4MINA

Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor nad
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
339
structure length
339
Chain Sequence
MVVKVGVIGTGAMGRAHIDRLTNVLTGAEVVAVTDIDHEAAEAAVRDFHLNAKVYPDDTSLLQDPDIDAVFVVSFGGAHEATVLKALDTDKFIFTEKPLATTLEGAKRIVDKELTKSKKVIQVGFMRRYDQGIRALKEKLDTGIIGAPLVVRASHINPNVASNYSNEMAITDTLIHEIDEMHWLLDDEYTSIQITYPRQSAEVRNEGLHDPQLATLTTKKGTVIQVLVHVTAQYGYEVKLEVIGETGELQLPNYGLGPILRSNANQQTAVEMSWINRFIQAYNTEVQEFIDEVAKSEPPVGPSAWDGYIAAITAAAANRSQKDQETVLINVAGTPTFYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of myo-inositol dehydrogenase from Lactobacillus casei with bound cofactor NAD
rcsb
source organism Lactobacillus casei
molecule tags Oxidoreductase
molecule keywords Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
total genus 114
structure length 339
sequence length 339
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.18: Inositol 2-dehydrogenase.
pdb deposition date 2013-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4minA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4minA01
3JQCA 3TL2A 1JKJA 3RWBA 1NWCA 2A92A 1GYRA 3ANMA 4Z3DA 1DHTA 1XELA 2PZKA 2OGUA 5T8KC 1BRMA 3TL3A 3ROPA 4BMSA 3FNHA 4J1SA 3QWAA 3I4FA 3Q1LA 1G1AA 1GD1O 4KUGA 4J1TA 4FB5A 1L7DA 1QSGA 4LISA 4AJHA 5EQFA 4N54A 4BQRA 3TN7A 3PLNA 4NFSA 2E49A 4BB6A 1A72A 2Y99A 1XEAA 1HDGO 3D5TA 2B5WA 4J90A 4EI2A 4Q3BA 4YJHB 3RU7A 1UXGA 4G81A 3ZN2A 4NU5A 2NTNA 4XZ3A 3LDHA 1X0VA 1P44A 1EVZA 1G0OA 1YL5A 3RUIA 4IQ8A 2DU8A 3UH1A 4IIUA 2I3GA 4BV8A 4WLVA 3CPSA 5AVOA 4EJ0A 2BFAA 2VQ3A 3ANLA 3KTDA 5JCJD 4CLRB 1KYQA 4IMPA 3JQBA 1I10A 3JQ6A 1EEHA 2HLPA 4ROSA 3VKUA 3T7EA 1VM6A 1K3TA 1QYWA 2EKLA 3KZVA 2JCVA 2TMDA 1DIAA 5HS6A 2GZ3A 1YB4A 4Z6KA 4QTZA 3LK7A 3GHHA 4MJLA 2NM0A 3HUDA 4J7CA 3PWZA 3N58A 1A9ZA 1T1SA 4OYRA 2XF8A 2IXBA 2Q1WA 3JYLA 6LDHA 1QP8A 3DFZA 4R4JA 4O6VA 3QVSA 1S7CA 4I08A 4YT4A 4RF2A 4ZU3A 1DJNA 4RVHA 4BV9A 3LC2O 1UAYA 3GAFA 3FHLA 4IUYA 4E30A 3L9XA 4WCFA 5L7TA 5JY6A 1GZ3A 3GF4A 3QQPA 4WLEA 2OORA 3DQPA 3LVFO 3HQ4O 2PH5A 3DTTA 4MIEA 4QX6A 3A14A 3GK3A 1KEPA 2VTDA 3UVEA 1F8FA 3M2TA 2EHDA 3HZZA 4BO0A 1Y8QB 3MTGA 2HMSA 1NWHA 4RZHA 4BKQA 3UCEA 5KIAA 3K96A 1NFFA 2QRLA 1XQ1A 1DIGA 4BNGA 1HETA 3GGPA 1U7TA 3JQFA 5C3MA 5CPFA 3P19A 4HADA 1JWBB 4MVJA 2DUUA 2QZ9A 1YKFA 2OBYA 3NUGA 4A27A 4HFMA 2VZ0A 4LK3A 4GH5A 1LDYA 3NT2A 4K1LA 2Y0CA 1WAMA 2EWMA 1ENOA 2I66A 4NH4A 2SCUA 4NBWA 2C5AA 2OP0A 3SXPA 1ZFNA 3DZJA 4AJOA 2B35A 2XOXA 2HK9A 4LW8A 5CDYA 1NQOA 5A3VA 2WYWA 1DHRA 1X15A 3RD5A 9LDBA 4CPDA 3GQVA 2O50A 3G1UA 4KWIA 4XCVA 4KZPA 4YPOA 5TC4A 3RUEA 1MFZA 2VUUA 1ZIDA 4WOKA 1YL7A 3KHUA 3ENKA 2DC1A 2LDBA 2RBEA 1YJ8A 4EUFA 2GZ1A 1VE9A 4RZIA 4BNUA 1GYPA 4CLEA 5KVVA 4CLDA 4Q39A 3FNGA 3BMNB 1FDSA 3JD2A 4EJMA 4WCFB 1ZZEA 2HCTA 1LC0A 4JJGA 4LVUA 2ZIZA 1GQQA 3TJRA 3VTFA 3JD4A 2Y0EA 3ETGA 3H9UA 3JCZA 4HX5A 5BR7A 4FCCA 4HV4A 3K5PA 4IS2A 1NFRA 2C07A 4YDRA 4DC1A 5ENVA 5IZCA 1ADCA 1YJQA 3H65A 1B8PA 1TT7A 1EDZA 3QY9A 3CE6A 5JCXA 2C5EA 1WLYA 1UXKA 3HE3A 4B4OA 3IQDB 1RM5A 3NTOA 4K26A 1QG6A 3OJLA 1Q1NA 1FDWA 1P1JA 3C8MA 4XJSA 5DBFA 1X7DA 1Q7GA 3NDIA 5I8WA 4PG5A 3KLPX 3SLGA 3FSRA 4FFRA 2QG4A 1R37A 2NQ8A 5A5EA 1CYDA 1A5ZA 2QW8A 4RVFA 2ILTA 3RVDA 3JQEA 3ZGYA 3ZWWA 4R3NA 2VHYA 5JPIA 1U8XX 4NBRA 1E1KA 2ZK7A 1ENYA 2FHSA 1XG5A 1B14A 1P45A 4Q3CA 2WD7A 2FP4A 3S2EA 4J1NA 2Q46A 4OOFA 1E6EA 2PD4A 3NV9A 2X9NA 3ZDFA 4Y6PA 4PG7A 1ZK4A 1R0LA 3VDRA 1M6WA 1DRVA 4XRGA 1X14A 3F1KA 1H93A 4BO8A 1VL0A 2CMDA 2G82A 1RM4A 1V3VA 1IY8A 4FS3A 4QXMA 4CL8A 4WOJA 3BMNA 1QYXA 1A27A 5AYVA 4XWYA 4E12A 2NU8A 1EFLA 1DOHA 1A4IA 3L77A 1ZW1A 4FJ1A 5JMPA 4YEDA 5IXSA 1U28A 2GUGA 1GADO 1KEVA 2J3KA 3KLMX 4AVYA 3PPIA 5BNTA 3OIDA 5IN5A 4ND4A 4K6FA 3Q9NA 3NAQA 5FFFA 2EJWA 1LNQA 2DLDA 5TJHA 4PLYA 4WNCA 1WWKA 2RIRA 2WM3A 3GC6A 1LX6A 2AHRA 5G0WA 3V1UA 4CLOA 1WNTA 5KJFA 4Q3EA 3I83A 1LA2A 4GKBA 1AGNA 2QRJA 3O38A 4OQZA 2DT5A 4N5LA 3WBFA 3F5QA 4IM7A 2VWQA 3RJ5A 1A7KA 3K6JA 4XGKA 1T26A 4AICA 2NUAA 4TQGA 4BKRA 4GX1A 3HSKA 3JD1A 1B0AA 4ZQBA 3QWBA 4MOWA 2Q4EA 1ML3A 3Q0EA 2O3SA 4W7IA 3K2EA 3M1LA 4DYVA 3WBBA 2O3TA 1YBMA 3CKYA 2O2SA 2RH4A 4IQGA 1ARZA 4JJIA 3WQRA 2LDXA 5L4NA 4I9NA 3E48A 4ZQEA 5EINA 1PS0A 5FWNA 2VWHA 4E31A 4KOAA 3ON5A 2J3IA 1CETA 3PRJA 3L07A 3GFBA 3GVXA 3RUHA 4JQCA 3RC2A 1Q0LA 2VRBA 4DPLA 2Y05A 2YQ5A 4FW8A 1U5CA 3ZNOA 1FDTA 2Y1OA 1DIRA 2QZZA 3BTUA 2AG5A 1SPXA 3C1OA 4TRMA 1B7GO 3M1AA 1K6JA 4ONEA 4MIYA 1A71A 1NXQA 5C7LO 4RLSA 5ENDA 4NBVA 3DBRB 3OIFA 2Q1UA 3CTMA 1MLDA 2EW8A 4CUZA 5LC1A 1PR9A 3JD3A 1EVJA 3GDOA 3PP8A 3UCXA 3FPCA 2PGDA 4YB8A 5TQVA 1AUPA 3GVCA 1KERA 3UKOA 3DTYA 1W73A 3F4LA 2Y68A 1KEWA 4RVGA 2IE0A 3NGLA 3M6IA 3VH4A 1LLUA 1LI4A 3LLVA 3G3EA 1QR6A 4Y98A 3ZWCA 5ADHA 1MC4A 1C1DA 4CMIB 1ID1A 2BLLA 1DIBA 3AUTA 3WGOA 1RJWA 4F6CA 2UUPA 3UN1A 4I9UA 2FOIA 1GUZA 1U5AA 4E5PA 3QRWA 1RYEA 2ZATA 3KXDA 1ONOA 3GUYA 1X7HA 3TSCA 4BNJA 4ZN6A 3V2HA 3MTJA 5CG1A 3GAZA 4U6SA 1ONNA 3DO5A 1ZCJA 3GH3A 1LUAA 2AEMA 4XQ9A 1PGNA 4FC6A 2GN9A 1U8FO 3TFQA 3KYDB 3DXFA 1VJ0A 2Q2QA 5TJ9A 1SEPA 3MOIA 1D4FA 1ZXBA 4NI5A 1OAAA 1GU7A 1UXIA 5I7SA 4D79A 3R6DA 3L0DA 2QHXA 4PZEA 3U09A 4AJ4A 5I7VA 5EMHA 4A73A 4RDIA 3VH3A 4INAA 4IINA 2BGLA 4RQTA 3BIOA 4MP3A 1PJ3A 4LSWA 1KIFA 2BELA 3UAGA 5JMWA 4J2HA 3VZQA 4AJIA 4EGFA 5FI5A 1T4DA 1XGKA 2GRAA 5CEFA 2HQ1A 3JQ7B 3AOGA 2OMEA 3IIEA 2NWQA 4Q3DA 4RPLA 1H9AA 5H83A 1E3WA 4CQMB 2BMAA 5A06A 4E3ZA 3VVBA 4BNWA 3WYEA 2HKIA 2ZJ0A 4GSLA 2GF2A 2GDZA 4YT2A 1UXJA 3DDNA 1VC2A 2UV8A 1NTOA 3OECA 3PLRA 2R00A 4D43A 2Q99A 1BSVA 1NQTA 1Y6JA 3RBVA 4QO7A 2EKPA 4NU6A 1XIVA 2AEJA 2WEKA 3ZZNA 5DBGA 3WGIA 1U3UA 2NV6A 5BQFA 1R4NB 5HRUA 3C85A 2BF7A 4MVJG 1AHHA 5DOZA 2PK3A 1SNYA 1I01A 1CEQA 3U9LA 1J6UA 1U9JA 5IAAA 3G1TA 1ZEJA 3LF1A 3HN2A 3V8BA 4CR7A 5CDGA 4FBGA 1ULUA 5KVQA 1KVUA 2J5QA 2EKQA 5JAMA 1DAPA 2VWGA 4GQAA 3S55A 5LDHA 2QRKA 5JDCA 1HT0A 3QVOA 5JYEA 1KVQA 1QXSA 5IJZA 1DC3A 1Y1PA 3WMWA 5I9NA 5IN4A 3GGOA 2V7PA 5L4LA 2J5KA 3U4IA 2CVOA 3VDQA 3OQBA 1RPNA 2X22A 1Y9AA 1A7AA 3GLQA 1I3LA 4S1VA 4I5GA 3IJPA 4W9NA 1R16A 3B6ZA 5TGDA 3SJUA 4WGGA 4RGBA 3LYLA 4K9DA 1MXHA 2HAEA 4PLVA 2J3JA 2JFGA 2D5CA 4M55A 1XU9A 2NVWA 3D64A 1ZVMA 1P1FA 1P0CA 1XLTA 3QLJA 3DC2A 5IDYA 5KVSA 2I76A 2C0CA 3ONDA 1WP4A 1WMAA 1DO8A 3PXXA 4NQZA 4O1MA 4OOEA 3KEQA 4WLFA 3QW2A 1WDLA 5COBA 1UDBA 1N92A 4N18A 1AE1A 5JAZA 1I5RA 5A02A 3PIDA 4GX0A 5IFLA 4GGOA 2X0RA 4CLXA 1H5QA 4IJKA 4QUKA 4DL9A 1B3RA 2PZLA 3CIFA 4ND5A 1TLTA 3BMOB 4A7PA 1LDMA 4BNHA 4YWJA 4KUEA 3ADPA 3GG9A 1I30A 2BI7A 3COSA 1HYGA 3QA9A 3FBGA 3UUWA 1J5PA 2BD0A 2YV3A 5EQDA 1HDOA 1K6XA 1QORA 1ZK1A 3LC7O 2EW2A 3FNFA 3HDHA 3EYWA 3JQ8A 3MCVA 3O26A 2BKAA 4ILKA 4CMBA 4RLHA 4CM6A 2HK7A 4FIZA 1WVGA 3WGYA 2IYOA 4XGNA 5G4KA 3TDKA 2YHIA 3GA0A 3FRJA 4U7WA 3TZHA 1I32A 3C7AA 1JW9B 4UEKA 4BO6A 1U3TA 3CZMA 3ZWYA 4ESOA 3PYMA 3E9QA 4R1TA 3TNLA 3O8QA 3H7AA 1I36A 1P77A 1SOVA 3EY4A 3T7CA 4OKNA 3O03A 3U0BA 4EEXA 3EDMA 5JXWA 2C2XA 2C54A 1E7RA 3I6IA 1PQWA 4MVJM 1RM0A 1VL8A 2PKQP 3DEYX 2HUNA 1BMDA 2HMVA 3WSVA 1B3BA 4B8WA 1Z73A 2X0NA 3AM4A 5C37A 4U0KA 1EZ4A 1U3VA 4L8VA 3PDJA 4YQZA 2WJPA 1E3IA 1TT5A 1UZNA 1NVTA 4EITA 2AQ8A 3S2IA 1NPTO 4EUHA 1MB4A 5DDIP 3WYCA 1GTMA 3OA2A 3PI7A 1UP6A 4CM8B 1ISFA 5L7YA 1HRDA 1X0XA 4D3SA 3HJAA 3HG7A 1R6DA 3U62A 3RQSA 5HWSA 1E77A 5G0TA 4WECA 5JLAA 4Q3AA 1I33A 5CDUA 5HM8A 5EIOA 2CF6A 2O4CA 3H9JA 5ES3A 3NJ8A 4XYGA 2A35A 4IZIA 4Z0HO 2WE7A 2CNBA 3JSAA 1ZXLA 1T24A 1LBEA 4PLHA 1V6AA 3AM5A 4DPKA 1UDAA 3WJ7A 4Q3NA 3CSDA 4YA6A 3ROMA 3WMXA 4PG4A 3ZV6A 4C7JA 4ALIA 1PZHA 3PZRA 4LMPA 1LEHA 1GFSA 1DRWA 3ZWPA 3MJTA 1KY4A 3K30A 1GUYA 4UEOA 1IL0A 3HHPA 4AL4A 1K89A 3ZH2A 3PQFA 3ZCXA 1N8KA 4WK6A 4PLTA 4YR9A 4Y6SA 4XQCA 1N7GA 4P22A 4L75A 2CDBA 1PQPA 4I9HA 1HE4A 4GVXA 3H5RA 4D41A 3PHGA 1F0YA 2D8AA 2C29D 2H9IA 2ZYGA 4NK4A 1WDMA 3RU9A 3DZBA 3W6ZA 4RORA 3IUPA 3ZWNA 4BNTA 4J2OA 4RV9A 2OFPA 4L76A 5EPOA 3AU9A 3MJEA 3VPHA 1AHIA 4L4RA 4PG8A 1GV1A 3L6DA 4BNNA 3O4RA 1QMGA 3B1KA 4E5YA 3CINA 1F17A 3I3OA 3KO8A 3UGKA 1PZEA 4LSMA 1HWYA 1N7HA 2ZCVA 1EQ2A 1H2BA 4LRSB 4Y9DA 4UVHA 1KOLA 3GVPA 4W99A 4J6FA 4XDZA 1NQ5A 2D0IA 5CG2A 1BDBA 4DXHA 2YW9A 1UAGA 1Q7CA 4NNJA 1C1XA 1NPYA 4NJMB 1CDOA 3PHIA 2IEBA 4YRDA 3SJ7A 4PRKA 3DAGA 1ZUD1 3KRTA 4PCVA 1H2HA 3ZHXA 3WWYA 1O89A 3VVCA 1OMOA 2IDZA 1N9GA 3WXBA 2Z1NA 3JTMA 4B3IA 2RHCA 4C4OA 2IODA 3K73O 1H6AA 4ALJA 4ZGWA 3QWIA 4R5MA 3QSGA 1BVRA 4GX2A 2ZCUA 4MIOA 1UR5A 2E82A 3ZU4A 1H6DA 2HU2A 3D0OA 5KCZA 3GEDA 3X2FA 1DDOA 5KNLA 1MGOA 1E7SA 3WSWA 4CJXA 1QLHA 2AEFA 2E6UX 3WB9A 1ULSA 5T57A 3I9KA 3JYQA 2Z95A 2IZZA 1GYQA 5A9SA 3IKTA 2X9VA 3DMTC 3OEYA 4XQEA 1MC5A 1TA4A 4E2ZA 2Y1GA 3RJ9A 2FZWA 3DR3A 3NT5A 5ICSA 4BIIA 2P9EA 3WFIA 2JD1A 3AOEC 3LU1A 4NFHA 2DTEA 4LRTB 3GDGA 4KP7A 4ZHSA 1CF2O 4WASA 3E9NA 1P0FA 2FPGA 2GASA 1VJTA 3Q9UA 4EBFA 3IAHA 1ZK2A 2P2SA 3QE3A 2OL4A 4CMEA 5KVCA 3DOJA 3EC7A 2QYSA 2NU7A 4NBUA 2YY7A 3U3XA 4BKOA 2X7HA 5TRTA 2VZ8A 4G65A 4A5OA 2Q22A 2D1YA 1YO6A 4BNIA 4ZQGA 3PEFA 3P2YA 2CDCA 5IZ4A 2NSDA 4IDBA 2R00C 4CM3A 3LT2A 3GN1A 1CQIA 3H9GA 2QQ5A 3PK0A 4ZQHA 1PL8A 2O3JA 5KKCA 4Z9FA 2RAFA 1IZ0A 3O9ZA 1ADFA 4B4UA 1EBUA 3GMSA 1U2DA 4OXKA 2PKQO 1XYGA 1GQYA 1C1DB 4KTTE 4U8GA 3X2EA 3VZRA 3LT0A 1PX0A 3RFXA 2JJYA 4J49A 3MZ0A 1T25A 1TI7A 1H6CA 4ZRNA 2IZ0A 2NLOA 4CMGA 4RL6A 3I9MA 2DFDA 2EERA 2W2LD 4CM8A 2R2GA 3SC4A 3M2PA 1PU2A 4II2A 1U4SA 2JCYA 4WJZA 2EIHA 1I2BA 1ZO8A 4WEOA 1D8AA 1GEGA 1Q0HA 1ZKMA 3I5MA 2E48A 5JDIA 1YBAA 1EFKA 4PVCA 4RVSA 4YJFA 4DVJA 1HEUA 4W9NC 1MG0A 1P1HA 4OHUA 3KYCA 1LLCA 3GPDG 2C20A 3D3EA 3GEGA 3O8QB 3ROKA 4BO5A 4FOOA 2Q4BA 3AI3A 4OMUA 3H5NA 2OBNA 3GN2A 2FR1A 4RF3A 1IB6A 1YQXA 3ZU5A 4TWRA 4D0SA 1PJBA 3BHJA 4R3WA 4E5KA 5K6AA 4EZBA 3RI3A 5FF9A 1R15A 4IBOA 3JQ9C 3VZPA 3HDYA 4B8ZA 4CM7A 2IYPA 2ZB3A 3A9WA 3DZIA 3JYPA 1E3JA 2FSVA 4XYMA 5EERA 1T2DA 2A4KA 1PQUA 2AA3A 4YT5A 3WDSA 3WQSB 1E1MA 3PGXA 5AXCA 5DP1A 3NJ4A 2X86A 3JQGA 1Z75A 5I7EA 3E18A 4RF5A 4DLLA 4HY3A 1NASA 3DBLA 3PJFA 2EGHA 3F1LA 1YVEI 2BH9A 5F3RA 1DB3A 4HNHA 1ZJZA 3P7MA 3L6EA 4DBZA 5F5LA 2YDXA 4FGSA 4PVDA 1DRUA 1E3LA 4BNMA 2O3QA 3E1KA 2GNAA 2NACA 3PQEA 5GZ6A 3FR7A 1E3WB 3W4KA 2C82A 2I65A 1XR3A 5K0ZA 2JHFA 5GMOA 1Y5RA 2WMDA 3B20A 4BQPA 3GNTA 1RWBA 2Y1EA 1DJQA 1YH3A 5L95A 2NTJA 3DMYA 5JO0A 3OIGA 5B4VA 4FFOA 1Z82A 3ASVA 4R1NA 2A9FA 4AJLA 5TS3A 3NYWA 3Q6IA 4HKTA 1TXGA 3DZKA 1TEHA 3GG2A 1NX6A 1ZJYA 3PFFA 4TMFA 5JNLA 4MVJF 1R0SA 5DZSA 3GY0A 4MKRA 1Y5MA 1E0DA 3OICA 4W4TA 2YV2A 1T1RA 3RIHA 4WUVA 2ZB4A 4PLWA 3E6AA 4W82A 4BOYA 3ZHBA 1XKQA 1YL6A 5JW6A 3ZW9A 5MDHA 1KVRA 2NU9A 4XDYA 5JS6A 3RUCA 3QV1A 3Q2KA 3KBOA 1O9BA 4BO9A 2VOJA 3PZBA 2ZTMA 3U4HA 4TZTA 3TRIA 2J6IA 1J49A 3NGXA 3ZV4A 3D4NA 4NIMA 7ADHA 1UZMA 1RYDA 1GUFA 4A10A 2O2YA 4F46A 3PWKA 1OBFO 2X23A 4FJ0A 1J4AA 1VKNA 1YDWA 1GEEA 4IDDA 5BNIA 1G0NA 3QVWA 3CH6A 3WTBA 4WNIA 4B79A 4DA9A 2HRZA 5BSHA 2IXAA 3NX4A 4Q9NA 3NRCA 3PJEA 4XIJA 2AQKA 4XB2A 1JKIA 1NHWA 4YRAA 2FMUA 5JO9A 4U0JA 4OQYA 1UUFA 1JAXA 4NPCA 5IDXA 5CFZA 1R4MB 1Y8QA 3OBBA 1HLPA 3JQAA 4BNVA 4IQ0A 3JQ7A 5M6DA 2Y1FA 4YRBA 2ZYDA 1PJLA 3NTRA 4JXKA 3JQBC 4IZHA 5IZCC 1BVUA 4L0QA 1ENZA 1VLLA 5DT9A 3MJSA 2VNSA 4KMSA 1EUDA 2FPIA 1ZH8A 3RKRA 3C1AA 1B15A 2VRCD 2PWZA 3IL2A 1X7GA 3DOCA 4IGFA 4R1UA 1SOWA 1BXGB 1V35A 1WDKA 2VRCA 3IMFA 4PLPA 2P4QA 5DOVA 3DAFA 5DNAA 4WKGA 5HBRA 1E7MA 4M1QA 5B4UA 1LRJA 3MWEB 2B83A 5EL0A 2Q1SA 2VYVA 2HK8A 2F1KA 1M66A 4KTVE 1PGQA 3ABIA 2JAHA 5ITVA 2RCYA 2OXIA 4DQXA 5BSFA 1JTVA 2V6BA 5C5IA 2VHXA 1FMCA 1I3NA 4FOSA 4WCFC 4K6CA 1R4NA 1U1IA 3RC7A 4CMHA 5IG2A 1FDUA 3HB5X 4E4YA 2VHWA 1ORRA 3VHRA 4YAIA 1VKOA 2GZ2A 3AW9A 1EQUA 5JE8A 3AM3A 1Q2XA 3OJFA 3PFWO 3IOYA 4IXTA 1LLQA 4CQMD 4B4VA 2X5OA 4NZ9A 5JBIA 1QLJA 3NDRA 4RDHA 3ULKA 1HDZA 3D3WA 5DBIA 4IDCA 4Z9XA 3L4SO 3NT4A 3W4IA 4BHTA 1UJMA 2GPTA 4CMCA 1BG6A 2DPGA 3C7CB 5KJEA 1GZ6A 3A4VA 1IPFA 1OZAA 1C1XB 3AFMA 4Z9YA 1HDRA 4MP8A 4E2YA 4J4TA 5TX7A 1C3VA 1Y81A 2ZB8A 2P9GA 4GKVA 4E33A 4LMRA 2PTGA 5I7FA 2W2KB 3V5NA 1H94A 3IDSA 1HLDA 1LSJA 1ZEMA 4FR5A 3MOGA 1XHLA 4DYDA 3ZNQA 1WZEA 4E0BA 3ZNNA 2J5RA 4MINA 3WGTA 4YYZA 1RKXA 1V8BA 1U7HA 2P9CA 3G17A 1WZIA 2C7VA 3GZNB 4M87A 1LDNA 4HFJA 2JKVA 5K9ZA 4UUOA 5LCXA 3E82A 2X0JA 4GMGA 1JU9A 1NAHA 3DBVO 2PZJA 3DBRA 3PJDA 4B7CA 3E03A 2PLAA 4N7RA 1SBYA 4D0RA 3B1JA 3EHEA 3PQDA 5KKAA 1Q7BA 1NQAO 4MO2A 3MJCA 4G5HA 3RFTA 5G4KB 2Y93A 3DHNA 5COAA 2VYND 2DM6A 3N7UA 2VYNA 5A9TA 4JN6B 1E3EA 1CWUA 3RUFA 4DIOA 4NHEA 3EVNA 2GN8A 4IDGA 4L9RA 3LC1O 2VWPA 4RVDA 5J23A 2AXQA 1LQTA 3GZNA 1YGYA 2P5YA 2I9PA 4PZCA 4QFCA 3AY6A 3DHEA 2FR0A 3GGGA 1HF3A 2HRBA 8LDHA 3H9EO 4DLAA 2GD1O 5THKA 4YAKA 5A04A 3OM9A 2HMUA 4RPGA 3H4VA 5JDCC 1CIVA 2O4UX 1PJCA 1ZSNA 1IE3A 4JBHA 5BNFA 3D4PA 2V6MA 2CD9A 2R6JA 3E5MA 1FXSA 4NG5A 4E5MA 2O3UA 1JA9A 5A3JA 2PGLA 3DZFA 4GPD1 3U4DA 3UHAA 1WXDA 4MPDA 4O0LA 1DFGA 2B37A 2I99A 4Z3KA 4GAEA 1P1KA 2YV1A 1MX3A 1X1EA 1QV7A 3I23A 1KS9A 4NBTA 1VRWA 5A03A 3OQ1A 4PIVA 4RVUA 2X1HA 3GZ4A 1BXZA 3UFXA 3T4XA 1DC4A 1X13A 4FQ8A 2Q2WA 3BTVA 3EK2A 1Y7TA 5B37A 2C7GA 3ICCA 3EGOA 4IDAA 4JIGA 5L7WA 3BMCA 2QYTA 3F46A 4KWHA 1NR7A 3BTSA 2UVDA 3ZWVA 5L51A 1YWGO 1YE3A 3WIEA 5TSDA 3EUWA 4NJOA 5TF4A 1PGPA 7MDHA 2O48X 2CF5A 3WR5A 4M89A 2OOSA 3L4BA 5L9AA 1IULA 3OF2A 5BT9A 5JFOA 3OSUA 4TRJA 1M6HA 5TIIA 3AUAA 3RAJA 4Z0TA 3UCFA 1OFGA 4CM5A 3JQ9A 4XRRA 2D59A 4UEJA 2P68A 4XKJA 4R41A 2DFVA 4PLCA 4UUPA 4I5DA 2HSDA 1EDOA 4UAGA 4JP3A 3RBXA 1G6KA 2OO5A 1QKIA 2W2LA 3WGHA 4HWKA 3SX2A 1YS4A 4MKXA 2GCGA 3MJ4A 3WICA 4OXNA 5EJ2A 4QQRA 3L6OO 5DULA 3VZSA 3OH8A 3AK4A 5T6BA 2HJSA 1L1FA 3JV7A 1U2GA 5HTOA 2W90A 4ZICA 1JQBA 2EEZA 2D5AA 1E7YA 3AUUA 3Q2IA 2VZ9A 1GZ4A 1Z74A 1DSSG 3WNQA 1YONA 4CLOB 2GO1A 3EZLA 1E5QA 4UUNA 3TWOA 1D7OA 3WQQA 2WYVA 2GLXA 1PTJA 4HFRA 3FI9A 3P5SA 4J7UA 1ADBA 2FSSA 2NTVA 4BNKA 5KWEA 3GHYA 4YJHA 4N5NA 3QIVA 3DAPA 3VPFA 2PFGA 2WTBA 4TRRA 5HA5A 3GR6A 2RH8A 1LDBA 4BGEA 3JD0A 4YXFA 3NKLA 4PN3A 3TOZA 3EMKA 1PZFA 3FWZA 1GL3A 2W4QA 1SC6A 2Y67A 4GGPA 2B69A 3U5TA 2ZQYA 3FN4A 1PJ2A 4GVLA 4QT0A 1W0CA 1ZK0A 3UF0A 3VTZA 3JQAB 5CDTA 2DAPA 1KETA 3OFSA 1YB1A 4EEZA 4OSPA 3MJVA 1GDHA 3R3SA 3KYCB 1PL7A 2PKRA 3DB2A 1WPQA 1O8CA 4MVJD 1ZMOA 4ZA2A 3TFOA 1ZBQA 1SZJG 1DFIA 2Q45A 4UVIA 2X8LA 4JBGA 1MUUA 4ND3A 3H9QA 1L7EA 2NVBA 5G2OA 3ORFA 1Y9EA 4RJTA 3H8VA 5GY7A 3BHIA 2YQ4A 3W8EA 2GSDA 4XGIA 4EJ6A 4ZD6A 1OC2A 1IHXA 1BTOA 1NPDA 2F00A 5F1KA 3KETA 4NMHA 4AG3A 3D1LA 3RKUA 3F3SA 4FSHA 3OA0A 1ZSYA 2WYUA 1HKUA 3H5AA 5G0VA 4HFNA 1H6BA 3RBZA 4XYLA 3ITDA 3JQDA 4OSOA 5L45A 2DBQA 1KC1A 2PA3A 4K28A 1BHSA 3OJOA 1PJQA 4BL5A 1VJ1A 1SCUA 3OP4A 3ADOA 3WS7A 4F45A 1LU9A 5DN9A 2DTXA 8ADHA 4J4HA 1YXMA 2V65A 3DBLB 5KJ6A 2X5JO 1R12A 1KC3A 1LRLA 2CVQA 2C2YA 3ZU2A 4E32A 3QHAA 5T5QA 2Y0DA 1P33A 2J3HA 5CAEA 3WYBA 1BGVA 1E92A 2QX7A 2P91A 1JN0A 3BMQB 1KVSA 2H6EA 3WFJA 5ER9A 3S2GA 4FGWA 1Z7EA 2FN7A 5FI3A 2OZPA 2NQTA 4KDEA 3I9LA 3PYXA 3W1VA 4OH1A 5ER6A 2B4RO 4DMLA 1E1NA 2DUWA 3KV3O 4UUMA 4OGWA 4HBGA 3KM0A 4YTEA 5L40A 3ZV5A 1QYCA 4DIBA 2B5VA 3KSUA 4FJ2A 3K2BA 4R01A 4MDHA 4CR6A 1CQJA 2E37A 2DKNA 4ALKA 4GMFA 3GEMA 1K5HA 3G0OA 1V0JA 3GNSA 3ITKA 3PVZA 2P5UA 4HXYA 5JC1A 4L73A 3SC6A 3NTQA 1QYDA 3ZWOA 5KTKA 4P38A 1PWZA 2B0JA 4OO3A 4YJDA 1T2AA 2GGSA 4JNKA 4R1SA 4O63O 4HNGA 3NEPX 2X0IA 5B4TA 3PTZA 4BNXA 1I3KA 5IXYA 3D4OA 1IOLA 4ZRMA 1Z7BA 2DPHA 5GZ1A 2EF1A 2VN8A 3DONA 3IJRA 4M86A 4ND1A 4X54A 4XJTA 1EK6A 4QECA 5ILOA 4IGEA 1MV8A 5JYDA 1MG5A 4P4LA 1P31A 3LLSA 4LVCA 2YUTA 1IUKA 2I6TA 5JAIA 5C7OO 1P74A 3KSDO 4UVGA 3GRPA 4J1QA 5H82A 4NR0A 2EP5A 5T8KA 1EMDA 2HJRA 1NNUA 2NU6A 1V3TA 1HYEA 3E8XA 1C0LA 1HTBA 4ZJUA 2A94A 4CMKA 1DBVO 2Y66A 5JAQA 4D3DA 1O94A 1PZGA 1BW9B 1F06A 2CSUA 4CLRA 4DQUA 1E6UA 2WE8A 3TZ6A 2CDAA 3HFSA 2W98A 1J0XO 3KVOA 4EDFA 3GT0A 4EUEA 1GY8A 1UXHA 3ROQA 4BUCA 4J4BA 5IDQA 3ENNA 2BI8A 4Y67A 1C0PA 5TLSA 4RPJA 4R51A 2EJVA 5DCUA 2DTDA 3HFGA 3ASUA 2Y1DA 2ZKLA 1RM3A 4DMMA 4BNFA 1UP4A 1A9YA 1ISHA 4MVJP 2Q1TA 3UOGA 2BFMA 2H63A 3OJ0A 3GPIA 2CUKA 1ISIA 5JSFA 2AW5A 1GPDG 1ZK3A 4CM9A 3G79A 3TF5A 1W4ZA 2AE1A 4O5OA 5TT0A 1T2CA 2IEDA 5T64A 2NVUA 3FPLA 1VPDA 1FJHA 1C0KA 4CL3A 2W2KA 3ZWBA 1B8UA 2G17A 3OHSX 4WE3A 1JAYA 2XXBA 4GWKA 4DBVO 4MKZA 1VL6A 2IZ1A 4E5NA 5DP2A 2JL1A 1EBFA 1HE5A 4BO3A 2HDHA 3WGQA 2PGJA 1T4BA 4OAQA 3AU8A 3QVTA 3C24A 4ZVVA 4D7AA 1QYVA 3CUKA 4J7XA 1GR0A 3I1JA 5I9LA 4XEHA 3JQGB 4KQXA 5JDIC 1P1IA 4ITUA 1PGOA 3BTOA 1B2LA 2VUSA 3U49A 4YT8A 3P2OA 3CZRA 4JGBA 5GZ3A 2VHVA 4LN1A 4D44A 4F6LA 1O0SA 3QVXA 2JHGA 3C3XA 2FPPA 3KOUA 3JYOA 4CQLB 1V9LA 3I6QA 5A5FA 1PWXA 2VTEA 5JC8A 4U5QA 4TVOA 1QRRA 2DBZA 4IY1A 4YJGA 2H5LA 3JQFC 1I2CA 3F5SA 1QV6A 3IUSA 5B1YA 3GMDA 2AG8A 2GN6A 2PD6A 1EUCA 1SB9A 3D3WB 3ETDA 2VNAA 1H0KA 1FK8A 4PG6A 4BGVA 3BMCB 1PIWA 3MWDB 5CHEA 1R4MA 1NFQA 4FN4A 3RCBA 4BKUA 3L4BC 2I5PO 4QEDA 1AN9A 4DREA 4IJWA 4PLZA 2O7QA 3IS3A 2C59A 3DZGA 3FCOA 4CLHA 4ID9A 3IP1A 3T4EA 3LQFA 4XX0A 2V6GA 4BS9A 4CQLA 3V2GA 2PV7A 2WSBA 4LCEA 3WGZA 1HSZA 1X1TA 5J9GA 3GNQA 3F47A 1JLLA 4GLOA 3VH1A 1N9GB 4AJ1A 4BNLA 3CEAA 2G76A 4CV3A 2JD2A 3LT4A 1ISGA 2D3TA 4WLOA 3ETEA 3FR8A 4NFYA 4WCDA 5AOVA 4XD2A 1H9BA 2O3RA 4OXYA 5I8ZA 4JBIA 3DBHA 3PJGA 3A06A 3DMTA 4AJ2A 1LSUA 5ITWA 4P8RA 3RC1A 3I9OA 4YAEA 4AJJA 2FRDA 1PSDA 1E5LA 1HE2A 2JCXA 2Q2VA 3OMLA 3WWZA 4CM1A 4CM4A 3FTNA 3TZCA 5HS4A 4H16A 2PH3A 2B36A 4TROA 5H81A 4KDFA 3QP9A 2JAPA 2PR2A 3H6KA 4CQMA 3RASA 4TVBA 4CMEC 4MVJH 2Q49A 1KVTA 3HDJA 3WX0A 1AXGA 3WNVA 3EVTA 9LDTA 3E5RA 4XB1A 5EESA 3QWHA 4I8XA 2HMTA 1YBVA 3WG9A 4XR4A 2DBVO 1B16A 1KEUA 1EVYA 1K0UA 4OL9A 1KY5A 1Y8RA 4IMRA 4CODB 1O5IA 3AWDA 2AE2A 4OIMA 4N5MA 4J0FA 3MEQA 2DQ4A 3ST7A 1TB4A 2GN4A 3AY7A 4PGFA 2D2IA 2J8ZA 4YACA 5L53A 3F4BA 3KYDA 1LRKA 1DXYA 2DVMA 3VKVA 1I3MA 6ADHA 1PGJA 1EE9A 5A4DA 3I4CA 1LDEA 1IYZA 1OI7A 4I1IA 2FWMX 4JLWA 2ZTLA 4FFPA 2ZQZA 4R9SA 4YJGB 4J9UE 3HNPA 2I3AA 4QSMA 3GRKA 1NYTA 1OC4A 1PJ4A 1DEHA 3BA1A 1N1GA 3WTCA 4A2CA 4I5EA 1XU7A 2Z5LA 1TVEA 5T73A 2GR9A 4RQUA 3PHHA 4J3FA 5JY1A 3INGA 2JFHA 4ALNA 4XYBA 4H3VA 1Z6ZA 1DC5A 2VYVD 3STHA 1CERA 1S6YA 3C1TA 4P4NA 1IHYA 4UVEA 1PEDA 1ZNQO 4PZDA 3R1IA 1JDJA 1T2EA 1W8DA 3DL2A 2NADA 3RFVA 4TRNA 1PR3A 5I9MA 1BDMA 1ONPA 4OKIA 3ZWXA 3W4JA 5DF1A 4J0EA 1DC6A 5F21A 4C7KA 2YYYA 5KOIA 2G0TA 3ZW8A 1HDYA 4BO2A 3UW3A 3F9IA 4BVAA 5F1OA 4A0SA 3AI2A 3PHLA 4IDFA 5CEEA 1ISMA 2V6FA 2CY0A 1MP0A 4DTIA 4F3YA 4MVJE 2X58A 2PZMA 3C7DB 2JD0A 4CR8A 4XYEA 3HWRA 4WLUA 3RSHA 4AJKA 3PIIA 4R9RA 5FYDA 2FR8A 4BNYA 4HUJA 1GCUA 1LXCA 4B7UA 4GWGA 4DLBA 5A9SB 1F12A 4XQGA 3KSZO 1WMBA 2UUOA 4IJVA 4EW6A 1FF9A 3ZV3A 5JYFA 4IIVA 5FEUA 1SMKA 1LSOA 1GPJA 2VHZA 1GV0A 4ALLA 1HSOA 1W6UA 4L74A 4XR9A 5AXBA 3VPGA 3BZUA 4R16A 3BAZA 5U9CA 2OP1A 1B8VA 4J91A 1A4UA 3AY3A 3DHYA 4IXWA 1P9LA 4RCVA 1U3WA 2XPCA 2DBRA 3EAGA 1YQGA 3EW7A 3FNEA 4M49A 4DUPA 4CM9D 1JKFA 1M67A 2YHUA 1WW8A 4E13A 1YOVB 3NDJA 1VSUA 3DBHB 1D1SA 3ICPA 4AJPA 5A9RA 5CPBA 3PHJA 5F1PA 4KUHA 4YQYA 1ISJA 4BKPA 3TZQA 5TT1A 3VH2A 1SEVA 5JYAA 4JP2A 2EGGA 1NBOA 2Y1CA 4DPMA 3BHMA 4AFNA 4NJMA 4Y8VA 4I5FA 1I2ZA 4UVDA 1GAEO 4WPGA 3AFNA 3FBTA 3I9NA 4ZQFA 3DFUA 3VPSA 3WIDA 4FPXA 5BSGA 4A26A 3VC7A 1NP3A 4JJFA 4BGUA 4OM8A 1XWFA 3GVIA 2ET6A 3ANNA 3LF2A 1PJSA 3H3FA 1F14A 1ADGA 3QJ5A 4JROA 4E2WA 4B7XA 4RF4A 5AXAA 4D45A 4GX5A 3LT1A 3OQ6A 3TZKA 4W7HA 2VOEA 1YRLA 1IPEA 3ONEA 4Z0PA 5G4LA 1DPGA 3GOHA 1HL3A 1M2WA 2NVUB 3PDUA 1BWSA 4B3HA 1ENPA 1P3DA 1D3AA 4CV0A 2ZYAA 1LSSA 3AUSA 5G0SA 3BYZA 2YHIB 3KEOA 1B26A 3I52A 4GLLA 1I0ZA 1FDVA 3H3JA 5L4SA 1R0KA 2UYYA 5KJCA 2ZJ1A 2I67A 2E4AA 3K8ZA 4BMNA 1BXGA 1E7QA 1DFHA 1UH5A 2ZB7A 1Y8RB 4P4GA 4CV1A 4URFA 4FFLA 4LCJA 1YDEA 1ZMTA 3A28A 4ALMA 2WDZA 4UREA 4RPHA 4IPTA 4XA8A 4TKLA 4R54A 2H1SA 3KYBA 3GVHA 1XQ6A 4L4SA 1CJCA 1JWAB 3GFGA 4DGSA 3B1FA 4RO0A 3OJEA 2HMWA 5DCYA 2CVZA 3S2FA 3HB4X 4BNZA 5ILGA 2X5KO 2HO5A 2BHLA 2CFCA 4MP6A 5A1TA 1EE2A 1Z45A 4E21A 1SB8A 4YCAA 1D1TA 5CP8A 4DQVA 3QWFA 3HDQA 3CMMA 1LDGA 4FFNA 2XAAA 3W6UA 3INTA 3TOXA 1MA0A 2YJZA 1HXHA 1TT5B 4GBJA 3ZNPA 3D7LA 3HADA 5LDGA 4PLFA 4LGVA 1NVMB 1C14A 1V3UA 3V2UA 3H2ZA 1LC3A 3BXXA 3DWFA 1EVIA 1EUZA 2AMFA 3V1YA 5CDSA 4CMAA 1GCOA 1BXKA 1NR1A 2EV9A 3AI1A 5JCJA 1XSEA 1I8TA 1K6IA 1OOEA 2JFFA 3JYNA 1LLDA 4GI2A 4YVFA 2W8ZA 2ZTUA 4YJFB 2EG9A 2Q50A 1GQ2A 4M54A 4R5HA 1E6WA 2PD3A 4OJNA 3KB6A 1C0IA 2BRUA 3DOOA 5U4QA 1SO8A 4KQWA 1PS9A 1JVSA 1YOVA 2POQX 4CMIA 3TPCA 2O23A 3JQAD 3A1NA 5THQA 1HZZA 2UDPA 3ZI0A 4GSKA 4O59O 4DWVA 1DIHA 3AOEA 4DIFA 4IDEA 1HYHA 1Q0QA 1EK5A 5IF3A 3RROA 5AQ1A 3WGGA 3LZ6A 3RUDA 2EXXA 2UAGA 3V1TC 3VOSA 1VI2A 5G0UA 1NAIA 4FC7A 4TSKA 3EZYA 5F5NA 5U1PA 2VCYA 5C7IO 4JX8A 3IC5A 4IS3A 4S3MA 3SVTA 2OHXA 3F6YA 4BO4A 2G1UA 3CMCO 2YDYA 3HN7A 3K9QO 1LQUA 3L9WA 1YB5A 1HDCA 4TKMA 4R68A 3ONFA 4PLGA 1CRWG 4DRYA 4G2NA 3SEFA 4UULA 3RUAA 4H7PA 2YZ7A 4M8SA 4H15A 2X9GA 4PRLA 1JVBA 2AQIA 3SBOA 3BMOA 5COQA 1R66A 2PY6A 4CUJA 1T2FA 3S1LA 3Q11A 1XCBA 4FD3A 2PNFA 2BGKA 3PYLA 4E6PA 4J9VA 4JCOA 3S8MA 1DAOA 2BGMA 4W6ZA 2X4GA 3E9MA 1E7WA 4ND2A 1O95A 1MFPA 3BMQA 3WLFA 1I24A 2WWRA 5AXDA 3ZHYA 5MGBA 5IDWA 4J16A 3G49A 1YQDA 4EYEA 1N1EA 3OETA 2AQHA 3UICA 5KJ1A 2B4TO 3OEWA 3AJRA 4BO1A 1AXEA 3TQHA 1LTHR 3W8FA 2CZCA 2X6TA 4PFJA 4QO8A 5DCWA 1UP7A 3B70A 1HE3A 3WJAA 1U4OA 2BFPA 3UXYA 3VPXA 2VT2A 1HDXA 3INRA 3VAZA 3R3JA 4CM4B 3D5QA 2BFOA 2NNLD 5TNXA 3IP3A 4MVJI 3FD8A 1BW9A 4B3JA 1K2WA 1SAYA 3ZU3A 2RHRA 4RPKA 2O7SA 2XXJA 5K6AC 3H2SA 3K92A 1IZ9A 1M75A 4D3FA 2TMGA 4CUKA 2ZTVA 5BSEA 4XIYA 4FFMA 4BB5A 1N5DA 3CXRA 3PGJA 3K31A 1XA0A 4GL4A 1P1RA 2EP7A 3WOHA 1O6ZA 1NVGA 2GYYA 3WLEA 3RC9A 4QFDA 3IKVA 4E2XA 4BO7A 1NHGA 1NM5A 4WLNA 3U4CA 2FZEA 4YAGA 4U6QA 3LSYA 4NK5A 4BGIA 3GDFA 3SLKA 1PJTA 4AJNA 3JQ8B 1M76A 1ZSVA 1DLIA 2Z1MA 4R69A 3N74A 1PS8A 1VSVA 2Q3EA 4D46A 4D42A 1XDWA 4Y6RA 5B12A 2P4HX 2D4AA 3DZHA 4JK3A 1LJ8A 2WD7B 4DC0A 1UDCA 2VUTA 5ICMA 2FY8A 2IRWA 4WEQA 2G5CA 1E1LA 4TZKA 2YFQA 4BMVA 1HZJA 1KBZA 4NDNE 2GERA 2WD8A 4FDAA 4YBZA 3PWSA 1F8GA 5T67A 4CV2A 5CEJA 3FF4A 1MXFA 4YAJA 3Q3CA 1PL6A 2VT3A 4II3A 3R0IA 5EN4A 3W8DA 2OUIA 1DLJA 3ZHZA 4A03A 3FWNA 2YFHA 2QIOA 5L3ZA 2B4QA 3ZWMA 1N2SA 4AJEA 4J43A 4HP8A 3FTPA 4L4XA 5A05A 4CMJA 4IJUA 3KUXA 1E3SA 3ZWAA 4B4WA 3GUCA 1UZLA 3I9JA
chains in the Genus database with same CATH superfamily
3JQCA 5HQTA 4QG7A 1J8MF 1NWCA 1ODIA 2A92A 4Z3DA 1MHMB 4K9RA 1U0HC 4O2AB 3QW4B 4EFDA 4FZRA 1UL1X 2O57A 3X1DA 2PZKA 2Q5IA 1BHJA 3LWDA 2O6HA 4G1EB 1QK5A 2H7YA 2R7NA 3W7AA 1GP2A 2ADMA 4JBLA 4M7PA 3GLRA 1WS6A 3Q1LA 1HT3A 1L1RA 4UNSA 3NPAA 4J1TA 1L7DA 3VJRA 2KE5A 1I1QB 3K1AB 4BQRA 4KXNA 3TN7A 4FS8A 4BB6A 3O1HB 1DEXA 3B52X 1HDGO 1X77A 2B5WA 5IBQA 4LZZA 1WQ1R 2Z04A 3EN0A 4NAHA 4Q3BA 1UJ5A 1SUFA 3L0ZA 3IIMA 1W88B 3K1AA 2AXPA 5CJ2A 4TVSA 4MR9A 4XZ3A 5JSHA 1HYBA 1AHPA 1EJ0A 2PV0A 4BNDB 3EZXA 1P44A 1XEWX 3RUIA 4E94A 2C77A 5B3KA 4US2R 2I3GA 3M5PA 1YB7A 3CPSA 1PFYA 1ZH0A 4HB4A 4KKXB 5AVOA 4WLVA 2HRRA 4DV5B 3E7FA 4O4IA 2JVJA 1P2GA 3HB7A 3Q3HA 2W83A 4RESA 5A5VA 2CHFA 1GITA 1C8KA 1KYQA 2WJYA 2UXDB 2F3SA 3PS9A 4ZDIA 1EEHA 2X13A 3ET5A 4TTJA 3GLHE 1BD3A 1K3TA 4N40A 3W5JA 1YOBA 4J0HA 4MJ3A 4EW1A 2TMDA 3QPBA 1IBLB 1OY1A 2W8BB 1FYXA 1F9AA 5D00A 3FETA 4QTZA 3LK7A 2UYHA 3NXKA 3HUDA 4FYWA 4MWSA 1E8NA 1J8DA 4TLMB 4R2JA 2FSIA 1T1SA 2CHGA 1FC0A 1E2KA 3WB2A 2OZKA 4OSEA 2Q62A 3IBGA 4Z86A 3LE8A 4RH1A 2Q1WA 1UMCB 5AKGA 5A7FA 2VP6A 3U56A 1YULA 4KQ1A 3P9IA 4AZTA 1PX2A 1KPHA 2QB5A 2WR8A 3FWKA 4RHXA 3KFLA 4RF2A 1DJNA 3U39A 2PUFA 5TE9A 2A84A 3GAFA 2O06A 3AR6A 4QODA 5TPZD 1GT6A 3TJZA 4RULA 3R0VA 2YCLA 3ECSA 3VTKA 4FGKA 2QU8A 3QQPA 2D5BA 2Z4SA 3GJ4A 2W9XA 4G8BA 2XOKD 3DQPA 3P5BA 4MR8B 4NENB 4CL0A 4DMRA 4F3KA 5BY2A 2PH5A 2FZKA 1FZTA 2PKWA 2NUPA 4MIEA 3DM9B 3Q40A 5JWHA 3A14A 3WRYC 1VPVA 2JVIA 5FYQA 2VTDA 4AS2A 2IKQA 3WDKA 4BO0A 2QD5A 3DZ7B 4UNPA 4BKQA 3MS4A 4LMAA 2ZUUA 3B6MA 1JAZA 3K96A 3NIDB 4LPSA 3AVYA 3QEMB 1XVIA 2WHRA 1EAMA 5C3MA 1W5EA 1Y33E 2FWNA 3ACDA 2CNDA 1ZXXA 2XDQA 4NATA 2ZJOA 1LBHA 1Q3TA 3FJ1A 3K0CA 5DFAA 1UAAA 2OBYA 4A27A 1JH8A 2NXCA 5FKJA 4LK3A 1OPXA 1RCFA 2VHUA 3FYUB 1LDYA 1JXOA 1WHSB 4B32A 1NULA 4XFDA 1I80A 1IBRA 1ENOA 2EWMA 2I66A 2XMZA 3AETA 4YCBA 5IVIA 1KARA 4L78A 2H5EA 4CG0A 4EX6A 2FMTA 2C5AA 1BWRA 2IP1A 3GA7A 2B35A 3OQNA 1JJIA 2DQZA 1FMTA 3GP5A 3A70A 4H3KB 1DHRA 3VNAA 2IP4A 3RQIA 1GAXA 2FG6C 9LDBA 1GPH1 1P2FA 2Y0BA 5HYVA 3G1UA 3SK0A 4MJ7A 4IHQA 4YPOA 5TC4A 2EW1A 2CNOA 2JAWA 2VUUA 3OLVA 5K0BA 4AZVA 1YL7A 1L4EA 2DR0A 2DC1A 5JYBA 4MQFB 4ENTA 1XDBA 3B8HA 2RBEA 3D6TB 1KOJA 3TLGB 4B9EA 4EUFA 4JBYA 1G17A 2JFOA 3GRVA 4XVUA 5KKNB 3IVXA 2VT6A 4F9GA 2ZT7A 5AW9A 5FOSA 5H70A 2KI5A 4TS4A 2QPAA 1JTFA 4ZJZA 3UWKA 3PHCA 1N2JA 4O4HA 1GPWB 3NHPA 1ZZEA 1Q0PA 2ZIZA 3WWEA 1FP2A 4Y3UA 3HB1A 4IFEA 2QAIA 2VL7A 5AO9A 2C3OA 4P7KA 2RGEA 3KZXA 2ZSKA 3JCZA 4LXYA 1IU9A 3VTAA 3HJFA 1E98A 5BR7A 3COYA 4IS2A 4JB8A 4W5TA 3N3BC 3W0LB 4C14A 1IN8A 2DT8A 3L6RA 2X1LA 4YDRA 2IOYA 1N3IA 1DV1A 1ADCA 2ISSD 2QY6A 1EBBA 4RDXA 1VLHA 3WWPA 3C6QA 3C7TA 3D5EA 3U2QA 1PT5A 2XV1A 3B8EA 3CE6A 1CUWA 1CUUA 2AD5A 3ZX4A 5J3JA 1Q15A 4LJLA 1UXKA 5J2TB 3V55A 2QENA 4GT1A 5HKKA 1JR2A 1LBTA 1S8AA 3NTOA 3Q88A 5AW4A 4CIWA 4G4SO 5B7PA 1QG6A 2PMKA 1ESMA 2VXBA 4GOJA 4EGQA 5KX5F 3KDSE 4R0NA 5IDVA 3KT8A 3MTQA 1N2XA 1V7ZA 2AVDA 3MCUA 4LRXA 1KMIY 4PG5A 3C3YA 3GAAA 4U9HS 1Y6RA 1KPGA 3IERA 1Z17A 3T9AA 4XDGA 2WVJA 1YRBA 3FSRA 1EM8A 2QG4A 4YAOA 4YRIA 2NQ8A 5LOVA 4Q4DA 3S1AB 2DR3A 4RVFA 1A5ZA 3RJMA 5A5EA 3FMFA 3NBXX 1TC1A 3JQEA 4RMJA 1KI1A 5J40A 2PL5A 3HS3A 3FUUA 3NAZA 4NBRA 1E2NA 3NQ41 1J0EA 4WESB 4CTOA 3HLTA 2E5LB 2O0LA 3HKEA 3HDTA 4KX3A 5AJYA 1P45A 5DEIA 4DTCA 3S2EA 2OHOA 1S9DA 2Q46A 3NV9A 1O6FA 5JS2A 3UT5B 4ZCTA 4ZOQI 4Y6PA 4PG7A 3ROEA 2OECA 3VDRA 4YYEA 4EKEA 1M6WA 1CKEA 1DQRA 2FOLA 3A1UA 3DSRA 1E1QA 2OYSA 3EFOB 5K2OA 1T0UA 1DT3A 1N5LA 1VIMA 2HM7A 4IZOA 4BO8A 5K7SA 2R5WA 2QVYX 1NJ6A 3DT9A 2WJHA 3A1DA 3H05A 1SHLA 2G82A 1EK2A 1IY8A 2FPLA 2KBEA 1JQDA 1IHOA 3JW8A 4X20B 1XN4A 3JXEA 4IJ6A 4MQEA 3RS8A 4E12A 3VC2A 5FWYB 1KI8A 1XP8A 5LYJF 2XCSB 3EJWA 3PGLA 4G37A 1ZW1A 4MWDA 4FJ1A 5IXSA 4YEDA 4P2BA 2JLUA 5EI5A 2C9YA 1CG6A 1LNSA 4R6XA 1QCYA 3EVAA 4ND4A 3Q9NA 2B20A 3RVBA 2WM8A 4H59A 5DYTA 1O08A 3QUTA 5LYYA 1G8HA 1X1QA 3RSGA 3X0DA 1EVEA 1N6HA 4PLYA 3PPYA 4WNCA 1WWKA 1HC7A 4B3GA 5D6NA 1ITZA 1RZVA 2BE9A 3UQYS 5CRIA 1XDUA 2AHRA 1B1AA 2AJ8A 1E4YA 3ESDA 4L5YA 4LZOA 4PX2A 5G0WA 3TB6A 1OV4A 3N2LA 4TL7A 1LA2A 3N8GA 3NRJA 1IY9A 1KKMA 1RJEA 2V7QD 3O38A 4N5LA 3F5QA 4QOHA 4YBRA 1H2YA 1ZCZA 1U81A 4OGFA 3RJ5A 5E3IA 3RYCB 1AK2A 3DV9A 3HKDB 1T26A 3JPWA 4HAZA 4XIGS 5TDHA 1ZD8A 3S1AA 4CMEA 3N76A 4GX1A 3HSKA 4EYGA 4LOAA 3IQWA 1OHHA 1NVVR 2QTTA 2I7VA 3GJ6A 2QAJA 5AOBA 4FEGA 1P0PA 2XQKA 4X1KB 1ML3A 5TVOB 3LT5A 3WGKA 4W7IA 1VE7A 3K2EA 1RWKA 3KNZA 3M1LA 3N75A 3P2EA 1JB9A 3RVNA 3VR4A 5C32A 1G98A 4IHKA 1ARZA 3N0VA 3U1BA 1JQKA 2LDXA 2VLIA 1WABA 4LBWA 2IYTA 3E48A 1HOTA 4I9NA 1PS0A 1DCTA 2YMPA 3ZEAA 1B6GA 2VWHA 1VBNA 3A9TA 4KOAA 5B6IA 1CP3A 3ON5A 1OBOA 4KVZA 3N8IA 1RZRD 1GNQA 3JR3A 2DEUA 2ZJ2A 4EVRA 4N82A 3GFBA 4U63A 3CCFA 1CJUC 1NIPA 2I4LA 3O0TA 4WKPA 3RUHA 3ZVNA 4NESA 4N5IX 1Q0LA 4GM0A 1LTQA 5H1YA 1PNTA 1SC4A 3CR3C 3K16A 1FDTA 1FRQA 4UU7A 1ZICA 2BP7B 1R18A 1SPXA 2R86A 2WAOA 3NHAA 3ZY2A 5KVVA 5B53A 4ZKEA 1G66A 4G63A 1FNBA 2I71A 1PZXA 4RLSA 4JKOA 4NBVA 4XB6B 4ZJPA 4MJXA 1K9VF 2R6AA 1IQPA 1UT5A 4FMPA 4US0R 4CTKA 4CUZA 1XNRB 1PR9A 4N1AA 1SD5A 3F8TA 2NU6B 1P4JA 3GDOA 4M76B 3FPCA 2PGDA 5EVJA 4M9QA 2VF5X 4RIIA 3H2YA 2YQZA 3HP4A 3UKOA 2YOFA 1XWWA 1X74A 3F4LA 3LCVB 1KEWA 4NENA 2IE0A 3NGLA 3HV0A 3IX7A 3B85A 1N5IA 2FFHA 2YXBA 1OWNA 3M6IA 3VH4A 3VR1A 2UZ1B 4QBHA 1N75A 1YVPA 2QG9A 3U3KA 3WLNA 4HYYA 1OPRA 3SZOA 4C4TA 421PA 1X92A 2VPTA 2W6ID 1HO3A 2PVSA 3ZWCA 2Q9CA 2HSWA 1CQZA 3DZCA 4CMIB 4FUTA 1ID1A 1X1SA 4MWEA 3DBOB 1RYZA 1JAIA 2MSDB 3UN1A 1Z0UA 2MSLA 2QGFA 4I9UA 4MEAA 4Q4AB 4D5EA 4DNPA 1RYEA 2WHQA 2XUKA 3KXDA 1TAGA 3JZMA 5BQOA 4BFSA 1CJVC 1JG7A 1QH8B 2V3VA 4LRUA 3GAZA 4MGEA 3AVPA 4FCWA 3T6KA 3DO5A 5LMZA 1F8YA 1W4CA 4KVGA 2VRWA 2GBIA 3G2PA 2WMYA 5EMJA 2XZOA 2AEMA 3KCQA 4HYEA 2ZCJA 4RL4A 3HXOA 2G88A 4NF2A 1HNWB 3KYDB 1ZONA 4C43A 1ULHA 3TW4A 1UJ4A 3WIVA 1D4FA 1ZXBA 5LP6F 1WCWA 2FNAA 2I8AA 4DRXA 3R6DA 3L0DA 4PZEA 1H4SA 3T61A 3I76A 2KLHA 1N5RA 2IYAA 2ZSDA 4H1VA 4J6EA 4DM7A 3BGOS 4HH4A 5J4VA 4A73A 4E1VA 4EX7A 4D02A 1MB0A 2QX9A 2BGLA 5F2NA 1PD1A 1ZN8A 2EFJA 3O75A 4AM8A 4DLWA 5BVHA 2HL6A 3WNBA 1KIFA 2YTZA 3D2AA 1BH6A 2O2JA 4M53A 4J2HA 4IIEA 4LS3A 4MMYB 2FMKA 3VZQA 1QCDA 4BFTA 3UANA 4EGFA 5JWRA 1T4DA 5KAMA 4HPJB 1TYBE 2GRAA 3T5AA 2ZJYA 5JD5A 4Q3DA 2OMEA 4B3BA 2NWQA 3C97A 3N5CA 1U8UA 2ZJFA 3TTUA 4DAEA 4CFSA 5H83A 1KOGA 1E3WA 4QELA 4CQMB 2BMAA 1T5IA 3A05A 2IX9A 4FFSA 1Z2DA 1N1MA 1UBTS 4GSLA 1QHSA 4HWSA 4YT2A 4RLFA 4G9BA 3DDNA 4JZYA 1P6UA 1NXXA 1VC2A 4KSBA 4X7RA 4Y2PA 1NTOA 2A67A 1SBHA 1YASA 2N75A 4H9GA 4LZLA 1OAKA 1U7PA 5FFNA 4TQ9A 1NQTA 2GZAA 3LCUA 4P1ZA 4PGHA 2AEJA 1XDGA 3BOSA 3MPUA 3G82C 1U3UA 3LRTA 2NV6A 1AQNA 2CMFA 1R4NB 5DI3A 4I81A 4AO8A 2C95A 1NT2A 2YVLA 5K8VA 1QMHA 2FZLA 5F12A 5HRCA 3QF4A 5LQDA 3PR2B 5B58C 4X6LA 3HK2A 3NKVA 4KX5A 4QU5A 3HN2A 3V8BA 1KZGB 3W04A 5DT2A 4R2WA 4YUWA 2F1RA 3QMWA 4FBGA 1ULUA 4MR9B 2C2ZA 1ZD2P 3AIOA 4QE3A 3X1XA 4A0FA 5KVQA 3RFUA 4KR3A 2L0XA 2J5QA 3O1IC 3TZBA 4PQEA 3NLLA 2ZVQX 1DAPA 2VWGA 4GQAA 1GILA 1RHJA 3F71A 5TQ0A 3QYAA 3QVOA 5JYEA 1KVQA 5MN4A 3IPCA 4RXTA 1Y1PA 1L3BA 1YIAA 3ZGVA 2VJQA 3SSOA 2CV1A 3CEPB 5L4LA 3VPCA 1SQGA 2L17A 1F7UA 2W43A 3KWJA 1CTQA 2ZU6A 1CQPA 3FYTA 5DNWA 3OQBA 1RPNA 2P6MA 2W7TA 5CMLA 1ZG3A 2P27A 4YCDA 1M7BA 1I3LA 2DFTA 3IJPA 4UD2A 1T6ZA 1Y7PA 2VP2A 3O0DA 4B2PA 2H1IA 4P0TA 1SJ9A 1U7DA 3O6VA 3SJUA 4YCCA 1NUTA 2FFBA 3LYLA 2RGWA 4H2DA 4RGBA 1WB5A 3DT8A 1CEYA 1MXHA 2R44A 2ZBGA 2FPNA 2HAEA 4PLVA 2F3RA 3OHMA 2DHCA 3BXOA 4KBFA 1DQZA 1JJAA 2D5CA 1M7HA 5EJ7A 4BNDA 5BPFA 3ZZ0A 1XU9A 2XBUA 5K99A 3JAWB 4XTRA 3PFIA 1P1FA 3C74A 2ZAOA 1ZOIA 5IDYA 3SM9A 1RP1A 3EPRA 1YU6A 4COKA 1EUDB 1A4XA 1IK4A 2MR6A 3F3MA 2C0CA 3L40A 4NYJQ 1WMAA 3F3YA 4GYJA 3W5HA 3O5AA 1AOXA 2I4RA 2WUDA 1FNDA 1WDLA 1CQIB 1UDBA 1CR2A 5BN5A 1I5RA 3P9YA 3LDGA 3PIDA 4AAYA 3BGDA 1DDGA 4KG7A 3IEUA 3K0HA 3ROTA 3NCHA 1KHHA 1A1VA 4RGQA 2YRXA 4DL9A 4I55A 1AZWA 2BEUB 3CIFA 1XHFA 4ND5A 2Q21A 1WSBA 1A76A 2QN6A 4Z7QB 2QMZA 3M4JA 4QDOA 1UBFA 4GNRA 4KUEA 4TXJA 2VYFA 2BI7A 4PC1A 1HYGA 1L7VC 2HA5A 5KQLA 1I6KA 1HV8A 1QIDA 3AKEA 1QU2A 2HQOA 5F33A 1NSFA 1R5JA 2QRHA 4JUDX 4LSZA 1J5PA 2BD0A 4RZUA 3AVXA 1CY1A 2IIQA 2P77A 1K6XA 4PCVA 1WBJB 2YWEA 4QXPA 5BXQC 3H1FA 5ESXA 3EYWA 3HYSA 5CDGA 3M83A 5IAJA 5AD1A 5KYYB 2VTKA 3LGXA 5DHUA 4Q7EA 3UKJA 3B36A 1M2NA 4KXXA 4CMBA 3SR4A 3M6XA 4G0WA 1MO5A 4OJQA 2NSLA 3WGYA 4FD2A 1M34A 4XGNA 5DNEA 1KDVA 2YHIA 3GA0A 3FRJA 3TZHA 4BVJA 5HJ5A 4UEKA 3MRTA 1JW9B 4WGFA 5FADA 1SQ0A 3CZMA 4JT9A 3GRUA 4O2LA 4ZAYA 4B17A 3C6YA 3IILA 3P0JA 4Y2UA 4BRUA 5ELXA 1LJUA 2Q8NA 2VP0A 1L7BA 3O8QA 1Z0FA 1S7GA 5DM70 2Y4OA 3H7AA 3I6BA 1UMBB 2XJ9A 2PL3A 1F6BA 3CJTA 3QU4A 4GPIB 3U0BA 3THYB 2R87A 2EP8A 3RRYA 4EEXA 3SAJA 3V1LA 3LPCA 2C54A 3F7TA 2GAJA 1E7RA 1ZZGA 1PQWA 3ETJA 4KQCA 4LXIA 4BLTA 5K4GA 3ZKWB 1PE0A 2VBCA 4JSRA 2XE8A 4RKRA 5A9SB 1L9KA 4Z4GA 1UQTA 3QVGB 4L27A 3DEYX 4MQ5A 3A1CA 1ESDA 4X3CA 4F6RA 1Z73A 2NG1A 4L6AA 4LSGA 1TQHA 2BZGA 2FPRA 4DG5A 5C37A 1UBSB 2HHHB 4U0KA 2JLWA 3DEIA 1EZ4A 2WIDA 1EWVA 5JZSA 1IG3A 2BHSA 5AW1A 2V7VA 3RRZA 1TT5A 1D2AA 2MYUA 4HS9A 1UZNA 1XYVA 2CB9A 1MIHA 3PE6A 4MGHA 5AUQA 1NN0A 1NVTA 5E1MA 5D85A 2AQ8A 5FTLA 4XUGB 4NVRA 1J22A 4EUHA 1PFGA 1MB4A 5DDIP 2VDWA 3AEKA 5DM2A 4M9ZA 5E4YA 3IVCA 1UP6A 4EHKA 2CFSA 4QBIA 5TVKA 4CLQA 1ISFA 2XIQA 3LUDA 3PA8A 5AVJA 4LC9A 4D3SA 1FP4A 3H5TA 4QM6A 4ASUA 1JG2A 3TIFA 5HWSA 4AYTA 4D6YA 2QTBA 5L3SA 5JLAA 4KRGA 2CF6A 2OG1A 4MW0A 4NPAA 4YY3B 3CSSA 4P4UA 1GKKA 4BFLA 3JSAA 1T24A 3ZKWA 3ITEA 1ND5A 2XVZA 2VJYA 1V6AA 1UDAA 2HJGA 3P96A 2VIIA 2RJ3A 3ROMA 4NCHA 1H05A 4RNDB 4C7JA 1Z6PA 3EFHA 4G0OA 1PZHA 1W94A 5E0KB 2GBPA 4R1MA 2IVZA 5BWOA 1SXJB 3HCFA 4PM4A 1GUYA 3N0WA 4I55F 2QD3A 3L0CA 1QNFA 2Q7OE 3E5NA 1J20A 1DIOB 2Q3JA 4K1XA 4S0ZA 3L7CA 3ZCXA 1V5EA 4XQ0A 3U3OA 1H9CA 4WK6A 4DLTA 2PBLA 5JH7B 3G8YA 1GGJA 2EBWA 1TTQB 1Z4IA 2FN9A 1Z6TA 3I34X 4UTOA 5KU1A 5E8RA 1PQPA 4UDXX 2AOTA 4GVXA 4F04A 3IP9A 1V5GA 2DQKA 3H5RA 1CZKA 4U2KA 1WSAA 4Y6OA 1F0YA 2JCBA 2H9IA 2OAGA 3OT1A 3L0BA 5MF6A 5KYWB 1IM2A 2EJTA 2ZT5A 3P0HA 1NXSA 4LJ7A 5FOUA 1QG2A 2EZ8A 3W6ZA 3IUPA 3ZWNA 4BNTA 1HE1C 2BUBA 2OFPA 4HDOB 3AU9A 3P4YA 4TL9A 4WOBA 5EPOA 3RG8A 4J0JA 4G0XA 1U8CB 4A3SA 3I6MA 3SQLA 2ZANA 3L6DA 2MSKA 2PZ8A 3B1KA 4E5YA 4TN1A 2E85A 3PQ2A 1QB7A 3I3OA 2RHDA 3L0PA 3LLUA 4NCNA 1RQ7A 5CTAA 4EPWA 3L93A 3LDUA 4LSMA 1S8NA 2ZCVA 1AB5A 2ZIUB 3QEJA 4M1WA 1H2BA 2C8KA 1IZ7A 5BW4A 5IT5A 4UVHA 4X0EA 1QAQA 1YAJA 1NQ5A 2GAAA 4FHEA 4J6FA 1DDIA 5CG2A 1BDBA 4PN7A 2PM8A 2RHLA 4GO1A 1GZ7A 2O2DA 2Q41A 1ZM2A 3KD3A 3OSZA 2XMCA 5E4JA 3G9ZA 5EHNA 2IEBA 1JIJA 4ECEA 1NVDA 4C30A 3JAWA 4IGAA 4XVQA 3IBSA 4CF3A 3WV4A 4F3NA 2HBYA 1LZLA 1QH9A 4YC7A 1CLUA 1FNMA 2R8RA 3HR7A 4WK0B 1BFDA 3HRKA 3JASB 3VVCA 5FPKA 3I5YA 1WQ3A 3TI7A 4BYMA 5KYUA 4B3IA 4W63A 4QATA 5DTEA 4C4OA 2IODA 3K73O 4MCIA 1T13A 4GRAA 3QSGA 3EXG2 4KQGA 1D9XA 3ZZMA 3DE0X 4P54A 3WP1B 3IBFA 3OWHA 1C50A 2FMIA 2AMJA 2GN0A 3HNRA 2ZDQA 3ZU4A 3T94A 1IZZA 3OCWA 1ZH4A 4X8HA 1ODSA 3D6UA 3K0SA 1AQIA 2H48A 2Q5FA 3FLAA 2QJTA 4IGIA 1DDOA 1J5EB 5DASA 2CGEA 1MGOA 1SIOA 1E7SA 1SOMA 1T9CA 1XD8A 2QM0A 4YCMA 5FUQA 3PT9A 3JRXA 1ULSA 4AY2A 2JFXA 2PN1A 1NUUA 1IWBB 5IKEA 1DXQA 2ZRGA 2Z95A 3GJRA 4RD3A 1AS3A 3NV7A 5TS2A 1VG9B 2YN4A 3A9CA 3DOHA 1M5UA 4QGGA 5DCLA 5DKFA 4GPEA 1BXRA 2VA9A 5A9SA 3IKTA 4KN6A 3NOQA 3DMTC 4XQEA 4E2ZA 4E51A 3RJ9A 3EW9A 3A31A 3GDHA 6GPBA 4YRNA 3DR3A 3KJEA 4JQZA 3TKLA 4BIIA 1OSNA 4PWYA 2JD1A 2XZPA 1AF7A 1Z6GA 3LU1A 1RHMA 2GD0A 2IC5A 3IFSA 4M46A 2PUGA 1MIOA 3GDGA 1G5IA 2GETA 5ISMA 4ACBA 1ST3A 4IIHA 1CV2A 4WASA 1P0FA 2GASA 1DWOA 4ECAA 5IJ9B 2ZAMA 2A59A 1YUNA 3AP3A 1CUIA 3MMPA 3ZE9A 1NC1A 1CY4A 2E55A 4P2GA 4C0XA 2C4KA 4G1MB 2CHQA 2ZE8A 2PSDA 2JZOA 3G2QA 2XUHA 4NBUA 4P5DA 5B1DA 3FOCA 3LNCA 3BHNA 1LPAB 3A4MA 4A5OA 5ALZA 2HA6A 4ZQGA 2V7GA 3AINA 5EE5B 4G85A 2ODQA 3P2YA 1XX6A 5G1PA 5JH7F 2NSDA 1YT5A 2XE6A 4CM3A 3LT2A 1HH4A 3NAMA 1CQIA 3IIIA 1BDIA 4KPUA 4J07A 2QQ5A 3IEMA 1XTJA 4ZQHA 3LUCA 2DHRA 3W2GA 1W34A 2GQ0A 1TZJA 3O7WA 5DWQA 2PCLA 1BC5A 1R64A 1ZMXA 3JTEA 2I0FA 5DMXA 4OX9Y 1ZU5A 4FYKA 4TV9B 5ALIA 2PKQO 3ZH9B 4AZSA 2A33A 3ZPXA 4EW2A 1IBMB 4PRYA 2HT6A 1JB1A 2ZR8A 3VOTA 5EJ6A 5CVJA 1PX0A 5E9AA 3RFXA 1GNPA 5IAOA 4J49A 1LW6E 1OU0A 4PC7A 3MZ0A 3IWCB 1C4XA 1H6CA 1K7YA 1GDDA 1QHYA 1S5PA 2FUCA 3CT4A 3GFFA 3G2HA 4IJQA 3I9MA 5L3QA 3K1ZA 2OD9A 5BPHA 3BK7A 4CYMA 5REQB 2JGFA 5LZ7A 2GVNA 4NBSA 2VQFB 1QF6A 1OVMA 1RXVA 1RBQA 2EIHA 3CISA 5BNZA 1JALA 3MJRA 3AB7A 4KFUA 1D8AA 1FTGA 2E48A 4C78A 4WV3A 3CC8A 2IHJA 3IHKA 3HXLA 3VVLA 2QJRA 1JIUA 4X93A 2QVBA 5CURA 5DLDA 5JRJA 4EI7A 2OXRA 2G6BA 2OD2A 3OFNA 1QQ6A 5EZ6B 4DABA 4IG4A 3R2JA 3ROKA 3WC4A 1JLHA 3MXTA 3AI3A 2O7RA 4BO5A 3H5NA 3PPVA 3G5LA 2AUMA 4R2HA 3LOPA 1XCMA 1D6SA 5IH3A 3NHUA 2V74B 2AZ4A 2OHGA 4C6TB 4NECA 1B93A 5D8DA 3UTCA 2JFYA 1LV8A 1NF3A 4AZ0A 4MW9A 3A8TA 1DS6A 3VMFA 3A36A 1QQBA 3DVRX 4C7XA 5K6AA 4L57A 4XPZA 4OI2A 3DPSA 4OHRA 2PZFA 5FF9A 3TTXA 3CKLA 2QX6A 3ZXIA 4BV3A 1EP1B 1JFSA 3N2GA 4C3OB 1QQ7A 2QUHA 7ABPA 5EUQB 3PEWA 1IVSA 1CJKC 1YVDA 3FTQA 4ZPXA 1RMYA 1A88A 1T6XA 3A9WA 3C5EA 3DZIA 4NPHA 3JZFA 5A0TA 2FSVA 1TJNA 3O8OA 4X66B 2P2GA 3GD5A 4MMZB 4MVCA 4DBLC 3IQGX 5CA1F 2CW5A 5L8VA 1T2DA 4AY6A 2AA3A 1L8QA 1XP5A 2H65A 4KLZA 2OBXA 1E1QD 4TWZA 3TSYA 3TE7A 3WQSB 1TX4B 3FZGA 4AT1A 1E4EB 3WHLA 4RBNA 5JADA 1QU3A 1MRSA 4Q15A 3E18A 3JR7A 2FOXA 3IEVA 1SUIA 4UOQA 3PJFA 1KSHA 1FA9A 1Z4LA 5T7BA 1CZNA 1Y3CE 2G70A 2GRJA 5F3RA 2WBLC 1ZJZA 1BNCA 3T41A 1K88A 5F5LA 2PWBA 1C9EA 4QAJA 1RLJA 1XFDA 5BVHB 3UMMA 4FGSA 3ONNA 1ZX1A 3D7SA 4PCAA 5KQRA 4PVDA 4CETA 3Q0TA 4HQRA 3OCCA 4MW1A 1N25A 4BNMA 2O3QA 4E7OA 4P32A 2DWQA 1GOTA 2GNAA 2HHJA 5GZ6A 3HVJA 5IJAA 5P21A 3FR7A 3R7BA 4RTMA 3W4KA 2IYFA 3N2GB 1U0GA 2I65A 4KGVA 4KVFA 5K8UA 3VI4B 4L4YA 1RFGE 1Z9BA 2JHFA 1ZNYA 2WMDA 1TE2A 2Y1EA 4FXPA 2NTJA 2HXGA 3AR7A 3DMYA 3EXEA 4WNYA 4B6FA 3Q2OA 4GOND 4ERNA 5CXQA 2ZRBA 1NVWQ 2ZS8A 1PT7A 2GA9A 3CUYA 4BE7B 3KSBC 3TRHA 3K0CC 4C2BA 3FVRA 1MW8X 4EK9A 1JG4A 4HKTA 2RGUA 1TEHA 2VK1A 1ZJYA 3CNQS 2WWXA 2D2VA 1P7YA 1QH8A 4L3OA 2DULA 3B9RA 1UKAA 1T1RA 5L3VA 2XUJA 4WUVA 3MS7A 1OHHD 1YCFA 4CHTA 1IC6A 4YQFA 3E6AA 1YQTA 4GEGA 2FPSA 4F4IA 4F11A 3TUZC 2ID7A 2VDVE 1ZDMA 3D2LA 2CV2A 1SVLA 5MDHA 1JDPA 5M04A 3EP6B 4XDYA 2AFIB 3C87A 3H4IA 5K1ZA 5JS6A 3AHGA 2AUTA 4ISCA 2CVPA 2ZTMA 9GPBA 3A2NA 1SCQA 3IV7A 2J6IA 1PJAA 3O47A 4QUGA 4TZTA 2RGXA 2WSSD 5CNJA 4UHJA 1GUFA 4ZQIA 4A10A 1QOQB 1HQYE 5JOQA 2QEQA 2HXYA 2GK4A 1M73E 2IHNA 3SBEA 1M2VA 2X23A 3MFQA 3DLBA 3SYKA 4EHJA 1B41A 1GEEA 4PZAA 2PZEA 1G0NA 2DH6A 3IR6A 1WNFA 1YSCA 3MMNA 5BSHA 1Z5UA 3DFIA 3NR2A 4Q4HB 4Q9NA 3V8QA 2OVFA 2QUAA 4G25A 3BDVA 2OTCA 5JMOA 3FXAA 3ZHVA 4EVSA 3AQ4A 1JKIA 1DKQA 3E35A 4O2RA 3OZAA 4YRRA 5BOSA 5IDXA 3WWDA 5IVKA 1Y8QA 2BR5A 3MQ4A 3DULA 1BKSB 4CE6A 1C9NA 2ZYDA 1PJLA 3NTRA 1OXSC 4JXKA 4PRZA 5FOQA 1TCAA 3DMDA 4GR9A 4IZHA 4O25A 1BVUA 1EAYA 1ENZA 2M1XA 1R6AA 3K4QA 3PC8C 4L0QA 5E8JA 4IDPA 2VNSA 4IVNA 1QIJA 1ZH8A 2LWIA 4HDSB 1C9KA 4IFBA 4Y0NA 3IESA 3V8RA 4HXFB 3DOCA 3PRHA 4IGFA 3Q0IA 2YC4C 2VRCA 1T9GR 1RQ2A 2GLUA 3DAFA 3K9NA 3FMGA 1E94E 4WKGA 1D8TA 3MRXA 1O95C 4F2DA 4GE0A 4YRGA 3KWFA 3MWEB 1NLZA 3N8NA 3WJ2A 1QGUA 3UMBA 3IEPA 5M5BA 2YJ3A 3T9BA 2VYVA 1GKIA 2HK8A 4R83A 4FDUA 2PZBA 1K75A 3BE4A 1G21A 1JQLB 1E1CB 2G40A 3DKRA 4QL3A 1E5DA 2R5FA 2P2DA 2XUDA 4X1KA 1DAHA 2V97A 2YFKA 4JR1A 1JTVA 3WMRA 4DQXA 2F67A 1M7GA 2G0AA 2H08A 1FMCA 2VRNA 3C5CA 3DL7A 2IU4A 3E53A 4ND8A 3FCSB 4K6CA 4NZZA 4WCFC 4BMZA 3KOOA 4NJEA 5DK4A 3MVEA 5JBQA 2NTEA 2PT6A 1AGXA 2Z43A 1J8QA 3LO8A 2O0MA 4IQFA 4ENSA 2VHWA 3VHRA 3E5HA 4I4LA 1S8OA 2IFTA 5LLDA 2HRCA 3A6KA 3P52A 1T9BA 2DP4E 3OJFA 1A7JA 2Z0MA 3ROFA 1GGFA 3IOYA 2YIDA 2YVKA 1D4ZA 3CONA 3C98A 3EWNA 4FDTA 2OC9A 3INNA 4GHWA 3IIKA 1B74A 4IXTA 4MW6A 1EEXB 1YJXA 3BQMB 4EG1A 1KMHB 1CR1A 4N0MA 3ZYZA 5EZYA 4B4VA 2PSSA 5E6SA 4ZYUA 5JBIA 1XLVA 2OB2A 1W76A 2Z8YM 3EUAA 3TYXA 3L49A 3ULKA 1U98A 2ZXUA 5I9TA 4IDCA 2AGVA 4B0PA 2ZRHA 3NT4A 3ELYA 3HFRA 1WDTA 5LN1A 1JIXA 4CMCA 3A1WA 3R6GA 2OV6A 2P9FA 2OE2A 1MVLA 2DPGA 1RWPA 3C7CB 2Q1YA 5KJEA 1L3IA 5C34B 3TG8A 2YOGA 5DBHX 4DLKA 1ZRHA 2RFLA 1N57A 3DAHA 4IDNA 1I2MA 4F60A 4PHFA 3FOEC 4QRDA 4YP7A 1HDRA 1ZA1A 2PKEA 5IAKA 1FBTA 3WKEA 4MP8A 4BX9A 4HDKA 3LKBA 4DA0A 4PHGA 1C30A 2GARA 1NXTA 4ZIRA 1GNVA 2YS7A 2P9GA 3I2HA 1XZJA 4GKVA 4KYTA 1SKQA 3HA5A 5SYAA 3H42B 5ALLA 4OBEA 3IPLA 2D00A 4PC3A 3ZEIA 3V5NA 3IDSA 1LSJA 1TU3A 5C9ZA 5CYPA 1Y4AE 5AKKA 1XHLA 2VJDA 1Z15A 4RVCA 4PTYA 3ZUPA 4DYDA 1JILA 1CVRA 5KUTA 1AKRA 1V8ZA 5HIKA 2J5RA 3UAVA 1JR3A 1RKXA 1V8BA 3M6AA 3GZNB 4BFZA 4FDVA 4C76A 4F4FA 1FFCA 2ZJ6A 4PBTA 3DXZA 3PDCA 3G13A 5K9ZA 2CL7X 2B4KA 2FZ5A 4DMFA 3PJDA 4GMGA 1JU9A 1NAHA 3OZIA 2B78A 3ERCA 5BW6B 3E03A 1CD5A 2ODTX 3H5OA 2AN4A 3UWOA 2TYSB 1FFEA 4PAGA 3ZI7A 5G41A 1T0IA 4N3NA 4UASA 3VUFA 3AHFA 3VNSA 4FYPA 1N36B 2ONZA 4E15A 2OYRA 1I7SB 2XDQB 4RE6A 4EKGA 1P2BA 1V8FA 4KNWA 4OHPA 1PEKE 1M1NB 3F8WA 2V5AA 5COAA 2ZTHA 5BMVB 2AFHB 2V3CC 1Y1RA 1DRJA 2VYND 1YC5A 1EFPB 3BH0A 2O0HA 3EXIB 1R8XA 3FLBA 5A6SA 5YASA 2VYNA 4OCZA 1E3EA 4MRSA 1OKKA 3SBDA 1QNLA 2LW7A 4ZHQA 1F20A 2V7XA 3EVNA 5ICFA 1CR4A 2B6NA 4XH9B 1VJRA 4HEA1 1LQTA 2BFNA 2NUPB 4NZYA 3NZEA 3KSRA 3RVLA 2QI9F 4QYIB 4GMDA 5AW0A 4QFCA 4HNAA 5AR1A 1DI0A 2FR0A 3GGGA 5K0GA 3HCCA 4LECA 8LDHA 4I3HA 4HXGA 2GD1O 4G5XA 2IYEA 3H5WA 5A04A 3M6VA 2HMUA 4U4AA 5THKA 3H4VA 5JDCC 4A6PA 3VQTA 5EKTA 3SOPA 1N3YA 4JBHA 4HOYA 2IK8A 4UCWA 2YXNA 2J0VA 3CXUA 2R6JA 1UMCA 1RMTA 4P3XA 4ZVUA 4QA9A 3S2UA 1E6CA 4CQJA 4RTPA 1R50A 1OX6A 1NBWB 4JR0A 5D01A 3UHAA 3IT3A 1WXDA 4ODIA 1VDZA 1AU9A 4O0LA 2XMRA 2I99A 2ZULA 3LCMA 3MB5A 2YV1A 5F7ZA 3ZD8A 2CE7A 4GPTA 1L4BA 1OJLA 2NSJA 1SIWA 1CF9A 1F5NA 4NBTA 5F98A 4UTPA 2K2WA 5IJWA 1XLTC 3UFXA 3PUZA 3QHPA 1DC4A 1Q1QA 1LKZA 1TVCA 4TVKA 5A7GA 3KS9A 2JEZA 4RGYA 3REQA 3BTVA 4UD6A 4XM2A 1FIUA 2AS0A 4EF4A 3C45A 4X60A 5AHRA 4S12A 2QYTA 4OQQA 4R40A 1NR7A 2IW3A 4LEIA 5BW8A 3ZWVA 1RBMA 2XMPA 4EHDA 2W2OA 5L51A 3C3AA 4P7GA 1YWGO 3AFOA 3AJ9A 4NMXB 1YE3A 3JALA 3D0KA 4UBIA 3IIJA 1KEEA 1M74A 2O48X 3WR5A 5DHAA 1UM8A 3L4BA 1SBZA 4AYXA 1Q1ZA 4QJBA 5L9AA 1YKGA 1IULA 3OF2A 2VQ6A 1BKDR 4OHOA 3OSUA 1F4VA 4I50B 3SS9X 1M6HA 2K87A 3RAJA 2ONYA 5H0IA 5EE0A 1VGRA 1G7RA 2DFPA 3LH5A 2D59A 1BA3A 2PGOA 4TZ0A 4R41A 1N8TA 3SX0A 1JFFB 4A8TA 2GEDA 1CB0A 5LP6A 3BT7A 1V8DA 1ND6A 3IHLA 4LWQA 4X62B 4JP3A 2P3SA 4LE2A 4GSYA 4DA7A 3WGHA 2E7ZA 4HWKA 5LMCA 2GZDA 4EPTA 3T5TA 3UMYA 5AM3A 1YZUA 2HX1A 2XQJA 3STUA 3VSEA 2XT9A 5TQ2A 2J07A 3VZSA 2OV8A 4KH1A 1R9NA 4NCBA 3TTWA 1JHPA 1L1FA 4QLOA 3OTWA 2B8WA 2VPWA 1UDWA 3OTIA 1GLVA 1X87A 3AM1A 3IWDB 2EEZA 3HGQA 3H9CA 4YJ2F 2QTFA 1NQXA 1K8ZB 4YX9A 4YPFA 2VZ9A 4RKQA 5I4BA 3FSGD 1T9HA 4ZZ1A 3UFBA 3EIEA 4PBRA 1C81A 2XMSA 4Q1DA 3JWEA 3MELA 4WXPA 3WV5A 3EZLA 2WPDD 1D7OA 1J9ZA 1LF0A 1UIMA 2NO7A 3ORSA 3KGDA 1VKZA 4XUDA 4BXOA 1UADA 2H1LA 1CUCA 4KU4A 2NTVA 5EUMA 1MJGM 3K0FA 3NASA 1YJAA 1DKLA 4OQXA 3QBTA 5LNK6 2IKSA 3R8CA 4AK9A 3N8DA 3EOBI 3ND5A 1JBEA 3A3YA 5AW3A 5KS2A 2WTBA 3H2KA 3AZPA 3EVDA 3GR6A 4WY8A 4BGEA 1R4AA 4LJYA 4MKGA 1JIIA 2ORVA 3JD0A 1GPAA 2VJAA 3N53A 3NKLA 4YXFA 5KREA 2JIRA 1AS2A 1KZYC 1VG0B 2Y67A 4N6OA 2B69A 2IXFA 3BMXA 4G8CA 3SNHA 5I9IA 1ZK0A 3VTZA 4PGMA 1JQ3A 3OQIB 3C6BA 3W5IA 2WV7A 3OFSA 4EKIA 2P2ZA 3LV8A 3KHSA 1DCMA 2EYUA 2FPMA 3C6ZA 1FOEB 1PL7A 2PKRA 2Y1XA 1WPQA