4MINA

Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor nad
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
339
structure length
339
Chain Sequence
b'MVVKVGVIGTGAMGRAHIDRLTNVLTGAEVVAVTDIDHEAAEAAVRDFHLNAKVYPDDTSLLQDPDIDAVFVVSFGGAHEATVLKALDTDKFIFTEKPLATTLEGAKRIVDKELTKSKKVIQVGFMRRYDQGIRALKEKLDTGIIGAPLVVRASHINPNVASNYSNEMAITDTLIHEIDEMHWLLDDEYTSIQITYPRQSAEVRNEGLHDPQLATLTTKKGTVIQVLVHVTAQYGYEVKLEVIGETGELQLPNYGLGPILRSNANQQTAVEMSWINRFIQAYNTEVQEFIDEVAKSEPPVGPSAWDGYIAAITAAAANRSQKDQETVLINVAGTPTFYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
publication title Crystal Structure of myo-inositol dehydrogenase from Lactobacillus casei with bound cofactor NAD
rcsb
source organism Lactobacillus casei
molecule tags Oxidoreductase
total genus 114
structure length 339
sequence length 339
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.18: Inositol 2-dehydrogenase.
pdb deposition date 2013-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4minA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4minA01
1KETA 4OXNA 4JBIA 3OM9A 4II2A 3TZCA 2XOXA 2ZIZA 5C7OO 5ER9A 5JW6A 1EQUA 1JW9B 1DJQA 3JQFC 4LRTB 3QWBA 3QVOA 3DBRA 2FP4A 5I8WA 2BRUA 3L9WA 1Y8RA 3V2HA 4AVYA 4UVEA 3UOGA 4D0RA 2ZYAA 2WYUA 3W4IA 1E7QA 1VL8A 4BS9A 1A4UA 3CTMA 4LVCA 5GMOA 3JQGB 3WGZA 4WCFC 3DZHA 4XD2A 5KVSA 4Z9FA 1PQWA 2GLXA 3JCZA 5ICSA 3ZWYA 4J3FA 3PI7A 5DF1A 4QSMA 4MIEA 2AQIA 1LQTA 1EVJA 3AM4A 1U7TA 3AJRA 4Y6SA 5DBGA 4CV3A 1YL7A 4PVCA 4QUKA 4YEDA 4LRSB 1KVUA 3AUUA 3T4XA 4ESOA 1U4OA 4RF4A 1QV7A 3MTGA 1NXQA 3IUPA 1WMBA 3ZHZA 4IJWA 1LSUA 2GO1A 2O4CA 2P9CA 4E5NA 1KERA 2PA3A 3CE6A 4Z0HO 1CQJA 3RKRA 3TFQA 3PHJA 2Q1WA 1XU7A 4FJ0A 5CPFA 1PJCA 2Y99A 1PJBA 4IJUA 4XGKA 2OP0A 1PGOA 3HDQA 1SEVA 4I9UA 4ND1A 5T8KA 4NK5A 4DXHA 5CDGA 3DZIA 4ZGWA 4RV9A 5T64A 4CM1A 4CM9D 3BYZA 3ZU4A 1DC5A 4H3VA 2VZ8A 1ID1A 1H0KA 5EESA 1B8VA 3GFBA 4CM9A 4KUHA 2RIRA 4BQPA 5I7EA 1RM3A 1LDMA 4HUJA 1WZEA 4BO0A 3ITDA 1ZK3A 3MJCA 3NJ4A 2DBQA 1GPDG 5IDWA 1VKNA 4P8RA 1A27A 2AHRA 5KVQA 1HDYA 3FR8A 4UVDA 3F6YA 1UAYA 3P5SA 3ZHXA 5HTOA 4IDCA 4L4RA 3DR3A 4BHTA 3LT1A 4WJZA 2IE0A 3ZWXA 1UZNA 4YJGB 1UP4A 3OIFA 4BNIA 4GI2A 4GQAA 4KZPA 4NBWA 3N58A 1VC2A 2BHLA 5FYDA 3ETEA 4BGUA 4R68A 3WIDA 2D8AA 1UJMA 4TZKA 4YJFA 2GSDA 2HMSA 5F3RA 2DKNA 1DIAA 3R1IA 3ZWMA 3OHSX 4PG8A 2F00A 4B7UA 2VHYA 1GY8A 1I0ZA 4ZU3A 1PS0A 4OYRA 5CP8A 1ZK0A 3D7LA 1YONA 2AE2A 1SB9A 1OAAA 2B5VA 3K9QO 4TMFA 1LSSA 5I9NA 4BKUA 1HE5A 1LUAA 2OORA 2VNSA 3AOEC 4R01A 1KVQA 3VVBA 3WGYA 3EY4A 3L77A 4DQUA 4BNVA 2O48X 4Z0PA 1NBOA 3VPHA 1EDZA 4RF2A 3S2IA 1Q7BA 1IUKA 1B8PA 2D0IA 2QYTA 5HA5A 4J1TA 3IAHA 3H7AA 3VTZA 4KOAA 2IZZA 3B6ZA 5JDCA 4L9RA 3S1LA 4B4UA 1ISIA 2FMUA 3PEFA 4CV2A 1NVGA 4BL5A 3HN7A 3GZ4A 4RGBA 4CLXA 1UAGA 4O5OA 1ZXLA 1Q1NA 3QIVA 1GYQA 1R0LA 2NU8A 2XF8A 4J16A 3WQSB 3BHMA 5TS3A 2C29D 2PGDA 1CQIA 4CPDA 4FW8A 4NQZA 2YV3A 3BTSA 2Y1GA 3MCVA 1OC4A 1YJ8A 4E5MA 4EGFA 1NYTA 2W8ZA 2ZJ0A 4OSPA 4OJNA 2YHUA 3I4FA 3PLNA 3E03A 3L4SO 5JAZA 2GD1O 2BGKA 3LVFO 4A27A 3U5TA 3RJ9A 4Y9DA 1B15A 3AFMA 3PHHA 2NADA 5CDTA 4ZRMA 1NAIA 4B79A 2DBZA 4QECA 1NP3A 4QEDA 3AW9A 1XU9A 2I76A 3JSAA 1BGVA 3WGOA 2BI8A 3IS3A 4ALKA 2IZ0A 1R4MA 3VH1A 3VKUA 3ZU2A 1K6XA 5A1TA 2A4KA 4W9NA 4W99A 4BGIA 3QW2A 1PGJA 4ZICA 1PZGA 4XRRA 5K6AA 2ZCVA 1HYEA 2PH5A 1WP4A 1BXKA 1O95A 4ALLA 2UDPA 1HSOA 4RVGA 5DULA 4CMKA 3QE3A 2C5EA 4O1MA 4RQTA 1GQYA 1FDWA 5COAA 1LSOA 3CINA 1B3RA 3H3FA 4EDFA 5HRUA 4KDFA 2HMTA 4GSKA 1VSVA 3GGGA 1HDRA 2NV6A 3INRA 4DPKA 4D45A 5FFFA 2FSVA 1C1DB 4LSMA 1H94A 3D64A 2E6UX 3SBOA 4MO2A 4CMIA 3RBVA 4AJJA 3VH3A 1SC6A 5TIIA 1WDLA 1BDBA 2VRCD 2Q4EA 4R4JA 3DDNA 4OXYA 1V3UA 5IZCC 3WMWA 3GPIA 4Z9XA 3ST7A 1AN9A 1P9LA 3VPFA 3CMCO 2JHGA 5I7VA 3TF5A 2FSSA 2NTVA 1ZH8A 5KJCA 3DZBA 3AOGA 1MFZA 3LC1O 2Y1FA 5CAEA 5B4UA 5L45A 3SLGA 4DTIA 3BAZA 1QKIA 1UP6A 3EK2A 3NGLA 4WUVA 4XWYA 4R51A 4MVJD 3R3SA 4R5MA 4QXMA 4QT0A 3H2SA 3V1UA 2UUPA 4B7CA 3I5MA 3ZU3A 4XDYA 1V9LA 4TSKA 4BKOA 1ZSNA 1RM5A 3ANLA 1HETA 5BSHA 3O9ZA 3GGOA 1ONPA 4FBGA 2PH3A 3TL2A 4RPLA 3OFSA 1PR9A 1KC1A 1D1SA 2H5LA 6LDHA 1IULA 4YQZA 4WNIA 1P45A 5A3VA 1DOHA 4ZQFA 5KIAA 1IL0A 5F5NA 2P4QA 4R16A 5AYVA 3CZRA 1QORA 2R00A 1T1SA 3HZZA 2VCYA 3JYNA 1S6YA 4RF3A 3P7MA 1AGNA 1AXEA 4A10A 1DIGA 2Y66A 3I9MA 3UXYA 4ALJA 3QY9A 1QP8A 1NFQA 1ADBA 4A0SA 4CLEA 1P1HA 3I3OA 3VOSA 1LTHR 1BVUA 4B3JA 1SOWA 2JFHA 1M6HA 2TMDA 4KUGA 4QTZA 4IPTA 3JYOA 5I7SA 5TQVA 4IQ8A 3RQSA 3RUHA 5A9SA 1ISHA 3BIOA 4FGSA 4BMVA 2VYVD 2GPTA 5H81A 3GHHA 3RUCA 3DAGA 2ZJ1A 1YH3A 2VYVA 1YRLA 4ND2A 2C82A 2HRZA 3IDSA 5G4KB 1BG6A 5EQFA 3DAPA 1WNTA 3WFIA 1EK6A 3I6IA 1H6CA 1V6AA 2DBVO 1ULSA 4LCEA 5JY6A 2FN7A 4A7PA 3N7UA 3JQ9A 3OIGA 2X0IA 4FJ2A 4BVAA 2V6GA 1KBZA 2XXBA 1I33A 1F8GA 1E1NA 3GRPA 5L53A 2NVWA 1MP0A 2O3RA 2GR9A 4JP2A 4FIZA 1GAEO 4ROSA 4XIJA 2RHRA 4F6CA 5TRTA 4U0JA 2DUUA 2A35A 5AXDA 1IB6A 1E3WB 1ENOA 5ITVA 1N1GA 5C7LO 4MOWA 5F1OA 3CIFA 3HNPA 3BTVA 1EUZA 3LF1A 2JHFA 3PP8A 3JQAB 3WSWA 4F46A 3KXDA 2X58A 4AICA 1IYZA 4NH4A 3E82A 3DWFA 1SB8A 3G1UA 4PLGA 1UH5A 4O0LA 5ADHA 2YY7A 2ZTVA 4OO3A 1TA4A 3AWDA 4IDEA 3RD5A 2VT2A 1YB5A 2HMVA 4WK6A 1H6BA 4OL9A 3WTCA 3WMXA 2W90A 2EHDA 3A28A 4PLHA 3WGTA 1KVRA 1UXKA 4E6PA 4J1SA 4J7UA 2PD4A 3GDGA 4BUCA 3FBGA 4NU5A 4Q3AA 5EINA 4XZ3A 1NR7A 2D2IA 4NBRA 1RM0A 4L8VA 5IAAA 3VH2A 2C07A 2GYYA 2HJRA 1PGPA 5FI3A 1XEAA 4XYMA 4B3IA 1X1TA 4E2WA 2PKQP 2J8ZA 4J6FA 2EKLA 4G65A 4K6FA 5F5LA 4GMGA 3VVCA 2DTDA 4L73A 3BMNB 4R9RA 4BKPA 1HDZA 1VPDA 3CMMA 2ZTUA 3DO5A 1DBVO 3GVXA 4FS3A 1DRUA 1G1AA 4YBZA 4TROA 3QWIA 4O59O 2FZWA 3ICPA 5MDHA 4L74A 4R54A 3DBHA 3E48A 3FWNA 2X1HA 1BXGB 3PLRA 3WBFA 1QLHA 1A9ZA 4CQMB 3WGIA 1YDWA 3MOIA 3KO8A 1PEDA 1E6EA 2O23A 4YRBA 1IZ0A 3AFNA 2VYND 3VDRA 3H8VA 1E92A 4J7XA 1HLPA 3KVOA 4BO1A 4Z3KA 4CM8B 3PZBA 4CV0A 1NASA 4Y67A 3I9JA 1QR6A 3ZW8A 1LSJA 5G0UA 2W98A 1WZIA 2UUOA 5B1YA 4Q3DA 2NU9A 3OQBA 1L7EA 4RORA 5DZSA 2SCUA 4ZQEA 5JPIA 3ROKA 4FFPA 4ZVVA 1GYPA 3DZGA 4BNYA 3GOHA 4E31A 5TC4A 4BO4A 4J4HA 4RZIA 4D3SA 1LU9A 4XJSA 5IF3A 1PS8A 2X0JA 1CDOA 1QLJA 3KTDA 3KSUA 3NT4A 4CODB 4CQLA 4W4TA 3AUTA 2X5JO 1LA2A 4FDAA 4FN4A 1I10A 3ZH2A 4J4TA 1U28A 3NDRA 3DBRB 4GX1A 2B4TO 1LJ8A 2BFMA 3DHEA 1Y8RB 1V3VA 2DFVA 4BNUA 5KNLA 2ILTA 5JC8A 4J2OA 1NPYA 2VHXA 1LEHA 5L4NA 4OMUA 2NVBA 3KYCB 1EE2A 1Z73A 4J1QA 4W7HA 4URFA 1KYQA 1PJTA 2GN6A 4Z0TA 1QYXA 2HU2A 1IHXA 2NUAA 1EFKA 2O2SA 3X2EA 2EP5A 1EEHA 1I3KA 4D3DA 3HFSA 1DFGA 3FPCA 4LW8A 5JYEA 5BSFA 5JXWA 1HT0A 1JKIA 1N2SA 3GLQA 5HS4A 5JAMA 5C3MA 4MVJP 1KVSA 1T2EA 4DYVA 1D1TA 4PG5A 1I3MA 1YB1A 5JNLA 2EKQA 4IDGA 3WQRA 1H9BA 1MB4A 1RM4A 3RC9A 4P38A 4PLWA 3ZNNA 5A4DA 1XGKA 1H6AA 1GD1O 1PJSA 1P1RA 5U1PA 4LISA 3ULKA 4UUMA 4BNHA 4B4VA 2J3IA 2IZ1A 1JVSA 2GGSA 4IGFA 1NVTA 3JQBA 1YOVA 2RAFA 3TZHA 2WE7A 2YW9A 3KBOA 1BVRA 1T2DA 1YKFA 1CYDA 4FQ8A 2Q1SA 2JCVA 2GASA 4DA9A 1D3AA 4BOYA 1D7OA 3GVIA 4BV8A 3CKYA 3SLKA 2Y0EA 3VZRA 3N74A 4N54A 1W0CA 3K2EA 4GVXA 4CL8A 1C0KA 3AK4A 3PIDA 1H5QA 1X0XA 1ISMA 4Z9YA 3VC7A 3K31A 4IGEA 2QQ5A 2EW2A 4U6QA 2CF6A 2VUUA 2Z5LA 1Y8QA 4E5PA 1OOEA 2J5KA 1ULUA 3ETGA 2EG9A 1R6DA 1WMAA 4BO5A 3ZV5A 3DOJA 3I52A 4NZ9A 4EJMA 4R1UA 2WYVA 2P2SA 4TRJA 1EUDA 2B35A 3M1LA 2OUIA 5L3ZA 2J3KA 4YJFB 4YACA 1FDTA 4EUHA 8ADHA 1DSSG 3HJAA 1FDVA 4ZQHA 4JX8A 1PWZA 5I8ZA 5JDIC 5TX7A 4CLOA 2DTXA 3GF4A 3SXPA 1E3SA 4B4WA 1T24A 1BHSA 1KEVA 2DM6A 3ANNA 3KZVA 3KYDA 2NNLD 5IN5A 5BQFA 4RCVA 2I3GA 1U5CA 3U9LA 4QQRA 2QX7A 4A5OA 3G0OA 1PS9A 4J90A 4W6ZA 2CNBA 3OJ0A 5IDQA 3ZV6A 1F14A 4XQGA 4BNTA 1EVIA 2BMAA 4JJIA 5ILGA 3GRKA 5KKAA 4PCVA 4CR7A 3NEPX 5AXBA 1PL7A 3U49A 1F06A 1E1MA 4ND4A 4I1IA 3B1JA 3WX0A 3ZU5A 2HJSA 2ZB4A 2QZ9A 4YPOA 1U2DA 4XR4A 5JO0A 1PSDA 3L07A 3G3EA 2AXQA 3EHEA 1DXYA 2QG4A 1BWSA 1CJCA 4GSLA 4PG6A 3K96A 1LDGA 1Q7GA 2X5OA 4IDBA 5DBIA 2CSUA 3ZWPA 3EYWA 3GEDA 4LMRA 2BFAA 4WLFA 3A9WA 3ZGYA 5A03A 4C7JA 5A9TA 2VWPA 4BMSA 3EVNA 2AEFA 3A1NA 2WMDA 4IMRA 3U4IA 3AI2A 3JQ6A 5C7IO 1T2AA 2G5CA 1HTBA 2IRWA 2D5CA 2NTJA 4K26A 1PQPA 5BSGA 1HDCA 5K0ZA 2FPIA 5TT1A 4BO8A 1MFPA 1WXDA 1E3JA 3KETA 2WTBA 5COQA 2CY0A 2VOEA 4KP7A 4UVHA 3OEWA 2HO5A 4RO0A 2LDBA 1T26A 1EK5A 2QIOA 3PHIA 5JDCC 2NVUA 3Q2KA 3UF0A 1N5DA 4YCAA 1B3BA 3FBTA 4D42A 4EBFA 4JBGA 5J9GA 4MIYA 3K92A 3O8QA 2Q22A 5GY7A 4U0KA 1SBYA 4S1VA 4AJKA 5A5EA 1WLYA 5DOZA 3AI1A 5A04A 1YDEA 1LRJA 4HADA 4XYBA 3UN1A 4RF5A 3TOZA 2PZKA 3ZHBA 4A26A 3COSA 4CMIB 1EUCA 1I01A 2I5PO 2W2LD 2JD1A 1H9AA 2HUNA 5CDSA 1PWXA 4MPDA 2Q1TA 3GVCA 3GT0A 3FWZA 1A71A 1R4NA 2NTNA 4HY3A 3H5RA 2QRJA 2W2KA 1V8BA 4XB2A 1LDBA 4CR8A 2PLAA 2D5AA 1A7KA 3QWAA 1G6KA 3AU8A 3SX2A 2E82A 2PGLA 5GZ3A 1G0NA 1P77A 3DTTA 1AHHA 1DHRA 1NWHA 1SZJG 3I6QA 3OQ6A 3HDYA 4W9NC 4GVLA 3PYLA 1R37A 5G0SA 5K6AC 4YAIA 4YAKA 3IJPA 5H82A 2I6TA 4H15A 1I2ZA 4Q3EA 5TJHA 3EGOA 4IQGA 3IP3A 4K6CA 3U0BA 2DAPA 1T25A 1Y6JA 3JQDA 2WJPA 2E4AA 4DBVO 1M76A 3HDJA 1B0AA 1Q0QA 1ZFNA 4CMAA 4NK4A 1U2GA 1I5RA 3W4KA 1R66A 2CVZA 3ABIA 2PD6A 2GNAA 1I24A 2I3AA 1GZ4A 4YWJA 1P0CA 4CM7A 3FD8A 3NDIA 4FC7A 3S2GA 2NM0A 4WKGA 4GX0A 3OECA 4HFRA 4E0BA 3KSDO 5IJZA 3FCOA 3H3JA 1ZMOA 5CDUA 1Y9EA 4OHUA 1F17A 3MJTA 4BB5A 1I32A 3V2UA 1U5AA 3S8MA 3W4JA 4K28A 4IXTA 4FGWA 4BB6A 2A94A 4CUKA 2C54A 1KEPA 3JV7A 3AY3A 4F6LA 4EW6A 1PGNA 1NHGA 1C1XA 3SC6A 1Z82A 5G4LA 5BNFA 1VJTA 2Y0CA 3LU1A 4CM4A 3F1LA 2QRKA 2JL1A 3FNEA 5JYAA 1ZEJA 1EE9A 2DC1A 3H9JA 1TI7A 1ZW1A 3BMOB 5L4SA 5COBA 1J0XO 3OEYA 4JCOA 2GN8A 3JYPA 4HFJA 4PLTA 3AM5A 2WD7A 3JD0A 1RPNA 1FDSA 1ZK4A 4WNCA 1S7CA 4XYLA 3NRCA 4E33A 2VT3A 3AY6A 4NIMA 3X2FA 3W6UA 3ZZNA 3MTJA 3C7CB 3LK7A 1F0YA 4E21A 2AQKA 3IMFA 1UDAA 1U3VA 1JDJA 2P4HX 4OIMA 2Q49A 4ILKA 2EKPA 2LDXA 4UULA 4GBJA 5AOVA 3H65A 4LK3A 4AJHA 3HSKA 2VUSA 1R0KA 3ZHYA 8LDHA 4NI5A 4AJPA 4YJHA 4JK3A 1MC4A 4FPXA 1W8DA 5ES3A 1MX3A 2EXXA 1M2WA 3HWRA 3GUYA 1VE9A 1XQ1A 3M6IA 2NU7A 4IDDA 2VTDA 1LC0A 1YVEI 3JQFA 2YFHA 3FNFA 1HE2A 3PFWO 2PGJA 3DZKA 4KWHA 4G5HA 4ZQGA 3IC5A 4OOEA 1ZEMA 5CPBA 2CZCA 5LC1A 1TXGA 2FR8A 3U4DA 5BT9A 1D8AA 1YQGA 3AI3A 3ASUA 3MJVA 4FFRA 2HRBA 4KDEA 4NU6A 4UUPA 2UVDA 2ZK7A 3JQ9C 4UREA 4BO6A 4DLBA 4PRLA 4YYZA 2WM3A 1HYHA 2Y1DA 3K5PA 2YDXA 5CG2A 3W1VA 5TLSA 1CIVA 4HP8A 1E7SA 1YS4A 2IXBA 1DAPA 1Q0HA 4JP3A 4DIFA 4EEZA 3EVTA 4Y98A 1PZFA 4CMGA 5DCUA 3ZWWA 3IKVA 1B16A 3UKOA 3PHLA 1N1EA 2Y1CA 3DBHB 4QO8A 1XCBA 2OP1A 3I23A 2PTGA 2WDZA 3WS7A 5A5FA 4NFYA 4YA6A 2JD2A 2PNFA 3GAZA 3VZPA 4M55A 4J49A 1ML3A 2VZ0A 5DOVA 1T2CA 1XR3A 2C5AA 1E3LA 4J9UE 2QZZA 2WD8A 4M54A 9LDBA 1M6WA 3STHA 4ALMA 1GV0A 2VRCA 3LT0A 4JQCA 1B7GO 5EIOA 2Q2WA 4EUFA 2O3SA 3EDMA 3MWEB 4JBHA 3EW7A 4EITA 1GEGA 1LLDA 3RJ5A 4BNKA 3R0IA 3H9UA 1OBFO 2VHWA 4DLAA 4CLRA 5CEJA 1NX6A 4GPD1 2X6TA 2EERA 2EF1A 4CQLB 2CVOA 1ADCA 2OBNA 5DP2A 4GWGA 4WOJA 4MVJA 1PJ3A 1VL0A 4OGWA 4NBVA 3L0DA 2CDAA 1ZBQA 5JAIA 1LDEA 4Z3DA 3ZNPA 5L9AA 2PK3A 3WB9A 4KQWA 4BNXA 3OJEA 2GN4A 4R5HA 2JJYA 3OQ1A 3C24A 4XA8A 1SAYA 1EBUA 5T6BA 4BIIA 2BGLA 3L6DA 1PX0A 3M1AA 2RBEA 3GUCA 3OJFA 4U6SA 4JJFA 3HQ4O 4FSHA 4MP6A 4IJKA 4X54A 4RPJA 3U62A 1ENZA 1H2BA 2HCTA 2B5WA 2CVQA 3KEQA 1O89A 4D46A 1GUFA 1LDYA 4CM5A 1GV1A 4NMHA 4Q3CA 3TWOA 5JCXA 3VAZA 2GRAA 3VHRA 4GX2A 4LGVA 1UDCA 3TRIA 4ALIA 2FRDA 5FI5A 4E2YA 1RYDA 2CD9A 3K73O 2OOSA 2X22A 4J43A 4RPKA 3ZN2A 1CF2O 4ZQBA 4NJMB 1MG0A 4ONEA 2VOJA 3WOHA 3SJUA 1LRLA 3E9NA 1PTJA 3GPDG 4J91A 4M49A 4IY1A 2UYYA 1YOVB 2FOIA 2FR0A 3LSYA 4YJGA 2UAGA 2YDYA 4JROA 1YBMA 2OL4A 3ZWAA 1IPEA 4XGNA 3S55A 1E6UA 2GF2A 1EVYA 4CLHA 3DOOA 1OFGA 3ZNQA 5A3JA 1XA0A 4RDIA 3MZ0A 5IXYA 5JY1A 1PZEA 4BNWA 2YZ7A 3DZFA 1DJNA 2IEDA 3RVDA 1F12A 3GDOA 1ZVMA 1GQQA 4HKTA 4BNLA 4D44A 4PZDA 3ZWVA 1XG5A 1XELA 2XPCA 3GEGA 5G0TA 2DVMA 4DC1A 1DO8A 4EYEA 3E6AA 3W6ZA 4I9HA 2Y93A 2CF5A 1Y8QB 2Q2QA 1NHWA 5JSFA 1Y81A 2YHIB 2VRBA 3PJGA 2GDZA 2BF7A 1HLDA 1WAMA 2DQ4A 3W8FA 3HADA 1YL6A 4WECA 1TEHA 5KJFA 1NQ5A 4AJLA 1T2FA 3TZ6A 1TT7A 2G76A 4E30A 1JKFA 1NQTA 4PIVA 4NJOA 3OBBA 5CEEA 1GADO 3C8MA 3INGA 1GZ6A 2BKAA 1C0LA 1ZZEA 5DCYA 1X13A 5T67A 1YE3A 4I08A 3ZV4A 4FC6A 2Y05A 5KJ1A 5AVOA 1XKQA 3L4BA 1HL3A 2J3JA 3QV1A 2IEBA 3IQDB 3OH8A 3AM3A 4CLOB 2YUTA 2JAHA 4IBOA 4IJVA 2R2GA 4XYGA 5ICMA 5ER6A 5DT9A 2YJZA 4IDFA 1P74A 4U7WA 4RZHA 3C85A 1HZZA 3WGQA 1UR5A 2X0RA 2YFQA 3JQCA 3FHLA 3LDHA 3DTYA 3GC6A 1PL8A 3WLEA 1Y5MA 1E3EA 3GAFA 1UXJA 2DPHA 3B20A 5HS6A 5FWNA 1PL6A 2YQ5A 2QYSA 3FF4A 3K2BA 3EUWA 5JCJD 3C7DB 4ZJUA 3JD4A 3U09A 4XR9A 3PFFA 4WLNA 4JLWA 3DBVO 2OO5A 4Q3BA 3ZW9A 2HK7A 2DTEA 1I3LA 4G2NA 4BMNA 3H9GA 3PQFA 3O38A 4DVJA 5U4QA 3ROQA 1LLUA 2E49A 3UHAA 1N92A 4GLOA 5T57A 3EAGA 1RKXA 4IXWA 3LT4A 3WXBA 3Q0EA 1E1KA 3DBLA 2VZ9A 2ZB3A 1OZAA 3RSHA 1V3TA 1ZMTA 5DNAA 2PZMA 2VYNA 3BA1A 4H16A 5JS6A 1O8CA 1U8XX 1W73A 2Q99A 4A73A 3U4CA 1EDOA 1ZSYA 1ZIDA 3GVPA 5DP1A 4ALNA 3WLFA 2AEJA 3DMTA 4E13A 4AG3A 2P5YA 2DBRA 5KWEA 1GCOA 3OF2A 5L7YA 4B8ZA 4BNGA 5JFOA 4II3A 4ZD6A 2GERA 1DC3A 4RVSA 5BR7A 3UUWA 3E5MA 3C7AA 1DEHA 4P4GA 2G82A 1GR0A 5GZ1A 3PTZA 3UVEA 1TT5A 2CFCA 3IOYA 2NVUB 1O6ZA 3ORFA 2HQ1A 4OKNA 5HM8A 3GQVA 2E48A 4J0FA 2HK8A 5TGDA 1F8FA 3ENNA 3P2YA 4PGFA 4GGPA 3BXXA 3E9MA 1IPFA 5JC1A 1HXHA 4MDHA 1DAOA 4RJTA 4R41A 4NPCA 3GMDA 5JMPA 5I9MA 1XDWA 4UVIA 3PJEA 3PHGA 1PIWA 3DMYA 5KKCA 3PYXA 1E0DA 3E8XA 3NGXA 3OICA 2HKIA 4FFNA 1VL6A 3QSGA 3ZWOA 4FB5A 1EZ4A 1X15A 4TZTA 3FRJA 5M6DA 1YBAA 4RVHA 4B3HA 1EBFA 2Q3EA 4PN3A 2WSBA 2X4GA 4TVOA 1ISFA 3VTFA 1VRWA 1X0VA 1ZK2A 4I5GA 1Y9AA 3TDKA 3WYBA 4YAGA 2AW5A 1MXFA 2DPGA 1KEWA 1W6UA 2NACA 1NWCA 5BNTA 4XJTA 3ONDA 4NFHA 4QFCA 2X7HA 4WCDA 7ADHA 2VHVA 5IG2A 3RIHA 4N7RA 1PJ2A 3RCBA 1P3DA 4KMSA 4JN6B 3ONFA 3T7EA 3GFGA 3ONEA 4DQVA 3GG2A 3NUGA 1ZCJA 4CMBA 1J4AA 1ADGA 3GH3A 5K9ZA 1XLTA 1LXCA 2VQ3A 4WOKA 5JO9A 2G1UA 4J9VA 3INTA 4IINA 2PKQO 1YB4A 2OMEA 1E7MA 2O7QA 3KV3O 3WNQA 2B0JA 5KVVA 1WVGA 1U3TA 2D59A 1VI2A 3HDHA 4CMEA 1NTOA 4NNJA 4EJ0A 1ZJYA 1YQXA 1P1IA 3V1YA 1WWKA 1LX6A 3FSRA 4EI2A 3ZCXA 3QP9A 5KCZA 1T1RA 2HSDA 3NTRA 4DREA 3D3EA 2W4QA 1E77A 1DIBA 2OGUA 3WWZA 1A72A 3B1KA 4RLHA 3K30A 2VTEA 1N7GA 2DU8A 3BTOA 3DC2A 4NFSA 4DGSA 3AU9A 1HDXA 1K6IA 2D1YA 4M89A 4OAQA 3PXXA 3TZKA 1ZK1A 3WTBA 5G0WA 3F46A 2C2YA 4NR0A 3TNLA 1YXMA 2VWGA 5IDXA 3KHUA 1NNUA 3D4PA 3ROMA 3BMQA 1C1XB 1GTMA 2QW8A 4KUEA 1QSGA 4RQUA 5T8KC 3MJEA 4CM4B 1ZJZA 1GL3A 3E9QA 1DRWA 3GZNA 3PGJA 4YT4A 2FPPA 1XYGA 3I1JA 4MINA 2AA3A 4HFNA 3EZLA 4UAGA 2EJVA 4MP8A 4PG7A 3V5NA 2WD7B 3EMKA 5TSDA 5A9RA 1NPTO 1BSVA 3L6OO 1Y5RA 3ON5A 4MKZA 3WGHA 2GUGA 1CERA 2HLPA 1GQ2A 4PLZA 1QXSA 4A2CA 2EP7A 5GZ6A 4GKVA 2J5QA 4M87A 3FPLA 1JA9A 4DIBA 1MG5A 4NBTA 4HWKA 4CL3A 1PU2A 3RWBA 3OMLA 1FF9A 3OETA 5ITWA 3DZJA 4EEXA 3GN1A 4YR9A 3Q2IA 1YO6A 3C1OA 2O3TA 2BGMA 3NTQA 1NFRA 4YJHB 3RASA 5J23A 3E1KA 3L6EA 2EEZA 3D4OA 1I2BA 5AXCA 4AJOA 4I5EA 1GPJA 3MOGA 1M67A 2XAAA 2GZ1A 4JNKA 4IIVA 4CMCA 4CQMD 4E4YA 4BNJA 3UW3A 3DFZA 4F45A 1A9YA 3BMCA 4BKQA 4AJ2A 3HG7A 3GG9A 4OSOA 1P1FA 4TRRA 4Y8VA 2H9IA 3RBXA 2JCYA 3DFUA 4Y6RA 2EWMA 1K6JA 3I9NA 2C20A 1UXHA 5EJ2A 3F9IA 3JQ8A 3A4VA 5KOIA 1QYDA 1M75A 3FTNA 1X7HA 2EW8A 4XQ9A 1R4MB 4YJDA 2Z95A 2CUKA 4XX0A 4D3FA 2AG8A 2B4RO 1HSZA 3I9OA 3HB4X 3GVHA 3D4NA 2VWHA 2PV7A 4IZIA 2O3QA 2YV1A 1J5PA 4MVJG 1HRDA 4INAA 1KS9A 4R1NA 2DLDA 2H1SA 5JAQA 4HNGA 1P0FA 4DWVA 1MGOA 1MV8A 1Q0LA 3WIEA 4D43A 3LC7O 1NQAO 5AQ1A 1P33A 2BLLA 4WLOA 3D5QA 1YWGO 3FNHA 4LVUA 2CDBA 1LLCA 3CSDA 2PZLA 4GMFA 1XQ6A 1P31A 3PZRA 4FOOA 1ONOA 1K3TA 3OIDA 1ENPA 3H5NA 2NWQA 4PLFA 3RI3A 3RFXA 5EPOA 2C59A 1ONNA 1P44A 1ENYA 4W7IA 3TFOA 1A7AA 4XQEA 5TT0A 5L7WA 2W2LA 3CZMA 3WNVA 1GYRA 1EMDA 2JFGA 4GLLA 5JYFA 3KYCA 5CHEA 2B4QA 1KVTA 4UEKA 4U8GA 1ARZA 3DHYA 3JD3A 1A5ZA 2AQ8A 1LLQA 4BKRA 2Y68A 2RCYA 4A03A 1XWFA 1JTVA 2IYOA 3H5AA 4M1QA 1GZ3A 4XCVA 4BO2A 4CLRB 5JE8A 5L7TA 2NLOA 2DFDA 1CWUA 1I2CA 4WASA 4TKMA 3F5SA 5EERA 1HF3A 1JAXA 2O2YA 4N18A 4GL4A 2Z1NA 4I5FA 2V6BA 3ITKA 3QQPA 3BTUA 4J2HA 5ILOA 4DPLA 3QVTA 3IP1A 4MVJH 1XHLA 5CG1A 1NFFA 2AQHA 5JDIA 5T73A 1DDOA 4FR5A 1CEQA 1LI4A 2J5RA 3PIIA 1QRRA 2OBYA 1GU7A 4WE3A 1PJLA 1AUPA 1QMGA 4IZHA 1CETA 3EC7A 1JWBB 2QHXA 1BRMA 1ISGA 1X1EA 1LNQA 4RVDA 3SJ7A 3DEYX 4IS3A 4B8WA 3K8ZA 2ZQYA 1FK8A 2C2XA 1WW8A 3F4BA 3PPIA 4CMHA 4MJLA 4BNNA 4J4BA 5DBFA 5G2OA 2DT5A 4MVJM 5JYDA 1VKOA 3LLSA 3RROA 1BW9A 3HUDA 5G0VA 3P2OA 3ETDA 4DQXA 5A9SB 3OA2A 4TWRA 5B4TA 4YRDA 1H93A 5LDHA 1SPXA 2ZB7A 3SVTA 2DUWA 1I3NA 1E7YA 3RUIA 4YTEA 3U4HA 2I65A 3FTPA 3H9QA 4DRYA 4UUNA 3FN4A 4IMPA 4MP3A 1CRWG 4BNMA 3QVSA 1KOLA 1E1LA 4MVJF 4ND3A 4L76A 1BXZA 1EVZA 4G81A 4HX5A 4D79A 1K5HA 2WWRA 3AY7A 1GUZA 2R00C 2Y67A 4Q3NA 3JQ7A 2BFOA 3WWYA 1HWYA 4RDHA 1SEPA 2AMFA 2HMWA 2CMDA 2BI7A 1HEUA 3RC7A 3ZI0A 1BMDA 1Y1PA 4YAJA 4HFMA 3TQHA 2V7PA 4B7XA 4XB1A 4I8XA 2ZB8A 1ADFA 5U9CA 1X14A 4DMMA 3KEOA 2P68A 5TNXA 1Z7BA 2H63A 3SEFA 2G0TA 4RVFA 5EN4A 3S2FA 4XKJA 4F3YA 3WDSA 5FF9A 2X9VA 3QRWA 2Y1EA 1U9JA 2P5UA 2Q2VA 1I8TA 4EUEA 3JTMA 4TRNA 4FFLA 4M8SA 1IOLA 5B4VA 1AE1A 4WCFA 4WLEA 2PY6A 1I30A 3E18A 3KLMX 5DCWA 5CEFA 4R9SA 2V6MA 1QV6A 4D7AA 2Q45A 3OP4A 1HE3A 3V2GA 3QLJA 4R3WA 1N9GA 1JN0A 5MGBA 2X8LA 3TSCA 5JLAA 3DHNA 3S2EA 1R15A 2IODA 5KVCA 4UUOA 3W8EA 1N8KA 5L51A 2EGHA 2OHXA 1FDUA 1SNYA 2V6FA 3PWKA 4UVGA 5B37A 4DL9A 2OXIA 4E5YA 2Q1UA 1FMCA 2VNAA 1R12A 4FOSA 1O0SA 3DB2A 2BD0A 3D3WA 4JGBA 5L4LA 4AJEA 4LN1A 4YVFA 3V8BA 2X0NA 5IDYA 4R3NA 5AXAA 1KY4A 1VJ1A 2A9FA 3AUAA 3R6DA 3BHIA 3DBLB 4DBZA 3FR7A 2C7VA 3L4BC 2Q50A 1DRVA 1HZJA 2EV9A 2Q46A 4I9NA 1UXGA 3LYLA 4WPGA 3G1TA 4TRMA 3BZUA 1MA0A 3CEAA 2VWQA 1J49A 3G49A 2YQ4A 1B14A 3JQGA 1HYGA 1M66A 1SCUA 2G17A 1UZLA 3UFXA 1MLDA 3ADOA 4UEOA 4L4SA 4ITUA 1LRKA 3R3JA 1JU9A 1ZUD1 1U7HA 1Z7EA 3LLVA 3RKUA 1DIRA 1PJ4A 3TN7A 4XRGA 4RPGA 2IXAA 4N5MA 3KLPX 1X7DA 1PZHA 3WGGA 3OSUA 3VZSA 2YV2A 3GK3A 3Q1LA 2IYPA 3K6JA 4XEHA 4CM6A 2F1KA 4PLPA 3GEMA 3TPCA 4OQYA 2AEMA 1TT5B 3W8DA 4YDRA 5A06A 5KJEA 1GDHA 2ZYGA 4GGOA 1UZMA 4L4XA 2FHSA 1Q7CA 4HV4A 7MDHA 3UAGA 4OQZA 2GZ2A 3RAJA 3QHAA 1XIVA 5KJ6A 3GNSA 5TJ9A 4CJXA 4YQYA 5THKA 2ZCUA 1LQUA 1BTOA 1K2WA 2I66A 3H6KA 4R1SA 4XYEA 4LMPA 1ZXBA 5C5IA 1G0OA 2XXJA 3T4EA 2HAEA 3ENKA 3AOEA 3RUAA 4NDNE 1HE4A 2J6IA 4WGGA 5I9LA 2ZKLA 4I5DA 2R6JA 4HXYA 3WJAA 3V1TC 3HFGA 1C14A 4L75A 3O26A 3DMTC 1NR1A 4C7KA 4D41A 4YT2A 4GX5A 5CDYA 1H6DA 2X9NA 4K9DA 1RWBA 2ET6A 2QRLA 2NU6A 3HN2A 2O3JA 4L0QA 3UICA 3I83A 1EFLA 2I99A 2HMUA 3P19A 1L7DA 3Q3CA 1ORRA 4DMLA 2P91A 4AJIA 1GCUA 3E5RA 3CXRA 3RBZA 1HDOA 3ZNOA 5IFLA 1U3WA 3G79A 1B2LA 2WE8A 3MJSA 4N5LA 3LZ6A 1I36A 5DN9A 2O7SA 1DC6A 4P4LA 4E3ZA 4Y6PA 1VJ0A 3B1FA 4R1TA 4EZBA 1WDMA 3IKTA 4J1NA 3AUSA 1O9BA 4O63O 4ID9A 4FFOA 4BO7A 1PQUA 5DDIP 3RU9A 1R0SA 1JWAB 3LT2A 3QWFA 3BMOA 2ZYDA 3CH6A 1OI7A 2BELA 4EJ6A 3H4VA 2GZ3A 1NPDA 2P9EA 1XSEA 2Q4BA 2PR2A 1KIFA 3PJFA 3UCXA 5I7FA 1RJWA 4HNHA 3ROPA 4PRKA 3NKLA 1ZKMA 4PLYA 3NJ8A 1E7RA 3F3SA 2CDCA 4YT8A 1DLIA 4P22A 4S3MA 3LC2O 4DIOA 4PG4A 3BMQB 4E32A 1E6WA 3JQBC 4ZA2A 2I67A 3A06A 4FD3A 3WSVA 4FCCA 2O50A 4CLDA 1VM6A 1GEEA 5JBIA 3GZNB 5F1PA 3C3XA 2O3UA 5KTKA 3KYDB 4Z6KA 4IM7A 5L40A 3WQQA 4E5KA 3M2PA 2OFPA 1YL5A 2Y1OA 4IIUA 1X7GA 3GMSA 1VSUA 3VZQA 1JLLA 2VN8A 2UV8A 1JQBA 3VPGA 4CMEC 3Q9NA 4C4OA 1ZO8A 4CMJA 1DFIA 1T4DA 2B69A 4JJGA 4WEOA 4BGEA 3BHJA 4D0SA 3UCFA 1QYVA 3LQFA 5BSEA 2EIHA 4RVUA 5JCJA 5IZCA 1EQ2A 2FZEA 1ZSVA 5A02A 4PLVA 3GHYA 3ICCA 4RLSA 4HBGA 4XIYA 5F21A 4J7CA 5A05A 1SO8A 1O5IA 1VLLA 3Q9UA 4P4NA 4QFDA 3PRJA 4MKXA 1IZ9A 1N7HA 1K89A 3KSZO 1KY5A 3DQPA 3GGPA 4MKRA 4DYDA 1E7WA 1HKUA 3B70A 4PVDA 3KYBA 5FEUA 5L95A 1P1JA 4PFJA 3D1LA 3QVXA 4JXKA 3MEQA 3TZQA 4R69A 3TOXA 4AJ4A 3RFTA 4DC0A 3F5QA 4CV1A 4IDAA 4N5NA 2TMGA 2B37A 2PD3A 1NM5A 4KQXA 2ZQZA 3PQEA 4TQGA 4CM3A 3PWSA 1GUYA 3BMCB 4YT5A 1E5LA 3ZWCA 5CFZA 2V65A 3C1AA 3JD1A 5EMHA 1TVEA 1NAHA 1C1DA 3WYCA 1Q2XA 4OM8A 3VPSA 4TKLA 2VUTA 5EQDA 3ASVA 3JQ8B 4ND5A 4PZCA 3WJ7A 2P9GA 4IS2A 2JKVA 3JD2A 1OMOA 3PQDA 2B36A 5ENDA 4E12A 2X23A 4PZEA 3UH1A 2X86A 5JMWA 1QG6A 5IZ4A 1R16A 4YRAA 2PFGA 3WBBA 3FNGA 3WR5A 3QA9A 4BO9A 3VKVA 2YYYA 5LDGA 2ZTLA 3PDJA 4XGIA 3O8QB 3GR6A 3CPSA 4GWKA 3KM0A 3M2TA 3RC1A 3WFJA 3GNTA 6ADHA 1A4IA 1HDGO 1ZNQO 2PWZA 3NAQA 1J6UA 1V35A 2JCXA 3NTOA 2NQTA 1PJQA 3ADPA 5THQA 2IDZA 1LBEA 4BQRA 2NSDA 4OH1A 5F1KA 3JYLA 3ZWNA 2EGGA 3JYQA 4RPHA 4YXFA 4BV9A 3NYWA 3OJOA 4DLLA 1GFSA 1R4NB 2ZTMA 3ZDFA 1U4SA 3KOUA 4GKBA 2HDHA 2W2KB 3KB6A 4QO7A 1DC4A 2HK9A 3FI9A 1B26A 4MIOA 1RYEA 2EJWA 3QVWA 1KEUA 3OA0A 3F47A 1V0JA 1C0IA 1FJHA 1U8FO 4WLVA 5LCXA 5EL0A 3SC4A 1Z45A 1NVMB 5IN4A 3H9EO 2RH4A 3NT5A 2Z1MA 4LCJA 3VH4A 4W82A 1DPGA 2D4AA 1PGQA 2GN9A 3A14A 1DHTA 4ZN6A 1UUFA 2JFFA 3Q11A 4GH5A 3KRTA 3IIEA 1AHIA 3GY0A 2JAPA 4MVJI 5B12A 4NJMA 3GA0A 3KUXA 2FWMX 2BH9A 4KTVE 4CUJA 4LSWA 4TVBA 2C0CA 3MJ4A 3H2ZA 3QWHA 4O6VA 3JQEA 4ZHSA 1MXHA 5HBRA 1SOVA 5IXSA 3GN2A 1Y7TA 4IUYA 3I4CA 1DFHA 1E5QA 1BDMA 1E3IA 5G4KA 4WEQA 1Z74A 4OXKA 2PZJA 2FPGA 3NX4A 4AJ1A 3ZWBA 3O4RA 4DUPA 3ZV3A 1C0PA 1QYWA 4BNZA 4Q9NA 4FFMA 1DIHA 3D5TA 3RUDA 1AXGA 4OKIA 4PLCA 1D4FA 2D3TA 1BW9B 1IY8A 2BFPA 2JD0A 4DPMA 2I9PA 2YHIA 3PVZA 1P1KA 4U5QA 2AE1A 1MUUA 1SMKA 3EZYA 4AL4A 3WYEA 3HHPA 3O03A 2FY8A 1E3WA 1W4ZA 1YQDA 2X9GA 3JQAD 3RU7A 3L9XA 3MWDB 3TJRA 4NG5A 3IL2A 3HE3A 1KC3A 4MVJE 1UXIA 1YBVA 3F1KA 4M86A 3JQAA 2X5KO 3WICA 1H2HA 4IQ0A 4OOFA 5HWSA 1FXSA 1JKJA 3D0OA 3RUFA 1IE3A 2WYWA 3PJDA 5H83A 3ANMA 4XDZA 1DLJA 1T4BA 2C7GA 3IUSA 1C3VA 3RC2A 1LC3A 1NQOA 3NV9A 3Q6IA 4JIGA 2NQ8A 3PWZA 2RHCA 4KTTE 2POQX 2Y0DA 1TLTA 1YJQA 3DL2A 3I9LA 3G17A 4K1LA 4NBUA 4E2XA 4E2ZA 2PKRA 1O94A 2J3HA 3JQ7B 9LDTA 3PYMA 4AJNA 3F4LA 1WPQA 1LDNA 4GAEA 1K0UA 3U3XA 3LF2A 3GNQA 1JAYA 2E37A 4BO3A 4BGVA 2FR1A 4QX6A 1B8UA 2WEKA 3RUEA 1L1FA 2AG5A 3WG9A 4YAEA 1Z6ZA 2VHZA 3BMNA 3DONA 3IJRA 3T7CA 3C1TA 2A92A 1U3UA 4XQCA 4ZRNA 5ENVA 3PGXA 4KWIA 1UDBA 4WLUA 4FJ1A 1WDKA 5C37A 3GDFA 1U1IA 1BXGA 3NDJA 4CUZA 5T5QA 3DAFA 4H7PA 4CQMA 2RH8A 3DOCA 4RL6A 1JVBA 1MC5A 2H6EA 1PR3A 3DXFA 3OJLA 3PK0A 4WCFB 4NHEA 5TF4A 2GCGA 4J0EA 2OZPA 3HB5X 1ISJA 1IHYA 3CUKA 3VDQA 4AFNA 1DB3A 1Z75A 4CM8A 3TL3A 1OC2A 4BNFA 3PDUA 2ZATA 4YB8A 1UP7A 1N9GB 3NT2A 1QYCA 3UGKA 3RFVA 4CR6A 3QJ5A 4B4OA 3I9KA 5BNIA 2O4UX 1YGYA 3D3WB 1TB4A 3UCEA 4Q39A 4UEJA 2B83A 3VPXA
chains in the Genus database with same CATH superfamily
1HKHA 1XMXA 4EF5A 3CTPA 4OXNA 3TZCA 4ZJPA 4ARVA 3IA2A 2CW5A 4IWNA 5ER9A 5JW6A 2B3DA 2IX3A 4RVCA 1AA6A 1TQ8A 4ZOEA 1MRNA 1CUDA 4LRTB 4D9BA 3FZQA 4X71A 3L6UA 5I8WA 2FP4A 4XLTA 1SCBA 4C06A 5CBPA 4G0VA 2VVTA 1KMCA 3V1NA 4B34A 4MUBA 4AVYA 1JG3A 2Y6VA 5IMBA 3UOGA 1CU1A 3O84A 1PUIA 4LI3X 5ALHA 1A82A 2W9XA 4TLLB 3ZXIA 3HBLA 4LVCA 3B52X 1U81A 1RFGE 3JQGB 2FR8C 5ERXA 3IBSA 3PFHA 4XD2A 3LOPA 2AKYA 4PX9A 3WGJA 1RXEA 4KMRA 4E70A 4HLUC 5AVYA 4GKKB 4JCCA 4M1MA 1Y1RA 4Z9FA 3HR8A 3JCZA 3WNDA 4B32A 1FNSA 3PI7A 3GLHA 5JXGA 3ABZA 4FCVA 4N0QA 1MAHA 4UNQA 3SC3A 1JEYB 2HDWA 3AJRA 3NYRA 1UANA 3GYGA 5DBGA 2OYRA 4CV3A 4JLOA 5A62A 2J9YB 4IILA 4LRSB 3T4XA 1RRGA 1KMNA 1OWPA 4RF4A 3U3MA 3MTGA 2JIOA 2Q5QA 2ZT7A 5REQA 4EG0A 4JV5B 1LSUA 2H4XA 2O4CA 3VO1A 1UJBA 2FI1A 5LQUA 1PG2A 3CE6A 1FSSA 1X38A 4KOEC 1CQJA 3RKRA 2AF3C 1SCAA 1SCQA 1XU7A 4FJ0A 4HDAA 5CPFA 3TFQA 3U7FB 2I22A 4GZ5A 4MROA 2YY6A 2QUZA 4ZC8A 2ZRNA 3LK6A 4ND1A 1ZMBA 1H0RA 3ZGXA 4I99A 4NK5A 4DXHA 5B58C 2RHHA 3A0UA 3T0GA 2J32A 4ZGWA 2GESA 1FX0B 4X6UA 4CM1A 3TOCA 3QEBZ 3BYZA 3OT1A 3PHBE 1BCSB 1SK9A 3QOYA 3ZU4A 2FTKE 4H3VA 2VZ8A 1TKRA 2AOXA 1ID1A 4K6KA 2GS9A 1CY4A 5CH3A 3BK2A 1AS0A 3SLRA 5LU9A 1PV4A 4WN9B 4AZVA 1RM3A 1A8SA 4BO0A 3IPYA 3LRTA 1DWQA 2REBA 4HLNA 4W5JA 3C1UA 2A0XA 4HGRA 4P8RA 1ODSA 1ZCAA 3S1AA 1T3HA 2PE5A 4IHJA 1GTZA 1HDYA 2QI9F 5FBLB 2H1OA 1TMKA 2HIHA 1EFVB 3OHMA 3Q7PA 1AH2A 3GWGA 2WG1A 2VG8A 3P5SA 4IHAA 2NU6B 5CNMA 5HTOA 4WKNA 1NW3A 4BHTA 3LT1A 5FDFA 3IURA 3JASA 3G5TA 4R81A 1UZNA 2Z8YM 2I34A 1FQJA 4RV5A 2GA8A 4GI2A 4QJBA 1WCIA 3QXJA 4D5GA 4D25A 2BHLA 3VHLB 3FOWA 4TTPA 5BNWA 3WIDA 3DV2A 4TZKA 2GSDA 2HX1A 2FQQA 4KE6A 4QNMA 5EYPA 1ZMRA 1MX5A 2DKNA 2X0FA 1KGDA 2VP6A 4UE3S 2AFIE 3M9WA 4DR7B 1RFLA 2VHYA 4PHGA 2GCPA 1CNMA 2JB9A 1Q44A 4KV9A 5K0SA 2YJ5A 5KTMA 2GJ9A 4NDAA 1PS0A 4WZZA 2IJGX 3HWX1 5CP8A 7ABPA 3D7LA 2AN1A 4BLSA 2B5VA 2Q5HA 1SBTA 5I9NA 4M1EA 2A5JA 4QUBA 3U13A 1GXSB 4OMCA 5FOXA 2XE8A 4A2QA 4PQGA 1TX4B 3VPCA 2C9YA 4AIIA 3AOEC 2BL4A 1KVQA 1R3UA 3BE8A 4I55A 4TKUA 4D4MA 1AZSC 4BNVA 2K6GA 3EBOA 1UT6A 4LRQA 1NBOA 2D5BA 1T8TA 3E5NA 1EDZA 4RF2A 5DM0A 4AX4A 4G5GA 2DHQA 4U2KA 4DA4A 1IUKA 1QB7A 1GR1A 2JIPA 1U3DA 4FW9A 2FG7C 3W5JA 1RMTA 4A23A 3FDZB 2B7CA 4ZT3A 3IAHA 3H7AA 4YRFA 5F9FA 3NOQA 1RJ9A 3OIVA 4IDHA 5HKLA 3FDXA 3UMCA 3N8DA 4I50A 3K8YA 4PAGA 4NZZA 2IYFA 1GCAA 4CV2A 2VJDA 1Y6QA 4L51A 2GN1A 4L5JA 1ZR2A 4D96A 4NECA 3SHWA 4CLXA 3AZQA 2R6R1 3PA8A 2IQIA 2FGKA 1IATA 4U7GA 3I4LA 3W3AH 4MCIA 2VBCA 5K05A 3QPCA 1R0LA 1EWYA 3ONNA 2YXEA 1XTTA 1ZOPA 2CZQA 3VC1A 4RCZA 4NZYA 4Y2JA 3MCVA 4C87A 2PKCA 3PNLA 3RGWS 3DQQA 4DJJA 1T9CA 1H23A 1TAHA 2PS0A 1UK8A 4KMOA 4MTCA 1SBQA 4XOIA 2OR3A 4L4YA 1NYLA 4NABA 1SQGA 5SZHB 1M83A 5KSPA 3S5JA 4BTEA 5FH9A 4Q7JB 1EX1A 3L4SO 1EK2A 4MV5A 4R05A 2GD1O 1KHHA 5JAZA 3TM4A 1U04A 5SY9A 1ZWLA 4KL8S 2NADA 6CHYA 3MQ2A 4EAAA 1JYSA 3URMA 5CLGA 4CDRA 2QIPA 2CFTA 1NJ1A 5DGTA 3UEOA 3WZ2A 3KQLA 1XU9A 2AOVA 2FSHA 5DH9A 3VR0A 2BGWA 5KJ1A 3N2ZB 3KVNA 1OAOC 2IZ0A 2JIQA 1R4MA 3PNOA 3MJDA 3VH1A 3SVZA 4FWBA 3R2JA 5AP9A 4LIPD 2HDNB 3ILXA 4XRRA 5K6AA 4DM4A 3UHFA 4WZAB 5TVGA 2IEAA 4DSTA 2ZBGA 5TMPA 1BXKA 3ZYZA 2N75A 1OFVA 1O95A 4TXHA 2ZZMA 2SICE 1HSOA 4CMKA 2AJTA 3LUGA 2HXYA 2C5EA 3HO6A 1CJSA 2H4HA 2J3QA 4YAOA 1GQYA 4OM7A 2NO6A 5GONB 4RS3A 5IC5A 1JQAA 3EW9A 4YRGA 1LSOA 4KDFA 1HT3A 3WWDA 5JOQA 3IKMB 1VSVA 2QAGB 1HDRA 4ZYZA 4DPKA 3NDBB 3U3DA 2FSVA 4LSMA 5HZKA 3AF2A 1H94A 3SBOA 2E6UX 4DRXA 5L8VA 3V7WA 4N76A 1Q6YA 1QVAA 1JDZA 1SC6A 3H75A 5TIIA 2VRCD 4JI2B 3DB1A 5E6RB 1NZJA 4B6OA 5ELXA 2UKDA 4QREA 2V58A 1UXOA 1CUEA 1ZINA 3WMWA 5IZCC 4JI7B 4GPAA 3ST7A 3FDJA 4D02A 1M8JA 2EQBA 3LYAA 1TTTA 4B6QA 5KJCA 3AVYA 1DRKA 1BXRA 1OXUA 1RRFA 2BF4A 2Y1FA 5CAEA 1FVFA 4HSEA 1PNTA 2RHDA 3D0RA 1FLNA 2P2CA 3WYFA 4HEA6 4DTIA 4E1BA 3NIFB 3EK2A 4YJ3A 5LMCA 3EBPA 5A0TA 4OA8A 2FPMA 1I4OA 1KAEA 4UD2A 4F06A 4C4AA 3AJ9A 4QXMA 4QT0A 2X8BA 3PPWA 3V1UA 4F4DA 2UUPA 6PFKA 5TEWA 2FCAA 4TM8A 1SBIA 3ZCVA 3I5MA 2RSLA 5AUQA 5KHAA 4Y0AA 3N7AA 3GI1A 1TJ4A 3CLRD 1XKXA 2VC2B 4TTTS 4A92A 5HRAA 2HCBA 4BAGA 3OLXA 4Z1OA 3MB5A 3GGOA 4FBGA 3O8OB 3GCZA 3TLCA 1R4ZA 2PH3A 3AUYA 5B2ZA 4RPLA 4JOCA 4G97A 2M6LA 3ZZUA 5IABA 5JCZA 1PR9A 1COZA 5C52B 1D1SA 1MDFA 2LBPA 4N03A 2QSZA 2I7CA 4MI3A 4R0MA 6LDHA 4BASA 2Q1XA 1K5GA 1AQNA 1QJCA 5IBCA 2NZYA 5A3VA 1DOHA 4HGNA 4ZQFA 1ONSA 5F5NA 1VE1A 2P4QA 4N8EA 1Y1SA 2QOEA 1A77A 2BFFB 2AG1A 1T1SA 3IUNA 1RVDA 1FXWF 3FYDA 3N8KA 4GUAA 3W5HA 1DIGA 2Y66A 3PUXA 3UXYA 5K5EA 2R7NA 1IG3A 2HY7A 1Z17A 3RIXA 1P1HA 2F59A 2QDXA 1I9GA 4MGIR 5K4AA 4C43A 4OKSA 4B3JA 3FMVA 4M8IA 4F4CA 4KUGA 2IPNA 1U4NA 4YAFA 4Z4IA 1OTYA 1AZLA 1X94A 2R96A 1ORHA 1QKKA 5E6SA 1VTKA 3EGWA 4NE2A 5C80A 4HQFA 4IQ8A 1OYWA 3C5WP 1UWKA 3RQSA 1X3LA 2YS7A 1TUEA 1KO7A 1P4AA 1R5NA 1SCKA 1Z4JA 1ZCBA 1QG0A 2QX6A 2ZIXB 3L7CA 4MMZB 3UUEA 3PXUA 2VYVD 4FMCF 4HTFA 4JQOA 3BH0A 2ONJA 2XECA 3TBKA 2QTVB 3RIMA 4AKSA 2CDRA 4E51A 1QIGA 1QE5A 1Z0FA 2GYWA 3GHHA 3RUCA 4A8JB 1CR4A 1FFYA 4A16A 3EXG1 1DZ3A 3IDSA 3PC3A 1RWKA 5EQFA 3WFIA 2XNDD 1EK6A 1MOSA 3Q85A 2H0AA 1H6CA 2CYAA 2QSJA 2DBVO 4TXNA 4LCEA 2HFKA 5JY6A 3C8DA 3SHFA 2FN7A 4DRZA 3BOSA 3NDPA 3OIGA 1MJ5A 4FGUA 3OZDA 5DMHA 4AY4A 5E2BA 4BVAA 1NJ2A 1KBZA 1DTWB 2X0KA 2AC4A 4W1SA 1F8GA 3V4LA 3VR6A 1M2OB 3GRPA 2X8AA 5HBGA 3SFTA 4FIZA 2QPTA 4BE7B 3GT3A 4EH1A 1V16B 2JZNA 1STOA 3I05A 2RHTA 3N9IA 2GRJA 4U0JA 2ODNA 5DMXA 6AT1A 5LN1A 3DTVA 4G0UA 4L5BA 4WOBA 3ZDCA 2XOEA 1IB6A 1ENOA 2AMYA 5CT4A 1ZONA 5K3FB 2Z6VA 5F1OA 2PMEA 3FPEA 3LF1A 1TECE 5EMMA 1PX2A 2JHFA 3W2TA 4DMGA 3WSWA 4JU8A 1WJGA 5FUQA 4F2WA 4AICA 3A6GA 2G9ZA 3DE4X 3FYUC 1WRBA 3CUTA 4NH4A 4OUKX 4JUBA 3D1JA 2DWPA 4H2DA 4M7PA 4MPTA 4ZI2A 2B0CA 4O0LA 5FCDA 5ADHA 3DD1A 3AWDA 3F98A 1RTTA 3KPWA 3QY0A 4IDEA 3E7FA 2VT2A 3G9UA 3GLKA 4N7BA 2IKQA 3VJMA 2MSEB 1H6BA 1ZICA 3NHRA 4OL9A 4QNRA 2W90A 3O31A 3GD5A 5F78A 1SVMA 1OLUB 3WMXA 2IKSA 2O5RA 2R2AA 4PLHA 5G41A 1UXKA 4EHNA 5CA1B 1TZ2A 4XX1A 2PD4A 3GDGA 2WKPA 3D6AA 5FEMA 2AJLI 2IGTA 4NU5A 4WFQA 5ULLA 1NR7A 2C00A 1CQZA 3IQFA 3LQKA 1IRXA 3KG2A 4G0XA 4LOJA 3VNUA 2C92A 2GYYA 2HJRA 1R10A 1N6LA 2P5SA 2FWJA 4YPFA 1XEAA 4YMGA 5A4AA 2VH2A 4B3IA 1X1TA 4C0WA 2J8ZA 3G85A 4G65A 2IZOA 2AYZA 1XCLA 2DTDA 3GJZA 1JE1A 3MNFA 5GAJA 4DJEC 4CEHA 5AKHA 4NOMA 4YGYA 4JI4B 4DDHA 1G64A 3LGSA 1KDVA 5FBWB 2OGWA 3SJZA 4CT4B 1G1AA 1SXHA 3CS3A 4TROA 1NSTA 1V1RA 5BSMA 4Z53A 3QWIA 2FGJA 3FMPB 1YR3A 1AS2A 3ICPA 4L74A 4R54A 1JBEA 3R20A 1U2ZA 3DBHA 4R2KA 4RFVA 5DW0A 5IDVA 5HF5A 4UKDA 4DKXA 1QANA 2GZSA 3WBFA 4N65A 1G7TA 4E07A 3Q8WA 5MHTA 4L8WB 1YDWA 2Y77A 5BMOA 3HMKA 3M7IA 1VYUA 1ZHFA 3MOIA 4LXYA 1M33A 3S70A 4EO7A 1PEDA 1E6EA 1PWEA 3STTA 2GAJA 3FMFA 1O1YA 3U4QA 2EFDB 2VYND 3T5DA 3ZKWA 4L9WA 5J2UB 3QX8A 5GOZA 1W75A 1CJVC 1HLPA 1YZKA 2DQZA 4J7XA 3CEPB 3PZBA 1Z8NA 4S2UA 2RKOA 1TDJA 2DWOA 3CLTD 4R9VA 2E2WA 3FFBA 3EULA 1C2TA 1QR6A 3F0TA 5EUQB 2BKEA 2GZRA 3C5EA 3X1WA 3L92A 2MR5A 2H06A 3ZY4A 5B1YA 1UJNA 5JPIA 1Z18A 5HEKA 3R3XA 4ZQEA 3AHFA 3C70A 3N2KB 4FFPA 4JEUA 2OD2A 4MQFA 4WK0B 1JIQA 1GYPA 1NF2A 3NEYA 1YJ5A 4MEJA 4RTLA 2EKZA 4K5QA 4E31A 4Q7MB 2ZM6B 4LFBB 1ULHA 3GCGA 4P0QB 1DJOA 4D3SA 3KKOA 1EI9A 2A86A 4DJDC 3L7OA 5AUNB 1QLJA 1TF5A 3KSUA 1D8TA 4JP5A 1KXZA 1SN7A 4CQLA 1LW6E 1JJVA 2W8BA 3JALB 3P0FA 4FDAA 1K27A 4KR7A 4KR6A 3S2ZA 1O4WA 2R7MA 3TL6A 2FW9A 2YWDA 4CFYA 2V0GA 1QC5A 3EODA 3AVXA 4L27A 4N0MA 4OI2A 1TC1A 1EFPA 1ELOA 1SCJA 3VYWA 1Z4QA 3RSFA 2OQIA 2DFVA 2FQWA 1NONA 1X74A 2RK3A 2KSQA 2DY1A 3EA0A 1KR2A 3R6TA 3PIRA 4P9NA 4YMSA 1R6AA 5KNLA 5AOBA 2W42A 3CW2A 3IQHX 4EO9A 1J2TA 4CDMA 5JPCA 4E15A 1EE2A 2GA9A 4LJ7A 3I2JA 5CX1A 3RQIA 3V4FA 2ODEA 2ZJ3A 1N5OX 4YJ2F 4QGHA 4BLQA 3CN9A 1QYXA 2YZKA 5CHYA 3PGKA 3FI0A 2RGEA 3PXBA 4JBYA 4GM0A 4MB0A 1EEHA 3N2YA 4KZKA 1QHIA 5AKKA 3FPCA 3U81A 2CE2X 3H83A 4KPYA 5JXWA 3ESAA 1O0BA 5BR1A 3BIWA 3LKVA 2OV1A 5JAMA 5J2TA 4MVJP 1YJXA 1EM8A 1QHHB 3MTQA 4ZCTA 1KI4A 2EKQA 4RSGA 4PXYA 2I4TA 1F60A 1H6AA 2VDNB 1A9XB 1DJMA 4GDFA 1FEZA 1ZUIA 3TW6A 1PJSA 2OYCA 3ULKA 5FR2A 5TF0A 4UUMA 3ZE9A 2MSWA 3GJTA 1JHYA 5J63A 2AG6A 1JVSA 5DJ5A 1KZ9A 5I8PA 5IBRA 3ZXSA 2O57A 5AK6A 1T2DA 1CYDA 4FQ8A 3Q8MA 4DLZA 3I04M 1D7AA 2YBEA 2Q1SA 4YRSA 3LPMA 3WK4A 1TZCA 3FCEA 5DYYA 4DIKA 1IK6A 2BZGA 1EZZA 1D3AA 4GLFA 1RAGA 3TVYA 2CJWB 1FQWA 2I3BA 5MF6A 1WUHS 1WB4A 2M1XA 3O47A 5EKXA 2QTCA 3OTOB 4ENPA 5JFGA 3ZDYB 2SBTA 3BULA 1BQ3A 2FVYA 4FVTA 1E58A 3K4PA 1L5HA 4B84A 3HJCA 3A9RA 2WFLB 1SM4A 1SOUA 1YVRA 4IGEA 4LJSA 5TPWB 3TSAA 1TFRA 3ITEA 5LOVF 2VUUA 1PZXA 2Z5LA 4E5PA 1KI6B 1L9KA 4I4TF 1OOEA 2J5KA 3IAUA 3T52A 3AERA 3D2BA 3ETGA 5HJ2A 5FBZA 3V3TA 5CLQA 4PYJA 3FUUA 4BO5A 1UK9A 2O1SA 4WERA 1UBUS 5FO0A 4ZXPA 1V3QE 3BQ9A 5BQ5A 5SY6A 3REOA 2EWWA 3N0VA 4MCHA 4D3XA 1ZYUA 4TRJA 3N07A 4B87A 1I6LA 1BFUA 2B35A 1U7PA 2ZJ6A 3OCJA 3M1LA 4JGGA 3T9DA 1AV7A 1EFUA 5CA0F 3ZIAD 3OF5A 1UEXC 3DKKA 1FDTA 4F38A 5C81A 4EKNB 3PLAE 1XAIA 5DEIA 5M5BA 1FDVA 4ZQHA 1BYIA 5I8ZA 1EGHA 4Y9UA 2BGUA 1A2KC 2H2IA 1R0ZA 3V6LA 1DV2A 3K9CA 2BN4A 3CRVA 4B4WA 3SAJA 4B71A 3CC8A 3OLYA 1HNXB 3IMGA 1CS0A 2CUNA 3BXPA 3DO8A 4DSOA 4RCVA 4EHAA 2AJ8A 2C84A 4MLPA 4MR8A 3EP8B 1TCAA 6Q21A 3AL2A 3G0OA 1G20B 3TQTA 4KITB 3QU9A 4ETIA 4TVSA 4FIDA 4HMQA 4FYXA 3M6VA 4P35A 2R6FA 3ZV6A 5A1JA 2OWEA 3BK7A 4BVBA 5IW8A 3O83A 1EVIA 2CUTA 5IVDA 3JVUA 3OTQA 5ILGA 3P20A 3IWBB 4EZIA 4GEGA 3SQDA 1OT5A 3I2YX 4MQ6A 5AXBA 1NF8A 1LBQA 1F06A 1DQYA 5H7XA 3X1MA 5KU7A 5K45A 3PENA 3FWYA 2J4FA 3B1JA 3K0KA 3N5KA 4I1IA 2HJSA 1G5RA 3DZ4B 1R0BA 1ORTA 2H1VA 3HZRA 2W2TA 4XR4A 1JYEA 1K7SN 2Q4RA 3A4TA 3LBIA 4H1VA 2RAUA 3ETLA 1X1CA 3QU2A 4FDUA 2AJCA 5H80A 4KE9A 1C1YA 3OQVA 3SXUA 2B34A 4DMKA 2QG4A 3G2OA 2XMGA 2OV3A 3UK2A 1BWSA 1CJCA 4QGGA 3UAVA 2NO5A 3HEAA 3EWAA 1GGJA 3K96A 3QI2A 4L22A 1UMBA 1XD2A 3P2IA 1RXCA 2BFNA 1N0WA 3RTAA 2IK8A 5BRNA 1GNSA 3Q6MA 3H5OA 3EHDA 2BFAA 1YS7A 3CNEA 5IARA 1RXWA 4BMPB 4ZARA 5FNVA 1EFCA 3OU2A 2I1WA 3EVNA 3CR7A 2AEFA 4BMSA 4CFZA 2XXAA 4IMRA 4LMAA 2I4IA 2Y92A 1W36B 3AI2A 1KPHA 3JQ6A 4Q19A 4UMEA 1F8UA 2G5CA 4TWAA 1HTBA 1JAHA 3M4JA 1JDBC 2H3EA 3UHOA 4A5SA 4ZO9A 4K26A 2OB2A 3SDZA 5CYOA 1QRAA 2J7PD 4KRFA 3ESXA 2NYVA 4GOXA 1GSIA 2FPIA 1CUAA 1I0IA 1X9GA 2TMKA 4IXMA 3WK8A 1G16A 1CFJA 1KJJA 1MFPA 5C8DA 1TKCA 1WXDA 1XZLA 4I1SA 3M6LA 3KETA 4EL5A 3ICQB 1P9RA 2VOEA 4FR2A 2DECA 2DFLA 5EQTA 5ICFA 1XYVA 4RO0A 4AU1A 1Y3CE 1T26A 1T5LA 1YMVA 2NZUG 3EIEA 4YI3A 4BX8A 3PHIA 4AY3A 5JDCC 1JT9A 1NKSA 2NVUA 3GFTA 1XZPA 4HO1X 3FNQA 4CGYA 3UF0A 3HBFA 4EQ6B 1A5TA 1N5DA 3DL4A 3PF8A 4L5YA 3PR1A 5FULA 4EB3A 3M33A 3OZTA 1G66A 3L06A 4ZVMA 1B3BA 4D42A 4EBFA 4JBGA 5EUCA 4MIYA 3K92A 5ERGB 3OOYA 3OEED 3TW3A 4CT5A 4XJXA 1SCUB 3O0DA 5FB3A 5J9FA 3A2KA 1MD9A 2I6GA 1M2FA 4JR0A 1OGYA 1P91A 2IHKA 3OE5A 3T0FA 3C7TA 4IIGA 4A26A 3ADDA 5A5GA 2B1JA 5AD1A 3FE2A 3VR2A 1ULZA 5FUYA 4Q1CA 4C0XA 4PYMA 5CDSA 1DKQA 1PWXA 3QVGB 2QUBA 3EP3B 1SPBS 5T7BA 3GT0A 2RGRA 1RKUA 3S28A 4BMZA 4NY1A 3H5RA 2QRJA 3RK4A 2FAXA 2XMDA 3RSQA 2CFIA 1VHDA 5JZMA 5LQNA 1LDBA 3UPTA 13PKA 4QHTA 5AHOA 1H2YA 1N3LA 3VGPA 1P2GA 2X5XA 3P0RA 4TQUS 1SC3A 4B9EA 2E85A 5AVTA 1G0NA 1P77A 2KB0A 5B1HA 1AHHA 4HV4A 5JALA 3G9TA 5FKJA 4B31A 1WCYA 1XU4A 2NZ2A 4Z3OA 4NXMB 1D2AA 3KFVA 4YK7A 2JDIA 4P53A 5G0SA 2C97A 1G17A 4WZAE 3IJPA 3NR2A 4P98A 3Q7RA 4AY6A 4ZI7A 2PHZA 4JYMA 1UPCA 3CVVA 2JLRA 2I6TA 1I2ZA 1EUYA 1WUKS 8ADHA 5FHRA 4UE2A 3EDRA 3ILVA 5HW0A 4QRIA 3FTDA 3AVUA 1T25A 2X4LA 3MUEA 5AK3A 1CUVA 4MH0R 2WQ6A 1ISPA 2B1IA 1M76A 5J1TB 1B0AA 4EB6B 1L5OA 1XTIA 2YIVX 4GI1A 3ERCA 3W4KA 5A4MS 1KH2A 3FF1A 3COPA 3OD1A 3U40A 3ABIA 3INYA 4WRRA 5H1YA 1I24A 4F92B 1GZ4A 1ZNYA 2QM8A 1EM6A 2B5OA 3LZDA 4FOTA 3TLGA 1ZZGA 4CM7A 4FC7A 3NDIA 1OH8A 1M0EA 3HO1A 4WKGA 3R6LA 3KTOA 4KSYA 1YMUA 4G25A 1RR6A 2FMKA 4AZ0B 5AW9A 4Z5XA 1P17A 1QFZA 2EZ8A 5JJKA 3H3JA 1ZMOA 2K2QB 4BBZA 1Y6RA 4YQFA 4JSYA 4C2AA 2FJPA 1ULAA 5BW6B 1F17A 4NL4H 3TOVA 1JFRA 2JGLA 3T7RA 3V2UA 3TRHA 1C3LA 4J8PA 1U5AA 2Q7XA 1FY2A 2W6MA 1IBRA 3AKYA 1DBRA 3JV7A 1IEWA 4EW6A 2JEYA 3T94A 4EKGA 1R9GA 4KYTA 4JC4A 1TCBA 5FYQA 3P45A 3A3YA 1IHOA 1Z82A 1QU3A 1DJPA 2ZSFA 1S2OA 4P80A 2Q4DA 2Y0CA 2O8DB 4M1ZA 4CNBA 3T5PA 2PBRA 1ZEJA 1XMQB 3F7MA 3H9JA 1U80A 1ZW1A 3UJBA 1IVSA 3LWNA 3FRIA 3T5CA 5J4HA 3JYPA 4PLTA 4IEFB 2HC9A 4ZVTA 1RU3A 2DH6A 2HHHB 4HMPA 1CZNA 3JPWA 3NRCA 3UJPA 1KFJB 1GG5A 2OFWA 4BLWA 3R3HA 2BGGA 2O54A 2VPXA 2BMEA 1G8MA 4NIMA 1YJCA 1BMFD 1M7GA 5L3SA 3C7CB 1JEQB 1MR3F 4YCDA 4F5YA 4MJ7A 1XQVA 3Q2OA 2CL5A 3IBFA 5BN5B 3WLOA 4BEJA 5CUQA 3R24A 4TLDA 4ZRDA 2IHZA 4DANA 5GM2A 2Q6OA 2JBWA 5CB8A 4AKTA 1XVLA 4UULA 1O08A 1MJGM 1Y1LA 3H65A 1TIPA 1ZHOA 3NW9A 2ZIWB 4H1UA 4D9NA 3NBUA 1MORA 2F43B 4ZDIA 1R0KA 1N6IA 1XZNA 3CNQS 1EG2A 1UZAA 2YNMA 3MERA 5C5EA 5KQMA 4LUCA 2Q0HA 4AJPA 1F2VA 1MC4A 1U5BA 3P9KA 2I7TA 2J5XA 5ES3A 3TMKA 1M2WA 4EOGA 1G21A 1WP9A 4UARA 1Q12A 1DOZA 4V0MA 1KQGA 4W5OA 1TUGA 1FFCA 2NG1A 2W6OA 3JQFA 5EMNA 1JBQA 3T9CA 1BS1A 2WB4A 2YFHA 5C1PA 4FLMA 2OLJA 5DI3A 1C9DB 2MWMA 1DEKA 1HE2A 2PGJA 1Q84A 2NO0A 1RAIA 2FKNA 1GSHA 3K9BA 2E4UA 2EBUA 3IC5A 4G5HA 1SD5A 2I4RA 3EXIB 2VNIA 3OT5A 2CZCA 2BFDB 3RPEA 3C5VA 3LHIA 2ERCA 3H11A 2VEOA 1LZLA 5JAOA 1D8AA 3AI3A 1MRZA 2GZDA 3LXUX 3NVDA 2XWSA 2NPFA 4AMBA 1TUIA 1X42A 3BZBA 4MS3A 1FFWA 4PZ9A 5TPZD 4OK5A 4EFMA 1QFYA 5CM8B 2UVDA 1UQUA 2ZK7A 3C87A 3JQ9C 4BO6A 1F7UA 4PRLA 3G5AA 2JK0A 1F6DA 3K5PA 3RSCA 1J42A 3GT4A 4BV3A 4HP8A 1YS4A 2IXBA 1T2UA 1Q0HA 1UQTA 4BCCA 3H6GA 3R5KA 4QDTA 2ZIFA 3E23A 4EEZA 3K09A 4Y98A 3RT7A 1GL7A 4CMGA 5KQPA 1LNSA 1KIAA 2QJRA 3E1GA 4GBMA 3IAFA 1QOPB 2KM1A 2C4TA 1P80A 3BKWA 1N1EA 3PHLA 3CB2A 4LVOA 3UKOA 1PYDA 1W25A 4IHQA 3G2HA 3W5AA 3MT8A 4RJKA 4QO8A 4H35A 2UYHA 3EGIA 3H2BA 3U17A 1Y1TA 3BRCA 4ZDJA 1U0BB 1ZW6A 1T1IA 2P1ZA 2PTGA 2WDZA 3E53A 3WS7A 1JFSA 1S01A 4HEQA 1QUEA 3LUJA 3K0HA 3UKJA 4J49A 2PWBA 5CH5A 2Q0SA 3DULA 1KEEA 1V8FA 4K9SA 4LYAA 4XIFA 5I7HA 2AOTA 2J4CA 2QZZA 2WD8A 4BB9A 3EXFB 4G01B 1WD5A 3C8ZA 1M6WA 1XXHA 2MDTA 3FZYA 9LDBA 1B0UA 4MW9A 5JVDA 3VO2A 3A8TA 1B7GO 3CLUD 4N39A 4C4TA 4EUFA 2FPXA 2O3SA 5IXJA 1KYZA 1WXWA 3S8EA 5E3IA 1GEGA 3BEDA 1YRHA 2HSZA 4ESOA 2P1RA 4IX9A 4O4IB 2GARA 2Q2NA 4ZYLA 2XCRB 4KH0A 4OK3A 4WNAA 3FVVA 2P7IA 1E61A 2IZ7A 2FDCA 1JEYA 1DWOA 1E2MA 4KACA 3T35A 2EF1A 4REOA 2B99A 2OBNA 5F23A 4WOJA 4MVJA 1PJ3A 3BICA 3Q3IA 3DUFA 3REQA 4NBVA 1NDHA 3QTTA 4NZPA 2JGEA 1R8SA 2CLSA 4D4IA 4QZVA 4MGEA 1SUAA 3HGMA 5L9AA 1K7CA 3I28A 1J23A 4XUCA 2R6ZA 1UOOA 1YR6A 4Y0NA 3ELUA 2Z8YA 3QKRB 1WBBA 5KBYA 2H1RA 1X80B 5T6BA 1NLZA 1VL2A 4G0ZA 2C5HA 3JXEA 5LVAA 3IOBA 2R1VB 2X8JB 5D3ZA 1E60A 4LBYA 1FSZA 4Q01A 4U6SA 3ZR4B 1E8MA 4P5EA 1RMQA 2NZWA 3E3OA 2QAJA 4FSHA 2YVAA 2YXLA 4IJKA 3UT5B 3GL9A 3B6EA 2I0FA 1Z6AA 2RGCA 1JHQA 2P67A 5AW6A 1O9GA 1IN6A 2FFJA 3B7PA 1GUFA 4PN7A 1LDYA 3FTQA 2PO7A 3K5HA 4GQIA 1NVXQ 1JLSA 1DUSA 4IQFA 2IX9A 1JYFA 4C6RA 3RSOA 4RKYA 3DF9A 4N6OA 4C29A 4UM9D 3VHRA 1FUKA 2XSZA 5IC4A 1L5YA 4ALIA 3AVWA 1IN8A 3IQXA 4RENA 4E2YA 4HGYA 2ZIGA 1AQ6A 2ZPAA 1VIVA 3K73O 1ABBA 1MDBA 3IDOA 2FSIA 1H3FA 4ZQBA 2YIMA 3EQ2A 3MSXA 1I4TD 3I0ZA 3GPDG 3OPVA 4XW2A 1E2JA 4IY1A 3N2NA 1N2OA 1BYUA 2JANA 2YDYA 1KZYC 2XDYA 3E70C 3GARA 4Q6WA 4XM0A 4XGNA 6ABPA 3INNA 4CLHA 3TXXA 1U28C 3RVRA 3FNIA 1XA0A 5ALPA 2QA5A 3MZ0A 3WB1A 3WO0A 3IHTA 4XB6B 4TWZA 3Q5EA 1XMPA 4BNWA 3RSGA 1TTQB 4C22A 3MMNA 1U98A 4DV7B 1E3DA 4NJEB 5IWCA 2ISCA 1KU6A 2HTEA 2FEPA 3U7RA 2ZVDA 4D44A 2Z08A 1QF6A 1SC9A 3DJFA 1EIWA 3ONWA 3KAJA 3UV7A 1XELA 3GEGA 4U2GA 5G0TA 3FB1A 1QP0A 1KYTA 5FHQA 2O8FA 1Y5NA 1DO8A 2CL0X 3QFRA 4WZBA 4C6HA 2HXSA 1SU4A 4E5VA 5KTOA 3IAS1 4HGZA 3O95A 3W6ZA 4RH0A 1JPVA 4DLKA 4V02A 5A0VA 2DPXA 2CF5A 4MPPA 1IWBB 3WMGA 1Y81A 2YHIB 2GHQA 2G40A 2GDZA 1HLDA 3EF1A 3AR7A 4U7TB 3BIXA 1DQZA 3HADA 4RGVA 4CKEB 1U7XA 3QKTA 1Z29A 3E3AA 3S0JA 4CL2A 2ZXEA 1Y8CA 3K9GA 4BGDA 3SKYA 2VSFA 1TT7A 4E30A 2O7VA 3U56A 1EUDB 1CUSA 4PIVA 4EMSA 4OXXA 4HAOA 1GADO 3INGA 1GZ6A 2BKAA 3Q9LA 4LQ4A 1KE2A 5JHHB 1C0LA 1CVIA 2C78A 5CVJA 4P5PA 1WVIA 1JKJB 4KQJA 3JAWB 2DYKA 4NARA 3CV3A 1C2YA 1X13A 3AW8A 2AUNA 5DCYA 3NNNA 5BSUA 1YE3A 1NVDA 2JEOA 4FYKA 2Y27A 1S2IA 1RIFA 2QTAA 4P82A 5AVOA 3AJ8A 3E7DA 1HL3A 2WVHA 3L4BA 3LO5A 3TH5A 3W2GA 1MVNA 1L5NA 3EXG2 2CXTA 2JAHA 4FE4A 1EK1A 4NMMA 2WLSA 1JRLA 5DT9A 3ECSA 1DKMA 4IDFA 1P74A 2XOKA 4U7WA 4RZHA 2Y0BA 1KORA 3WGQA 1UR5A 3LQ4A 3FHLA 1FTQA 1ZX1A 3LDHA 3O7MA 4UOZA 1PL8A 4HBZA 2F1OA 4NICA 4RTRA 4OB6A 5EI5A 5K0LA 2DPHA 3M70A 3DHVA 4QPNA 4BFWA 4UM5A 1PL6A 4ER7A 4IO1A 2FPWA 3K2BA 3NV7A 3LUHA 4X1YB 5JCPA 1A95A 2RHMA 3B53X 3EZGA 4ZJUA 2QTMA 1WNFA 1EDEA 1PEYA 2FOXA 4FXOA 3ISTA 3DBVO 3HYCA 2CWWA 1Q1ZA 3PQ3A 4RH3A 2HK7A 2A9KA 2JVIA 1I3LA 1L7VC 3BKXA 5L3QB 4B3BA 3FMIA 4BMNA 3KQPA 1XMIA 2HZBA 3FAZA 2RJOA 5D85A 2FFHA 2QEQA 5U4QA 2NXJA 2E49A 1PSWA 1E62A 1GFZA 1R27A 5LXTB 4ZPJA 3HB9A 1H1LA 2G83A 5JADA 2ZU6A 5EWLB 4H1HA 3M3DA 3DBLA 4BU1A 4OMDA 3GIWA 1GGMA 2H2FA 1QDUA 2PCJA 1OZAA 2UVPB 3K1JA 4QTTB 1P2DA 1EFRA 1ZMTA 2XEXA 4MI1A 1LF5A 2D7JA 5JS6A 1E5XA 1WQ1R 3LPLA 5AW5A 1P4JA 3EIXA 1UEJA 2GK4A 4O1HA 3BT7A 1ZSYA 2FWPA 3IERA 4H6WA 5HNKA 5CR9A 5DP1A 3RO7A 1V8PA 3GJSA 1MU0A 4URWR 2QKYA 1ZC4A 3SJBA 1EA5A 1G20E 1VG9B 2RK6A 3CEMA 4RDXA 4E13A 4N5DA 1SKMA 5C1IA 1UPXA 2QRHA 4X7BA 4HTAA 1O97D 3C8UA 5K3DA 4A8TA 4PBSA 5CA1F 1NBWB 1TM2A 1W5BA 4JL8A 5DI9A 5L7YA 2CNWA 4UZFA 4ILEA 3U1TA 4F5WA 1DC3A 4RVSA 2C8VA 1GZ5A 1DO0A 2JJ1D 1XPJA 2WWWA 4P4GA 3I3SR 2G82A 3ZC3A 4TWBA 3W6PA 4CXMA 2W0MA 2JH8A 4PS0A 5HDQA 1R6BX 4OU4A 3UVEA 3U26A 4DLSA 2F4NA 4YHBA 5DK4A 1E3QA 2PX3A 2P75A 3GQVA 1VCMA 2JH3A 3DLPX 3JS5A 1R8XA 1Z7WA 3ANSA 3ECAA 3ENNA 4ZI5A 1K6EA 2QR3A 4GGPA 1SA0A 1XA4A 1IPFA 1CB0A 2NPIA 1HXHA 4HDCA 3CFYA 4R41A 4NPCA 2XWBF 3ZDZB 1OU0A 2IU0A 2R5FA 1RLMA 3DMYA 1AC5A 1NE7A 1RRVA 1FW6A 1N0VC 4RTPA 2A7XA 4FFNA 1VL6A 3QSGA 4FB5A 3KOZA 4JJKA 3FRJA 1O96A 1YBAA 3O8OA 2NT3A 4GYYA 3ITNA 2HWUA 2CLIB 4L9AA 5SZKB 3K1AB 1T15A 4OHCA 1JEAA 2YJNA 4X9XA 2V0NA 3X1KA 4HNVA 2CV1A 4US2R 4F96A 4GS5A 2AW5A 1J2UA 1RADA 1U0JA 2V7VA 3QUCA 5C8YB 1W9MA 1YSCA 1Z25A 1KI9A 4UZSA 2UYCA 4X8LA 1NULA 4LXTA 3SJAA 2GPNA 3ZHRA 1JI3A 1G5TA 1W35A 3ONDA 4U4AA 1GIAA 4WCDA 4G67A 7ADHA 1K8YB 5IG2A 3RIHA 1QAOA 1T9BA 1X7XA 3RCBA 1NN1A 1P3DA 1ZN7A 1GRVA 2FSGA 2J45A 2WOOA 2P69A 3ONFA 5CD9A 3GG2A 1ZCJA 3A26A 2QTNA 3FVQA 3MXTA 3B1ZA 2PPVA 4BMXA 4TPKA 4DDVA 2JIRA 1CR1A 2NN3C 2OZEA 1LXCA 4DJTA 5BXYA 3RS7A 2BMJA 3ZI4A 2G1UA 4J9VA 3INTA 5FR1A 2PKQO 1K6MA 1YB4A 2AZDA 1WB5A 1I9CA 2FN4A 2HGZA 2VDWA 3T1YB 2O7QA 3CPEA 5CCXA 3KV3O 5KVVA 2B0JA 3V9AA 2PDAA 1OI4A 2I80A 1VI2A 5B1DA 3SEQA 1NTOA 3V4PB 5IM4F 3ZEAA 3Q40A 2DE0X 1P1IA 4IGKA 5F9HA 4IOJA 2HF2A 3FSRA 1W581 1M1YA 3G8DA 1T8SA 3QP9A 4AF8A 5KCZA 3CZPA 4B6GA 1C8BA 1CE8A 1GP2A 1PT5A 1E2KA 1KKUA 3GDWA 4HDNA 3AR3A 3BX1A 5DWQA 1DIBA 2O0MA 2PM8A 4QD3A 3ZQ4A 4CQJA 2IH2A 4EL0A 1KMMA 2AMVA 3GJXC 4OHWA 1N7GA 2DU8A 1CUBA 4MV8A 5EE0A 3SHQA 1LTQA 1Q74A 1D0VA 3C3WA 4TLCA 4ZREA 1HDXA 4DGSA 4ZEVA 2D1YA 2DFNA 1DJLA 4ZANA 3OVMA 1TYDE 3CW8X 3ES9A 5BP7A 1ZK1A 3EUEA 4TT3D 4FFDA 3WTBA 4H0FA 4YHHB 1FSPA 2HCFA 3WB2A 3HBAA 1JPJA 1WSDA 1Z56C 1HM5A 2VWGA 5IDXA 3KPVA 1JDVA 1YI0A 3LFTA 1NNUA 3D4PA 3LH5A 5CYFA 4DG9A 3R7DA 1A4RA 3BRSA 5KYYA 2C9MA 1Z2EA 4CM4B 3BXZA 4MUMA 4KRGA 3CZ9A 3LPAA 5IT4A 1CX9B 1RHQA 3AP2A 2XGMA 1YR7A 3EZLA 3ROTA 1DKPA 1SQSA 2O0HA 3MGCA 3MB8A 2XUAA 1TMOA 2VJPA 3E7PA 1LJUA 5HF8A 4UFNA 5TSDA 3H0EA 1DWPA 3OZAA 4PSC