;  4F18 A;  4P1L A;  4X9T A;  5CM6 A;  3E79 A;  2PCR A;  4OAN A;  2DE4 A;  1G0H A;  3IFC A;  4N15 A;  4NHB A;  1FBD A;  4OVQ A;  3RPL B;  5ET5 A;  5ET7 A;  4NF0 A;  3PTY A;  3U65 A;  1FPF A;  2HPG A;  2FVZ A;  2PFZ A;  1YZ0 A;  4NAP A;  2VT5 A;  4NQ8 A;  2XXK A;  4MCO A;  5F24 A;  3IFA A;  2OWZ A;  4PF6 A;  4H46 A;  2WBD A;  5IZZ A;  4MEV A;  2F3B A;  2CZI A;  4LN5 A;  4MNI A;  1G0I A;  4HCY A;  2QVR A;  2V4C A;  4OVT A;  2OX3 A;  4PAI A;  3B50 A;  2P3V A;  4YZZ A;  5FBP A;  2WYP A;  2ZZW A;  3EKI A;  2WX9 A;  2QPQ A;  4F1U A;  1JP4 A;  4AS4 A;  2PFY A;  4P47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...