4MIJA

Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. js666 (bpro_3107), target efi-510173, with bound alpha/beta d-galacturonate, space group p21
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
302
structure length
302
Chain Sequence
TEFRSADTHNADDYPTVAAVKYMGELLEKKSGGKHKIKVFNKQALGSEKETIDQVKIGALDFTRVNVGPMNAICPLTQVPTMPFLFSSIAHMRKSLDGPVGDEILKSCESAGFIGLAFYDSGARSIYAKKPIRTVADAKGLKIRVQQSDLWVALVSAMGANATPMPYGEVYTGLKTGLIDAAENNIPSFDTAKHVEAVKVYSKTEHSMAPEILVMSKIIYDKLPKAEQDMIRAAAKESVAFERQKWDEQEAKSLANVKAAGAEIVEVDKKSFQAVMGPVYDKFMTTPDMKRLVKAVQDTKAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Polaromonas
molecule tags Transport protein
total genus 116
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2013-08-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mijA00
2XWOA 2XWKA 4PFIA 4PBHA 4P9KA 2HZKA 2HZLA 4DI3D 4MIJA 4P1LA 4YZZA 4MMPA 4XFEA 2WYPA 4XF5A 4NQ8A 2XWVA 4PAKA 4X8RA 4PAIA 2PFYA 4N91A 4OANA 4O94A 4PDDA 2PFZA 4NX1A 4N17A 4P3LA 4PGPA 4O8MA 2XA5A 5IGAA 4NAPA 4PC9A 4UABA 4PBQA 4PF8A 4LN5A 4MEVA 4N15A 5LTCA 4PAFA 4MX6A 4O7MA 4OVTA 2VPNA 4PFRA 4P1EA 4DI4B 2VPOA 4PETA 4P47A 2ZZVA 4MNIA 3B50A 2WYKA 2V4CA 4PGNA 2HPGA 4MNCA 5I5PA 4NGUA 3U65A 5I7IA 5IZZA 4PFBA 2XWIA 3FXBA 4MHFA 4OA4A 5IM2A 4OVPA 4OVSA 4PCDA 4P8BA 4NG7A 4PDHA 4MNPA 2CEYA 4N8GA 4MAGA 2XXKA 4X04A 4PF6A 4P56A 4NF0A 4XEQA 4MCOA 4NN3A 4NHBA 4N6DA 4OVQA 4N6KA 2CEXA 4N4UA 4OVRA 2ZZWA 4YICA 3GYYA 4N8YA 2ZZXA 4PE3A 2WX9A 5CM6A
chains in the Genus database with same CATH superfamily
1I6AA 4BDRA 3OXNA 5BUUA 4MMPA 3M3FA 2THIA 3IR1A 3IFAA 3S4UA 1NL5A 4F22A 3D4CA 2WBDA 4G8HA 5CRYA 5B7DA 4PAIA 3F11A 5IZ1A 1IXIA 1RKMA 2BJJX 2CZLA 4AB5A 1KA0A 1UTHB 3RN8A 1B5HA 5I59B 1FQBA 4PBQA 1LFHA 2YPNA 3MAMA 4KFQA 5I57B 3EF7A 2VPNA 4HE0A 2ZMBA 3HN0A 4KHZE 2ONRA 2QMXA 1ZIUA 3VLVA 1N76A 3I6VA 3KFMA 4ELPA 4BLAA 2ZXTA 3G3IA 1B1HA 5I5PA 1LBCA 4G4PA 4WKMA 3UA8A 3HSTA 1IIWA 2Y7RA 4C1UA 1CNQA 5FTIA 2R9JA 3DP6A 5KDTA 3SEXA 1O63A 4H5FA 2ANJA 1Y3NA 1AOVA 2DYXA 4JXIA 5JTYA 2VD3A 3U1OA 1R6ZA 5L9MA 2FYIA 2I3WA 3BIHA 3EN3A 4EF1A 3PPRA 1B3GA 4I3EA 4XKNA 4QBAA 3O29A 2RC7A 4ZEKA 4LP2B 1MY1A 4RK9A 4NF6B 1NNPA 3CFLA 1B2HA 3I3VA 4NF8B 3WAEA 4GL8A 4FECA 4QFOA 2B3BA 2HZKA 1TFAA 2PVUA 3OOAA 2DQVA 1FBDA 4UACA 4FEBA 2WYPA 3MPLA 3E13X 2L5VA 4ZE9A 4R75A 4U1ZA 4JB7A 4F1VA 2RCBA 3A3CA 4JWOA 4PGPA 1ZJLA 1LB8A 2Z23A 2F78A 4YB5A 1T0KA 4U4SA 4MEVA 4N15A 1IMDA 1GV8A 3QUJA 3VVFA 4RY1A 4MH5A 4OEUA 1SYIA 2A5SA 5I56A 1QW0A 1MXWA 4YB6A 3QYTA 2IA4A 3PD9A 1IZ1A 2F7AA 1SW4A 4PP0A 2Q74A 4IO6A 3RY3A 5CBSA 1ELJA 4N13A 5I2NA 1XHYA 1PBPA 2XWIA 3UN6A 4MLVA 1MY3A 4JVCA 1R9QA 3MP6A 5EYFA 3ZKKA 5H8QB 5DYHA 1FPEA 4NE4A 4LZ5A 4XEQA 4Q8RA 1HSJA 5ICQA 2ABHA 4BDMA 1GGGA 4N6KA 2DOJA 4OVRA 4BDQA 4YICA 1MY2A 4ZEDA 5H8HA 1MS7A 1S7YA 2OWSA 4N07A 2UXAA 4HE1A 5DVIA 4F2OA 3S9LC 1FJ6A 1UTBB 4OEVA 1P1OA 1QVSA 1INPA 2F5XA 1OMPA 4RJZA 4P0GA 3FVKA 5LOMA 2F8DA 4OFOA 2PFYA 4KYEA 2QS1A 1H76A 3MZBA 3T9UA 1FBHA 2Q8MA 4DXBA 1VE4A 3W9VA 4LATA 3IO6A 4O8MA 5J16A 2AL4A 1YYZA 2OK2A 5ET5A 4GRKA 4G8MA 4R72A 2WKYA 4ND9A 3OMBA 4H6DA 3SEUA 3MSTA 3N6TA 3V83A 5F7VA 3O6IA 5ESYA 4O7MA 1FTMA 3GLBA 1IUDA 1BKAA 3GBAA 1YAEA 4OZ9A 3ZSFA 4FIMA 4LUBA 3ILUB 3IOUA 4HE2A 4YB7A 4IB2A 3U72A 4OESA 3IB0A 2D5WA 3IOVA 3Q29A 2RC8A 1D9YA 3TPAA 4RXLA 1Y4CA 1YPNA 3D4GA 4G68A 4WXJA 3OO7A 3U8QA 4G68C 2P3NA 2V3UA 3ODBA 2LAOA 3G3HA 4R74A 5AA1A 3KJ7A 3RQTA 2XHDA 4X04A 1XVXA 4NHBA 5EQAA 5H8SA 1NNFA 4DCXA 1K9ZA 1IMEA 3FJ7A 2DXYA 3O6GA 2ONKE 2CZKA 4N6PA 4OVJA 5IKBA 3M3KA 3TTMA 2I0CA 4TOZA 2OLBA 2XXPA 2F34A 4DI3D 1P1WA 4R73A 4NF5A 2PYYA 1B40A 4E0XA 2W7YA 1VFDA 3GZGA 3KOSA 3G3KA 1NV7A 3HHGA 2PFZA 3KBRA 4NX1A 1LB9A 3TEPA 4KD5A 1LFIA 4DDDA 3OENA 2Y7IA 1LBBA 3PPOA 1B4HA 2X26A 2HFBA 3B7DA 1NUWA 5FHMA 4ZEFA 1UQWA 2RC9A 2FA7A 1EZPA 4JWXA 2H25A 4ZDMA 2XD2A 2F3BA 3O66A 2H99A 3U65A 3QIMA 1NV5A 4OA4A 1EH3A 2DWIA 2ZNUA 1GVCA 5CMMA 4IO5A 3PUVE 4MAGA 5L8DA 2Q2CA 1WVJA 1QUIA 4OMBA 1JQFA 1RYOA 2QRYA 3CFZA 1FQEA 3IB2A 3TTNA 3IAZA 3T96B 4ZE8A 2ZZWA 1N84A 2O84X 1US4A 4KYSA 3CG3A 1QULA 4F39A 3SEVA 1FSAA 1BLFA 3G3FA 3V5AA 3PUYE 3ECRA 4MJOA 1IXHA 5BWJA 1EYIA 2ALUA 3S9EA 2G29A 5EYGA 3IOWA 4N91A 1NV1A 3L6HA 1URGA 4ESWA 3N26A 3E4RA 4JSOA 3GBBA 1FW0A 2O7UA 2GHBA 4DXUA 2ZYOA 4IO3A 4YMBA 3RTWB 5H8NA 2ZZVA 1B7HA 1IXCA 1FQDA 1JEUA 5IZ3B 1IEJA 4YKPA 4NF4B 3R7XA 1D9QA 3FVOA 2QPQA 2O51A 3IB1A 3FXBA 5AA4B 2PT2A 2F36A 3MPKA 1B0HA 3CIJA 4PCDA 5I58A 3KG2A 1B5JA 4DXCA 1FBEA 3OEMA 1MXXA 2PT1A 4PTKA 1OQHA 2UYEA 4OVQA 3CSGA 4GBVA 1NV4A 1B5IA 1B3LA 1FTOA 1LAXA 4PE3A 1FQFA 2VT5A 3CG1A 3U93A 5A5XA 1OVTA 2YJPA 3USDA 3VVDA 1NNTA 4POXA 1VR5A 2O69A 4GF8A 2A5TA 4K3FA 5CMBA 1MXUA 1LBZA 1NUXA 4LZ7A 4PAKA 4FATA 1DPEA 4R6KA 1P1QA 4I3YA 4O94A 1S50A 3WAFA 1MXZA 1SBPA 3EKIA 5L9SA 4H45A 2GQ1A 5AA2B 1JW1A 1H3DA 3FV2A 4I40A 2F97A 3C32A 3TZAA 4OVTA 5JK4A 3MP1A 3FXUA 5JEIA 3HPIA 2P1SA 4WEPA 1PDAA 2XXRA 4GX4A 3KJTA 1DTZA 4M1VA 1FCKA 3DM0A 3FGSA 4FJPA 3T9XB 4Q0CA 4MBPA 4U22A 1SW1A 4OQOA 1OLCA 2RINA 4PFTA 4OVSA 1NV3A 4F1UA 1A7LA 1LBXA 2OBGA 4JSDA 3BFUA 1LBYA 3A3UA 2CEYA 5LDZA 5FHNA 4QRZA 4PF6A 3O28A 4JVIA 4H0WA 4PFWA 1UTHA 5KDTB 4N6DA 5I59A 1SPIA 3IX1A 3RPWA 4HXVA 2H9BA 2ZZXA 5JTYB 1LAFE 2WX9A 5I57A 1FPBA 3Q28A 3TAJA 4P9KA 3R26A 3TTRA 4LQ5A 4H8IA 3SKPA 4XF5A 2NUVA 5L9OA 1TWYA 4RPNA 4KR5A 3T22A 4N17A 2B3FA 1URSA 4R9GA 3RPLB 4PC9A 1IQ7A 1POTA 4AS5A 1PC3A 1KWHA 4R9FA 4U2RA 4ELQA 3MC2A 3S9MC 5FBPA 1MXVA 2Y7KA 4IGRA 1HSEA 3BBRA 3NOHA 4P1EA 1A55A 1JP4A 5AE4A 2V3QA 1D3KA 3IO4A 1GR2A 4NF6A 2GH9A 4GWXA 5KCJB 5A5LA 2Q2AA 5IZZA 4Z0IA 1MQJA 5HPQA 3MZ1A 4OHNA 2B4LA 2RF1A 3H6WA 5IM2A 3FXRA 4DIGA 3FJMA 1H44A 1NV2A 1MPCA 1RDYA 4GXSB 5I2NB 2FNCA 3CR9A 1AWBA 3OO9A 2OCUA 3DP8A 3N5LA 3ILTB 4THIA 4TLMB 1EU8A 1JW5A 3HHFA 4HCYA 5I2KB 1A8EA 4DZ1A 4PFUA 4G77A 3KZGA 1O7TA 2XXWA 2GFEA 4GQOA 4PFYA 1NUYA 3T9HB 1M5EA 1MDP1 1OLAA 2XWOA 2XX8A 2XXYA 4OFLA 5DEXB 2NWJA 2QVVA 3UORA 1LGBC 4IGTA 4GOTA 5ET8A 4RNSA 5H8HB 3IOTA 4ZS9A 4AQ4A 4KI0E 3R6UA 5HM4B 1ZMGA 2V93A 2ZYKA 3H4ZA 1B3HA 4GX3A 4UABA 5H8QA 1KZ8A 3KN3A 3PPPA 1FTKA 1LCTA 3PUWE 4YKIA 2XX7A 4LA9A 4P47A 1XI6A 3TDJA 2Y7WA 3OELA 1A99A 3TTLA 2PCRA 5HBCA 2R71A 1TFDA 1FBPA 5DVFA 2QMWA 5CC2A 1Q35A 4AB6A 2XD3A 1QKBA 2QVRA 2HCAA 3V89B 3OD7A 2H5YA 2GHAA 1SVXB 1UTBA 1D9VA 3IJXB 1P1NA 2O6AA 3IK6B 2PMSA 4HS7A 1ZU0A 4C0RA 1A40A 2FIXA 3MVXA 1RDXA 2OZZA 4TQUQ 4P11A 2DSFA 3LSFB 3GXAA 2OWZA 1LCFA 2FHYA 3TCHA 1ANFA 5IAIA 1N3WA 5TP9B 1MQIA 1SQYA 4EXLA 2DDKA 3I5OA 2HXRA 3RUMA 3U92A 2DXRA 1M5FA 5I84A 3ZS6A 3T1BA 4FAJA 4EQ7A 3HV1A 4P1LA 1L5TA 4RYAA 3KEIA 1XS5A 1MG1A 4NQ8A 4LONB 3W9WA 3P7IA 4X8RA 1URDA 2E1SA 4NF5B 3K6VA 4IR8A 3FVNA 4O3CA 2FIEA 3Q27A 3FZVA 4NEDA 5TPAB 3FXQA 2XA5A 5IGAA 4P0IA 3KC0A 1UIVA 4XIGQ 4LN5A 1ZTYA 3C36A 4OWDA 5EQ8A 3MQ9A 4I62A 4Q5TA 1N04A 3K1PA 1IMFA 2P2AA 5ISUA 1VDWA 4GWOA 1QUKA 4ISUA 1B7ZA 3SDFA 4GXAA 3E9XA 2H98A 2B65A 1NMUA 1AL3A 2CZHA 4JBZA 3TFLA 4YU0A 1FBGA 4NMYA 3K2DA 3LUYA 3MJNA 1EZOA 2YLNA 2Z8DA 4OETA 3E78A 4ZEIA 4OERA 2UVGA 4QXDA 1N3XA 4NN3A 2F35A 3BIGA 3PPQA 1XOCA 1VSOA 1B52A 5AA3A 3G7WA 3DELB 3PPNA 4QSDA 3PD8A 4N8YA 1OIBA 3LUZA 3BFTA 3ONMA 1Y4TA 3KGCA 4ELRA 1MQHA 2UYFA 5H8FB 1N7WA 4N81A 4YZZA 2G93A 2Q89A 1QUJA 5CMKA 3T0JA 4XFEA 2O68A 4R2FA 3OEKA 3KC1A 3KOTA 5ITPA 2ZYMA 4GL0A 4X48A 3D1RA 1LFGA 4GLIA 4M4GA 4JWYA 5ET7A 3SERA 4LQ2A 1R9LA 2JJKA 2Q88A 1MDQA 4C1TA 3CI8A 4PF8A 5TU0A 4H46A 3LC8A 1POY1 1A54A 1DTGA 2HHMA 3N94A 2FBPA 2AIXA 3DP4A 2F7CA 4H8JA 5B70A 4BDNA 1BP5A 3VFJA 2XXIA 1R1NA 5KZTA 2E0SA 2WYKA 1I6BA 2I4CA 5ET6A 3TKDA 1CB6A 1DBZA 5I7IA 1EYJA 3K4UA 2Z8EA 4RPOA 4POWA 3VLWA 1XVYA 1PEBA 3OO8A 1FPIA 1B0LA 3K00A 3CFXA 2XX9A 5CMCA 3FD3A 3RTFB 2I6EA 2QSXA 2OWTA 5DVJA 5K2XA 1NNKA 2CMOA 2XXHA 2DWAA 4F1YA 2ZNSA 1MQGA 5I58B 4ONYA 3PTYA 2KLFA 3IJOB 5K2YA 3LBSA 2O1LA 1P99A 1Q1KA 1SI1A 4PBHA 3PMWA 4MIJA 4FORA 1FQAA 2F6GA 3RT8A 2XXTA 3SZPA 4NF4A 2F3DA 4PE5B 2DE2A 3S9NC 4O3AA 2Y5LA 2XXUA 5ITOA 5AA4A 3EPEA 4PQJA 3H6TA 1J1NA 1Y20A 4U23A 4QSCA 2QVUA 1QJMA 2DE4A 1LEVA 1DSNA 1DPPA 4BDOA 3VXCA 1QGXA 3MP8A 1S9TA 3B50A 1FTLA 1AH5A 4PGNA 1Y1ZA 4LVQA 4IO2A 2I49A 3VE1B 4KXPA 2CZIA 3O97A 1FPJA 1N7XA 4MHFA 4KCDA 3B6WA 4QFKA 4ELOA 2M8CA 3RT6B 1ZKBA 3K6XA 1FBFA 4NG7A 4O3BA 4DE8A 4QF9A 3B6TA 4ECFA 3C31A 4QHQA 1NV6A 2Y5KA 3LSXA 3S2VA 4P56A 3O6HA 4MCOA 2VD2A 3T9VA 3QMFA 3UIFA 1WODA 1FPKA 2I0BA 2F6PA 2QS2A 5AA2A 2QS3A 1XC1A 1FBCA 2ONSA 1ZBMA 3TELA 1MQDA 1IXGA 4IO4A 1YCJA 4QFLA 3EHSA 1JW4A 3H6VA 4GWWA 3MW0A 4MLQA 2DS9A 2PBWA 2DWHA 1Y9UA 3K02A 4H67A 2HQ0A 3TODA 4GWYA 2D3IA 4JVDA 2XWVA 4ESXA 2GRVA 4KPTA 1ZLQA 1MY0A 4LZ8A 2DVZA 4OANA 3KSXA 1LSTA 4EF2A 3FVGA 3CVGA 4QFNA 3CHGA 1PBQA 1NI9A 1WDNA 2I58A 3TCGA 1MH4A 1IITA 1MY4A 2F7BA 3C33A 4BDLA 1LLSA 3SESA 1Y1MA 4PFRA 1USYH 3PV0E 2UVIA 2B4MA 3UGWA 3A29A 3H3GA 2I48A 4U4XA 5FTHA 2OJTA 3G3JA 1YTVA 4NGUA 4EDPA 1NH7A 4PFBA 3H03A 5CBRA 4KQPA 1MPDA 2DWJA 3LSLA 3K01A 2BJIA 3CSBA 1PB9A 3T93B 3FIRA 4HCWA 2XXKA 3MZ9A 2PX1A 4RA1A 1YXIA 5AA2D 1LAHE 2VOZA 5I56B 4NF8A 1M5CA 3MWBA 5I3SA 3FJGA 2KR0A 2P3VA 3RPLA 1SYHA 4XKQA 5EHMA 3C34A 2V84A 1FPDA 5ICTA 1IMAA 1JVXA 3MVZA 4PFIA 2HAVA 3VV5A 3H7MA 2VGQA 3MBPA 3W15C 3PUZE 4JDFA 4EUOA 3RGYA 3UP9A 5KCJA 1NFTA 3Q25A 4IY5A 4OYVA 3KBZA 3KN8A 4PDDA 1BIYA 1SW2A 4P3LA 4R6HA 4YMAA 1H45A 3M3LA 1DK4A 1B32A 4DCYA 2Q9TA 4YKJA 4F3BA 3V8XB 4L17A 2RKMA 1B58A 3QUFA 5F24A 4F19A 1Z7NE 2D21A 1ATGA 5FHOA 4NWDA 3RNNA 3B6QA 3M8UA 5I2KA 3E3KA 4ZZAA 3PMVA 4U1OA 1B4ZA 2ZNTA 3K6WA 1D4NA 4MNCA 1RYXA 2Q8JA 4GX6A 3HO7A 2NOOA 3AXFA 3FBPA 5DEXA 4GD5A 3PGFA 1FPGA 2WBBA 2I3VA 3B8BA 3RYDA 1G0HA 4H5GA 3HFUA 3T66A 4EQBA 3TTKA 1TXFA 3VXBA 2X7PA 2REJA 4N8GA 3VVEA 5EHSA 2DE3A 1USYE 3FV1A 1FRPA 4HTGA 1LAGE 2VP1A 3IORA 2CEXA 1IMCA 1BK4A 1B05A 4OENA 3HCQA 3IFCA 2Z22A 1A8FA 5CM6A 2O1MA 1US5A 2XWKA 4QSEA 2R8TA 3SETA 3OO6A 1CE2A 4DLDA 4G68B 4R6YA 4HW8A 4KYDA 2QL3A 4GIZA 1IMBA 5EQ7A 1XT8A 2V25A 3PMXA 3IL1B 3SEWA 1FTAA 4NAPA 2VHAA 4AS4A 2XXVA 1OQGA 3K0VA 4IO7A 5LTCA 3E79A 4UA8A 1K9YA 2I4BA 3K1NA 2V4CA 3A09A 3O9PA 3QK6A 3TCFA 4I8CA 2UVHA 4YKKA 5TP9A 2QJEA 2AL5A 4ZZEA 4NWCA 4MF3A 3BKIB 1JNFA 2NXOA 4OVPA 3FUZA 2HEUA 3PUXE 4OFJA 2UVJA 1DMBA 2QFLA 1B7UA 4MNPA 1NH8A 1Q9DA 4F3PA 4G61A 1RDZA 1B9JA 4Q30B 3JZJA 4GVOA 3ISPA 2MKZA 5TPAA 4MFIA 4N4UA 3SEYA 1DCUA 1TT1A 1SI0A 4F18A 1M5DA 3C35A 2REGA 3U94A 3ROJA 1G0IA 2HZLA 3KN7A 1NUZA 3UK4A 1EYKA 1LBVA 1P1UA 1B3FA 2HXWA 3THIA 1FPLA 4NTLA 3EHTA 3Q26A 2FVZA 4U21A 3EQ1A 1MPBA 4FEDA 1MH3A 1I6QA 1PB7A 3MVYA 4R2BA 1FPFA 2KQZA 1GTKA 4X1BA 1Z7ME 4OTEA 4PAFA 1NV0A 4GBWA 1O64A 4EXKA 4GWSA 2VPOA 4PETA 1AMFA 1JEVA 1OVBA 1FQCA 4MNIA 3TQLA 3OSQA 5EQ9A 2ZYNA 5DTBA 1B6HA 2HAUA 2O7IA 4X1DA 4X9TA 3N6UA 1SD3A 5H8FA 1VFEA 4GWUA 4XKRA 1UIUA 1B3EA 3H06B 1YZ0A 3FASA 4PDHA 1JVYA 4GWZA 2Y84A 3VLUA 1MM7A 2DP8A 4NF0A 5DW8A 3EHUA 5H8NB 4TLLB 1B51A 4XXUA 3MUQA 2X7QA 4EQ9A 4F3SA 3C9HA 2V3TA 2IEEA 3LR1A 5CI5A 3GYYA 1FTJA 3H6UA 3G3GA 1KA1A 3C4MA 1I69A 3LV0A 5F1QA 1QKAA 4F3GA 3ZKLA 3JV9A 4OXVA 3O2AA 1NKXA 1SW5A 5J1DA 2DVCA 3PU5A 1B46A 2Y7PA 3QAXA 3RLFE 2XXXA 3JYRA 4XTCQ 4O7IA 1LBWA 2WEFA 4FBPA 3TQWA 4Z7EA 1Y3QA 5EYHA 1FJ9A 1HSLA 1H43A 2R6GE 4H1XA 1MRPA 1JETA 5T3JA 3MVWA 4RK2A 5M2VA 1AIVA 3L6GA 3TMGA 2P0SA 4F29A 4MX6A 5IZ3A 3OSRA 5A5XB 3TYHA 1DOTA 2ESNA 2H4IA 4DI4B 1SDXA 1II5A 1B1XA 3MYUA 4I9DA 2OX3A 3VDFA 4KCCA 4XKPA 2HPGA 2A5TB 1EZ9A 4WEDA 5ELVA 4G8NA 4E0WA 5DT6A 3QXMA 1F9BA 1MM6A 1M5BA 2NVUB 1N0TA 4YAHX 1Y3PA 4G2ZA 3DLNA 3CRBA 4H65A 1BTJA 1MXYA 4GFRA 4P8BA 2XXQA 2QS4A 4ZECA 2AYSA 3KSJA 3TUSA 3QSLA 3K6UA 2Z8FA 2RCAA 4F31B 4QFPA 4FE8A 4I1DA 1PB8A 3K1MA 3LSWA 4ZEBA 4IY6A 3FATA 4F2QA
chains in the Genus database with same CATH topology
4PFIA 3T1BA 1FSAA 4P1LA 4MMPA 4MJOA 3IFAA 1EYIA 4NQ8A 3W9WA 2WBDA 4X8RA 5EYGA 4PAIA 5IZ1A 4N91A 1NV1A 3KBZA 4IR8A 4PDDA 2FIEA 4P3LA 1KA0A 2XA5A 5IGAA 1DK4A 4PBQA 2Q9TA 3KC0A 4LN5A 5EQ8A 5F24A 4F19A 2VPNA 4HE0A 1IMFA 2ZZVA 1VDWA 5IZ3B 4MNCA 1D9QA 5I5PA 4GX6A 2CZHA 2QPQA 3FBPA 1FBGA 3FXBA 1FPGA 2WBBA 3B8BA 1CNQA 3RYDA 1G0HA 4PCDA 3HFUA 3E78A 1FBEA 4N8GA 2DE3A 4PTKA 4QXDA 4NN3A 3BIHA 1FRPA 3BIGA 4OVQA 4I3EA 2CEXA 1IMCA 1BK4A 4GBVA 1NV4A 4QBAA 4N8YA 4PE3A 3IFCA 3LUZA 2VT5A 5CM6A 2XWKA 2HZKA 2R8TA 4N81A 4YZZA 1FBDA 3T0JA 4XFEA 2WYPA 3KC1A 1LBZA 1NUXA 4PAKA 3D1RA 1IMBA 5EQ7A 2L5VA 4I3YA 4O94A 5ET7A 4F1VA 3EKIA 4PGPA 4H45A 1FTAA 2JJKA 4NAPA 2GQ1A 4AS4A 4PF8A 4H46A 4MEVA 2HHMA 4N15A 1IMDA 5LTCA 4I40A 2FBPA 4OVTA 5JK4A 3E79A 1K9YA 2WYKA 2V4CA 4GX4A 5ET6A 4M1VA 2Q74A 1DBZA 5I7IA 1EYJA 2XWIA 4OVPA 4OVSA 1NV3A 4F1UA 4JVCA 1LBXA 1FPIA 2QFLA 1LBYA 4MNPA 2CEYA 1FPEA 5LDZA 1Q9DA 4PF6A 4XEQA 4G61A 4JVIA 1RDZA 4N6DA 3ISPA 3PTYA 4N6KA 2MKZA 4N4UA 4OVRA 1SPIA 1DCUA 4YICA 4HXVA 2ZZXA 2WX9A 4F18A 1FPBA 4PBHA 4P9KA 3ROJA 1G0IA 2HZLA 4HE1A 4MIJA 1NUZA 1FJ6A 1EYKA 1LBVA 1INPA 4XF5A 2F5XA 1FPLA 3SZPA 2F3DA 2FVZA 2DE2A 2PFYA 1FBHA 2Y5LA 2Q8MA 4N17A 3W9VA 4O8MA 5J16A 1YYZA 5ET5A 3RPLB 4PC9A 4AS5A 1FPFA 2KQZA 3MSTA 2QVUA 2DE4A 4PAFA 5FBPA 1LEVA 1NV0A 5ESYA 4GBWA 4O7MA 3NOHA 4GWSA 4P1EA 2VPOA 4PETA 1QGXA 1JP4A 4MNIA 3B50A 2V3QA 4PGNA 4HE2A 5EQ9A 4GWXA 5A5LA 4KXPA 5IZZA 2CZIA 1FPJA 2B4LA 4X9TA 4MHFA 5IM2A 4GWUA 1NV2A 1RDYA 1YZ0A 2P3NA 1FBFA 4NG7A 4PDHA 1AWBA 1NV6A 2Y5KA 4GWZA 4X04A 4P56A 4NF0A 5DW8A 4MCOA 4NHBA 4HCYA 5EQAA 3QMFA 1K9ZA 1FPKA 1IMEA 1FBCA 2CZKA 3GYYA 1NUYA 1KA1A 2XWOA 3LV0A 2QVVA 4DI3D 4GWWA 5ET8A 4GWYA 5J1DA 4JVDA 2XWVA 4O7IA 1LBWA 2WEFA 4FBPA 2DVZA 4OANA 1NV7A 2PFZA 5EYHA 1FJ9A 4NX1A 3CHGA 1NI9A 5T3JA 4GX3A 4UABA 1KZ8A 4MX6A 5IZ3A 1NUWA 4PFRA 4DI4B 2B4MA 4P47A 3MYUA 1XI6A 2OX3A 3A29A 2PCRA 2HPGA 1FBPA 2F3BA 4NGUA 3U65A 2QVRA 4PFBA 1NV5A 4OA4A 2BJIA 4P8BA 4HCWA 4MAGA 2XXKA 2FIXA 1YXIA 1RDXA 5I3SA 2OWZA 2KR0A 2P3VA 2FHYA 3RPLA 2ZZWA 1FPDA 1IMAA 2DDKA 2HXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XWO A;  2XWK A;  4PFI A;  4PBH A;  4P9K A;  2HZK A;  2HZL A;  4DI3 D;  4MIJ A;  4P1L A;  4YZZ A;  4MMP A;  4XFE A;  2WYP A;  4XF5 A;  4NQ8 A;  2XWV A;  4PAK A;  4X8R A;  4PAI A;  2PFY A;  4N91 A;  4OAN A;  4O94 A;  4PDD A;  2PFZ A;  4NX1 A;  4N17 A;  4P3L A;  4PGP A;  4O8M A;  2XA5 A;  5IGA A;  4NAP A;  4PC9 A;  4UAB A;  4PBQ A;  4PF8 A;  4LN5 A;  4MEV A;  4N15 A;  5LTC A;  4PAF A;  4MX6 A;  4O7M A;  4OVT A;  2VPN A;  4PFR A;  4P1E A;  4DI4 B;  2VPO A;  4PET A;  4P47 A;  2ZZV A;  4MNI A;  3B50 A;  2WYK A;  2V4C A;  4PGN A;  2HPG A;  4MNC A;  5I5P A;  4NGU A;  3U65 A;  5I7I A;  5IZZ A;  4PFB A;  2XWI A;  3FXB A;  4MHF A;  4OA4 A;  5IM2 A;  4OVP A;  4OVS A;  4PCD A;  4P8B A;  4NG7 A;  4PDH A;  4MNP A;  2CEY A;  4N8G A;  4MAG A;  2XXK A;  4X04 A;  4PF6 A;  4P56 A;  4NF0 A;  4XEQ A;  4MCO A;  4NN3 A;  4NHB A;  4N6D A;  4OVQ A;  4N6K A;  2CEX A;  4N4U A;  4OVR A;  2ZZW A;  4YIC A;  3GYY A;  4N8Y A;  2ZZX A;  4PE3 A;  2WX9 A;  5CM6 A; 
#chains in the Genus database with same CATH topology
 1I6A A;  4BDR A;  3OXN A;  5BUU A;  4MMP A;  3M3F A;  2THI A;  3IR1 A;  3IFA A;  3S4U A;  1NL5 A;  4F22 A;  3D4C A;  2WBD A;  4G8H A;  5CRY A;  5B7D A;  4PAI A;  3F11 A;  5IZ1 A;  1IXI A;  1RKM A;  2BJJ X;  2CZL A;  4AB5 A;  1KA0 A;  1UTH B;  3RN8 A;  1B5H A;  5I59 B;  1FQB A;  4PBQ A;  1LFH A;  2YPN A;  3MAM A;  4KFQ A;  5I57 B;  3EF7 A;  2VPN A;  4HE0 A;  2ZMB A;  3HN0 A;  4KHZ E;  2ONR A;  2QMX A;  1ZIU A;  3VLV A;  1N76 A;  3I6V A;  3KFM A;  4ELP A;  4BLA A;  2ZXT A;  3G3I A;  1B1H A;  5I5P A;  1LBC A;  4G4P A;  4WKM A;  3UA8 A;  3HST A;  1IIW A;  2Y7R A;  4C1U A;  1CNQ A;  5FTI A;  2R9J A;  3DP6 A;  5KDT A;  3SEX A;  1O63 A;  4H5F A;  2ANJ A;  1Y3N A;  1AOV A;  2DYX A;  4JXI A;  5JTY A;  2VD3 A;  3U1O A;  1R6Z A;  5L9M A;  2FYI A;  2I3W A;  3BIH A;  3EN3 A;  4EF1 A;  3PPR A;  1B3G A;  4I3E A;  4XKN A;  4QBA A;  3O29 A;  2RC7 A;  4ZEK A;  4LP2 B;  1MY1 A;  4RK9 A;  4NF6 B;  1NNP A;  3CFL A;  1B2H A;  3I3V A;  4NF8 B;  3WAE A;  4GL8 A;  4FEC A;  4QFO A;  2B3B A;  2HZK A;  1TFA A;  2PVU A;  3OOA A;  2DQV A;  1FBD A;  4UAC A;  4FEB A;  2WYP A;  3MPL A;  3E13 X;  2L5V A;  4ZE9 A;  4R75 A;  4U1Z A;  4JB7 A;  4F1V A;  2RCB A;  3A3C A;  4JWO A;  4PGP A;  1ZJL A;  1LB8 A;  2Z23 A;  2F78 A;  4YB5 A;  1T0K A;  4U4S A;  4MEV A;  4N15 A;  1IMD A;  1GV8 A;  3QUJ A;  3VVF A;  4RY1 A;  4MH5 A;  4OEU A;  1SYI A;  2A5S A;  5I56 A;  1QW0 A;  1MXW A;  4YB6 A;  3QYT A;  2IA4 A;  3PD9 A;  1IZ1 A;  2F7A A;  1SW4 A;  4PP0 A;  2Q74 A;  4IO6 A;  3RY3 A;  5CBS A;  1ELJ A;  4N13 A;  5I2N A;  1XHY A;  1PBP A;  2XWI A;  3UN6 A;  4MLV A;  1MY3 A;  4JVC A;  1R9Q A;  3MP6 A;  5EYF A;  3ZKK A;  5H8Q B;  5DYH A;  1FPE A;  4NE4 A;  4LZ5 A;  4XEQ A;  4Q8R A;  1HSJ A;  5ICQ A;  2ABH A;  4BDM A;  1GGG A;  4N6K A;  2DOJ A;  4OVR A;  4BDQ A;  4YIC A;  1MY2 A;  4ZED A;  5H8H A;  1MS7 A;  1S7Y A;  2OWS A;  4N07 A;  2UXA A;  4HE1 A;  5DVI A;  4F2O A;  3S9L C;  1FJ6 A;  1UTB B;  4OEV A;  1P1O A;  1QVS A;  1INP A;  2F5X A;  1OMP A;  4RJZ A;  4P0G A;  3FVK A;  5LOM A;  2F8D A;  4OFO A;  2PFY A;  4KYE A;  2QS1 A;  1H76 A;  3MZB A;  3T9U A;  1FBH A;  2Q8M A;  4DXB A;  1VE4 A;  3W9V A;  4LAT A;  3IO6 A;  4O8M A;  5J16 A;  2AL4 A;  1YYZ A;  2OK2 A;  5ET5 A;  4GRK A;  4G8M A;  4R72 A;  2WKY A;  4ND9 A;  3OMB A;  4H6D A;  3SEU A;  3MST A;  3N6T A;  3V83 A;  5F7V A;  3O6I A;  5ESY A;  4O7M A;  1FTM A;  3GLB A;  1IUD A;  1BKA A;  3GBA A;  1YAE A;  4OZ9 A;  3ZSF A;  4FIM A;  4LUB A;  3ILU B;  3IOU A;  4HE2 A;  4YB7 A;  4IB2 A;  3U72 A;  4OES A;  3IB0 A;  2D5W A;  3IOV A;  3Q29 A;  2RC8 A;  1D9Y A;  3TPA A;  4RXL A;  1Y4C A;  1YPN A;  3D4G A;  4G68 A;  4WXJ A;  3OO7 A;  3U8Q A;  4G68 C;  2P3N A;  2V3U A;  3ODB A;  2LAO A;  3G3H A;  4R74 A;  5AA1 A;  3KJ7 A;  3RQT A;  2XHD A;  4X04 A;  1XVX A;  4NHB A;  5EQA A;  5H8S A;  1NNF A;  4DCX A;  1K9Z A;  1IME A;  3FJ7 A;  2DXY A;  3O6G A;  2ONK E;  2CZK A;  4N6P A;  4OVJ A;  5IKB A;  3M3K A;  3TTM A;  2I0C A;  4TOZ A;  2OLB A;  2XXP A;  2F34 A;  4DI3 D;  1P1W A;  4R73 A;  4NF5 A;  2PYY A;  1B40 A;  4E0X A;  2W7Y A;  1VFD A;  3GZG A;  3KOS A;  3G3K A;  1NV7 A;  3HHG A;  2PFZ A;  3KBR A;  4NX1 A;  1LB9 A;  3TEP A;  4KD5 A;  1LFI A;  4DDD A;  3OEN A;  2Y7I A;  1LBB A;  3PPO A;  1B4H A;  2X26 A;  2HFB A;  3B7D A;  1NUW A;  5FHM A;  4ZEF A;  1UQW A;  2RC9 A;  2FA7 A;  1EZP A;  4JWX A;  2H25 A;  4ZDM A;  2XD2 A;  2F3B A;  3O66 A;  2H99 A;  3U65 A;  3QIM A;  1NV5 A;  4OA4 A;  1EH3 A;  2DWI A;  2ZNU A;  1GVC A;  5CMM A;  4IO5 A;  3PUV E;  4MAG A;  5L8D A;  2Q2C A;  1WVJ A;  1QUI A;  4OMB A;  1JQF A;  1RYO A;  2QRY A;  3CFZ A;  1FQE A;  3IB2 A;  3TTN A;  3IAZ A;  3T96 B;  4ZE8 A;  2ZZW A;  1N84 A;  2O84 X;  1US4 A;  4KYS A;  3CG3 A;  1QUL A;  4F39 A;  3SEV A;  1FSA A;  1BLF A;  3G3F A;  3V5A A;  3PUY E;  3ECR A;  4MJO A;  1IXH A;  5BWJ A;  1EYI A;  2ALU A;  3S9E A;  2G29 A;  5EYG A;  3IOW A;  4N91 A;  1NV1 A;  3L6H A;  1URG A;  4ESW A;  3N26 A;  3E4R A;  4JSO A;  3GBB A;  1FW0 A;  2O7U A;  2GHB A;  4DXU A;  2ZYO A;  4IO3 A;  4YMB A;  3RTW B;  5H8N A;  2ZZV A;  1B7H A;  1IXC A;  1FQD A;  1JEU A;  5IZ3 B;  1IEJ A;  4YKP A;  4NF4 B;  3R7X A;  1D9Q A;  3FVO A;  2QPQ A;  2O51 A;  3IB1 A;  3FXB A;  5AA4 B;  2PT2 A;  2F36 A;  3MPK A;  1B0H A;  3CIJ A;  4PCD A;  5I58 A;  3KG2 A;  1B5J A;  4DXC A;  1FBE A;  3OEM A;  1MXX A;  2PT1 A;  4PTK A;  1OQH A;  2UYE A;  4OVQ A;  3CSG A;  4GBV A;  1NV4 A;  1B5I A;  1B3L A;  1FTO A;  1LAX A;  4PE3 A;  1FQF A;  2VT5 A;  3CG1 A;  3U93 A;  5A5X A;  1OVT A;  2YJP A;  3USD A;  3VVD A;  1NNT A;  4POX A;  1VR5 A;  2O69 A;  4GF8 A;  2A5T A;  4K3F A;  5CMB A;  1MXU A;  1LBZ A;  1NUX A;  4LZ7 A;  4PAK A;  4FAT A;  1DPE A;  4R6K A;  1P1Q A;  4I3Y A;  4O94 A;  1S50 A;  3WAF A;  1MXZ A;  1SBP A;  3EKI A;  5L9S A;  4H45 A;  2GQ1 A;  5AA2 B;  1JW1 A;  1H3D A;  3FV2 A;  4I40 A;  2F97 A;  3C32 A;  3TZA A;  4OVT A;  5JK4 A;  3MP1 A;  3FXU A;  5JEI A;  3HPI A;  2P1S A;  4WEP A;  1PDA A;  2XXR A;  4GX4 A;  3KJT A;  1DTZ A;  4M1V A;  1FCK A;  3DM0 A;  3FGS A;  4FJP A;  3T9X B;  4Q0C A;  4MBP A;  4U22 A;  1SW1 A;  4OQO A;  1OLC A;  2RIN A;  4PFT A;  4OVS A;  1NV3 A;  4F1U A;  1A7L A;  1LBX A;  2OBG A;  4JSD A;  3BFU A;  1LBY A;  3A3U A;  2CEY A;  5LDZ A;  5FHN A;  4QRZ A;  4PF6 A;  3O28 A;  4JVI A;  4H0W A;  4PFW A;  1UTH A;  5KDT B;  4N6D A;  5I59 A;  1SPI A;  3IX1 A;  3RPW A;  4HXV A;  2H9B A;  2ZZX A;  5JTY B;  1LAF E;  2WX9 A;  5I57 A;  1FPB A;  3Q28 A;  3TAJ A;  4P9K A;  3R26 A;  3TTR A;  4LQ5 A;  4H8I A;  3SKP A;  4XF5 A;  2NUV A;  5L9O A;  1TWY A;  4RPN A;  4KR5 A;  3T22 A;  4N17 A;  2B3F A;  1URS A;  4R9G A;  3RPL B;  4PC9 A;  1IQ7 A;  1POT A;  4AS5 A;  1PC3 A;  1KWH A;  4R9F A;  4U2R A;  4ELQ A;  3MC2 A;  3S9M C;  5FBP A;  1MXV A;  2Y7K A;  4IGR A;  1HSE A;  3BBR A;  3NOH A;  4P1E A;  1A55 A;  1JP4 A;  5AE4 A;  2V3Q A;  1D3K A;  3IO4 A;  1GR2 A;  4NF6 A;  2GH9 A;  4GWX A;  5KCJ B;  5A5L A;  2Q2A A;  5IZZ A;  4Z0I A;  1MQJ A;  5HPQ A;  3MZ1 A;  4OHN A;  2B4L A;  2RF1 A;  3H6W A;  5IM2 A;  3FXR A;  4DIG A;  3FJM A;  1H44 A;  1NV2 A;  1MPC A;  1RDY A;  4GXS B;  5I2N B;  2FNC A;  3CR9 A;  1AWB A;  3OO9 A;  2OCU A;  3DP8 A;  3N5L A;  3ILT B;  4THI A;  4TLM B;  1EU8 A;  1JW5 A;  3HHF A;  4HCY A;  5I2K B;  1A8E A;  4DZ1 A;  4PFU A;  4G77 A;  3KZG A;  1O7T A;  2XXW A;  2GFE A;  4GQO A;  4PFY A;  1NUY A;  3T9H B;  1M5E A;  1MDP 1;  1OLA A;  2XWO A;  2XX8 A;  2XXY A;  4OFL A;  5DEX B;  2NWJ A;  2QVV A;  3UOR A;  1LGB C;  4IGT A;  4GOT A;  5ET8 A;  4RNS A;  5H8H B;  3IOT A;  4ZS9 A;  4AQ4 A;  4KI0 E;  3R6U A;  5HM4 B;  1ZMG A;  2V93 A;  2ZYK A;  3H4Z A;  1B3H A;  4GX3 A;  4UAB A;  5H8Q A;  1KZ8 A;  3KN3 A;  3PPP A;  1FTK A;  1LCT A;  3PUW E;  4YKI A;  2XX7 A;  4LA9 A;  4P47 A;  1XI6 A;  3TDJ A;  2Y7W A;  3OEL A;  1A99 A;  3TTL A;  2PCR A;  5HBC A;  2R71 A;  1TFD A;  1FBP A;  5DVF A;  2QMW A;  5CC2 A;  1Q35 A;  4AB6 A;  2XD3 A;  1QKB A;  2QVR A;  2HCA A;  3V89 B;  3OD7 A;  2H5Y A;  2GHA A;  1SVX B;  1UTB A;  1D9V A;  3IJX B;  1P1N A;  2O6A A;  3IK6 B;  2PMS A;  4HS7 A;  1ZU0 A;  4C0R A;  1A40 A;  2FIX A;  3MVX A;  1RDX A;  2OZZ A;  4TQU Q;  4P11 A;  2DSF A;  3LSF B;  3GXA A;  2OWZ A;  1LCF A;  2FHY A;  3TCH A;  1ANF A;  5IAI A;  1N3W A;  5TP9 B;  1MQI A;  1SQY A;  4EXL A;  2DDK A;  3I5O A;  2HXR A;  3RUM A;  3U92 A;  2DXR A;  1M5F A;  5I84 A;  3ZS6 A;  3T1B A;  4FAJ A;  4EQ7 A;  3HV1 A;  4P1L A;  1L5T A;  4RYA A;  3KEI A;  1XS5 A;  1MG1 A;  4NQ8 A;  4LON B;  3W9W A;  3P7I A;  4X8R A;  1URD A;  2E1S A;  4NF5 B;  3K6V A;  4IR8 A;  3FVN A;  4O3C A;  2FIE A;  3Q27 A;  3FZV A;  4NED A;  5TPA B;  3FXQ A;  2XA5 A;  5IGA A;  4P0I A;  3KC0 A;  1UIV A;  4XIG Q;  4LN5 A;  1ZTY A;  3C36 A;  4OWD A;  5EQ8 A;  3MQ9 A;  4I62 A;  4Q5T A;  1N04 A;  3K1P A;  1IMF A;  2P2A A;  5ISU A;  1VDW A;  4GWO A;  1QUK A;  4ISU A;  1B7Z A;  3SDF A;  4GXA A;  3E9X A;  2H98 A;  2B65 A;  1NMU A;  1AL3 A;  2CZH A;  4JBZ A;  3TFL A;  4YU0 A;  1FBG A;  4NMY A;  3K2D A;  3LUY A;  3MJN A;  1EZO A;  2YLN A;  2Z8D A;  4OET A;  3E78 A;  4ZEI A;  4OER A;  2UVG A;  4QXD A;  1N3X A;  4NN3 A;  2F35 A;  3BIG A;  3PPQ A;  1XOC A;  1VSO A;  1B52 A;  5AA3 A;  3G7W A;  3DEL B;  3PPN A;  4QSD A;  3PD8 A;  4N8Y A;  1OIB A;  3LUZ A;  3BFT A;  3ONM A;  1Y4T A;  3KGC A;  4ELR A;  1MQH A;  2UYF A;  5H8F B;  1N7W A;  4N81 A;  4YZZ A;  2G93 A;  2Q89 A;  1QUJ A;  5CMK A;  3T0J A;  4XFE A;  2O68 A;  4R2F A;  3OEK A;  3KC1 A;  3KOT A;  5ITP A;  2ZYM A;  4GL0 A;  4X48 A;  3D1R A;  1LFG A;  4GLI A;  4M4G A;  4JWY A;  5ET7 A;  3SER A;  4LQ2 A;  1R9L A;  2JJK A;  2Q88 A;  1MDQ A;  4C1T A;  3CI8 A;  4PF8 A;  5TU0 A;  4H46 A;  3LC8 A;  1POY 1;  1A54 A;  1DTG A;  2HHM A;  3N94 A;  2FBP A;  2AIX A;  3DP4 A;  2F7C A;  4H8J A;  5B70 A;  4BDN A;  1BP5 A;  3VFJ A;  2XXI A;  1R1N A;  5KZT A;  2E0S A;  2WYK A;  1I6B A;  2I4C A;  5ET6 A;  3TKD A;  1CB6 A;  1DBZ A;  5I7I A;  1EYJ A;  3K4U A;  2Z8E A;  4RPO A;  4POW A;  3VLW A;  1XVY A;  1PEB A;  3OO8 A;  1FPI A;  1B0L A;  3K00 A;  3CFX A;  2XX9 A;  5CMC A;  3FD3 A;  3RTF B;  2I6E A;  2QSX A;  2OWT A;  5DVJ A;  5K2X A;  1NNK A;  2CMO A;  2XXH A;  2DWA A;  4F1Y A;  2ZNS A;  1MQG A;  5I58 B;  4ONY A;  3PTY A;  2KLF A;  3IJO B;  5K2Y A;  3LBS A;  2O1L A;  1P99 A;  1Q1K A;  1SI1 A;  4PBH A;  3PMW A;  4MIJ A;  4FOR A;  1FQA A;  2F6G A;  3RT8 A;  2XXT A;  3SZP A;  4NF4 A;  2F3D A;  4PE5 B;  2DE2 A;  3S9N C;  4O3A A;  2Y5L A;  2XXU A;  5ITO A;  5AA4 A;  3EPE A;  4PQJ A;  3H6T A;  1J1N A;  1Y20 A;  4U23 A;  4QSC A;  2QVU A;  1QJM A;  2DE4 A;  1LEV A;  1DSN A;  1DPP A;  4BDO A;  3VXC A;  1QGX A;  3MP8 A;  1S9T A;  3B50 A;  1FTL A;  1AH5 A;  4PGN A;  1Y1Z A;  4LVQ A;  4IO2 A;  2I49 A;  3VE1 B;  4KXP A;  2CZI A;  3O97 A;  1FPJ A;  1N7X A;  4MHF A;  4KCD A;  3B6W A;  4QFK A;  4ELO A;  2M8C A;  3RT6 B;  1ZKB A;  3K6X A;  1FBF A;  4NG7 A;  4O3B A;  4DE8 A;  4QF9 A;  3B6T A;  4ECF A;  3C31 A;  4QHQ A;  1NV6 A;  2Y5K A;  3LSX A;  3S2V A;  4P56 A;  3O6H A;  4MCO A;  2VD2 A;  3T9V A;  3QMF A;  3UIF A;  1WOD A;  1FPK A;  2I0B A;  2F6P A;  2QS2 A;  5AA2 A;  2QS3 A;  1XC1 A;  1FBC A;  2ONS A;  1ZBM A;  3TEL A;  1MQD A;  1IXG A;  4IO4 A;  1YCJ A;  4QFL A;  3EHS A;  1JW4 A;  3H6V A;  4GWW A;  3MW0 A;  4MLQ A;  2DS9 A;  2PBW A;  2DWH A;  1Y9U A;  3K02 A;  4H67 A;  2HQ0 A;  3TOD A;  4GWY A;  2D3I A;  4JVD A;  2XWV A;  4ESX A;  2GRV A;  4KPT A;  1ZLQ A;  1MY0 A;  4LZ8 A;  2DVZ A;  4OAN A;  3KSX A;  1LST A;  4EF2 A;  3FVG A;  3CVG A;  4QFN A;  3CHG A;  1PBQ A;  1NI9 A;  1WDN A;  2I58 A;  3TCG A;  1MH4 A;  1IIT A;  1MY4 A;  2F7B A;  3C33 A;  4BDL A;  1LLS A;  3SES A;  1Y1M A;  4PFR A;  1USY H;  3PV0 E;  2UVI A;  2B4M A;  3UGW A;  3A29 A;  3H3G A;  2I48 A;  4U4X A;  5FTH A;  2OJT A;  3G3J A;  1YTV A;  4NGU A;  4EDP A;  1NH7 A;  4PFB A;  3H03 A;  5CBR A;  4KQP A;  1MPD A;  2DWJ A;  3LSL A;  3K01 A;  2BJI A;  3CSB A;  1PB9 A;  3T93 B;  3FIR A;  4HCW A;  2XXK A;  3MZ9 A;  2PX1 A;  4RA1 A;  1YXI A;  5AA2 D;  1LAH E;  2VOZ A;  5I56 B;  4NF8 A;  1M5C A;  3MWB A;  5I3S A;  3FJG A;  2KR0 A;  2P3V A;  3RPL A;  1SYH A;  4XKQ A;  5EHM A;  3C34 A;  2V84 A;  1FPD A;  5ICT A;  1IMA A;  1JVX A;  3MVZ A;  4PFI A;  2HAV A;  3VV5 A;  3H7M A;  2VGQ A;  3MBP A;  3W15 C;  3PUZ E;  4JDF A;  4EUO A;  3RGY A;  3UP9 A;  5KCJ A;  1NFT A;  3Q25 A;  4IY5 A;  4OYV A;  3KBZ A;  3KN8 A;  4PDD A;  1BIY A;  1SW2 A;  4P3L A;  4R6H A;  4YMA A;  1H45 A;  3M3L A;  1DK4 A;  1B32 A;  4DCY A;  2Q9T A;  4YKJ A;  4F3B A;  3V8X B;  4L17 A;  2RKM A;  1B58 A;  3QUF A;  5F24 A;  4F19 A;  1Z7N E;  2D21 A;  1ATG A;  5FHO A;  4NWD A;  3RNN A;  3B6Q A;  3M8U A;  5I2K A;  3E3K A;  4ZZA A;  3PMV A;  4U1O A;  1B4Z A;  2ZNT A;  3K6W A;  1D4N A;  4MNC A;  1RYX A;  2Q8J A;  4GX6 A;  3HO7 A;  2NOO A;  3AXF A;  3FBP A;  5DEX A;  4GD5 A;  3PGF A;  1FPG A;  2WBB A;  2I3V A;  3B8B A;  3RYD A;  1G0H A;  4H5G A;  3HFU A;  3T66 A;  4EQB A;  3TTK A;  1TXF A;  3VXB A;  2X7P A;  2REJ A;  4N8G A;  3VVE A;  5EHS A;  2DE3 A;  1USY E;  3FV1 A;  1FRP A;  4HTG A;  1LAG E;  2VP1 A;  3IOR A;  2CEX A;  1IMC A;  1BK4 A;  1B05 A;  4OEN A;  3HCQ A;  3IFC A;  2Z22 A;  1A8F A;  5CM6 A;  2O1M A;  1US5 A;  2XWK A;  4QSE A;  2R8T A;  3SET A;  3OO6 A;  1CE2 A;  4DLD A;  4G68 B;  4R6Y A;  4HW8 A;  4KYD A;  2QL3 A;  4GIZ A;  1IMB A;  5EQ7 A;  1XT8 A;  2V25 A;  3PMX A;  3IL1 B;  3SEW A;  1FTA A;  4NAP A;  2VHA A;  4AS4 A;  2XXV A;  1OQG A;  3K0V A;  4IO7 A;  5LTC A;  3E79 A;  4UA8 A;  1K9Y A;  2I4B A;  3K1N A;  2V4C A;  3A09 A;  3O9P A;  3QK6 A;  3TCF A;  4I8C A;  2UVH A;  4YKK A;  5TP9 A;  2QJE A;  2AL5 A;  4ZZE A;  4NWC A;  4MF3 A;  3BKI B;  1JNF A;  2NXO A;  4OVP A;  3FUZ A;  2HEU A;  3PUX E;  4OFJ A;  2UVJ A;  1DMB A;  2QFL A;  1B7U A;  4MNP A;  1NH8 A;  1Q9D A;  4F3P A;  4G61 A;  1RDZ A;  1B9J A;  4Q30 B;  3JZJ A;  4GVO A;  3ISP A;  2MKZ A;  5TPA A;  4MFI A;  4N4U A;  3SEY A;  1DCU A;  1TT1 A;  1SI0 A;  4F18 A;  1M5D A;  3C35 A;  2REG A;  3U94 A;  3ROJ A;  1G0I A;  2HZL A;  3KN7 A;  1NUZ A;  3UK4 A;  1EYK A;  1LBV A;  1P1U A;  1B3F A;  2HXW A;  3THI A;  1FPL A;  4NTL A;  3EHT A;  3Q26 A;  2FVZ A;  4U21 A;  3EQ1 A;  1MPB A;  4FED A;  1MH3 A;  1I6Q A;  1PB7 A;  3MVY A;  4R2B A;  1FPF A;  2KQZ A;  1GTK A;  4X1B A;  1Z7M E;  4OTE A;  4PAF A;  1NV0 A;  4GBW A;  1O64 A;  4EXK A;  4GWS A;  2VPO A;  4PET A;  1AMF A;  1JEV A;  1OVB A;  1FQC A;  4MNI A;  3TQL A;  3OSQ A;  5EQ9 A;  2ZYN A;  5DTB A;  1B6H A;  2HAU A;  2O7I A;  4X1D A;  4X9T A;  3N6U A;  1SD3 A;  5H8F A;  1VFE A;  4GWU A;  4XKR A;  1UIU A;  1B3E A;  3H06 B;  1YZ0 A;  3FAS A;  4PDH A;  1JVY A;  4GWZ A;  2Y84 A;  3VLU A;  1MM7 A;  2DP8 A;  4NF0 A;  5DW8 A;  3EHU A;  5H8N B;  4TLL B;  1B51 A;  4XXU A;  3MUQ A;  2X7Q A;  4EQ9 A;  4F3S A;  3C9H A;  2V3T A;  2IEE A;  3LR1 A;  5CI5 A;  3GYY A;  1FTJ A;  3H6U A;  3G3G A;  1KA1 A;  3C4M A;  1I69 A;  3LV0 A;  5F1Q A;  1QKA A;  4F3G A;  3ZKL A;  3JV9 A;  4OXV A;  3O2A A;  1NKX A;  1SW5 A;  5J1D A;  2DVC A;  3PU5 A;  1B46 A;  2Y7P A;  3QAX A;  3RLF E;  2XXX A;  3JYR A;  4XTC Q;  4O7I A;  1LBW A;  2WEF A;  4FBP A;  3TQW A;  4Z7E A;  1Y3Q A;  5EYH A;  1FJ9 A;  1HSL A;  1H43 A;  2R6G E;  4H1X A;  1MRP A;  1JET A;  5T3J A;  3MVW A;  4RK2 A;  5M2V A;  1AIV A;  3L6G A;  3TMG A;  2P0S A;  4F29 A;  4MX6 A;  5IZ3 A;  3OSR A;  5A5X B;  3TYH A;  1DOT A;  2ESN A;  2H4I A;  4DI4 B;  1SDX A;  1II5 A;  1B1X A;  3MYU A;  4I9D A;  2OX3 A;  3VDF A;  4KCC A;  4XKP A;  2HPG A;  2A5T B;  1EZ9 A;  4WED A;  5ELV A;  4G8N A;  4E0W A;  5DT6 A;  3QXM A;  1F9B A;  1MM6 A;  1M5B A;  2NVU B;  1N0T A;  4YAH X;  1Y3P A;  4G2Z A;  3DLN A;  3CRB A;  4H65 A;  1BTJ A;  1MXY A;  4GFR A;  4P8B A;  2XXQ A;  2QS4 A;  4ZEC A;  2AYS A;  3KSJ A;  3TUS A;  3QSL A;  3K6U A;  2Z8F A;  2RCA A;  4F31 B;  4QFP A;  4FE8 A;  4I1D A;  1PB8 A;  3K1M A;  3LSW A;  4ZEB A;  4IY6 A;  3FAT A;  4F2Q A; 
#chains in the Genus database with same CATH homology
 4PFI A;  3T1B A;  1FSA A;  4P1L A;  4MMP A;  4MJO A;  3IFA A;  1EYI A;  4NQ8 A;  3W9W A;  2WBD A;  4X8R A;  5EYG A;  4PAI A;  5IZ1 A;  4N91 A;  1NV1 A;  3KBZ A;  4IR8 A;  4PDD A;  2FIE A;  4P3L A;  1KA0 A;  2XA5 A;  5IGA A;  1DK4 A;  4PBQ A;  2Q9T A;  3KC0 A;  4LN5 A;  5EQ8 A;  5F24 A;  4F19 A;  2VPN A;  4HE0 A;  1IMF A;  2ZZV A;  1VDW A;  5IZ3 B;  4MNC A;  1D9Q A;  5I5P A;  4GX6 A;  2CZH A;  2QPQ A;  3FBP A;  1FBG A;  3FXB A;  1FPG A;  2WBB A;  3B8B A;  1CNQ A;  3RYD A;  1G0H A;  4PCD A;  3HFU A;  3E78 A;  1FBE A;  4N8G A;  2DE3 A;  4PTK A;  4QXD A;  4NN3 A;  3BIH A;  1FRP A;  3BIG A;  4OVQ A;  4I3E A;  2CEX A;  1IMC A;  1BK4 A;  4GBV A;  1NV4 A;  4QBA A;  4N8Y A;  4PE3 A;  3IFC A;  3LUZ A;  2VT5 A;  5CM6 A;  2XWK A;  2HZK A;  2R8T A;  4N81 A;  4YZZ A;  1FBD A;  3T0J A;  4XFE A;  2WYP A;  3KC1 A;  1LBZ A;  1NUX A;  4PAK A;  3D1R A;  1IMB A;  5EQ7 A;  2L5V A;  4I3Y A;  4O94 A;  5ET7 A;  4F1V A;  3EKI A;  4PGP A;  4H45 A;  1FTA A;  2JJK A;  4NAP A;  2GQ1 A;  4AS4 A;  4PF8 A;  4H46 A;  4MEV A;  2HHM A;  4N15 A;  1IMD A;  5LTC A;  4I40 A;  2FBP A;  4OVT A;  5JK4 A;  3E79 A;  1K9Y A;  2WYK A;  2V4C A;  4GX4 A;  5ET6 A;  4M1V A;  2Q74 A;  1DBZ A;  5I7I A;  1EYJ A;  2XWI A;  4OVP A;  4OVS A;  1NV3 A;  4F1U A;  4JVC A;  1LBX A;  1FPI A;  2QFL A;  1LBY A;  4MNP A;  2CEY A;  1FPE A;  5LDZ A;  1Q9D A;  4PF6 A;  4XEQ A;  4G61 A;  4JVI A;  1RDZ A;  4N6D A;  3ISP A;  3PTY A;  4N6K A;  2MKZ A;  4N4U A;  4OVR A;  1SPI A;  1DCU A;  4YIC A;  4HXV A;  2ZZX A;  2WX9 A;  4F18 A;  1FPB A;  4PBH A;  4P9K A;  3ROJ A;  1G0I A;  2HZL A;  4HE1 A;  4MIJ A;  1NUZ A;  1FJ6 A;  1EYK A;  1LBV A;  1INP A;  4XF5 A;  2F5X A;  1FPL A;  3SZP A;  2F3D A;  2FVZ A;  2DE2 A;  2PFY A;  1FBH A;  2Y5L A;  2Q8M A;  4N17 A;  3W9V A;  4O8M A;  5J16 A;  1YYZ A;  5ET5 A;  3RPL B;  4PC9 A;  4AS5 A;  1FPF A;  2KQZ A;  3MST A;  2QVU A;  2DE4 A;  4PAF A;  5FBP A;  1LEV A;  1NV0 A;  5ESY A;  4GBW A;  4O7M A;  3NOH A;  4GWS A;  4P1E A;  2VPO A;  4PET A;  1QGX A;  1JP4 A;  4MNI A;  3B50 A;  2V3Q A;  4PGN A;  4HE2 A;  5EQ9 A;  4GWX A;  5A5L A;  4KXP A;  5IZZ A;  2CZI A;  1FPJ A;  2B4L A;  4X9T A;  4MHF A;  5IM2 A;  4GWU A;  1NV2 A;  1RDY A;  1YZ0 A;  2P3N A;  1FBF A;  4NG7 A;  4PDH A;  1AWB A;  1NV6 A;  2Y5K A;  4GWZ A;  4X04 A;  4P56 A;  4NF0 A;  5DW8 A;  4MCO A;  4NHB A;  4HCY A;  5EQA A;  3QMF A;  1K9Z A;  1FPK A;  1IME A;  1FBC A;  2CZK A;  3GYY A;  1NUY A;  1KA1 A;  2XWO A;  3LV0 A;  2QVV A;  4DI3 D;  4GWW A;  5ET8 A;  4GWY A;  5J1D A;  4JVD A;  2XWV A;  4O7I A;  1LBW A;  2WEF A;  4FBP A;  2DVZ A;  4OAN A;  1NV7 A;  2PFZ A;  5EYH A;  1FJ9 A;  4NX1 A;  3CHG A;  1NI9 A;  5T3J A;  4GX3 A;  4UAB A;  1KZ8 A;  4MX6 A;  5IZ3 A;  1NUW A;  4PFR A;  4DI4 B;  2B4M A;  4P47 A;  3MYU A;  1XI6 A;  2OX3 A;  3A29 A;  2PCR A;  2HPG A;  1FBP A;  2F3B A;  4NGU A;  3U65 A;  2QVR A;  4PFB A;  1NV5 A;  4OA4 A;  2BJI A;  4P8B A;  4HCW A;  4MAG A;  2XXK A;  2FIX A;  1YXI A;  1RDX A;  5I3S A;  2OWZ A;  2KR0 A;  2P3V A;  2FHY A;  3RPL A;  2ZZW A;  1FPD A;  1IMA A;  2DDK A;  2HXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...