4MINA

Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor nad
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
339
structure length
339
Chain Sequence
MVVKVGVIGTGAMGRAHIDRLTNVLTGAEVVAVTDIDHEAAEAAVRDFHLNAKVYPDDTSLLQDPDIDAVFVVSFGGAHEATVLKALDTDKFIFTEKPLATTLEGAKRIVDKELTKSKKVIQVGFMRRYDQGIRALKEKLDTGIIGAPLVVRASHINPNVASNYSNEMAITDTLIHEIDEMHWLLDDEYTSIQITYPRQSAEVRNEGLHDPQLATLTTKKGTVIQVLVHVTAQYGYEVKLEVIGETGELQLPNYGLGPILRSNANQQTAVEMSWINRFIQAYNTEVQEFIDEVAKSEPPVGPSAWDGYIAAITAAAANRSQKDQETVLINVAGTPTFYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of myo-inositol dehydrogenase from Lactobacillus casei with bound cofactor NAD
rcsb
source organism Lactobacillus casei
molecule tags Oxidoreductase
molecule keywords Inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
total genus 114
structure length 339
sequence length 339
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.18: Inositol 2-dehydrogenase.
pdb deposition date 2013-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4minA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4minA01
4G65A 2BF7A 1H2BA 4GI2A 5JY1A 4ZRNA 3ABIA 2D1YA 1F8FA 4CQMB 2BI7A 1SPXA 4L4RA 5DF1A 1KVUA 1K6XA 1UDBA 1PR3A 2SCUA 4FPXA 4B4WA 3DHNA 2XF8A 5C7LO 3H4VA 4CLOB 4GMGA 1XSEA 4U0KA 1PGJA 4HY3A 4AJEA 2DT5A 1GY8A 5KVVA 2ZATA 2UV8A 1FMCA 5TGDA 3WWZA 3JQEA 1B8PA 3RC1A 2XPCA 4RPJA 3MJSA 3ST7A 1EZ4A 5JXWA 2X22A 4E5YA 1T1SA 4OMUA 2GR9A 2VYNA 1Y8RA 1B3BA 1S6YA 3AOGA 3EGOA 1DHTA 1KBZA 4BNGA 3U09A 3P7MA 2WMDA 1LDMA 3EHEA 3F3SA 1NQ5A 2VRCA 5B1YA 1U7TA 3HZZA 4QXMA 4RVDA 3EMKA 1KC3A 4P38A 2PY6A 3E18A 1TT5A 3RWBA 1ZFNA 4WASA 4P4GA 1M67A 2XAAA 3GRKA 2DPGA 3O9ZA 1BXZA 2DUUA 2FY8A 3Q3CA 1V3VA 4HNHA 4MJLA 1I33A 3PTZA 1VL0A 2C7VA 4L0QA 1N7HA 3EDMA 5B12A 5L51A 1GQYA 1XA0A 3AWDA 3JD3A 4HP8A 2H6EA 4MVJF 1GD1O 1C0LA 3FTNA 1ULSA 3D5TA 4DL9A 1O5IA 1S7CA 1KEPA 3CPSA 4CMEA 2A4KA 3VZPA 2VT3A 1LU9A 2RHCA 4Q3NA 2WD8A 1TLTA 1WP4A 1EK5A 3DBRB 5CG1A 1M76A 5TT1A 1Z7EA 5CEJA 4KDFA 1YH3A 1YBAA 4BNIA 3QSGA 1GU7A 4MVJH 4HFMA 3TQHA 3PLRA 5A3VA 2HQ1A 4RDIA 4IQ0A 5H81A 3ZV6A 4RQTA 4XYLA 4ZQEA 2X8LA 4IDDA 5F3RA 1IPEA 3E1KA 1B8UA 4ND5A 5A5EA 1ZXLA 3QWFA 5JC8A 4NIMA 7ADHA 1J5PA 1SMKA 2A94A 2GN4A 1EUDA 1D1SA 4B8WA 1I3NA 1B14A 2PD6A 2XXJA 2NQTA 4CUJA 4KMSA 2B35A 2Q50A 4D7AA 1P1RA 4O1MA 4D3FA 1O9BA 1HKUA 1B16A 1TXGA 3OF2A 1I3MA 2EJVA 3NUGA 3MTGA 1CDOA 5GY7A 2O50A 3C7DB 3G79A 3DL2A 3DHYA 3VH1A 3FNGA 1ZEMA 3H9JA 1YBMA 3PIDA 5FYDA 2ZB3A 1YWGO 1U3WA 1H93A 2D8AA 4DMLA 4YT8A 3JQ9C 1LX6A 1NPTO 3C1TA 3MWDB 4CV0A 3SC6A 3DC2A 2HAEA 2J5KA 3UW3A 3OA2A 1ZK3A 3D7LA 4JP2A 2NTVA 1ZH8A 2HCTA 2GCGA 1K0UA 2NLOA 4QUKA 4NZ9A 3ZU3A 3DZBA 3WGHA 2YYYA 2VUUA 1W6UA 1I2BA 3UVEA 1LSSA 1T2FA 3O26A 2VHWA 1YGYA 3R1IA 3H65A 4JLWA 2VYND 1Z75A 2VNSA 3PJFA 4OXNA 4N5MA 5JCJD 4QX6A 4UVEA 1WLYA 3OICA 4YEDA 1NPDA 4B79A 4D0SA 3GDGA 4A27A 2Z95A 1I01A 3STHA 1E3WB 3G1UA 4NU5A 3TDKA 3GVCA 1T2AA 3K2EA 5C7OO 3HN7A 3AUUA 5KOIA 4CLRA 4I1IA 1WDKA 1VSVA 1K5HA 1ONOA 1ZZEA 4WCFB 1PU2A 3JD2A 4RPGA 5T5QA 4H16A 3LYLA 4M86A 5JMPA 2VZ8A 4W9NA 5DDIP 5IZCA 3DDNA 1ISMA 2GN6A 3DZFA 2Q2QA 3R3JA 1BXKA 3D4PA 2BD0A 2HSDA 2O2SA 3OMLA 1E7RA 2PZMA 3R6DA 5EIOA 2OOSA 2V6GA 3KO8A 4L74A 1NWCA 1JA9A 1GCUA 5TSDA 2PKQP 1ZO8A 5IN4A 5FEUA 1GCOA 3RC2A 3TFQA 3ADPA 2A9FA 3IAHA 4BKQA 4CL3A 4O6VA 3SJUA 3AOEA 3EYWA 5KVQA 3UICA 4WJZA 4PZDA 3PJDA 3RCBA 2EW8A 2X58A 3GDFA 3HDJA 4B3IA 1DEHA 2GZ3A 1GUYA 3HB5X 3M6IA 4I5FA 3S2IA 2O48X 2O3JA 1J49A 3O8QB 4YJGA 1Q7BA 2HDHA 3GAFA 3SLKA 1KETA 4EJ0A 1UXGA 1PTJA 1TI7A 3EK2A 3F4BA 1SC6A 1EVIA 2D59A 4XDZA 3DHEA 1HETA 1UXKA 2J6IA 4YVFA 3GZ4A 3JD1A 4BGEA 2VWGA 1E92A 5AXDA 2FMUA 2IRWA 4WLUA 4MVJE 2Y05A 4CM8B 2WEKA 3PHLA 1PQUA 1PZFA 1IE3A 4PFJA 4DGSA 3FCOA 1RM5A 5JAZA 3NTRA 2FZEA 4LW8A 4HWKA 2XXBA 1R0KA 5TJ9A 3QV1A 3PHJA 1CRWG 3OIFA 4QSMA 2B4TO 1LEHA 2NU6A 2Y68A 3FD8A 2I9PA 3HDHA 4K28A 3NEPX 3RUEA 5JNLA 2VZ0A 4XQ9A 5DZSA 5ENDA 4Y9DA 2F1KA 3ROQA 1YL5A 4LCEA 2VRBA 4MVJP 4GL4A 5BQFA 1LRJA 3VDRA 1DC4A 3MJ4A 4JGBA 3BXXA 3JV7A 4QQRA 4TZKA 5JCJA 4QTZA 5HS4A 3JQBC 2Y93A 4G5HA 1DRUA 1NFRA 4OXKA 4E12A 1N5DA 4ZICA 5JLAA 4XRRA 3RC7A 3AFMA 3ZN2A 1MUUA 3D4NA 1A9ZA 3F46A 1LDNA 1P31A 5JYFA 3QLJA 4GSLA 2Q1UA 4L4XA 1LXCA 5IZ4A 5L7YA 1NVMB 4FC6A 2B69A 2YHIA 4E2WA 4HXYA 3L0DA 1A7AA 2HRBA 3QWBA 2PGDA 2ZTVA 3T7CA 3FN4A 3OBBA 1F14A 3LZ6A 3RBZA 3RKRA 3TZQA 2Q22A 1I30A 1JN0A 1LSUA 3D0OA 2IEBA 2IXAA 1K6IA 3ZWNA 3H9GA 4MPDA 4B4UA 1IL0A 1M6WA 3KTDA 3I9NA 3PQEA 3I83A 3MJVA 1N8KA 4KWIA 3VOSA 4A03A 3WBFA 2J3JA 5CP8A 1E3IA 5TRTA 3KUXA 2GD1O 1LRKA 4AJLA 4I8XA 5G0SA 3E9MA 3M2TA 2YFQA 4A0SA 1EDOA 3TL2A 4YA6A 3UFXA 2H63A 3JQFC 1NM5A 3RIHA 3VVBA 1ADFA 3H7AA 3TF5A 3EZLA 2PFGA 4AJ1A 1Z6ZA 2BMAA 4BQPA 2ILTA 2R2GA 3OJFA 5IDYA 1E7QA 2HU2A 4UEOA 1JVSA 4XJSA 3PDJA 4WGGA 4NR0A 4FFLA 3JQCA 4DLAA 1QYVA 4U8GA 4BKOA 4LISA 5JDIA 4UEKA 3T4EA 1FDSA 2BLLA 4J91A 1J0XO 4RVUA 2ZCVA 3WLFA 1PL7A 4J3FA 2RCYA 3TWOA 4Q3EA 1ZEJA 3M1LA 4ROSA 4IZIA 5IZCC 1HSOA 4YT2A 1VM6A 5JMWA 1A7KA 2Q4BA 2X6TA 4NJOA 5JCXA 2BFPA 1LBEA 3KEQA 2DBZA 3U62A 3COSA 4AL4A 1L7DA 2UAGA 1B8VA 1ZSNA 4OHUA 2VOEA 3OEYA 1D3AA 4NHEA 3RASA 4PRKA 4MIYA 4M1QA 1Q7GA 5KNLA 3PP8A 3JYLA 5MDHA 3W4JA 4UUPA 3GAZA 3RFVA 4NI5A 5KCZA 1H0KA 1SOWA 4PGFA 4NH4A 3U49A 2RH8A 5L4LA 1KVRA 2BHLA 2O3UA 3H5AA 1OZAA 2X86A 3KSUA 3FBTA 3W6UA 1IHYA 3DB2A 1UAYA 4IINA 4U0JA 4DREA 2P9CA 4CM1A 4DIOA 5DOZA 1KYQA 3NDJA 1AUPA 3JTMA 3U0BA 1PGPA 3GZNB 3F47A 6LDHA 5LCXA 3H9UA 2IE0A 3AY3A 2HK8A 1IPFA 1P0CA 2NU7A 1GDHA 4NBVA 5G4KA 2G0TA 4FJ1A 4KWHA 4TROA 1O0SA 1A72A 5EERA 1I36A 1XG5A 2YHIB 1T1RA 3VTFA 4MO2A 2VQ3A 4ZGWA 3L6DA 3LQFA 1XDWA 3HDQA 4KQWA 5B4UA 3OETA 4CQMA 4FC7A 1DB3A 2FSSA 3INRA 4NDNE 4CMAA 3F9IA 4JX8A 3QVTA 3LVFO 3N7UA 1O94A 3WGZA 2NUAA 1CEQA 1VL6A 3ROMA 4II2A 1BXGA 5TIIA 4CM4B 3E9QA 3RUIA 1YOVB 4BNLA 4NJMB 2C07A 3LU1A 5I7SA 5KWEA 1Z7BA 1LTHR 5BNTA 1GAEO 3RKUA 2DM6A 3IJPA 4XQEA 2QZZA 3IIEA 3WX0A 4N18A 2DTEA 3HSKA 3ETGA 1DRVA 4FJ0A 1DC6A 1NBOA 4LCJA 3PGXA 4IBOA 4Z3DA 1U3TA 4CM5A 2NQ8A 4ALKA 1NAIA 5B4VA 5L4NA 5A9SB 1DSSG 1O6ZA 3OSUA 1SZJG 4R1NA 1ZK0A 2H1SA 3WGOA 1PIWA 5L45A 4PZEA 5K0ZA 3DONA 3I6QA 5COAA 3BMOA 3ZNPA 1R12A 1QV6A 1T4BA 1QYXA 1YRLA 1HRDA 1DDOA 1LI4A 1H6BA 4XIJA 2XOXA 3OQ6A 3PYLA 4LRSB 4YCAA 4B3HA 3PYXA 3GVIA 4DQXA 5I8ZA 3G0OA 3CIFA 4YRDA 1AGNA 4UVIA 4LGVA 4QECA 4RZIA 4YJDA 4AFNA 1N7GA 2EGGA 3A06A 2PNFA 3RU7A 3BHMA 2EW2A 5COQA 4TWRA 4OAQA 4CMCA 1HE2A 3ADOA 5DBIA 3JQ7B 2JCVA 5L53A 1RM4A 1N1GA 1AHHA 5A04A 2DFDA 3ICCA 3DZHA 4D46A 3K9QO 4KQXA 1O89A 3AU8A 4GBJA 4J0FA 1YKFA 3DAFA 1EBUA 4JBHA 4EDFA 4QFCA 2YFHA 4YAJA 4CMIB 1WPQA 3GC6A 1SNYA 1UR5A 3U3XA 1P77A 3EW7A 3X2FA 5C3MA 4RL6A 3GNTA 1IZ0A 1XELA 5CAEA 1NVTA 1YL7A 1AE1A 1YQXA 4ND3A 5ICSA 3HFSA 5DNAA 5HBRA 3JQGA 3TL3A 4W82A 3FSRA 4MOWA 2A35A 3LLVA 1U4SA 3T7EA 1NXQA 3PXXA 1L7EA 3SXPA 3KYCB 4BNKA 3CTMA 4C7JA 3SLGA 4PCVA 5DCWA 2CFCA 2C20A 1XEAA 1KIFA 4PIVA 1H6DA 3MCVA 5EESA 1BW9B 4EEZA 1E1KA 3GHYA 4NG5A 1MFPA 3T4XA 2C2XA 3JQBA 2CSUA 4CJXA 2DAPA 4Z0HO 4XYEA 3HWRA 4ZVVA 3TN7A 1NQAO 3HJAA 4RF5A 4ZJUA 2CMDA 2Y0EA 1I3LA 1KVSA 1FF9A 3RUCA 1WZEA 3CZRA 4Y67A 3AFNA 4AVYA 3N58A 3I9MA 4RPLA 3C85A 1XR3A 4MIOA 4D41A 4F6LA 3JQDA 4Q3AA 5I9MA 4B4VA 3MOIA 1PGQA 2AEFA 5IG2A 3KM0A 1B0AA 4Y8VA 1EK6A 1R66A 4OH1A 3IS3A 1WAMA 3MJEA 2JJYA 3DAGA 4FN4A 5EN4A 1H6CA 1CETA 4IJUA 1CQIA 2W2KB 4UAGA 4YTEA 2H9IA 2JHFA 3F6YA 3GG2A 4CV3A 2B83A 1PEDA 2E37A 4DRYA 4MDHA 2HJSA 3GZNA 2I99A 4W4TA 5HRUA 4K6FA 4D45A 3GGPA 1H9BA 1GUZA 4JXKA 1Y8QA 1NNUA 1GFSA 2UUOA 1LJ8A 4GMFA 1HSZA 2CUKA 3OIDA 2NU8A 4BO0A 1XLTA 2AE1A 4LSWA 4R51A 4XZ3A 1ENOA 3EY4A 2I6TA 3QJ5A 3H2ZA 5T73A 1TT5B 4H15A 4HFRA 3DBLB 1E7YA 1MC5A 4WLEA 1C1DB 4CLHA 5CDGA 4IDEA 5KIAA 1TT7A 2IZ0A 2OO5A 3PGJA 1QG6A 2E82A 3L9XA 1ZMOA 4GKBA 1QSGA 1AXEA 5TT0A 1IHXA 2E4AA 3IJRA 4DC1A 3JQAA 4D43A 4UVDA 5FF9A 2W2LA 1RWBA 5J9GA 1Y9EA 3HADA 1XKQA 4FW8A 4PVCA 5HWSA 2BELA 3I23A 4XR4A 4XQGA 3G17A 2DVMA 5JYEA 3KYDA 1XYGA 1QLJA 1VE9A 4PLGA 1MA0A 3OFSA 4AJOA 4OIMA 4R4JA 4I9NA 5K9ZA 4JNKA 1UP7A 4P4LA 1V8BA 1C1DA 4Z6KA 1T24A 4CLDA 5CHEA 4F6CA 4EUHA 3DOOA 4W7HA 2CY0A 1XGKA 4IDFA 3OP4A 2I65A 1R37A 3EUWA 5BR7A 3WSWA 3JQ9A 1HYHA 1YJQA 4I5DA 4KTTE 3V8BA 1JVBA 4LVUA 1NTOA 4LRTB 2Q4EA 1OAAA 2FRDA 5C7IO 4CM9D 1HTBA 3OJEA 1VJTA 3WJ7A 3ICPA 1XIVA 3JD0A 4RF4A 2WD7B 1LC3A 3WFIA 3ITKA 2GF2A 4E5PA 1E0DA 4EEXA 1E5LA 2JD0A 4CR8A 1E3JA 1UAGA 5COBA 5TF4A 1E6UA 4QEDA 3P2YA 4JROA 4Q39A 1P1KA 1UDAA 2Y1EA 4J43A 1PWZA 3EVTA 3L9WA 1YQGA 4BL5A 3C8MA 9LDBA 3HUDA 2DLDA 4I9UA 2OUIA 1QLHA 4R16A 3W8FA 2NTNA 1YE3A 1YB4A 4LMPA 2Q1TA 1DC3A 2IYPA 1H9AA 4GLOA 5IAAA 1GADO 3E82A 1UXHA 1FJHA 4M54A 3WNQA 4ESOA 4RV9A 1U5AA 2PKRA 4H7PA 4DLLA 5KJCA 3QVWA 4R5MA 1ML3A 2NM0A 1P45A 2HLPA 4EUFA 1ZBQA 2R00C 2GNAA 2JCYA 4N54A 1DXYA 4A10A 2PZKA 4ITUA 1ENZA 1BG6A 3PQFA 3LC1O 3BMCA 1EVYA 3C1OA 1DHRA 3EAGA 3GFBA 1DIGA 1UZNA 9LDTA 4CMBA 4AG3A 6ADHA 5KVSA 2FR8A 1P1FA 2OFPA 4UUNA 3QWAA 2CNBA 2PWZA 1VKOA 3JQAD 3RBVA 1I2CA 4LMRA 4ND2A 3M1AA 2DUWA 3NX4A 2Q1SA 4WCDA 3OA0A 1H2HA 1Q7CA 3FR8A 2ZQYA 3NT4A 3PIIA 4CM9A 4UEJA 5B37A 1HWYA 3KEOA 1YO6A 3A9WA 3KLPX 3WIDA 2Y1DA 3ZWPA 4UULA 3VKVA 1HDOA 3TJRA 3KLMX 3QY9A 2EKQA 3KZVA 2YV2A 4L73A 5DOVA 4BO1A 4CPDA 3ZWVA 4PN3A 1ZK4A 3D64A 3WWYA 1FK8A 5CDTA 4IS3A 3W4KA 4MP3A 3VH3A 3RC9A 4AJHA 3DTYA 1I10A 2DPHA 2Q46A 4ALMA 3ULKA 3V1YA 5K6AC 1Q2XA 1ONPA 2H5LA 4PG4A 2OORA 1YB1A 2GYYA 2AEJA 2DTDA 3L4BC 3PHIA 3GVHA 2Q2VA 4FJ2A 2ZJ1A 2DBVO 2WE8A 2OXIA 1I5RA 3DBLA 2OBYA 5L7WA 3S2EA 5KKCA 4TSKA 1G1AA 3AJRA 4Y98A 4WLVA 1MG0A 4C7KA 2WJPA 2ZYGA 4FCCA 3U4CA 3IKTA 5EINA 2PZJA 1YXMA 4J16A 1NX6A 3GFGA 5I7VA 2HO5A 2CDCA 2ZTUA 1YB5A 4BO6A 4BNHA 4N5LA 3JQ7A 3UUWA 4RORA 1NFQA 2YW9A 3I4FA 4XGKA 3MTJA 1OC2A 1ZK1A 2IEDA 4DPMA 4AJJA 1BDBA 3INTA 2P4QA 3AUTA 3ZWAA 3D1LA 1MV8A 3B1FA 3DZIA 4XDYA 4OSOA 3G3EA 2DC1A 4CLEA 3CSDA 4CQMD 2WD7A 4S3MA 1QYCA 4XA8A 1Y6JA 1PX0A 3F5QA 3FI9A 5L95A 1KEWA 5AVOA 2VUTA 1UZMA 4FGWA 4R3NA 1U7HA 1KY5A 1PJQA 1CIVA 3Q2IA 2EERA 2QRJA 2Y0CA 3QVXA 1PJBA 3DMYA 3NGXA 4PLFA 2CVOA 3DQPA 5EQDA 5CDYA 1U2GA 4GSKA 1PR9A 2PV7A 4FGSA 1BMDA 4GPD1 1GQ2A 4OYRA 4YRBA 4EI2A 4GX5A 4Y6PA 1WMBA 2EKPA 3ZHBA 3HHPA 2J3KA 2DKNA 4RDHA 4XCVA 4MVJA 3JQ6A 1DJNA 3A1NA 5F1KA 4YRAA 4II3A 1ISFA 2BFMA 3F4LA 3ANMA 4NU6A 4OKIA 4YB8A 3S2FA 4BVAA 2ZYAA 3GA0A 4DIFA 3VHRA 1DIRA 4QO8A 2AG8A 3IQDB 3AW9A 3ENNA 4NBWA 4XYBA 3KETA 3FBGA 3RVDA 1BVUA 3BMNB 3V2HA 4IY1A 1VSUA 3FTPA 4M87A 4LVCA 3ANLA 2B5WA 1HF3A 3IUSA 4CMEC 5B4TA 1LLCA 2J5RA 4DPKA 3WGYA 2W8ZA 3H6KA 2BI8A 3HB4X 3V1TC 5GMOA 3U4IA 1T4DA 5T6BA 3CZMA 2J3HA 1MP0A 2HKIA 1V0JA 3I5MA 3IOYA 4YBZA 5HM8A 2ZTMA 4KP7A 2GDZA 4D42A 2VUSA 5JYAA 3DMTC 1U28A 5T67A 2W2KA 3I4CA 4I9HA 4GQAA 1RPNA 4EYEA 3GH3A 2OL4A 1DIBA 2CZCA 3FPCA 4W6ZA 3IC5A 1DPGA 1K2WA 2G76A 5T57A 1SB8A 2FP4A 3FNFA 3JQ8A 4IZHA 5DN9A 3NTQA 2E48A 4ZQBA 5A9TA 3OECA 4J90A 2RHRA 1E3SA 1IY8A 1HZZA 3AK4A 1I8TA 3AI1A 5IDXA 4Q3BA 3GNQA 3V1UA 2GZ2A 3HQ4O 3FNEA 5JE8A 4TZTA 1NQTA 2EIHA 1E6WA 4BMNA 1NWHA 4K9DA 2Y0DA 3WLEA 3ZU2A 2HK7A 1ZCJA 3ITDA 1LQUA 4IXWA 1M2WA 1LLDA 3GGOA 2PLAA 2QW8A 5CFZA 1RM3A 2PKQO 2O4CA 1EQ2A 1MX3A 2EJWA 1P1JA 4OOEA 1GZ6A 4Q3CA 4RQUA 4R41A 1U3VA 3QE3A 4PLCA 1KERA 3K31A 3EC7A 5ES3A 3KYCA 3WQQA 3ZV5A 1GEEA 4B7CA 4K1LA 1U2DA 1SO8A 5G4LA 4K26A 4OL9A 3OH8A 1TVEA 1VC2A 1PJ3A 2EV9A 3WTCA 2O7SA 4YJHB 1JDJA 1HT0A 2RH4A 2Y66A 3JYOA 4HNGA 1E5QA 2UUPA 4NFSA 4J4HA 3PWZA 5A4DA 4LN1A 5FI5A 1EE2A 1VLLA 4PLHA 1D4FA 2GSDA 4PLYA 1F06A 4FD3A 4ZQHA 4BNNA 1J6UA 2WYVA 2EP5A 3I9OA 4FOOA 1DAOA 2Q2WA 2VCYA 3OQ1A 3S2GA 5F21A 4PG7A 3DZKA 3RD5A 2GPTA 3AOEC 2VHZA 3WOHA 4RVGA 2DTXA 4GVXA 2GASA 3LF2A 3RJ5A 1VJ1A 4MP6A 2WYWA 3PWSA 2W4QA 1EBFA 2WDZA 2VHXA 1UDCA 4NMHA 1R4NB 3RUHA 4CQLB 3KOUA 4RLSA 3PYMA 4AJIA 1NASA 3BTVA 1BXGB 4YACA 4EJMA 1YOVA 2OBNA 2C59A 2W2LD 5DULA 4W7IA 2CDAA 3Q9UA 4YPOA 3QA9A 2D5CA 1DJQA 3CMMA 4YT5A 2NV6A 3QW2A 4E0BA 1LDYA 1X15A 3K96A 3B1KA 1R15A 1JTVA 4D0RA 3RFTA 1YJ8A 1P1IA 1HYEA 2P91A 1PJTA 1N9GB 4S1VA 5DT9A 1X0VA 3GOHA 3ZGYA 1PGOA 1RKXA 4W99A 4MKXA 4YQYA 5BSEA 5MGBA 1ISJA 4R1SA 3X2EA 2W90A 1CERA 3LF1A 2YHUA 1GV0A 4J9UE 4BB6A 2X23A 3ZHXA 1CF2O 2VWQA 2IZ1A 4TRNA 2R00A 4XX0A 5HTOA 1JKJA 1ISHA 4KUHA 3JQAB 3VPFA 2QRLA 3L6EA 4E4YA 1X1TA 3CMCO 3LDHA 3P5SA 4XRGA 1C1XA 3TSCA 3Q9NA 3JD4A 1BRMA 1JQBA 3SJ7A 4HV4A 1E77A 2X9VA 3LC2O 1W4ZA 2YQ5A 3OIGA 3H5NA 2NTJA 3QVOA 4PLZA 4RVHA 3LLSA 3B70A 2FZWA 1Z74A 2QRKA 4XGIA 2G5CA 2D3TA 3GHHA 1WVGA 3LT4A 1EDZA 1F8GA 3NKLA 4BNUA 4PG6A 4NK5A 5A5FA 3W6ZA 5FFFA 4DYVA 3VZRA 5IJZA 4IDCA 4CMJA 3ETDA 1C0PA 4J1SA 3TOXA 2LDXA 4HFJA 2Q99A 2DFVA 1DC5A 3ZNQA 4BB5A 4BO8A 1HDRA 3ANNA 3DBHA 3PRJA 3ZWXA 1BHSA 3DAPA 3K73O 3GR6A 4WOKA 3WYEA 5ITVA 4BKPA 5GZ1A 4R69A 5JSFA 3F5SA 3IMFA 4RPHA 4CLRB 3KRTA 4YXFA 1YL6A 4WCFA 4JN6B 1JAXA 3UGKA 3UN1A 4ILKA 3MJCA 3SC4A 1QV7A 5CDUA 5I8WA 3VAZA 3O8QA 4R9RA 1PJ2A 3BMQB 5ITWA 1A4IA 3BZUA 4GVLA 3NAQA 1P74A 1EFLA 1WDMA 4GLLA 1IUKA 4TRRA 1U9JA 3CEAA 2C82A 3KB6A 1L1FA 2O7QA 2AG5A 4BOYA 5M6DA 3F1LA 2JD1A 2W98A 1B3RA 3AY6A 3O4RA 1KY4A 2NADA 1D8AA 4N5NA 4OQZA 3GDOA 1NVGA 4OSPA 2HMWA 3TZHA 4L76A 3TFOA 2AMFA 4BS9A 5ADHA 1DFIA 4OKNA 5I9LA 1F0YA 2QYSA 1TEHA 4P8RA 1U1IA 1ONNA 2Y67A 1A5ZA 4YT4A 5A3JA 2X4GA 4YQZA 2BKAA 2CF6A 5JYDA 3H5RA 4E33A 3WGQA 2HMTA 1ZUD1 3UH1A 2VN8A 2JHGA 2VOJA 4RVSA 1SEVA 3JYPA 3ZV3A 1VKNA 1PWXA 3K2BA 1T2DA 4FFRA 1C3VA 2AQHA 4GGPA 3ASUA 1U4OA 4XB1A 5JDIC 1LSOA 5JW6A 1K6JA 3KSDO 2B4QA 2DQ4A 2FPGA 3PVZA 4BO2A 4CM7A 1V3TA 2HMVA 3R0IA 5THQA 1X0XA 4XYMA 4BKRA 1MG5A 1C14A 7MDHA 2BH9A 4DA9A 1PS0A 1GYRA 5LC1A 1BVRA 1P1HA 3PEFA 3WMXA 4NQZA 4OJNA 3DZJA 4NPCA 4RLHA 1CQJA 2JD2A 1KOLA 4E6PA 1ZJZA 4AJPA 2D2IA 1R4MB 3BYZA 3KBOA 4KOAA 2ZB4A 3AY7A 4D44A 2PH5A 1T2EA 2HMSA 4M55A 4OM8A 4NJMA 3UCFA 5I9NA 3I3OA 1QMGA 4EJ6A 1JLLA 2NVBA 4QT0A 5G0TA 1YQDA 4YAEA 5TX7A 2JKVA 3VPHA 1P3DA 1R0LA 2HMUA 3A14A 3KHUA 4A73A 1HDGO 4IXTA 4WUVA 3DO5A 5A9SA 1X7HA 4R5HA 4IMRA 3E03A 4WK6A 5C5IA 3K30A 2QX7A 1SBYA 1KVQA 3L4SO 5TQVA 4E2ZA 4TRJA 5L40A 3VDQA 3BIOA 2HJRA 3VPGA 3DMTA 5KVCA 5DP1A 3WS7A 4C4OA 4AICA 2EP7A 1ADBA 1SOVA 2BFAA 4RF2A 2PH3A 4ND4A 4CODB 1G0NA 2GRAA 4R01A 4BMSA 3WB9A 1XU7A 1Z82A 5JO9A 3TZKA 3KXDA 1YDWA 2FPIA 3ZDFA 1ZKMA 1GPJA 5A9RA 1C1XB 5HA5A 3ZWOA 3UAGA 5C37A 4DC0A 1SB9A 3VVCA 1DRWA 3O03A 3BMQA 4IGEA 4KUEA 4JBGA 5KJ1A 4HUJA 1HDXA 3CE6A 3RUFA 4Q3DA 4XIYA 4RGBA 2J5QA 4NFHA 3QQPA 1QXSA 2C5EA 1ADCA 1T25A 4CUKA 1HDZA 5CDSA 1Y8RB 2VTEA 1QR6A 1P33A 3I9KA 3WICA 3ASVA 4B8ZA 4NBTA 3L6OO 2NNLD 1IOLA 3N74A 4JQCA 2Q3EA 3WNVA 2X5JO 4IQGA 4J9VA 1YONA 3PZRA 1DLJA 4GKVA 2PGJA 1JW9B 2E6UX 5L3ZA 4YDRA 3HN2A 4UUOA 3RSHA 1B15A 5HS6A 4O0LA 1Z73A 1ZSYA 3LT1A 4CM8A 3PZBA 4DMMA 4J6FA 2Y1CA 4IQ8A 1K3TA 4IIVA 2I76A 4F46A 3TOZA 1P9LA 5JO0A 3OJOA 3GY0A 1IULA 4J1NA 4A5OA 4MVJM 3VH4A 2J3IA 1EQUA 2HRZA 4Z9YA 5GZ6A 3GF4A 1FDTA 3MJTA 1MFZA 2AEMA 3H9QA 1EEHA 1Q0HA 4M49A 1EVZA 1AXGA 4PRLA 3UKOA 3BTOA 3QIVA 4Z0TA 1HE5A 3DEYX 5DCYA 5F5LA 2QQ5A 4NBRA 2PTGA 4J7UA 4DQVA 1DBVO 2NU9A 1PJSA 3ENKA 1XCBA 2GN9A 1NFFA 2JCXA 2X0RA 4L75A 4DBZA 5L4SA 4PLWA 3HFGA 5EMHA 1E7MA 2B4RO 4KZPA 5ILGA 4J0EA 1H94A 1VI2A 1Y7TA 1PS9A 1V3UA 5ER6A 1N2SA 4BNWA 3UCXA 5EPOA 1Y9AA 4JCOA 4URFA 1C0IA 4XYGA 5TNXA 1FDUA 1HDYA 3GMDA 4CLOA 3RUDA 4CM4A 1B7GO 4KUGA 4ZRMA 3NJ4A 3ZHZA 3FWZA 4J7XA 5K6AA 2EF1A 1M75A 3VKUA 3ONDA 1PQPA 1V6AA 5TJHA 1PGNA 4DTIA 1GYPA 2Z1NA 3WYBA 4UVGA 4BKUA 3BAZA 3DFUA 3FHLA 1E6EA 3QVSA 2Q45A 4HFNA 1UXIA 1SCUA 4J4BA 3GT0A 3V2GA 2PA3A 3GUYA 3E8XA 1E1NA 3BHJA 2WM3A 3GQVA 5IFLA 4JJFA 2EHDA 4BNYA 4Y6SA 5KTKA 3IP1A 3PI7A 1NHGA 4WEQA 3OQBA 4EBFA 2O3TA 1TA4A 3D4OA 3UF0A 3ZW9A 3LSYA 4ALLA 1D1TA 3TZ6A 2YDXA 4DBVO 1E3WA 1Q0LA 2UVDA 3HNPA 5GZ3A 1UUFA 2V65A 2JAPA 4OO3A 3EZYA 3RFXA 1DFHA 1YDEA 3ZU4A 4BNZA 4YAKA 4BGIA 2J8ZA 3KYDB 3ORFA 2POQX 1U8XX 2VWPA 3DBRA 3FF4A 4DVJA 1KC1A 1SAYA 3Q2KA 3QWHA 3NTOA 3D5QA 2PZLA 3NGLA 1RYDA 3IP3A 2UYYA 3ZI0A 3SBOA 5IF3A 1RYEA 1HLPA 2G1UA 4PVDA 3BA1A 2VRCD 2X9NA 3ROPA 4HADA 5G0UA 5A05A 2O2YA 3L07A 4QO7A 3KV3O 1V35A 4TRMA 2IODA 1GL3A 4BGVA 1HE4A 1DIAA 4DWVA 3A28A 1LA2A 4INAA 2QYTA 4BO4A 3SX2A 1G6KA 4XEHA 4IDGA 5AXBA 4UREA 1E3LA 2NACA 2ZIZA 2EXXA 2R6JA 4H3VA 1D7OA 5KKAA 2B5VA 5A06A 1YVEI 5JAIA 1QORA 1YBVA 1UP4A 3DR3A 1N1EA 4FFNA 3ZWCA 1ARZA 4IIUA 3S1LA 3PJGA 1ENYA 4J49A 2G17A 4XD2A 4BNFA 3S55A 3K8ZA 2RAFA 3NDRA 1K89A 2O3RA 4BGUA 1F12A 1BW9A 5G2OA 1NR7A 1N92A 3ZCXA 1H6AA 1UP6A 3L77A 1W8DA 4NNJA 3WYCA 1ISGA 1PL6A 4DYDA 3BMCB 2I3AA 4DQUA 1OMOA 2IYOA 1O8CA 3NV9A 4HX5A 3CH6A 3WMWA 4CUZA 2F00A 2I67A 3ZU5A 3JYNA 3RI3A 5BT9A 2IXBA 1E3EA 3WIEA 5JDCC 3E48A 1I3KA 5CEEA 3WGGA 2Z5LA 2AE2A 3FPLA 4J1TA 4EUEA 8ADHA 1WZIA 2V6MA 4CR6A 4YWJA 1DFGA 2EWMA 3GG9A 2YJZA 3DFZA 2PD3A 3ZH2A 1ZMTA 1GV1A 2WYUA 3IUPA 3PK0A 5KJ6A 4MVJD 4IMPA 2V6BA 1I32A 3WJAA 1IYZA 3E5RA 3GNSA 3AU9A 2X5KO 1JWAB 5F1OA 4B4OA 4WLOA 2I5PO 1OI7A 2O23A 3RAJA 1X7GA 3QHAA 2V6FA 2IDZA 1E1MA 5BSGA 4HBGA 3BTUA 2YZ7A 4ZQFA 4RZHA 4WLFA 3OEWA 4U6QA 3JQ8B 1WMAA 1CYDA 1JWBB 3ETEA 1UH5A 4LK3A 4W9NC 1MXFA 3B6ZA 3F1KA 4XR9A 4XWYA 3Q6IA 3QRWA 5G4KB 2AQKA 2BGLA 5A02A 4FS3A 4I08A 3ON5A 1P44A 3GUCA 4WKGA 3H3FA 5JDCA 4J2OA 2YDYA 1HYGA 1ZK2A 1GTMA 4R1TA 5U9CA 4P22A 3KVOA 2O3QA 1RJWA 3JQFA 2BGKA 3RQSA 1PL8A 4AJNA 1NR1A 3CUKA 5AOVA 3VPXA 4IJVA 2X0IA 2FHSA 3BMOB 3JYQA 4GX2A 5THKA 3H9EO 2VWHA 3I52A 3UOGA 3ZHYA 2V7PA 5DP2A 1LDGA 2C29D 2GUGA 3FNHA 4M89A 5JAMA 1B2LA 4J7CA 1PJLA 1QYWA 4WEOA 1XQ6A 2TMGA 2RBEA 5ICMA 2D5AA 5LDGA 3VZQA 4AJ2A 5J23A 1NP3A 1GZ3A 3UCEA 1VJ0A 4E2YA 2FR0A 5JPIA 5KJFA 4YAGA 3PHGA 1MB4A 1R16A 3V2UA 4YAIA 2P9GA 2X1HA 1FDVA 3WQRA 4EZBA 3QP9A 4WLNA 2ZCUA 1YS4A 4KTVE 3D3WA 3GVXA 4BV8A 2WSBA 1DOHA 1I0ZA 3A4VA 1M6HA 4ALIA 4ZU3A 1EE9A 5A1TA 1XHLA 2CVZA 3B20A 1PZEA 4B7UA 2P4HX 4CR7A 4FQ8A 3CKYA 4E21A 5I7FA 4FFOA 2DU8A 2QG4A 1EVJA 4GWGA 4RPKA 2C54A 1NHWA 1PZHA 3GPIA 3LK7A 2JFGA 5KJEA 4F3YA 3PFWO 1X7DA 4FFMA 4AJ4A 4CQLA 3PJEA 4RJTA 2GN8A 2UDPA 3L4BA 3JCZA 3LC7O 1I24A 1Q0QA 4PLVA 1XWFA 4EITA 3PQDA 2NSDA 1OBFO 5F1PA 3LT0A 3C7CB 5AYVA 5IDWA 3OHSX 1ZVMA 3K92A 4YJGB 4IDBA 3MWEB 4OOFA 3ZW8A 5BNFA 1ZNQO 4DUPA 3OJ0A 3WDSA 5BSHA 4A26A 5IDQA 4A2CA 4GWKA 1N9GA 1X13A 4IPTA 1DAPA 1JKFA 4GAEA 1W73A 3WG9A 3GEMA 1ULUA 4CMKA 1LC0A 3VPSA 3U5TA 3VH2A 4I5EA 5FI3A 4JBIA 3Q1LA 3UXYA 4X54A 1WDLA 4XJTA 3AI2A 4FDAA 2Y99A 3KSZO 3U4DA 3PPIA 3SVTA 3AI3A 1NYTA 2PD4A 1E1LA 1Q1NA 3FRJA 2C5AA 2ZQZA 3GEDA 4P4NA 3HG7A 1H5QA 3AM4A 4FSHA 1GYQA 2GLXA 5A03A 3K6JA 3NYWA 4ALJA 2PK3A 1ORRA 4R68A 3RROA 3PDUA 3W1VA 1BTOA 2Z1MA 4XQCA 2GGSA 1QKIA 4J1QA 4OXYA 3BTSA 3K5PA 1BDMA 3ZNNA 4BO5A 3GLQA 4G81A 4JJIA 4EW6A 4PLTA 2OHXA 3OM9A 4ZA2A 2NVWA 3PWKA 2EEZA 3BMNA 5DBFA 5G0VA 2VT2A 1ZSVA 2HK9A 4YJFB 5ER9A 5T8KA 1AHIA 1HDCA 4R54A 4BQRA 2CD9A 3QWIA 4Z0PA 4WCFC 4ND1A 2G82A 1VL8A 4WNCA 1GZ4A 1LSJA 2C2YA 3WXBA 1HEUA 3RBXA 2ET6A 4BNMA 2I3GA 2QHXA 3RJ9A 1RM0A 3GRPA 5TC4A 2OP0A 2JL1A 3DWFA 4IJKA 5U1PA 1GUFA 2B0JA 2EKLA 1IB6A 3GGGA 2VTDA 3P19A 4D3SA 2ZKLA 4CV2A 3WBBA 3I9JA 3DXFA 3MOGA 3G49A 4BNXA 3PFFA 1SEPA 5L7TA 5CPFA 4E2XA 3H3JA 3Q0EA 1KEVA 4ZN6A 2RIRA 2EGHA 2BFOA 3AUSA 3HE3A 5H82A 4OQYA 1NPYA 5IXSA 1ENPA 2VYVA 4MIEA 4O5OA 1BWSA 2YV3A 4E30A 2P5UA 1KVTA 4TMFA 4JP3A 3NT5A 3V5NA 2B36A 4L9RA 2O3SA 4FOSA 4BO3A 3RUAA 4TVOA 5JFOA 4IJWA 1G0OA 1Z45A 4GX1A 4TKLA 4E5NA 3ROKA 4XGNA 4PG5A 4CV1A 2C0CA 3E5MA 3H2SA 1P0FA 1V9LA 2P68A 1IZ9A 3O38A 3S8MA 1FDWA 4E31A 3U4HA 3ZWYA 1BSVA 2GERA 1EFKA 3U9LA 3DOCA 1WWKA 1ZIDA 2VNAA 1DIHA 2X0JA 1AN9A 3GK3A 4Z3KA 2I66A 5EL0A 4IUYA 3C1AA 4JJGA 4IS2A 2GZ1A 3I6IA 3ZNOA 1FXSA 5JAQA 4WNIA 3NRCA 4R9SA 2YQ4A 1LDEA 4BV9A 3H8VA 5EQFA 2JFFA 3D3EA 4A7PA 1LLQA 1WNTA 1ZW1A 4E13A 3D3WB 2AA3A 1E7WA 2CDBA 4TVBA 1DLIA 1GR0A 2Q1WA 2X0NA 2ZB7A 5CPBA 1PJCA 5DBGA 1GEGA 2OZPA 2YUTA 4CMGA 3NJ8A 4E5KA 3WGTA 4ZHSA 4JIGA 4O63O 3W8DA 5TLSA 1JKIA 1LQTA 3ZWMA 5L9AA 3MEQA 4HKTA 3NDIA 4NK4A 1LDBA 4WECA 3P2OA 2WWRA 4U6SA 1KS9A 2D0IA 4E32A 4GGOA 2VYVD 2FR1A 5LDHA 4PG8A 4E5MA 2ZYDA 4IGFA 4XKJA 3FWNA 1Y5RA 5CEFA 5JC1A 1WW8A 3C24A 3I1JA 2VHVA 4JK3A 1PS8A 4IM7A 2TMDA 3PHHA 4ALNA 4BMVA 1HL3A 1LNQA 5JBIA 4CLXA 2X5OA 4LSMA 5FWNA 2LDBA 3WFJA 4YR9A 2QZ9A 4XB2A 1DO8A 2C7GA 2DBRA 3AM3A 4CMHA 2IZZA 3DBVO 5ENVA 1LUAA 5EJ2A 2OMEA 4TQGA 1QYDA 1J4AA 3AM5A 1ISIA 5U4QA 2AQIA 3G1TA 4WPGA 5I7EA 4BO9A 4BNTA 2Y1GA 4U7WA 4EGFA 5BNIA 3WTBA 4UVHA 4G2NA 2VHYA 1U8FO 3ZWWA 4ID9A 4ZD6A 3Q11A 3RU9A 3IKVA 4OGWA 3UHAA 1T26A 3GPDG 3EVNA 1UZLA 4CMIA 2AHRA 1ZJYA 3TRIA 2ZTLA 2O4UX 2FOIA 4FIZA 1A27A 1ADGA 4PLPA 4RCVA 5DCUA 3ZWBA 4IDAA 1WXDA 3ONEA 3DZGA 1EUZA 4PZCA 4K6CA 2VZ9A 4J4TA 1GPDG 1Y8QB 1MC4A 3GMSA 3DOJA 1X1EA 1A71A 3JQGB 1U3UA 4BNJA 8LDHA 2A92A 4FBGA 3VTZA 2Y1FA 1CWUA 2X7HA 3BHIA 4BO7A 3DBHB 4RVFA 4WOJA 1LRLA 4DLBA 2ZK7A 1ID1A 3E6AA 4J2HA 3C3XA 5IXYA 1W0CA 1LLUA 2FSVA 3JSAA 2CF5A 4MVJI 1JAYA 1MLDA 1X14A 4YJHA 3ZZNA 1NQOA 2OP1A 4FR5A 1OOEA 4BIIA 2Y1OA 1A9YA 4R1UA 1CJCA 3M2PA 1U5CA 1GQQA 1QP8A 2NVUA 4R3WA 4B3JA 1Y81A 2AW5A 2NVUB 4CM3A 3IL2A 5IN5A 4DXHA 5T64A 4QFDA 3TZCA 3TPCA 5AQ1A 4D79A 3WQSB 3IDSA 1F17A 1T2CA 2AQ8A 4CM6A 3I9LA 2FPPA 3E9NA 3R3SA 2ZB8A 3DTTA 4MINA 3GN1A 2JFHA 3CINA 4O59O 1EUCA 2E49A 4U5QA 1B26A 3FR7A 1HXHA 3MZ0A 3VC7A 3SEFA 4KDEA 4Z9XA 4FB5A 1R4NA 1OC4A 4MKZA 3TNLA 2OGUA 2D4AA 4MP8A 4NBUA 4B7XA 2DBQA 3KYBA 2FWMX 2AXQA 3ONFA 1UXJA 1TB4A 4BNVA 4UUMA 1UJMA 1XU9A 4CL8A 2BRUA 3GEGA 1HLDA 2YY7A 2WE7A 2JAHA 4BUCA 1HE3A 1EMDA 1M66A 2EG9A 4GH5A 5ILOA 2GO1A 4TKMA 2B37A 1VPDA 2YV1A 3B1JA 3WR5A 2P2SA 4NFYA 1NAHA 1KEUA 1PQWA 2FN7A 1R6DA 3WSVA 4DIBA 3NT2A 1A4UA 2BGMA 1E7SA 3HDYA 4D3DA 1R4MA 4ZQGA 5T8KC 5F5NA 3W8EA 4RF3A 4BHTA 3AUAA 5TS3A 4FFPA 1XQ1A 4MVJG 1Y1PA 1MXHA 2PGLA 1MGOA 3GVPA 4I5GA 4L4SA 2ZJ0A 4DPLA 1PJ4A 1ZXBA 4GX0A 1QRRA 2P9EA 5H83A 1PSDA 3ZV4A 2PR2A 4E3ZA 5BSFA 1I2ZA 3PLNA 4RO0A 4Y6RA 3INGA 5JY6A 1C0KA 3LT2A 1Y5MA 2P5YA 3CXRA 5AXCA 1O95A 4WE3A 2NWQA 3C7AA 4Z9FA 2X9GA 4MKRA 4ONEA 4AJKA 1PZGA 3GN2A 2CVQA 1R0SA 5JS6A 4Q9NA 3OJLA 3WGIA 1BGVA 4L8VA 3VZSA 4F45A 4YJFA 2QIOA 1OFGA 1HZJA 5AXAA 4YYZA 5CG2A 2Q49A 5G0WA 1VRWA 2WTBA 4M8SA 3W4IA 4N7RA 1JU9A 2HUNA
chains in the Genus database with same CATH superfamily
5TPZD 2YBEA 3TM5A 5JY1A 4RA6B 5C4MA 1Y82A 5EJGA 2M6RA 2BI7A 2P2YA 4NMLA 4CNQA 4XVHA 4DV6B 4RH3A 1H3EA 2PWYA 2W58A 3JATB 3JAWB 4FPXA 4IVNA 3DHNA 4M0PA 2XF8A 5C7LO 2HC9A 3H4VA 3S1AB 4B5KA 4KLNA 2NT3A 4XTCS 1CC1S 1LBTA 4RNDB 4YRIA 4AJEA 1J1ZA 4PX9A 1GY8A 5KVVA 3VHXA 2D0DA 1RRPA 3GJQA 1ZD9A 1N3IA 3SZ3A 3WWZA 4YMVA 3W78A 5BN3B 1B8PA 3RC1A 2XPCA 4MJ7A 3MJSA 4TYMA 5KX5A 4B43A 5J2TF 3VXKA 4MIKA 3HJFA 2H65A 2O1WA 3OCCA 3Q6MA 5KREA 2XMSA 5K51A 2VYNA 1KYYA 1LX7A 1Q15A 3IUBA 1XZKA 5AKXA 1W6RA 1CR1A 4WN9A 1JAHA 4O2AA 4CKYA 3DEAA 3H0KA 5HK8A 4YIHA 3BD6A 3HZZA 4O4JF 5DLYA 1PN3A 1R6TA 1ZPDA 1KC3A 2VXCA 3EMKA 3E18A 3PENA 4L5IA 4P38A 4ZO6A 3ZZ1A 1GAWA 2MJLA 4Z4EA 2OC4A 1M67A 4G5RA 3ZD6A 3GRKA 1BXZA 2G9QA 1GPYA 1TAQA 1Q6YA 2IYZA 2G06A 4HNHA 4B3FX 2Q3HA 4RK0A 1AG9A 4MJLA 1I33A 1J8YF 1MQAA 3A9CA 4ZMRA 1KY2A 3PTZA 1WBBA 2C7VA 3M83A 1Z07A 3DKVA 5CK5A 5B12A 1OXSC 1SXJC 5D3QA 2OYRA 1DXHA 4HEQA 3C3PA 2ZI7A 2BMWA 1YVDA 4AI6A 1C0LA 1RKUA 1GUDA 1ULSA 3D5TA 4XASA 2B3DA 5CFPA 1XD9A 2QUAA 3WB2A 2ZWVA 2SECE 3VZPA 5KWJA 4Q3NA 3ESDA 4PHTA 3SX0A 3OOJA 3S28A 4Z7NB 2R1VB 3VJRA 1EK5A 1UKVY 4UC0A 5TT1A 5CEJA 1GGVA 4UBMA 1N2IA 3ESQA 2WJWA 1GU7A 2PNJA 1DMSA 2PV0A 1VGQA 3BFJA 1A7UA 4IIDA 1EGMB 1UZUA 4FOTA 5AVZA 2FK8A 4G0YA 4F9GA 5A6SB 4RDIA 5EYPB 4IQ0A 5E7QA 1CHDA 3NBYC 4XYLA 2QR5A 3I37X 3T0GA 2P4EA 4BN0A 3DBOB 2OAP1 3CX3A 4MO9A 5HE8A 3TRHA 3IKMB 2JDIA 3QYAA 4ZCIA 1KJNA 4X97A 2R1UA 4NIMA 3F6SA 4KNYA 1SMKA 2VP6A 2JAXA 5F64A 2GN4A 2BE9A 3U7GA 1UAAA 4B8WA 4RFSB 1NMYA 2MR5A 4CUJA 3IMCA 2RBKA 1UC8A 3HDTA 4IVPA 2BI4A 2VBGA 1DKQA 1FTSA 3N2KB 4LNUB 2B35A 4EL5A 1P1RA 2WD9A 1ABBA 1KWKA 4GR4A 4K9QA 5K0FA 5FTKA 1HKUA 1XXHA 2BM0A 1TXGA 4JT8A 1RU3A 1LVHA 3OF2A 4FEGA 2MSDB 3NUGA 2H1LA 4H31A 1HNNA 1BMFD 2FW8A 3SHOA 3E3OA 3L8MA 4Q7KA 1UDXA 2ZSHA 2O50A 4MYDA 4Q7EA 3L05A 2GKOA 4M1SA 3A31A 4TMKA 4V38A 4DCOA 4HDCA 4UFNA 2AWOA 1Y8AA 5EYPA 1CEEA 4L5CA 4WCVA 4BQSA 1U3FA 1JZTA 3PIDA 3GQBB 4X1KA 5FYDA 3T3IA 4BV2A 4UNSA 2MOKA 3FHOA 3LQQA 5KUTA 3JQ9C 1LX6A 5J47A 3HPRA 3C70A 1EVLA 2PGXA 1J1IA 4YRFA 3T3EA 3MWJA 1ZK3A 1QVAA 1CNMA 1W5EA 2DPMA 2UYGA 3D7LA 4YUVA 4HN4B 1WCV1 4HAZA 4FNOA 2QBYB 1ZUHA 5TR9A 1K0UA 3QNMA 4B3GA 2HSGA 2R8OA 1P62B 2QW1A 5F5XA 3ZU3A 4ARUA 2QYHA 3V3TA 3L01A 3VAYA 1JRLA 4D9IA 4HWSA 5LB4A 1OASA 1O54A 3H65A 4JLWA 5REQA 2A0UA 3IRUA 1Z75A 2SCUB 3PJFA 3QJYA 3H5TA 2DHDA 3K1JA 3GDHA 4WAUA 4QX6A 1V11A 3OD1A 4L27A 5B30A 2W71A 1NXVA 1Z6GA 3G7SA 2QXTA 4G1UC 1NPDA 3K70C 2R47A 3GDGA 1D0SA 4A27A 4N6NA 1E3WB 3MWDA 1EZZA 4UM8B 1CUJA 1GQOA 3TDKA 3VO2A 4RMGA 5JD6A 3GVCA 1L7BA 3JRWA 3A6PC 4MLCA 4QVIA 4G1BA 2C8KA 3K2EA 2B30A 2DX7A 5C7OO 1Q92A 2ONZA 3E3AA 1YDMA 1Z18A 1ESMA 2D06A 4CVNA 1VSVA 1O6FA 1PR1A 2J59A 4FR0A 1E1CB 4WCFB 5T5QA 4YV2A 2ZRIA 4KFSA 4M86A 1IXZA 2QVLA 3KPVA 4E70A 2HYIC 3T61A 2GN6A 1FFYA 3DZFA 4YAFA 3RIMA 3NIDB 1ODIA 1PAUA 2HSDA 4XH9B 4HQ0A 2R8BA 4KE6A 2O2SA 3WIOA 4D99A 5EFOA 2H4HA 2XE6A 3A3OA 1VCNA 1Y34E 3KWLA 2W6IA 3SXJA 4I3GA 2H57A 1DQZA 3DEJA 3W2FA 2V6GA 4FU0A 3T38A 2JGNA 3RRMA 3UQZA 5JBQA 1CT9A 4XSGA 4LBZA 5IN4A 1OVGA 2K5UA 3RC2A 5FEUA 1MV5A 1EFTA 2Q3DA 1IN4A 1UKZA 3T1YB 4CL3A 4G5SA 2HA7A 2B0CA 5DHUA 1BNCA 4MGEA 2KYRA 4WJZA 3AR3A 4PZDA 3PJDA 3RCBA 3V8PA 4B3IA 1DEHA 1GUYA 1KPGA 4I5FA 5LXTF 1TZJA 2DCMA 4OH7A 4OXXA 1ACMA 3OTWA 1J49A 4HEA6 1V7QA 1N6LA 1XQ9A 3GAFA 1XD8A 1XRNA 3E22B 1EWKA 3O8OB 3EEBA 2YTZA 3EK2A 4NDAA 5LZ2A 1QUEA 2HLNA 4KPUB 2QYOA 2ZRLA 3DHEA 3JAKB 4IKEA 4ARBA 1HETA 2GPWA 2NO0A 4Q00A 5EKDA 4YVFA 3GZ4A 2WUGA 2YXEA 2VWGA 4BGEA 2MTBA 3S7TA 3ANTA 5AXDA 1T9BA 3RWOA 4PX2A 1E6KA 2ZULA 2FMUA 3BWYA 3DVAB 4ZZIA 2IRWA 1R0BA 1WBJB 4WLUA 2Y05A 3O1LA 5FNVB 3PHLA 4PSCA 2ZP1A 3GWGA 2JH8A 1P60A 5LQKA 3QTLA 1JHRA 4F86A 2FZEA 2O2IA 3KPYA 4HWKA 2ZIFA 4WT7A 1KI3A 1R0KA 2B94A 4HAOA 3LY7A 5EZYB 3OIFA 3UY4A 1MQ8B 4QSMA 1D2MA 3T9DA 2B4TO 1LEHA 2ZJ2A 4C6SA 2RI1A 3FD8A 2I9PA 3FA2A 3A37A 3NEPX 2FGKA 4ARZA 4XQ9A 2BMDA 2VZ0A 4U39A 3ROQA 4B3BA 2XZOA 3ABQB 1D03A 1YL5A 4LXXA 3GRCA 4H1WA 1E4VA 4PC6A 1M2OA 4G36A 5KTYA 1YF3A 4GL4A 4QRIA 1JIVA 1UKYA 4YLEA 1M2OB 4DXAA 3BXHA 4JGBA 5J2TB 4QQRA 4XVCA 2CDNA 3JQBC 2Y93A 1DRUA 1NFRA 1RS0A 3OM1A 3EXHC 4XRRA 2ISSD 3TG8A 5GM2A 4IOJA 1PFUA 3VGPA 3HKEA 3DE4X 3IP8A 5CH3A 1P31A 1UBEA 2WKSA 4NG4A 1CZHA 1NF9A 5B3JC 1XCOA 3SKYA 5B36A 2Q1UA 4L4XA 1U4NA 4X0EA 3UB2A 5IZ4A 4R05A 2GM9A 3KEFA 2C3PA 2XUAA 3D2CA 3K53A 2AYYA 1VA5A 3ONNA 4JLPA 3RRNA 3V8MA 5DW0A 2AG6A 1K7XB 1FLAA 1A7AA 2HRBA 3DP7A 3I1YA 2F8SA 5J4KA 1P9WA 3FN4A 3HV0A 2G0NA 1XLTC 5HNKA 3LZDA 4WY5A 3RKRA 3TZQA 5JJIA 1YCGA 2BV3A 2XOKA 3D0OA 3E9ZA 4MV9A 2I8CA 5JT1A 4AROA 2ZJBA 4MPDA 3K9GA 4UPVA 4FWIB 3SSMA 3UAOA 5JNSA 4UFOA 5CT6A 5K3DA 1KI1A 1WB6A 3LTNC 4KWIA 2ZYWX 2ORVA 1B6SA 3VOSA 4M21A 4Z99A 3I61A 3KZ1E 5EJFA 5TRTA 2YXNA 4E5UA 2J9YB 3ZI7A 3OE7A 1LRKA 3ZBUA 3K6SA 4I8XA 5G0SA 3FOBA 4DLVA 3SMVA 1E2IA 4MICA 1G9SA 4NZYA 4ZT2A 2V54A 3QXHA 1B41A 4YA6A 3UFXA 4EARA 2H63A 4X64B 4ADSG 2QP3A 1GG9A 2V4ZA 5EKUA 4I1PA 5AIBA 1ADFA 3H7AA 5JAOA 1ILWA 2WAMA 3F9CA 2AFHE 4JBLA 3SXUA 4DAOA 4AJ1A 3QYJA 4ZYXA 5AI5A 4IX1A 1Q84A 1DELA 3A6JA 3OJFA 3N0RA 1FFCA 4JOQA 4MNTA 4WXEA 1V8OA 1GPH1 5CIQA 2WTEA 4F3NA 1JEQB 1OBVA 1MVOA 1XVTA 3PDJA 3RQIA 3FAKA 4FFLA 3VR5H 5KSZA 4DV5B 1J8DA 3BD7A 3PSHA 1TUBA 3TQTA 3TLCA 4DLAA 1PX2A 2OCAA 4KDRA 5BSTA 3PFHA 1DAGA 4LISA 4AZVA 4GBED 4U7HA 5D3MB 1QAQA 3HV2A 2XEXA 4H08A 4BFCA 3BCRA 1FDSA 3LD9A 4YMGA 3OWXA 3V4ZA 1L7OA 1WSBA 4J3FA 4P2GA 3QX7A 2HREA 2L2QA 2V7WA 3A1FA 4IWNA 3TWOA 1YBHA 1U8CB 4ROSA 1IDOA 2I2FA 3H6GA 3KDSE 1IRXA 2X0FA 4EAAA 5JMWA 1A7KA 1FNMA 3C3JA 1MB0A 4OMCA 5EWMB 5C32A 5IKPA 4MV7A 2P4UA 1QOZA 2CHUA 4HGRA 3S2YA 4BEVA 2P9QA 4C2UA 3R76A 3KNZA 1QF9A 1YHNA 2H1HA 3QE0A 1ZSNA 4OHUA 3ESCA 2FXVA 2FUG6 1D3AA 3QE4A 4JODA 4NHEA 3LP5A 1E66A 5FULA 4Y0VA 3AR7A 1N9KA 4LYYA 5FPYA 3LYUA 2R4TA 3CLUD 4HLUC 1Q7GA 3KZKA 2AFHA 1E64A 4UUPA 3Q85A 1UBKS 3LW7A 4FCWA 3R6TA 4NI5A 5KCZA 3WYGA 2GZMA 1VFPA 1KDRA 1BROA 1JSZA 4QODA 4BWYA 4CG0A 1ORIA 3DDCA 1JV2B 3PQ6A 1IOVA 1L4KA 2WWWA 3BOSA 5L4LA 4HOYA 4KR3A 2ODQA 2BHLA 3GJRA 1CUWA 3H5AA 4QDUA 1RVV1 4MRMB 4S1WA 5TVGA 4OL0A 1IHYA 3LI2A 2VI5A 1UAYA 4DREA 4P53A 5FPQA 1XK7A 3HP7A 3KU4A 2P9CA 2QJFA 1J9ZA 5DM1A 3A3KA 3GRFA 1CD5A 3AUFA 4QM7A 2N47A 2ZJ3A 5C5DA 3IQIX 3SR3A 2EZ8A 2WU0A 1PGPA 2F8LA 3DQZA 3EQZA 4WFJA 1C1HA 1X1SA 2WAAA 3F47A 2NXEA 2OBFA 2RJ3A 1T4CB 1U2DC 2GLUA 3AY3A 3H9UA 3EB9A 3X1DA 1P0CA 2JZCA 2NU7A 4PZ9A 1TEZA 1C8LA 3TIIA 1SD2A 3GB9A 3BGIA 3ZDQA 1K4YA 4FYWA 4QOHA 3UWSA 4KWHA 4OQXA 4E6EA 1O58A 5BUSA 1I36A 5EERA 3O8BA 1NP7A 1T1RA 4JJ8A 1P5JA 2VQ3A 3EG5A 3L6DA 1GTZA 4IOMA 2N0SA 3NONA 4NP6A 5ELLA 3WRVA 3OETA 4PNHA 3ZC3A 2C3UA 4CQMA 3MRTA 2AMJA 4WQMA 3JALA 3IP6A 4AK9A 1PUIA 3OLZA 3INRA 5JNRA 4JX8A 2D0OB 2X6RA 4XCQA 2JJQA 3K9BA 4X20A 1YD7A 2WJ3A 3LVFO 3A6GA 4H7EA 5DX1A 2EDAA 2FCRA 2ZSBA 2NAFA 2PSHA 2HWYA 4II2A 5AW8A 1BXGA 1IY0A 4OLJA 4C1NA 4ZYZA 2O1EA 1NT2A 3E9QA 2HPVA 1XCLA 2CB9A 5I7WA 1RRCA 2C07A 3LU1A 2WFMA 2OLJA 3DKPA 5AJHA 1J0CA 3FUUA 1UYJA 5I7SA 5JCPA 1DUIA 1R2QA 3DF7A 4QXMA 1GSAA 5K01A 3IJPA 1C8BA 2V8OA 3IAFA 1NXOA 3RIXA 4LWQA 3WX0A 5AO9A 2NTEA 1CY8A 1DWPA 1ODLA 2CDRA 2HQBA 2H51A 2J09A 1XF9A 3ETGA 1TM4E 1YRQA 5ALQA 3DJFA 1ZRMA 4IWXA 2AYXA 4X1YA 1DC6A 5IK2A 3FFBA 1OIXA 5AW6A 3IDQA 1NJGA 5A9SB 1K3UB 4R1NA 4XARA 1TW3A 3GP3A 5FNVF 3WGOA 4RY2A 4EL0A 1PYDA 2EARA 5K0ZA 2BFFB 3DONA 1JEQA 1T3ZA 3NHWA 4JH0A 2HPZA 1QV6A 5E1BA 3EGIA 3ZNPA 2NO4A 4LVOA 4DT1A 1HRDA 5B58T 2MMCA 1DDOA 2HQRA 1HUQA 1WOYA 5EWLA 1LI4A 3TNJA 1H6BA 4XIJA 3IESA 2HZ7A 4LRSB 2Z2IA 3KE9A 1XAIA 4HI0E 4LTMA 4W63A 4YASA 1QPZA 3ICQB 5I8ZA 2IQ5A 3NOQA 3G0OA 3CIFA 5KHLB 4YR7A 2IOFK 2SKDA 2XBUA 3H5VA 5LWQA 5DIFA 2GEUA 4KJZA 1NNLA 2FVYA 4MLDA 2CN1A 3BHMA 2I54A 4FMPA 2FHPA 4LI3X 3RSOA 3MCAA 1WEHA 1UMBB 2OB2A 4QAJA 4CMCA 1JZQA 4MZXA 1KJQA 4US2R 3OQOA 2X5NA 3R41A 1YU6A 3OQMA 1RM4A 1AHHA 3VYVA 5A04A 3MJFA 4D46A 1GRNA 1G7RA 1M1NB 3TG2A 3TEJA 1D0VA 1QF6A 1A9RA 3AG5A 3BXOA 4EDFA 3MTQA 1OGIA 2E1PA 4QFCA 5H0IA 4EGJA 5KYYB 1IJFA 1WPQA 2C4WA 2JHAA 3HGTA 1UR5A 1PR6A 1BEZA 4HWOA 3HDGA 3EW7A 5EWMA 2W0MA 1WHTA 3R77A 2UZIR 1IK4A 4G3XA 1SIBE 2I6UA 3IPAA 4HN2A 5DPMA 2UU9B 1W4CA 1ZJ6A 4JU8A 2MYPA 4B3SB 2EL9A 4ZREA 4AMUA 4AWAA 5A0TA 4FBLA 1E2GA 1G1MA 4QPDA 4WL0A 4ND3A 5LR6A 2ASVA 1R0YA 3WK7A 2C97A 1YCDA 4RL4A 4WBSA 3TUZC 1XE3A 5LVAA 3RWMB 4W82A 1IBKB 3FSRA 2VDRB 2A35A 3AMVA 3BDIA 3IUJA 5D3MA 1USIA 4A0RA 1NA5A 2AF3C 3ODGA 3OQHA 3PXXA 5I45A 4LOKA 3E3MA 1NQWA 3V7NA 3BDVA 4ZT4A 4ACAA 1WR8A 3VRHA 1LBSA 3KYCB 2PL9A 3NXSA 2OZEA 3O1IC 3GGSA 4FIDA 4GEKA 1TX4B 2C20A 2TECE 5EHIA 5F9HA 2TYSB 2UYCA 2XVXA 2PX5A 3VVLA 1BW9B 3QVVA 1E1KA 2QAGC 4NG5A 3CNLA 1LI5A 1ZESA 4ER7A 1Q1ZA 2C2XA 2LP4Y 2J08A 2NXWA 1UKCA 3JQBA 4H7DA 2CSUA 1SPBS 2H1CA 3AR2A 3HM2A 5E1MA 3IDOA 3T34A 4MUFA 4XYEA 1Q0UA 1T5HX 1TCVA 5AVYA 3KDPA 9ATCA 1QFSA 3DFKA 1H23A 4ZKEA 3TLGA 5MN5A 4B32A 3HJAA 4I3FA 2CMDA 2Y0EA 1KVSA 1QKKA 3D1VA 4PO3X 5F2KA 1WV1A 1WZEA 2FH5B 2ZWPA 3CZRA 3I28A 5B3JA 2VQ6A 4WJKB 1ETHA 1FDIA 1KXZA 1P18A 3TBHA 4RPLA 2WR8A 4FDUA 6NULA 1KAHA 1SR8A 2OO5C 3F6BX 3NUZA 5FWXA 4YJ2F 4F6LA 3B1VA 4IEIA 1F1BA 1MKYA 1Z33A 2Z9BA 3D8UA 1Z4MA 3NETA 4TMWA 4W5WA 5DCLA 5FQOA 5I9MA 4BWGA 4DMFA 4YYZA 1PGQA 2QRPA 2A14A 3A6EA 1B0AA 3DEKA 1AKVA 2ISCA 2I71A 2XKAA 1GZ7A 1GPMA 1CSEE 1ZLYA 1MHMB 2FDXA 1II8A 3MJEA 2FEAA 3OC6A 2JFNA 3P9IA 4IJUA 1WBDA 5C1PA 5JZVA 2GBFA 2H9IA 3I42A 4RHCA 4FONA 4HH4A 5JI2E 3LDUA 3WLQA 1WUJS 3GG2A 2DFNA 2B83A 5FDFA 1HG1A 1PEDA 3BUSA 4D9CA 3NVKI 4MDHA 1KFBB 1JG4A 3R7BA 3FUXA 1SVWA 2WV9A 3GZNA 4C0KA 1PNOA 4W4TA 1ZG3A 3AVOA 4EHLA 3KXIA 1P81A 3WLAA 4ZQIA 5BMVA 2CEAA 1GUZA 1XI2A 3B6IA 3EFOB 4IHQA 4QELA 2Q0XA 1UBTS 1YHYA 5K5EA 3NI2A 3FLBA 1OFHA 2CUKA 2P1ZA 4O4IF 1J25A 3WKBA 3OAAA 4RIHA 4AZ3B 3TI7A 1Y7LA 1ZGHA 4RETA 3KJQA 3QJ5A 1TCBA 4H15A 1V16B 1GITA 5LKAA 1E7YA 1MC5A 1L5QA 1G3UA 4GGMX 1E1DA 3K1AA 1MAVA 4QOSA 4WLEA 3VJKA 5CDGA 1OI2A 2ZANA 4KSBA 3A0UA 4IDEA 3E4DA 3I0ZA 3IUYA 4Q48A 3TKLA 1IJBA 4C4SA 5IBPA 5KIAA 2OO5A 1W8IA 3C5EA 2PQMA 1P8JA 4UAVA 2E82A 2JGEA 1ZMOA 1KDZA 4AP6A 1I4LD 1QSGA 2GAFA 4PPNA 5JRJA 4JLUA 5A4FS 4HRYA 4D43A 1VXRA 2WIAA 4FEYA 4UVDA 5EY5B 2W2LA 3AHGA 1RE0A 3DE5X 1PKEA 3HADA 1L9KA 1OROA 1K8YB 5MGNA 4FW8A 1KH1A 3E3NA 2X1MA 2BELA 4M9RA 1QFXA 1N32B 4YXWD 3G13A 1G2QA 4XQGA 1XN1A 4RIGA 5IK2D 3HBFA 2R0QC 1XYGA 1QLJA 1VE9A 2ZIVB 4RK1A 1YC2A 1MO5A 3MWKA 2VK8A 3PXDA 4DLZA 4HYQA 4JLBA 1BX3A 4LJ9A 5B3AA 1BE1A 4OIMA 5F12A 1SXHA 2ES4A 1TF7A 2QQEA 1S2MA 4I9NA 5K9ZA 2YWHA 1UP7A 4A0QA 3ECCA 4WESB 4FILA 1KPIA 4Z6KA 2OVFA 3KDAA 1S0UA 1JMKC 1PBTA 1T5OA 1FX0A 2QL9A 4JOBA 5FEMA 1V4BA 3VU9B 2RD2A 5EHGA 3PD1A 4HK4A 4YI3A 1G8AA 2XMGA 4DNXA 4M8NE 4YV1A 4GSYA 3LLUA 3NRJA 4W7HA 3O3NB 1XGKA 1SOMA 1DC8A 2WVHA 1MABB 4L4YA 1Y37A 2V7BA 4WY8A 4YUXA 3B53X 3N7AA 4PYOA 2WVJA 2H52A 2CJFA 3TIGA 1HYHA 1H4QA 3C6MA 3OI7A 2O7VA 4I5DA 4O4LA 3V8BA 1MT3A 2LCQA 5J4VA 3L7BA 1JEYA 4LRTB 4JXJA 2PUEA 5C7IO 3DNFA 1HTBA 1XAJA 2OY0A 4KQ2A 2QY9A 3W6NA 1J70A 4RY8A 2FMKA 1XIVA 4RF4A 4EG1A 5LQRA 1C3LA 1MB3A 2R2AA 1Y4SA 1OTXA 1OW3B 4DA8A 4E5SA 3OIVA 1D7AA 2O59A 3U13A 3OC0A 4E5PA 4ENVA 4R31A 4HUQB 1NVVQ 5JRZA 3V42A 4CR8A 2IA5A 2EYUA 3EYAA 4NAVA 1SGWA 4ARAA 3P2YA 4C0SA 3AR5A 4Y9TA 4DEYA 3QEMB 4Q39A 1TYZA 1UDAA 3FKSA 1A96A 1E9CA 1MIOA 1MU0A 1XOIA 4LJSA 3GWZA 4D8XA 3DT6A 4AYWA 1UBSB 4OHCA 3LUAA 1EUYA 4JITA 3C8MA 4K9LA 2Z8XA 2DLDA 1RFGE 2OUIA 1M33A 2GFIA 2NTNA 4IGAA 4LYAA 1E61A 2LCFA 3W8FA 5HILA 3W5AA 3P9KA 1GTRA 2ZJ5A 4DCTA 1MO2A 4MR9A 1H9AA 3C98A 2WMOB 4CKWA 2RGWA 5IAKA 4R0NA 3WNQA 4ESOA 3VR1A 1U5AA 5CVDA 1G8FA 1JDZA 3IDFA 2HY7A 4NE9A 1ZGBA 3BE8A 4DLLA 5CB4A 2O14A 4OV6B 2NM0A 1DBWA 2PS0A 2QF7A 3K8YA 4OU5A 4G97A 4K9OA 4XSVA 4X85A 4EUFA 2GNAA 1V41E 3NWBA 2WYOA 1OB2A 2IS2A 1SWVA 1R9MA 1DXYA 4F92B 1LPSA 1ZGJA 1D2NA 1ANKA 2PZKA 3AX6A 2BJHA 3B9PA 3GBSA 3HFRA 4MW0A 5FBRB 3RSQA 3C1OA 1U1FA 3DLIA 3GFBA 5EZSA 5EMJA 2J0SA 5ALVA 2YWBA 1JDBC 1UT5A 3V4PB 1Z25A 4CMBA 2Q29A 4AG3A 5ICCA 4IV8A 2FR8A 2OFPA 3Q7EA 1INLA 4F3RA 1ZOIA 2PWZA 1VKOA 3TGPA 2I2CA 1P6QA 3EPJA 4PEVA 1ND6A 4KO2S 3FLAA 1I2CA 3DMRA 4LMRA 4V0LA 1LNZA 5ALGA 2HMYB 1PR4A 1S2IA 3CX8A 3KPWA 3ZHQA 4PX5A 4WCDA 2ZUBA 3OA0A 3LH5A 5KEIA 4RGQA 1WW3A 4C20A 3WHKA 4PNPA 4CM9A 4UEJA 1B6GA 3IVCA 3TEMA 2AJ8A 2WFZA 3KEOA 5C53B 1IZ7A 3A9WA 1R5JA 2Q3CA 1E6CA 1R6UA 4TS3A 4WV3A 1A2QA 2Y1DA 1U5BA 4NS4A 4LF7B 2UXCB 2BEKA 1WB9A 2D00A 1NI4A 2YOFA 2ZRPA 1HDOA 2P2LA 1RJFA 2RIPA 5KWVA 4KE9A 1RXVA 3TNFA 1PSWA 1L5LA 3F6RA 5CIYA 4KX5A 1JHYA 3WGNA 3COVA 2CHFA 2ABWA 1WS6A 3AVPA 3DTVD 3R23A 4FT4A 3D64A 3UJNA 4IS3A 4DUGD 1FUYB 4LQLA 4I1YA 4MP3A 1SZPA 2XTNA 1G17A 3DTYA 4HQNA 1IUNA 4OP1A 5JANA 1YIAA 1XTIA 4ALMA 2O8FB 2ZI4A 2OORA 2WJJA 3F8SA 1QK4A 4RK7A 5ADVA 1DEKA 1LPNA 3RC8A 3QK7A 3SSAA 2AEJA 1Q95A 3DL0A 3L4BC 1A76A 3O31A 4PSAA 2PJUA 3RTCA 2ZJ1A 3G5LA 4QXQA 5DI9A 2CHQA 3QHPA 3LBIA 1X80B 4D4HA 1ZAYA 2JFYA 2PQ0A 4AT1A 2HK6A 3OFKA 3HLTA 4TSKA 1G1AA 3AJRA 2QVZX 4Y98A 1XJWA 3UXMA 1MG0A 3OY2A 1TECE 1Z9BA 1DP4A 1CYEA 1JEDA 2WJPA 2ZYGA 3VV3A 4BVHA 3O4VA 5EINA 2JJ8A 3GFGA 3IBSA 2CDCA 2IEGA 2XNKA 3U7RA 1YB5A 3FPSA 3JQ7A 3A1DA 1XDDA 2FE1A 3KCQA 3OT4A 4OHZA 2WT4A 3E58A 2D8MA 5GM1A 4AXXA 1TJ4A 1W46A 4G89A 3RJMA 3TTXA 4EECA 5K6RA 4QEKA 2P4QA 3DCNA 5IULC 3D1LA 3Q7SA 4Y1RB 5LA6A 4EUNA 3DZ5B 1JB1A 1L0BA 4Q01A 3DZIA 1NBMD 4XDYA 5AUQA 4I1RA 5BV7A 2XYRA 3ORYA 1R5BA 4ZPXA 2C88A 4XDGA 3M6MD 2M98A 1KZGB 3MFYA 4CQMD 8OHMA 1CB0A 1QYCA 1ACJA 2AX3A 3FI9A 4PAWA 5L95A 1NMZA 3A1WA 3TKAA 4R3NA 1QBGA 1E59A 1GJRA 4W1SA 1QVZA 3FI0A 3CRRA 5A71A 2RAUA 3KPJA 1H2FA 4M37A 1SBTA 4WMLA 1KOJA 2ATCA 3HXMA 4TV9B 2EERA 3CONA 2QRJA 5DM0A 4D3YA 1RPTA 4W1RA 3G89A 4DHEA 2WSSA 3DQPA 4PLFA 3NS7A 5EQDA 4GPBA 4CDRA 4GSKA 1S7GA 1ULZA 2EZ9A 2FSUA 1BMDA 2I22A 2ZYVX 3L1HA 5FAKA 1GQ2A 3NU1A 1T34A 1Y3CE 4Y6PA 4MLZA 1N6IA 1W4RA 3M4XA 5F52A 2CB0A 2J3KA 2YFYA 3HHPA 4M76B 4A8TA 2FUEA 1TD1A 2WPDD 3VU3A 2FP3A 2PMKA 3EGEA 5EIXA 1V9SA 4YRAA 4AQ7A 3ZYCA 4UE3S 2YJ3A 4IUCS 4RIEA 3ZK9A 3F4LA 4B6GA 3R6GA 3QUSA 4KLAA 3HKEB 3S2FA 3T7TA 2ZYAA 3GPBA 1NV8A 5MHTA 4QBTA 4KMOA 4ZYVA 3IQDB 1SXIA 2ZWAA 4FOLA 4RV4A 4OG2A 2ZSFA 1PTJC 5BVHA 1Q44A 4QRDA 3RVDA 2Q8NA 4WH0A 4OAOA 1OX4B 3FTPA 3LP6A 2C94A 1R3DA 4LVCA 4F4JA 2B5WA 2XVZA 3NHZA 2DGDA 2ZSEA 3QKSA 1ELOA 2ZVPX 5IHPA 3FMOB 1LLCA 2HBRA 3EBPA 3P9QA 5B4TA 3WGYA 3L0BA 4CG1A 1I1NA 5GMOA 3GLGE 4KQIA 1BJTA 3ICEA 4JZYA 2J3HA 3KUKA 2IZ6A 2Z08A 3GT4A 3I5MA 1K75A 1SRRA 1BS1A 2EZ4A 3DW1X 2H2AA 1QIKA 5LP6C 4TZ6A 2AD5A 1YR3A 4OHPA 1QC5B 3TUJC 2AFIA 1YAHA 3HZOA 4D42A 5JYAA 3DMTC 1KOFA 1NVWQ 1U28A 1WMEA 3I4CA 1U90A 4LXHA 4M88A 4PS1A 4X20B 4X94A 4ZHQF 5LOVA 1XPOA 2ZUTA 3L8EA 2FUCA 2OL4A 3FPCA 3GH3A 5CJ2A 5DHQA 1AKTA 1H1TA 1PT7A 1TMKA 1K2WA 2G76A 3AGPA 2IHJA 1N2ZA 3L41A 4C07A 5A4JA 1VLQA 2PT5A 2FRXA 3DMPA 4Q18A 5HIAA 2HM7A 2RFLA 1DBRA 4B9EA 2E48A 1E2KA 3KQVA 3LDAA 3OECA 4PW0A 1SVNA 2RHRA 3DKKA 4Q4JB 1IY8A 2MHCA 1C7IA 3ZCQA 4RXMA 4KN5A 2ZKIA 1U8UA 2OAQ1 2GZ2A 4BUZA 1GTSA 5DKFA 3OZWA 3HQ4O 2CJWA 3N0VA 1E6WA 1D4AA 1NWHA 3WLEA 1WUTA 3IXQA 1OLXA 1C0EA 3K09C 4ZXPA 4JHLA 4MXDA 3USZA 4GDMA 3SYLA 5EJEA 3AT1A 4WHMA 2XXAB 3NH9A 1EINA 4L07A 4LXIA 4HQ6A 5JNVA 5C1BA 4IXWA 5LKRA 2PLAA 5AWFC 3R7LA 1RM3A 1IHUA 5CFZA 2XD4A 4BMCA 1QGDA 1NVAA 2FPLA 4RYDA 2C5HA 1EQ2A 2EJWA 4OOEA 1UK7A 3TUIC 2V7EA 4RQUA 2JJ2D 4PLCA 3TLBA 5CFOA 4Y2VA 1GEEA 2J3QA 2JB9A 2GCIA 1TUIA 5FOWA 3R9KA 1SO8A 5G4LA 3RS7A 3THWB 2XQVA 2W42A 4X8HA 3B6MA 5BWOA 4GL2A 3G02A 5LA6B 2Y66A 1A04A 1KMHB 2FZLA 1VYUA 4NESA 4BRSA 1Y1TA 3W3AD 3EGVA 3W5VA 4AO6A 5JWOA 2OG2A 2GB4A 5B3KA 3MUFA 2CWDA 4RCYA 1EE2A 1X70A 2YS7A 2IHZA 4LKRA 1D4FA 4OUDA 3CWQA 4PLYA 4TL8A 1JPNA 1RZUA 2GM5A 2X42A 4RJJA 1BVYF 1VYTA 1Z8DA 1T8YA 3I9OA 1TYBE 1N5OX 3HNOA 3S2GA 4ML3A 5F21A 4GLBA 3U37A 4RSGA 2NV0A 3AOEC 5DVZA 2OCYC 2VHZA 4I36A 3S5JA 1AK9A 1T0HB 1JLRA 4M0EA 3VDXA 1FUKA 4IR7A 4OU4A 1H3NA 4Q24A 4IHJB 5EMKA 621PA 1Z6QA 4KPYA 3RJ5A 5LMCA 3FW1A 5IFKA 2VQFB 2G1KA 4C43A 5AD1A 1CTQA 2EHJA 3IELA 3WGVA 4QJIA 5F9FA 1EBFA 2WDZA 5D3KA 1G8MA 5C1OA 1HR0B 3CT6A 2A1TS 1UKBA 3SOZA 3SG0A 2D1RA 1PFKA 4PSDA 4W6QA 3KOUA 3LWBA 4OGKA 4RLSA 2IH2A 1L4UA 4AJIA 2KLBA 1ISPA 4Q4LA 1MAAA 2VP9A 4UUAA 2IOQA 4MCJA 2C59A 1R6AA 1JGTA 2CDAA 2BE7A 3ANYB 2ETVA 4KWEA 3D7NA 4W7IA 5DULA 3QA9A 2D5CA 3I6ZA 2WUFA 3WISA 1N2HA 3EOZA 1OYOA 1OFUX 1S4QA 4E0BA 2X8JB 1AKWA 1LDYA 1OU4A 2JBWA 1E4YA 1JTVA 2MR6A 3CY6A 1OH7A 3RFTA 4BVFA 1ZC3A 1WUYA 3HXKA 3QVMA 4KAAA 5BN4A 3TTVA 3EDYA 1EFPA 1QHIA 4CW7A 4AX8A 4UTVA 4Z4FA 3VDMA 4XGRA 4W99A 4RTNA 1OAOA 3EDCA 3W5CA 5K8TA 4HZIA 1CJKC 3CN9A 2HHCA 4DRXA 1CERA 1CX9B 3D4BA 4BB6A 3CRVA 3CKKA 4FMCB 3ORRA 5AHXA 3X44A 2HXGA 1CF2O 4IIGA 2J4FA 4TRNA 3KQLA 2QRHA 1OI4A 4G4JA 2R00A 1XZCA 3W05A 3OY7A 3QENA 5IYZA 1ADJA 5K8JB 5K4HA 1CVLA 4EGSA 2B1GA 3L6EA 2ENUA 3T41A 5AM3A 1X1TA 3CMCO 3DA8A 2HPAA 3P5SA 4I4IA 4NH0A 4EMUA 3MQ2A 2RAVA 3G0GA 1AUXA 3TSCA 4MWCA 3JD4A 3ABRB 1BRMA 5FL7D 1ZBDA 1JQBA 4X41A 3SJ7A 1E77A 1T36A 2CL6X 4QPPA 4BQQA 3G1WA 3WQBA 3ZX4A 4FHEA 1COZA 2NTJA 3DE2X 3QVOA 4D57A 3LLSA 1CZKA 5KAMA 4HXGA 5A5GA 3HP4A 5HF5A 2VDQB 3GHHA 3LT4A 4M0KA 1EDZA 5F98A 3H1AA 1Z5OA 1QH1B 3QKRB 4HX2A 4MUKA 4PG6A 3IR6A 1QIFA 1UDRA 3OT5A 4NK5A 4EH1A 4F5EA 3HEBA 5FFFA 5IH3A 3G6KA 5EZYF 5BUZA 4UBIA 2ZRGA 3ETDA 3N75A 5DISB 3EISA 2LDXA 2YVAA 1AQJA 3FRIA 3WWEA 3AF5A 2JGFA 2GSWA 1DC5A 2GBLC 1ZM9A 2VF4X 2BSAA 2QTCA 5DHSA 2P7IA 2DHRA 2RHDA 1X1RA 1LPPA 3ZDXB 2HTEA 3LQKA 1QE0A 4MQLA 5BUCA 4RPHA 1TVKB 1IH8A 1PT9A 2VSNA 2XRFA 4YXFA 3OHPA 5KNBD 4OFXA 1ULBA 1JAXA 3DUWA 3L18A 2I6QA 4R2XA 4HVTA 5FBWB 4ILKA 1ZISA 2CHGA 3IVAA 3LTEA 2CV1A 1FYXA 4Q4JA 4LFCB 4DXDA 1N1MA 4LXQA 4OHWA 2BGGA 1PJ2A 4J0IA 5JZ9A 4V0OA 3NAQA 4OGFA 2R6R1 3K15A 4EG8A 3G2MA 2JVIA 2DFTA 2BW0A 1YJXA 4F1JA 3UYLA 4HQKA 4YUYA 3KJNA 1ATIA 2FCAA 3NCHA 4G0QA 1BA3A 4HDSB 4IUDS 4IICA 4BBJA 3PNQA 2F64A 1OBHA 2O7NA 3F1LA 1QUFA 3PDIA 2JD1A 3JARA 3AY6A 3L7OA 3O4RA 1FP4B 4RD1A 3TCNA 1W59A 3QA3E 4NEGA 4S24A 2NADA 2SKCA 3EIHA 1BWQA 3R44A 4M38A 1JQAA 4DB2A 3MFQA 4QBFA 4PR0A 4UM7A 3VYSB 5DLDA 2AMFA 2O2XA 3C4JA 1M3SA 2ZJOA 1PL0A 4OKNA 4ZOQI 1WE2A 1F0YA 3CLKA 3EDQA 1U1IA 1ONNA 1UK6A 5E38A 4IL5A 4Q3KA 2I4NA 4IG4A 3VBCA 3WYNA 1Q11A 1VLVA 5IARA 1U80A 5CLFA 5HSGA 1PG0A 2JARA 2EJCA 4S0ZA 1OZFA 2RJNA 5A3QA 1IVSA 3H16A 2CKMA 2Z83A 5J5AA 2JFWA 2VOJA 2OHOA 5C34B 4RVSA 2D7DA 3ZV3A 2Z2ZA 4O5AA 1DV2A 2Y27A 2ZUDA 1DWUA 3OZGA 1C3VA 2AQHA 3K0EA 1GLNA 4C4RA 3ZXXA 1A9XB 1CLUA 2N3ZA 4Y9UA 1U4OA 4XB1A 5JDIC 4JENA 1F3OA 1LSOA 2CNWD 3O3OB 3BH6A 2AL7A 1K6JA 5JMOA 2PIDA 1G21B 5TS2A 2CZGA 3B78A 1V3TA 2HMVA 3DC7A 2GFHA 3B8HA 1OU0A 3FYUA 3QQ5A 1CY0A 2HJ9A 1T1IA 2PDAA 1SBHA 3OT1A 3NASA 5ESXA 1MG5A 1C14A 2OPBA 2BH9A 1N6HA 1I9CA 3ETNA 3LC0A 1GYRA 3UC5A 3WI7A 1UMKA 1QGED 3Q8LA 3DEHA 2WQ7A 3PEFA 4YN3A 2FG6C 5LLSA 3WMXA 3GW8A 4ENWA 5CLJA 5IKEA 2WIKA 3AEQA 3M6VA 1VRCA 4OF4A 4RLHA 4FYPA 3OIWA 4XWWA 1N3BA 1Z22A 4EF4A 1Y4UA 4AJPA 2ADOA 4FZ3A 4P84A 5FTWA 1Y4ZA 3AY7A 3PFKA 5IKOA 2G5TA 3DCYA 5TMEA 5REQB 5HX7A 5DNCA 3QEBZ 4B40A 2OBLA 3TQQA 4M55A 1KZHA 4PBTA 4PHCA 1X2BA 4JBWA 1QMGA 3C5VA 3QIAA 4TMTA 3WYAA 1SUAA 1UM9B 4M7RA 2BUBA 1P3DA 4LZPA 3B1YA 1FXUA 1YQWA 4GKAA 3WK5A 3K1TA 3IKJA 4L51A 3DO5A 5A9SA 4U8HA 3LGXA 2CJYA 3GGJA 4TYPA 1ES9A 5GP1A 1P72A 1BDIA 3E03A 4XEUA 2WPNA 4RJIA 1SBYA 1KVQA 1VLHA 3L4SO 1Q21A