4MIRA

The structure of brucella abortus plic in the hexagonal crystal form
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
b'MGEITIKLPDSVKVSTNSILYKCGAKDLSVTYYNAGDISLAKLELEDETVVASNVISGSGAKYAGSVYIWWTKGKTASLYNLIDNPEEDKPISCVEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural basis for the inhibition of human lysozyme by PliC from Brucella abortus
pubmed doi rcsb
source organism Brucella abortus bv. 1
molecule tags Hydrolase inhibitor
total genus 16
structure length 97
sequence length 97
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09864 MliC Membrane-bound lysozyme-inhibitor of c-type lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.200 Mainly Beta Beta Barrel Lipocalin Lipocalin 4mirA01
2F09A 4MIRA 3OE3A 4ML7B 4MISA 3F6ZB
chains in the Genus database with same CATH superfamily
2I5VO 5HA0A 1SWOA 4BX6B 3BSZE 1SWJA 5B5FA 3NQ3A 1JYJA 2IZBA 2RN4A 3BDRA 2VDFA 2JU3A 2WQAE 3CMPA 1SWAA 2KW1A 1AVDA 3FR5A 5CHKA 3U0DA 1MK5A 3H3IA 1KZWA 3FW4A 1RSTB 2Q9SA 2LKKA 1A3YA 4GJSA 5B5GA 1NBXA 2IZHB 4JHQA 4Y5DA 1I78A 2LB6A 4KH8A 2LBVA 3LV4A 1ICMA 1Y53X 1I04A 1NP1A 1OEJA 1JJUA 2HKDA 1DZMA 2RTCB 3PK2A 3HWDA 4O49A 4U8UN 1LPJA 5EPQA 4PJ2A 4YCHA 3WJCA 4ZJ0A 3WJBA 4WFVA 3B2JA 2ALLX 2F73A 2IZGB 2OY1O 5D8JA 1BSYA 1DC9A 1MX8A 1K24A 1VWPB 3C78X 3PH5A 5IRUA 1XCAA 1WBIA 1Y9TA 3APVA 2XKLA 1STRB 1YWCA 4ALBA 4FQBB 2GJ5A 2OZQA 2L9CA 2IZKA 1KXOA 3ELZA 5H9KA 5F6ZA 1EW3A 5B3MO 1Y55X 2CZTA 2I5ZO 2MF6A 2QO4A 2GTLO 1LNMA 2FR3A 3AEHA 3BS2A 1SWPA 3FA7A 2KTDA 3FR2A 1KT6A 4FBOA 2BS5A 4CPHA 5LJKA 3O22A 5L3YA 1DZPA 4Z2VA 5F58A 5IO6A 3FA8A 3T1DA 5KHPA 1GX8A 3OD9A 2YMSA 1SWBA 3FMZA 4HFOA 3UAQA 2R74A 4INNA 4O4OA 4ORSA 1FENA 5H9LA 1LICA 1TXLA 5F6BA 2NP1A 5HAEA 1EPBA 1B0OA 1K3BA 1KT3A 1RAVA 3JQOA 3Q6LA 1QY1A 4I3BA 3KQ0A 1E2TA 4EQAC 4Z27A 4MVIA 2GTLM 3KFGA 4U9CA 3VU1A 2P8GA 1PBOA 5H9NA 2HZQA 4ORRA 1E5PA 1VWQB 4DNEA 1PM1X 3OBLA 4EXZA 3NX1A 3UEXA 4CDFA 2HLVA 3WJEA 1ERBA 1VWAB 2OL6O 1KFFA 3P6HA 2WSJA 4BX5A 2ACPX 4I95A 1SWHA 1O8VA 1VWIB 4O3YA 1S7DA 1SWSA 2AH7X 3D9WA 2LBAA 3VG4A 5L8IA 2Q4NA 1LCVA 1BSQA 3NBXX 4RUNA 3WZQA 3CWKA 4YVBA 5FQ8E 1VWDB 4KC8A 3BU1A 3FEKA 1KT4A 2AT0X 1YP6A 2RTRB 3C76X 2OF9A 1UYOX 4ML7B 1SWEA 1N0SA 2QO6A 4QAEA 2AT5X 1CRBA 4IB9A 1VWNB 2RTHB 4O4SA 1CBIA 2RTEB 3UEWA 1SWNA 2RD7C 2X32A 1B8EA 4DCBA 2WUTA 3BX8A 4CK4A 4YDAA 5DPQA 4YFPA 1SWCA 3BLGA 3FIDA 3I17A 2MJIA 4LKTA 4GU8A 3PPTA 1H91A 1I9HA 2NNQA 4ZGUA 2KTSA 3CBCA 5FQ6E 3RDOA 3SLOA 3T6LA 2C1SA 4I9RA 5D45A 3MBTA 4ZGFA 3STMX 4MISA 1SWQA 1N9MA 2FGSA 3HOEA 4OS3A 3NQKA 1EI5A 1NQNA 3Q34A 1SWKA 2AMMX 1DV9A 4TLJA 4AZMA 2JMBA 1VYGA 4GDZA 4N7CA 1KT7A 3VG6A 2ZAGA 1FDQA 1SWFA 2O62A 4HPDA 3RE5A 1LIEA 4U8UM 1GXAA 4O4XA 5EEDA 3RE6A 3TZSA 2QMIA 5D4AA 3DSZA 5HZ5A 4CPHB 2HYSA 1VWEB 4NYQA 4BOEA 3SZJA 3RBYA 2OFMX 1O1VA 3FELA 3HWFA 4RUUA 1VWKB 3EYCA 1E06A 4IAXA 5IXGA 3ZZVA 2OVSA 4QZUA 1LIFA 1MEPA 4NW4A 2AT8X 2RTNB 1T8VA 2IFBA 2RTOB 2X4MA 4GGTA 1WUBA 3VPJE 1RBPA 3I0AA 2Q39A 3TGCA 3C77X 1AVGI 1MUPA 1CBRA 5D48A 2FKJA 2G7BA 4HPBA 4O4UA 5AQ6A 1QFVA 3GAQA 3QKGA 4WHIA 4QQ1A 3D4RA 4QGXA 3STNA 2RTLA 3P24A 4AZOA 2K62A 4AYHA 4D6AA 1N9YA 4QNIA 2JU7A 4AZNA 3SZIA 1JJXA 1LUQA 5FFHA 5JR8A 2W2BA 3B2LA 4XMFA 1GGLA 3FA9A 1ML7A 4MVEA 1RSUB 1SRHA 2A5CA 2RTBB 1SRJA 4NV7A 2C1QA 5HBSA 4XMHA 4A8ZA 4GDAA 4MVLA 5IO7A 1QG5A 3SLJA 1GX9A 4ZHCA 1OEKA 3FYFA 3X00A 1EIOA 4I9SA 3BX7A 2NNDA 5BYPA 1S44A 3OJYC 2AVIA 1QFTA 2G79A 3B2KA 3P6DA 1JBHA 2CZUA 1EALA 1GT3A 1TW4A 1UZ2X 3EBWA 1I4UA 5EZ2A 4HPCA 4ID2A 4OMWA 1ZNKA 1D2UA 2CBSA 2FWVA 3ELXA 3WZNA 4CPFA 4GH7A 2OY7A 2E4JA 1HQQA 2LFOA 2Y32A 2ZSCA 4K19A 5LJGA 4EEJA 3T6FA 5HCCC 2CAMA 2QCBA 2OFBA 1U18A 3LTWA 1X8PA 1LIDA 5BVQA 1PEEA 1HMRA 4B55A 4CDEA 3VG5A 1W6FA 2QOSC 2RA6A 2JN3A 4GE1A 5FAZA 4GD9A 1N43A 3KFHA 3GE2A 1IKEA 2X8TA 3NX2A 3P6EA 4L3RA 4YKOA 3RDSA 2IZDB 2LA7A 4ES7A 5FENA 4NLJA 3ZW0B 4O3WA 1MVGA 4IB7A 1B56A 4IMNA 5BVSA 3LHNA 3STKA 4LQZA 1LCZA 2OY5O 1SWLA 5CE4A 1STSB 4DQ3A 1ZNGA 5HZ6A 1AVEA 1X8UA 1VYFA 2A0AA 4CV7A 3U03A 4NNTA 2EU7X 3BRNA 3KFFA 1CBSA 2C4IA 1LCWA 2UZ2A 3PP6A 1AB0A 4XMEA 4QZTA 4BQUA 3FR4A 4GGZA 5D47A 3KZAA 3WJGA 3WZOA 3VE1A 1KQXA 3AKMA 1G74A 2OVDA 2RTGB 4GK9A 3UEVA 5LJEA 2RTQB 2WEWA 5L8OA 4YGHA 2AT6X 4Z6JA 2FS6A 2ACOA 1KL5A 1OBPA 2QOMA 1FE3A 4ARHA 1SWGA 1VYOA 5CSEA 4UU3A 1IFCA 1HXLA 1SWUA 1ZNLA 2RTDB 1NP4A 2VFBA 5HA1A 3ZW2A 2HMBA 2PY1A 2A2GA 1SXXA 4IB8A 4Y0PA 1MOYA 2Z4HA 3EW2A 1MX7A 5LJCA 2YG2A 3P6CA 3S5VA 4GNWA 3RY1A 4OEMA 4U3QA 3WVMA 4YMYA 1SLEB 3MVFA 3WYPA 4BBOA 1LELA 5CYBA 3PECA 4ZHDA 4ZHFA 1MDCA 2BSZA 4GZVA 4CDDA 4COTA 3HWEA 1E00A 3B2IA 4OS0A 5B11O 1JMXA 1YP7A 3FW5A 3NR3A 4NP1A 2BHVA 1DF8A 1NC9A 4TKJA 2XSTA 3RWXA 3FA6A 4AW8A 5BVTA 1JMZA 2GH7A 2POAA 3VHHA 1TOWA 5AJCA 4Y0SA 4ZH6A 3RKGA 4AZPA 1BSOA 4Y59A 1SXWA 1DF3A 4IRWA 1STPA 1E02A 2AKQA 2QO5A 4IBAA 4CSBA 1RLBE 5LJBA 3ZUOA 4A1HA 1SRFA 1EXSA 3WYQA 1UYNX 1VWLB 2RTAA 3B2HA 1SWDA 3CR6A 4O9SA 4QRLA 1HQPA 1X71A 2RTIB 3F8AA 4YFQA 4TQ2A 1SLDB 3N91A 1OSPO 2BLGA 3D95A 3PDFA 1QY0A 2A3FX 4YBPA 4C5PA 2Z4IA 1FELA 2FRSA 1EQDA 5F1EA 2WPUA 3ZW0A 5HTDA 2CM9A 4BCSA 4LKPA 4CPEA 3F6ZB 2OF8A 3FIQA 3KFIA 4NV8A 4IAWA 4MVKA 2NNEA 5KIDA 1Y9LA 1A2DA 3AUMO 1MM9A 2W2AA 4QYNA 3MG5A 4YCEA 4OELA 5K68A 2WWPA 3CKGA 1QQSA 3P6GA 3RDXA 3NPOA 3HPEA 4ZH9A 5LKEA 2OVAA 2JW1A 1RXKA 2FR2A 4MEEA 4XMCA 2PI3O 5EDCA 3CQNA 2OYBO 4EDEA 3VE2A 1ZNEA 1LIBA 4KIIA 5HCEC 2FHLA 3CBSA 1KZXA 5LJHA 1D3SA 3VHMA 1EIIA 5C0NA 2A13A 2RTPB 2JGSA 4LZUA 1SREA 2IZEB 3NQ9A 4IABA 3NP1A 4KT5A 1YWDA 1P6PA 4GETA 2L68A 1NDJA 1YIVA 3SOTA 4U46A 3K3LA 4BGFA 2K23A 5IO5A 2AT3X 4YGGA 2Q2PA 5IRWA 1DZKA 1BEBA 1EUOA 3U9PC 1GT5A 1JV4A 2BS6A 2RQ0A 2FHNX 1ICNA 4IMOA 1PBYA 1AQBA 4YBUA 4ZCBA 1IKJA 3PH6A 4XMDA 1XKIA 3VHIA 4Z28A 4ORUA 3WJFA 2IZFB 4A1YA 2X8FA 3EMMA 2W2FA 4EKVA 4HWMA 4NNSA 2RTKA 2MWHA 2FTBA 2X46A 1Y0GA 2X56A 2OFAA 2WR6A 4LZVA 3S60A 5KICA 1T68X 4FGIB 2JOZA 5EEEA 2DJGA 4QGVA 1G5WA 3BU9A 4WBKA 3OE3A 1KT5A 4OS8A 3T2WA 3WZPA 3TGBA 3IFBA 1IJ8A 1LDOA 1KQWA 1EPAA 1PMPA 2MO5A 1OBUA 2WEXA 3SLTA 5F2BA 5L8NA 3S5XA 4M6SA 2OL8O 4BJ8A 4ZHGA 3PQSA 3JS1A 2MHDA 5HZ8A 5HZQA 1BWYA 2QM9A 3HTYA 4Y0QA 1CJ5A 3V8UA 1I05A 1Y52X 2AL0X 2G78A 3RSWA 4Z2OA 1JIWI 1JYDA 1BRQA 1GKAA 3S26A 1O1UA 3ZW1A 4ON1A 1GX3A 1RXJA 2OY8A 2R73A 5F7GA 1VWRB 4OKAA 4CDCA 4I3DA 4GNYA 1SA8A 3NADA 3RZYA 2Y3FA 2A2UA 3HWGA 3SAOA 1FEMA 2DM5A 1GT1A 2OVEA 4GKCA 5FQ7E 5AJBA 5B27A 2L67A 3ZQ3A 1X8NA 2OFRX 2RTJA 2G5LA 4PSQA 1SY0A 1SRGA 1RXHA 2L5PA 4DQ4A 1HMSA 4GUZA 2ASNX 2M4LA 1W5RA 1ERXA 2RTFB 5H9AA 1OPBA 1ZNHA 1X8QA 5HWZA 3TF6A 4ZHHA 4OMXA 4I6SA 1TVQA 2FT9A 3RDUA 4YGZA 2F09A 3RY2A 1QY2A 1ZNDA 1I06A 2FLJA 4FBRA 1BLRA 1B4MA 1GM6A 4ORXA 1ACDA 3EW1A 2HNXA 5AEOA 1Z24A 1ALBA 1VPRA 1CBQA 1T0VA 3HOLA 3VGWA 1W4TA 1HBQA 3MX7A 3WJDA 1AELA 3APXA 2HZRA 1HMTA 3UEUA 1U0XA 2CM4A 1YUPA 3VG7A 4M7MA 1QABE 3CQRA 3EM0A 4BX7A 2BT9A 1VWMB 2Q2MA 3AKNA 3EC5A 1VWOB 1ADLA 3P02A 2VFCA 3FEPA 1HY2A 4JGLA 3D96A 4NYRA 1L6MA 2KT4B 3E3CA 5B10O 2RCQA 1VWBB 1HBPA 1ZRYA 4YDBA 3ZWEA 1SMPI 1FJ1E 1X89A 4TKBA 4BVMA 1LDQA 1FTPA 2RCTA 4GJVA 1N7YA 5HTEA 3PQUA 3APUA 2CBRA 4A60A 1BM5A 3FENA 2A5BA 1N4JA 4ORYA 4BX6A 4QGWA 3SZHA 1OBQA 2UYWA 1SXUA 4KC7A 4TNNA 4Y0RA 2RTMA 1VWCB 1X8OA 4AZRA 4EFGA 1VWHB 3L4RA 2IZLB 1JZUA 3IA8A 1YWAA 3T2XA 1KL3A 1GT4A 3BY0A 1A18A 1VWFB 2IZJA 1SY1A 4YKMA 1LKEA 1LF7A 3ZUIA 4YH0A 1BJ7A 1GKAB 2OL7A 5JD2A 3WBGA 1S2PA 4AZQA 3F9DA 3VG3A 3RDMA 5IRAA 3ZW1B 1OPAA 4XMGA 2DJFA 3FLLA 5B2AO 1QWDA 1KOIA 3QQ2A 3O19A 4QYPA 1PTSA 3G7XA 3KVNA 2X55A 2A8GA 3FDCA 4WFUA 4U8UO 1UREA 4NLIA 1JQPA 1U17A 5EDBA 4O3ZA 1R0UA 3RDQA 3HK1A 2ZAIA 3P6FA 5H8TA 1DFVA 3DTQA 5B29A 2G8CO 4IB6A 1SLFB 2X8SA 2GTLN 4TJZA 2BC3A 1SY2A 1YWBA 2N93A 2GC9A 2R56A 4UU2A 1G7NA 1HXZA 1TOUA 3WXQA 1LFOA 3CKFA 3D97A 1OEEA 4KCAA 1SWRA 3EBKA 1SRIA 3WOVA 1SXYA 4N7DA 5K67A 4Z2PA 5DG4A 3ZI8A 1IFBA 3PEDA 1HN2A 2IZAA 4CPIA 1NGLA 2JU8A 4D6BA 2AF5A 2X45A 2Y3EA 4GGRA 2FS7A 1G85A 1VWGB 2GTFX 2MM3A 3O2YA 4JO6A 2IZIA 4O3XB 1JJJA 1SWTA 1IIUA 1BRPA 2WQ9A 4JNJA 2KD2A 4GRJA 4TKHA 4FBVA 1SY3A 4ODDA 5K06A 5LKFA 1KGLA 4ORWA 4YFRA 1DZJA 1SLGB 4BX7B 2FKGA 2ANSA 3TGAA 4I60A 3APWA 4ALOA 5HCDC 4MIRA 2F01A 3MM0A 1BBPA 2X34A 4BX5B 4HPAA 1VWJB 3VG2A 1IW2A 3JSQA 4I3CA 5LJDA 4ZFXA 4ZR2A 5HZ9A 1NQMA 4R0BA 1A57A 1KL4A 4L1NA 2IZCB
chains in the Genus database with same CATH topology
5HA0A 3BSZE 3NQ3A 1JYJA 2RN4A 3BDRA 2JU3A 2WQAE 3CMPA 3FR5A 2KW1A 3U0DA 1KZWA 3H3IA 3FW4A 2Q9SA 2LKKA 1A3YA 2LB6A 4KH8A 2LBVA 3LV4A 1ICMA 3VG5A 1I04A 1NP1A 1OEJA 4O49A 1DZMA 4U8UN 3HWDA 5EPQA 1LPJA 4PJ2A 4YCHA 3WJCA 4ZJ0A 3WJBA 4WFVA 3B2JA 2ALLX 2F73A 5D8JA 1BSYA 1DC9A 1MX8A 3C78X 3PH5A 1XCAA 1Y9TA 3APVA 4ALBA 2XKLA 1YWCA 4FQBB 2GJ5A 2OZQA 2L9CA 1KXOA 3ELZA 5H9KA 5F6ZA 1EW3A 2CZTA 2QO4A 3E3CA 3FA7A 4GDZA 2GTLO 1LNMA 2FR3A 3BS2A 3V8UA 3FR2A 2KTDA 1KT6A 4FBOA 2BS5A 5LJKA 3O22A 1DZPA 5IO6A 5F58A 3FA8A 3T1DA 5KHPA 1GX8A 3OD9A 2YMSA 3FMZA 4HFOA 3UAQA 2R74A 4INNA 4O4OA 4ORSA 1FENA 5H9LA 1LICA 1TXLA 5F6BA 2NP1A 5HAEA 1EPBA 1B0OA 1KT3A 3JQOA 3Q6LA 4TKJA 4EQAC 1QY1A 4I3BA 3KQ0A 4MVIA 2GTLM 3KFGA 4U9CA 3VU1A 2P8GA 1PBOA 5H9NA 2HZQA 4ORRA 1E5PA 4EXZA 1PM1X 3OBLA 3NX1A 3UEXA 2HLVA 3WJEA 1ERBA 3P6HA 2WSJA 2ACPX 4I95A 4O3YA 1O8VA 1S7DA 2AH7X 2LBAA 3VG4A 5L8IA 2Q4NA 1BSQA 3NBXX 4RUNA 3CWKA 5FQ8E 4KC8A 3BU1A 3FEKA 1KT4A 2AT0X 1YP6A 3C76X 4ML7B 1N0SA 2QO6A 4QAEA 2AT5X 1CRBA 4IB9A 4O4SA 1CBIA 3UEWA 2RD7C 1B8EA 2WUTA 3BX8A 4CK4A 4YDAA 5DPQA 4YFPA 3BLGA 3I17A 2MJIA 4LKTA 4GU8A 3PPTA 1H91A 2NNQA 4ZGUA 2KTSA 3CBCA 5FQ6E 4I9RA 5D45A 3MBTA 4ZGFA 3STMX 4MISA 3HOEA 4OS3A 3NQKA 1EI5A 2AMMX 1DV9A 4TLJA 4AZMA 2JMBA 1VYGA 4N7CA 1KT7A 3VG6A 2ZAGA 1FDQA 4HPDA 2O62A 1LIEA 4U8UM 1GXAA 4O4XA 5EEDA 3TZSA 2QMIA 5D4AA 3DSZA 5HZ5A 2HYSA 4NYQA 4BOEA 3RBYA 2OFMX 1O1VA 3FELA 3HWFA 4RUUA 3EYCA 1E06A 4IAXA 3ZZVA 2OVSA 4QZUA 1LIFA 4NW4A 2AT8X 1T8VA 2IFBA 3VPJE 1RBPA 3I0AA 2Q39A 3TGCA 3C77X 1AVGI 1MUPA 1CBRA 5D48A 2G7BA 4HPBA 4O4UA 5AQ6A 1QFVA 3GAQA 3QKGA 4WHIA 4QQ1A 3D4RA 4QGXA 3STNA 3P24A 4AZOA 2K62A 4AYHA 4D6AA 4QNIA 2JU7A 4AZNA 1JJXA 5FFHA 5JR8A 2W2BA 3B2LA 4XMFA 1GGLA 3FA9A 1ML7A 4MVEA 5HBSA 4XMHA 4A8ZA 4MVLA 5IO7A 1QG5A 4ZHCA 1GX9A 1OEKA 3FYFA 1EIOA 4I9SA 3BX7A 2NNDA 5BYPA 1S44A 3OJYC 1QFTA 2G79A 3B2KA 3P6DA 1JBHA 2CZUA 1EALA 1GT3A 1TW4A 1UZ2X 3EBWA 1I4UA 5EZ2A 4HPCA 4ID2A 4OMWA 1ZNKA 1D2UA 2CBSA 2FWVA 3ELXA 4GH7A 2E4JA 2LFOA 4K19A 5LJGA 4EEJA 5HCCC 1PEEA 1U18A 1X8PA 1LIDA 5BVQA 1HMRA 2QOSC 2RA6A 2JN3A 4GE1A 5FAZA 4L3RA 3KFHA 3GE2A 1IKEA 2X8TA 3NX2A 3P6EA 4ES7A 4YKOA 2LA7A 5FENA 4NLJA 3ZW0B 4O3WA 1MVGA 4IB7A 1B56A 4IMNA 5BVSA 3LHNA 3STKA 4LQZA 5CE4A 4DQ3A 1ZNGA 5HZ6A 1X8UA 2A0AA 1VYFA 4CV7A 3U03A 4NNTA 2EU7X 3BRNA 3KFFA 1CBSA 3PP6A 4XMEA 1AB0A 4QZTA 4BQUA 3FR4A 5D47A 3KZAA 3WJGA 3VE1A 1KQXA 3AKMA 1G74A 2OVDA 4GK9A 3UEVA 5LJEA 2WEWA 5L8OA 4YGHA 2AT6X 2FS6A 2ACOA 1OBPA 1FE3A 4ARHA 4UU3A 1IFCA 1ZNLA 1NP4A 5HA1A 3ZW2A 2HMBA 2PY1A 2A2GA 1SXXA 4IB8A 4Y0PA 2Z4HA 1MX7A 5LJCA 2YG2A 3P6CA 3S5VA 4GNWA 4U3QA 3WVMA 4YMYA 3MVFA 5CYBA 3PECA 4ZHDA 4ZHFA 1MDCA 4GZVA 4COTA 3HWEA 1E00A 3B2IA 4OS0A 1YP7A 3NR3A 3FW5A 4NP1A 2BHVA 2XSTA 3RWXA 3FA6A 4AW8A 5BVTA 2POAA 4AZPA 1TOWA 5AJCA 4Y0SA 4ZH6A 3RKGA 1BSOA 1SXWA 1DF3A 1E02A 2AKQA 2QO5A 4IBAA 4CSBA 1RLBE 5LJBA 3ZUOA 4A1HA 1EXSA 3B2HA 4O9SA 3CR6A 4QRLA 1HQPA 1X71A 3F8AA 4YFQA 4TQ2A 3N91A 2BLGA 3D95A 1QY0A 2A3FX 4YBPA 2Z4IA 1FELA 2FRSA 1EQDA 5F1EA 3ZW0A 5HTDA 2CM9A 4LKPA 3F6ZB 3FIQA 3KFIA 4IAWA 4MVKA 2NNEA 5KIDA 1Y9LA 1A2DA 2W2AA 4QYNA 4YCEA 2WWPA 1QQSA 3P6GA 3NPOA 4ZH9A 5LKEA 2OVAA 2JW1A 2FR2A 4XMCA 5EDCA 3CQNA 4EDEA 3VE2A 1ZNEA 1LIBA 4KIIA 5HCEC 3CBSA 1KZXA 5LJHA 1D3SA 1EIIA 5C0NA 2A13A 4LZUA 3NQ9A 4IABA 4KT5A 3NP1A 1YWDA 1P6PA 4GETA 2L68A 5IO5A 1YIVA 3SOTA 3K3LA 2K23A 2AT3X 4YGGA 2Q2PA 1DZKA 1BEBA 1EUOA 3U9PC 1GT5A 1JV4A 2BS6A 2RQ0A 1ICNA 4IMOA 1AQBA 4YBUA 4ZCBA 1IKJA 3PH6A 4XMDA 1XKIA 3WJFA 4A1YA 4ORUA 1A57A 2X8FA 3EMMA 2W2FA 4HWMA 4NNSA 2MWHA 2FTBA 2X46A 2WR6A 4LZVA 3S60A 5KICA 1T68X 4FGIB 2JOZA 5EEEA 4QGVA 1G5WA 3BU9A 4WBKA 3OE3A 1KT5A 4OS8A 3TGBA 3IFBA 1KQWA 1EPAA 1PMPA 2MO5A 1OBUA 2WEXA 5L8NA 3S5XA 4M6SA 4ZHGA 3PQSA 3JS1A 2MHDA 5HZ8A 5HZQA 1BWYA 2QM9A 3HTYA 4Y0QA 1CJ5A 1I05A 2AL0X 2G78A 3RSWA 1JIWI 1JYDA 1BRQA 1GKAA 3S26A 1O1UA 3ZW1A 4ON1A 5F7GA 2R73A 4I3DA 4GNYA 1SA8A 3NADA 3RZYA 2A2UA 3HWGA 3SAOA 1FEMA 2DM5A 1GT1A 2OVEA 4GKCA 5FQ7E 5AJBA 5B27A 2L67A 3ZQ3A 1X8NA 2OFRX 4DQ4A 4PSQA 1SY0A 2L5PA 1HMSA 2ASNX 2M4LA 1ERXA 5H9AA 1OPBA 1ZNHA 1X8QA 5HWZA 3TF6A 4ZHHA 4OMXA 4I6SA 1TVQA 2FT9A 4YGZA 2F09A 1QY2A 1ZNDA 1I06A 2FLJA 4FBRA 1BLRA 1B4MA 1GM6A 4ORXA 1ACDA 2HNXA 5AEOA 1Z24A 1ALBA 1VPRA 1CBQA 1T0VA 3HOLA 3WJDA 1HBQA 3MX7A 1AELA 3APXA 2HZRA 1HMTA 3UEUA 1U0XA 2CM4A 1YUPA 3VG7A 4M7MA 1QABE 3CQRA 3EM0A 2BT9A 2Q2MA 3AKNA 1ADLA 3P02A 3FEPA 4JGLA 3D96A 4NYRA 1L6MA 2KT4B 2RCQA 4YDBA 1HBPA 1ZRYA 3ZWEA 1SMPI 1X89A 4TKBA 4BVMA 1FTPA 2RCTA 5HTEA 3PQUA 3APUA 2CBRA 4A60A 1BM5A 3FENA 4ORYA 4QGWA 1OBQA 1SXUA 4KC7A 4TNNA 4Y0RA 1X8OA 4AZRA 4EFGA 3L4RA 1JZUA 3IA8A 1YWAA 1GT4A 3BY0A 1A18A 1SY1A 4YKMA 1LKEA 1LF7A 3ZUIA 4YH0A 1BJ7A 1GKAB 4AZQA 3WBGA 1S2PA 3F9DA 3VG3A 3ZW1B 1OPAA 4XMGA 3FLLA 1QWDA 1KOIA 4QYPA 3O19A 3G7XA 4WFUA 4U8UO 1UREA 4NLIA 1U17A 5EDBA 4O3ZA 1R0UA 3HK1A 2ZAIA 3P6FA 5H8TA 1DFVA 3DTQA 5B29A 4IB6A 2X8SA 2GTLN 4TJZA 2R56A 1SY2A 1YWBA 2N93A 2GC9A 4UU2A 1G7NA 1TOUA 3WXQA 1LFOA 3D97A 1OEEA 4KCAA 3EBKA 3WOVA 1SXYA 4N7DA 5DG4A 3ZI8A 1IFBA 3PEDA 1HN2A 1NGLA 2JU8A 4D6BA 2X45A 2FS7A 1G85A 4O3XB 2GTFX 2MM3A 3O2YA 1JJJA 1IIUA 1BRPA 2WQ9A 2KD2A 4GRJA 4TKHA 4FBVA 1SY3A 4ODDA 5K06A 5LKFA 1KGLA 4ORWA 4YFRA 1DZJA 2ANSA 3TGAA 3APWA 4ALOA 5HCDC 4MIRA 1BBPA 4HPAA 3VG2A 1IW2A 3JSQA 4I3CA 5LJDA 4ZFXA 4ZR2A 5HZ9A 4R0BA 4L1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F09 A;  4MIR A;  3OE3 A;  4ML7 B;  4MIS A;  3F6Z B; 
#chains in the Genus database with same CATH topology
 2I5V O;  5HA0 A;  1SWO A;  4BX6 B;  3BSZ E;  1SWJ A;  5B5F A;  3NQ3 A;  1JYJ A;  2IZB A;  2RN4 A;  3BDR A;  2VDF A;  2JU3 A;  2WQA E;  3CMP A;  1SWA A;  2KW1 A;  1AVD A;  3FR5 A;  5CHK A;  3U0D A;  1MK5 A;  3H3I A;  1KZW A;  3FW4 A;  1RST B;  2Q9S A;  2LKK A;  1A3Y A;  4GJS A;  5B5G A;  1NBX A;  2IZH B;  4JHQ A;  4Y5D A;  1I78 A;  2LB6 A;  4KH8 A;  2LBV A;  3LV4 A;  1ICM A;  1Y53 X;  1I04 A;  1NP1 A;  1OEJ A;  1JJU A;  2HKD A;  1DZM A;  2RTC B;  3PK2 A;  3HWD A;  4O49 A;  4U8U N;  1LPJ A;  5EPQ A;  4PJ2 A;  4YCH A;  3WJC A;  4ZJ0 A;  3WJB A;  4WFV A;  3B2J A;  2ALL X;  2F73 A;  2IZG B;  2OY1 O;  5D8J A;  1BSY A;  1DC9 A;  1MX8 A;  1K24 A;  1VWP B;  3C78 X;  3PH5 A;  5IRU A;  1XCA A;  1WBI A;  1Y9T A;  3APV A;  2XKL A;  1STR B;  1YWC A;  4ALB A;  4FQB B;  2GJ5 A;  2OZQ A;  2L9C A;  2IZK A;  1KXO A;  3ELZ A;  5H9K A;  5F6Z A;  1EW3 A;  5B3M O;  1Y55 X;  2CZT A;  2I5Z O;  2MF6 A;  2QO4 A;  2GTL O;  1LNM A;  2FR3 A;  3AEH A;  3BS2 A;  1SWP A;  3FA7 A;  2KTD A;  3FR2 A;  1KT6 A;  4FBO A;  2BS5 A;  4CPH A;  5LJK A;  3O22 A;  5L3Y A;  1DZP A;  4Z2V A;  5F58 A;  5IO6 A;  3FA8 A;  3T1D A;  5KHP A;  1GX8 A;  3OD9 A;  2YMS A;  1SWB A;  3FMZ A;  4HFO A;  3UAQ A;  2R74 A;  4INN A;  4O4O A;  4ORS A;  1FEN A;  5H9L A;  1LIC A;  1TXL A;  5F6B A;  2NP1 A;  5HAE A;  1EPB A;  1B0O A;  1K3B A;  1KT3 A;  1RAV A;  3JQO A;  3Q6L A;  1QY1 A;  4I3B A;  3KQ0 A;  1E2T A;  4EQA C;  4Z27 A;  4MVI A;  2GTL M;  3KFG A;  4U9C A;  3VU1 A;  2P8G A;  1PBO A;  5H9N A;  2HZQ A;  4ORR A;  1E5P A;  1VWQ B;  4DNE A;  1PM1 X;  3OBL A;  4EXZ A;  3NX1 A;  3UEX A;  4CDF A;  2HLV A;  3WJE A;  1ERB A;  1VWA B;  2OL6 O;  1KFF A;  3P6H A;  2WSJ A;  4BX5 A;  2ACP X;  4I95 A;  1SWH A;  1O8V A;  1VWI B;  4O3Y A;  1S7D A;  1SWS A;  2AH7 X;  3D9W A;  2LBA A;  3VG4 A;  5L8I A;  2Q4N A;  1LCV A;  1BSQ A;  3NBX X;  4RUN A;  3WZQ A;  3CWK A;  4YVB A;  5FQ8 E;  1VWD B;  4KC8 A;  3BU1 A;  3FEK A;  1KT4 A;  2AT0 X;  1YP6 A;  2RTR B;  3C76 X;  2OF9 A;  1UYO X;  4ML7 B;  1SWE A;  1N0S A;  2QO6 A;  4QAE A;  2AT5 X;  1CRB A;  4IB9 A;  1VWN B;  2RTH B;  4O4S A;  1CBI A;  2RTE B;  3UEW A;  1SWN A;  2RD7 C;  2X32 A;  1B8E A;  4DCB A;  2WUT A;  3BX8 A;  4CK4 A;  4YDA A;  5DPQ A;  4YFP A;  1SWC A;  3BLG A;  3FID A;  3I17 A;  2MJI A;  4LKT A;  4GU8 A;  3PPT A;  1H91 A;  1I9H A;  2NNQ A;  4ZGU A;  2KTS A;  3CBC A;  5FQ6 E;  3RDO A;  3SLO A;  3T6L A;  2C1S A;  4I9R A;  5D45 A;  3MBT A;  4ZGF A;  3STM X;  4MIS A;  1SWQ A;  1N9M A;  2FGS A;  3HOE A;  4OS3 A;  3NQK A;  1EI5 A;  1NQN A;  3Q34 A;  1SWK A;  2AMM X;  1DV9 A;  4TLJ A;  4AZM A;  2JMB A;  1VYG A;  4GDZ A;  4N7C A;  1KT7 A;  3VG6 A;  2ZAG A;  1FDQ A;  1SWF A;  2O62 A;  4HPD A;  3RE5 A;  1LIE A;  4U8U M;  1GXA A;  4O4X A;  5EED A;  3RE6 A;  3TZS A;  2QMI A;  5D4A A;  3DSZ A;  5HZ5 A;  4CPH B;  2HYS A;  1VWE B;  4NYQ A;  4BOE A;  3SZJ A;  3RBY A;  2OFM X;  1O1V A;  3FEL A;  3HWF A;  4RUU A;  1VWK B;  3EYC A;  1E06 A;  4IAX A;  5IXG A;  3ZZV A;  2OVS A;  4QZU A;  1LIF A;  1MEP A;  4NW4 A;  2AT8 X;  2RTN B;  1T8V A;  2IFB A;  2RTO B;  2X4M A;  4GGT A;  1WUB A;  3VPJ E;  1RBP A;  3I0A A;  2Q39 A;  3TGC A;  3C77 X;  1AVG I;  1MUP A;  1CBR A;  5D48 A;  2FKJ A;  2G7B A;  4HPB A;  4O4U A;  5AQ6 A;  1QFV A;  3GAQ A;  3QKG A;  4WHI A;  4QQ1 A;  3D4R A;  4QGX A;  3STN A;  2RTL A;  3P24 A;  4AZO A;  2K62 A;  4AYH A;  4D6A A;  1N9Y A;  4QNI A;  2JU7 A;  4AZN A;  3SZI A;  1JJX A;  1LUQ A;  5FFH A;  5JR8 A;  2W2B A;  3B2L A;  4XMF A;  1GGL A;  3FA9 A;  1ML7 A;  4MVE A;  1RSU B;  1SRH A;  2A5C A;  2RTB B;  1SRJ A;  4NV7 A;  2C1Q A;  5HBS A;  4XMH A;  4A8Z A;  4GDA A;  4MVL A;  5IO7 A;  1QG5 A;  3SLJ A;  1GX9 A;  4ZHC A;  1OEK A;  3FYF A;  3X00 A;  1EIO A;  4I9S A;  3BX7 A;  2NND A;  5BYP A;  1S44 A;  3OJY C;  2AVI A;  1QFT A;  2G79 A;  3B2K A;  3P6D A;  1JBH A;  2CZU A;  1EAL A;  1GT3 A;  1TW4 A;  1UZ2 X;  3EBW A;  1I4U A;  5EZ2 A;  4HPC A;  4ID2 A;  4OMW A;  1ZNK A;  1D2U A;  2CBS A;  2FWV A;  3ELX A;  3WZN A;  4CPF A;  4GH7 A;  2OY7 A;  2E4J A;  1HQQ A;  2LFO A;  2Y32 A;  2ZSC A;  4K19 A;  5LJG A;  4EEJ A;  3T6F A;  5HCC C;  2CAM A;  2QCB A;  2OFB A;  1U18 A;  3LTW A;  1X8P A;  1LID A;  5BVQ A;  1PEE A;  1HMR A;  4B55 A;  4CDE A;  3VG5 A;  1W6F A;  2QOS C;  2RA6 A;  2JN3 A;  4GE1 A;  5FAZ A;  4GD9 A;  1N43 A;  3KFH A;  3GE2 A;  1IKE A;  2X8T A;  3NX2 A;  3P6E A;  4L3R A;  4YKO A;  3RDS A;  2IZD B;  2LA7 A;  4ES7 A;  5FEN A;  4NLJ A;  3ZW0 B;  4O3W A;  1MVG A;  4IB7 A;  1B56 A;  4IMN A;  5BVS A;  3LHN A;  3STK A;  4LQZ A;  1LCZ A;  2OY5 O;  1SWL A;  5CE4 A;  1STS B;  4DQ3 A;  1ZNG A;  5HZ6 A;  1AVE A;  1X8U A;  1VYF A;  2A0A A;  4CV7 A;  3U03 A;  4NNT A;  2EU7 X;  3BRN A;  3KFF A;  1CBS A;  2C4I A;  1LCW A;  2UZ2 A;  3PP6 A;  1AB0 A;  4XME A;  4QZT A;  4BQU A;  3FR4 A;  4GGZ A;  5D47 A;  3KZA A;  3WJG A;  3WZO A;  3VE1 A;  1KQX A;  3AKM A;  1G74 A;  2OVD A;  2RTG B;  4GK9 A;  3UEV A;  5LJE A;  2RTQ B;  2WEW A;  5L8O A;  4YGH A;  2AT6 X;  4Z6J A;  2FS6 A;  2ACO A;  1KL5 A;  1OBP A;  2QOM A;  1FE3 A;  4ARH A;  1SWG A;  1VYO A;  5CSE A;  4UU3 A;  1IFC A;  1HXL A;  1SWU A;  1ZNL A;  2RTD B;  1NP4 A;  2VFB A;  5HA1 A;  3ZW2 A;  2HMB A;  2PY1 A;  2A2G A;  1SXX A;  4IB8 A;  4Y0P A;  1MOY A;  2Z4H A;  3EW2 A;  1MX7 A;  5LJC A;  2YG2 A;  3P6C A;  3S5V A;  4GNW A;  3RY1 A;  4OEM A;  4U3Q A;  3WVM A;  4YMY A;  1SLE B;  3MVF A;  3WYP A;  4BBO A;  1LEL A;  5CYB A;  3PEC A;  4ZHD A;  4ZHF A;  1MDC A;  2BSZ A;  4GZV A;  4CDD A;  4COT A;  3HWE A;  1E00 A;  3B2I A;  4OS0 A;  5B11 O;  1JMX A;  1YP7 A;  3FW5 A;  3NR3 A;  4NP1 A;  2BHV A;  1DF8 A;  1NC9 A;  4TKJ A;  2XST A;  3RWX A;  3FA6 A;  4AW8 A;  5BVT A;  1JMZ A;  2GH7 A;  2POA A;  3VHH A;  1TOW A;  5AJC A;  4Y0S A;  4ZH6 A;  3RKG A;  4AZP A;  1BSO A;  4Y59 A;  1SXW A;  1DF3 A;  4IRW A;  1STP A;  1E02 A;  2AKQ A;  2QO5 A;  4IBA A;  4CSB A;  1RLB E;  5LJB A;  3ZUO A;  4A1H A;  1SRF A;  1EXS A;  3WYQ A;  1UYN X;  1VWL B;  2RTA A;  3B2H A;  1SWD A;  3CR6 A;  4O9S A;  4QRL A;  1HQP A;  1X71 A;  2RTI B;  3F8A A;  4YFQ A;  4TQ2 A;  1SLD B;  3N91 A;  1OSP O;  2BLG A;  3D95 A;  3PDF A;  1QY0 A;  2A3F X;  4YBP A;  4C5P A;  2Z4I A;  1FEL A;  2FRS A;  1EQD A;  5F1E A;  2WPU A;  3ZW0 A;  5HTD A;  2CM9 A;  4BCS A;  4LKP A;  4CPE A;  3F6Z B;  2OF8 A;  3FIQ A;  3KFI A;  4NV8 A;  4IAW A;  4MVK A;  2NNE A;  5KID A;  1Y9L A;  1A2D A;  3AUM O;  1MM9 A;  2W2A A;  4QYN A;  3MG5 A;  4YCE A;  4OEL A;  5K68 A;  2WWP A;  3CKG A;  1QQS A;  3P6G A;  3RDX A;  3NPO A;  3HPE A;  4ZH9 A;  5LKE A;  2OVA A;  2JW1 A;  1RXK A;  2FR2 A;  4MEE A;  4XMC A;  2PI3 O;  5EDC A;  3CQN A;  2OYB O;  4EDE A;  3VE2 A;  1ZNE A;  1LIB A;  4KII A;  5HCE C;  2FHL A;  3CBS A;  1KZX A;  5LJH A;  1D3S A;  3VHM A;  1EII A;  5C0N A;  2A13 A;  2RTP B;  2JGS A;  4LZU A;  1SRE A;  2IZE B;  3NQ9 A;  4IAB A;  3NP1 A;  4KT5 A;  1YWD A;  1P6P A;  4GET A;  2L68 A;  1NDJ A;  1YIV A;  3SOT A;  4U46 A;  3K3L A;  4BGF A;  2K23 A;  5IO5 A;  2AT3 X;  4YGG A;  2Q2P A;  5IRW A;  1DZK A;  1BEB A;  1EUO A;  3U9P C;  1GT5 A;  1JV4 A;  2BS6 A;  2RQ0 A;  2FHN X;  1ICN A;  4IMO A;  1PBY A;  1AQB A;  4YBU A;  4ZCB A;  1IKJ A;  3PH6 A;  4XMD A;  1XKI A;  3VHI A;  4Z28 A;  4ORU A;  3WJF A;  2IZF B;  4A1Y A;  2X8F A;  3EMM A;  2W2F A;  4EKV A;  4HWM A;  4NNS A;  2RTK A;  2MWH A;  2FTB A;  2X46 A;  1Y0G A;  2X56 A;  2OFA A;  2WR6 A;  4LZV A;  3S60 A;  5KIC A;  1T68 X;  4FGI B;  2JOZ A;  5EEE A;  2DJG A;  4QGV A;  1G5W A;  3BU9 A;  4WBK A;  3OE3 A;  1KT5 A;  4OS8 A;  3T2W A;  3WZP A;  3TGB A;  3IFB A;  1IJ8 A;  1LDO A;  1KQW A;  1EPA A;  1PMP A;  2MO5 A;  1OBU A;  2WEX A;  3SLT A;  5F2B A;  5L8N A;  3S5X A;  4M6S A;  2OL8 O;  4BJ8 A;  4ZHG A;  3PQS A;  3JS1 A;  2MHD A;  5HZ8 A;  5HZQ A;  1BWY A;  2QM9 A;  3HTY A;  4Y0Q A;  1CJ5 A;  3V8U A;  1I05 A;  1Y52 X;  2AL0 X;  2G78 A;  3RSW A;  4Z2O A;  1JIW I;  1JYD A;  1BRQ A;  1GKA A;  3S26 A;  1O1U A;  3ZW1 A;  4ON1 A;  1GX3 A;  1RXJ A;  2OY8 A;  2R73 A;  5F7G A;  1VWR B;  4OKA A;  4CDC A;  4I3D A;  4GNY A;  1SA8 A;  3NAD A;  3RZY A;  2Y3F A;  2A2U A;  3HWG A;  3SAO A;  1FEM A;  2DM5 A;  1GT1 A;  2OVE A;  4GKC A;  5FQ7 E;  5AJB A;  5B27 A;  2L67 A;  3ZQ3 A;  1X8N A;  2OFR X;  2RTJ A;  2G5L A;  4PSQ A;  1SY0 A;  1SRG A;  1RXH A;  2L5P A;  4DQ4 A;  1HMS A;  4GUZ A;  2ASN X;  2M4L A;  1W5R A;  1ERX A;  2RTF B;  5H9A A;  1OPB A;  1ZNH A;  1X8Q A;  5HWZ A;  3TF6 A;  4ZHH A;  4OMX A;  4I6S A;  1TVQ A;  2FT9 A;  3RDU A;  4YGZ A;  2F09 A;  3RY2 A;  1QY2 A;  1ZND A;  1I06 A;  2FLJ A;  4FBR A;  1BLR A;  1B4M A;  1GM6 A;  4ORX A;  1ACD A;  3EW1 A;  2HNX A;  5AEO A;  1Z24 A;  1ALB A;  1VPR A;  1CBQ A;  1T0V A;  3HOL A;  3VGW A;  1W4T A;  1HBQ A;  3MX7 A;  3WJD A;  1AEL A;  3APX A;  2HZR A;  1HMT A;  3UEU A;  1U0X A;  2CM4 A;  1YUP A;  3VG7 A;  4M7M A;  1QAB E;  3CQR A;  3EM0 A;  4BX7 A;  2BT9 A;  1VWM B;  2Q2M A;  3AKN A;  3EC5 A;  1VWO B;  1ADL A;  3P02 A;  2VFC A;  3FEP A;  1HY2 A;  4JGL A;  3D96 A;  4NYR A;  1L6M A;  2KT4 B;  3E3C A;  5B10 O;  2RCQ A;  1VWB B;  1HBP A;  1ZRY A;  4YDB A;  3ZWE A;  1SMP I;  1FJ1 E;  1X89 A;  4TKB A;  4BVM A;  1LDQ A;  1FTP A;  2RCT A;  4GJV A;  1N7Y A;  5HTE A;  3PQU A;  3APU A;  2CBR A;  4A60 A;  1BM5 A;  3FEN A;  2A5B A;  1N4J A;  4ORY A;  4BX6 A;  4QGW A;  3SZH A;  1OBQ A;  2UYW A;  1SXU A;  4KC7 A;  4TNN A;  4Y0R A;  2RTM A;  1VWC B;  1X8O A;  4AZR A;  4EFG A;  1VWH B;  3L4R A;  2IZL B;  1JZU A;  3IA8 A;  1YWA A;  3T2X A;  1KL3 A;  1GT4 A;  3BY0 A;  1A18 A;  1VWF B;  2IZJ A;  1SY1 A;  4YKM A;  1LKE A;  1LF7 A;  3ZUI A;  4YH0 A;  1BJ7 A;  1GKA B;  2OL7 A;  5JD2 A;  3WBG A;  1S2P A;  4AZQ A;  3F9D A;  3VG3 A;  3RDM A;  5IRA A;  3ZW1 B;  1OPA A;  4XMG A;  2DJF A;  3FLL A;  5B2A O;  1QWD A;  1KOI A;  3QQ2 A;  3O19 A;  4QYP A;  1PTS A;  3G7X A;  3KVN A;  2X55 A;  2A8G A;  3FDC A;  4WFU A;  4U8U O;  1URE A;  4NLI A;  1JQP A;  1U17 A;  5EDB A;  4O3Z A;  1R0U A;  3RDQ A;  3HK1 A;  2ZAI A;  3P6F A;  5H8T A;  1DFV A;  3DTQ A;  5B29 A;  2G8C O;  4IB6 A;  1SLF B;  2X8S A;  2GTL N;  4TJZ A;  2BC3 A;  1SY2 A;  1YWB A;  2N93 A;  2GC9 A;  2R56 A;  4UU2 A;  1G7N A;  1HXZ A;  1TOU A;  3WXQ A;  1LFO A;  3CKF A;  3D97 A;  1OEE A;  4KCA A;  1SWR A;  3EBK A;  1SRI A;  3WOV A;  1SXY A;  4N7D A;  5K67 A;  4Z2P A;  5DG4 A;  3ZI8 A;  1IFB A;  3PED A;  1HN2 A;  2IZA A;  4CPI A;  1NGL A;  2JU8 A;  4D6B A;  2AF5 A;  2X45 A;  2Y3E A;  4GGR A;  2FS7 A;  1G85 A;  1VWG B;  2GTF X;  2MM3 A;  3O2Y A;  4JO6 A;  2IZI A;  4O3X B;  1JJJ A;  1SWT A;  1IIU A;  1BRP A;  2WQ9 A;  4JNJ A;  2KD2 A;  4GRJ A;  4TKH A;  4FBV A;  1SY3 A;  4ODD A;  5K06 A;  5LKF A;  1KGL A;  4ORW A;  4YFR A;  1DZJ A;  1SLG B;  4BX7 B;  2FKG A;  2ANS A;  3TGA A;  4I60 A;  3APW A;  4ALO A;  5HCD C;  4MIR A;  2F01 A;  3MM0 A;  1BBP A;  2X34 A;  4BX5 B;  4HPA A;  1VWJ B;  3VG2 A;  1IW2 A;  3JSQ A;  4I3C A;  5LJD A;  4ZFX A;  4ZR2 A;  5HZ9 A;  1NQM A;  4R0B A;  1A57 A;  1KL4 A;  4L1N A;  2IZC B; 
#chains in the Genus database with same CATH homology
 5HA0 A;  3BSZ E;  3NQ3 A;  1JYJ A;  2RN4 A;  3BDR A;  2JU3 A;  2WQA E;  3CMP A;  3FR5 A;  2KW1 A;  3U0D A;  1KZW A;  3H3I A;  3FW4 A;  2Q9S A;  2LKK A;  1A3Y A;  2LB6 A;  4KH8 A;  2LBV A;  3LV4 A;  1ICM A;  3VG5 A;  1I04 A;  1NP1 A;  1OEJ A;  4O49 A;  1DZM A;  4U8U N;  3HWD A;  5EPQ A;  1LPJ A;  4PJ2 A;  4YCH A;  3WJC A;  4ZJ0 A;  3WJB A;  4WFV A;  3B2J A;  2ALL X;  2F73 A;  5D8J A;  1BSY A;  1DC9 A;  1MX8 A;  3C78 X;  3PH5 A;  1XCA A;  1Y9T A;  3APV A;  4ALB A;  2XKL A;  1YWC A;  4FQB B;  2GJ5 A;  2OZQ A;  2L9C A;  1KXO A;  3ELZ A;  5H9K A;  5F6Z A;  1EW3 A;  2CZT A;  2QO4 A;  3E3C A;  3FA7 A;  4GDZ A;  2GTL O;  1LNM A;  2FR3 A;  3BS2 A;  3V8U A;  3FR2 A;  2KTD A;  1KT6 A;  4FBO A;  2BS5 A;  5LJK A;  3O22 A;  1DZP A;  5IO6 A;  5F58 A;  3FA8 A;  3T1D A;  5KHP A;  1GX8 A;  3OD9 A;  2YMS A;  3FMZ A;  4HFO A;  3UAQ A;  2R74 A;  4INN A;  4O4O A;  4ORS A;  1FEN A;  5H9L A;  1LIC A;  1TXL A;  5F6B A;  2NP1 A;  5HAE A;  1EPB A;  1B0O A;  1KT3 A;  3JQO A;  3Q6L A;  4TKJ A;  4EQA C;  1QY1 A;  4I3B A;  3KQ0 A;  4MVI A;  2GTL M;  3KFG A;  4U9C A;  3VU1 A;  2P8G A;  1PBO A;  5H9N A;  2HZQ A;  4ORR A;  1E5P A;  4EXZ A;  1PM1 X;  3OBL A;  3NX1 A;  3UEX A;  2HLV A;  3WJE A;  1ERB A;  3P6H A;  2WSJ A;  2ACP X;  4I95 A;  4O3Y A;  1O8V A;  1S7D A;  2AH7 X;  2LBA A;  3VG4 A;  5L8I A;  2Q4N A;  1BSQ A;  3NBX X;  4RUN A;  3CWK A;  5FQ8 E;  4KC8 A;  3BU1 A;  3FEK A;  1KT4 A;  2AT0 X;  1YP6 A;  3C76 X;  4ML7 B;  1N0S A;  2QO6 A;  4QAE A;  2AT5 X;  1CRB A;  4IB9 A;  4O4S A;  1CBI A;  3UEW A;  2RD7 C;  1B8E A;  2WUT A;  3BX8 A;  4CK4 A;  4YDA A;  5DPQ A;  4YFP A;  3BLG A;  3I17 A;  2MJI A;  4LKT A;  4GU8 A;  3PPT A;  1H91 A;  2NNQ A;  4ZGU A;  2KTS A;  3CBC A;  5FQ6 E;  4I9R A;  5D45 A;  3MBT A;  4ZGF A;  3STM X;  4MIS A;  3HOE A;  4OS3 A;  3NQK A;  1EI5 A;  2AMM X;  1DV9 A;  4TLJ A;  4AZM A;  2JMB A;  1VYG A;  4N7C A;  1KT7 A;  3VG6 A;  2ZAG A;  1FDQ A;  4HPD A;  2O62 A;  1LIE A;  4U8U M;  1GXA A;  4O4X A;  5EED A;  3TZS A;  2QMI A;  5D4A A;  3DSZ A;  5HZ5 A;  2HYS A;  4NYQ A;  4BOE A;  3RBY A;  2OFM X;  1O1V A;  3FEL A;  3HWF A;  4RUU A;  3EYC A;  1E06 A;  4IAX A;  3ZZV A;  2OVS A;  4QZU A;  1LIF A;  4NW4 A;  2AT8 X;  1T8V A;  2IFB A;  3VPJ E;  1RBP A;  3I0A A;  2Q39 A;  3TGC A;  3C77 X;  1AVG I;  1MUP A;  1CBR A;  5D48 A;  2G7B A;  4HPB A;  4O4U A;  5AQ6 A;  1QFV A;  3GAQ A;  3QKG A;  4WHI A;  4QQ1 A;  3D4R A;  4QGX A;  3STN A;  3P24 A;  4AZO A;  2K62 A;  4AYH A;  4D6A A;  4QNI A;  2JU7 A;  4AZN A;  1JJX A;  5FFH A;  5JR8 A;  2W2B A;  3B2L A;  4XMF A;  1GGL A;  3FA9 A;  1ML7 A;  4MVE A;  5HBS A;  4XMH A;  4A8Z A;  4MVL A;  5IO7 A;  1QG5 A;  4ZHC A;  1GX9 A;  1OEK A;  3FYF A;  1EIO A;  4I9S A;  3BX7 A;  2NND A;  5BYP A;  1S44 A;  3OJY C;  1QFT A;  2G79 A;  3B2K A;  3P6D A;  1JBH A;  2CZU A;  1EAL A;  1GT3 A;  1TW4 A;  1UZ2 X;  3EBW A;  1I4U A;  5EZ2 A;  4HPC A;  4ID2 A;  4OMW A;  1ZNK A;  1D2U A;  2CBS A;  2FWV A;  3ELX A;  4GH7 A;  2E4J A;  2LFO A;  4K19 A;  5LJG A;  4EEJ A;  5HCC C;  1PEE A;  1U18 A;  1X8P A;  1LID A;  5BVQ A;  1HMR A;  2QOS C;  2RA6 A;  2JN3 A;  4GE1 A;  5FAZ A;  4L3R A;  3KFH A;  3GE2 A;  1IKE A;  2X8T A;  3NX2 A;  3P6E A;  4ES7 A;  4YKO A;  2LA7 A;  5FEN A;  4NLJ A;  3ZW0 B;  4O3W A;  1MVG A;  4IB7 A;  1B56 A;  4IMN A;  5BVS A;  3LHN A;  3STK A;  4LQZ A;  5CE4 A;  4DQ3 A;  1ZNG A;  5HZ6 A;  1X8U A;  2A0A A;  1VYF A;  4CV7 A;  3U03 A;  4NNT A;  2EU7 X;  3BRN A;  3KFF A;  1CBS A;  3PP6 A;  4XME A;  1AB0 A;  4QZT A;  4BQU A;  3FR4 A;  5D47 A;  3KZA A;  3WJG A;  3VE1 A;  1KQX A;  3AKM A;  1G74 A;  2OVD A;  4GK9 A;  3UEV A;  5LJE A;  2WEW A;  5L8O A;  4YGH A;  2AT6 X;  2FS6 A;  2ACO A;  1OBP A;  1FE3 A;  4ARH A;  4UU3 A;  1IFC A;  1ZNL A;  1NP4 A;  5HA1 A;  3ZW2 A;  2HMB A;  2PY1 A;  2A2G A;  1SXX A;  4IB8 A;  4Y0P A;  2Z4H A;  1MX7 A;  5LJC A;  2YG2 A;  3P6C A;  3S5V A;  4GNW A;  4U3Q A;  3WVM A;  4YMY A;  3MVF A;  5CYB A;  3PEC A;  4ZHD A;  4ZHF A;  1MDC A;  4GZV A;  4COT A;  3HWE A;  1E00 A;  3B2I A;  4OS0 A;  1YP7 A;  3NR3 A;  3FW5 A;  4NP1 A;  2BHV A;  2XST A;  3RWX A;  3FA6 A;  4AW8 A;  5BVT A;  2POA A;  4AZP A;  1TOW A;  5AJC A;  4Y0S A;  4ZH6 A;  3RKG A;  1BSO A;  1SXW A;  1DF3 A;  1E02 A;  2AKQ A;  2QO5 A;  4IBA A;  4CSB A;  1RLB E;  5LJB A;  3ZUO A;  4A1H A;  1EXS A;  3B2H A;  4O9S A;  3CR6 A;  4QRL A;  1HQP A;  1X71 A;  3F8A A;  4YFQ A;  4TQ2 A;  3N91 A;  2BLG A;  3D95 A;  1QY0 A;  2A3F X;  4YBP A;  2Z4I A;  1FEL A;  2FRS A;  1EQD A;  5F1E A;  3ZW0 A;  5HTD A;  2CM9 A;  4LKP A;  3F6Z B;  3FIQ A;  3KFI A;  4IAW A;  4MVK A;  2NNE A;  5KID A;  1Y9L A;  1A2D A;  2W2A A;  4QYN A;  4YCE A;  2WWP A;  1QQS A;  3P6G A;  3NPO A;  4ZH9 A;  5LKE A;  2OVA A;  2JW1 A;  2FR2 A;  4XMC A;  5EDC A;  3CQN A;  4EDE A;  3VE2 A;  1ZNE A;  1LIB A;  4KII A;  5HCE C;  3CBS A;  1KZX A;  5LJH A;  1D3S A;  1EII A;  5C0N A;  2A13 A;  4LZU A;  3NQ9 A;  4IAB A;  4KT5 A;  3NP1 A;  1YWD A;  1P6P A;  4GET A;  2L68 A;  5IO5 A;  1YIV A;  3SOT A;  3K3L A;  2K23 A;  2AT3 X;  4YGG A;  2Q2P A;  1DZK A;  1BEB A;  1EUO A;  3U9P C;  1GT5 A;  1JV4 A;  2BS6 A;  2RQ0 A;  1ICN A;  4IMO A;  1AQB A;  4YBU A;  4ZCB A;  1IKJ A;  3PH6 A;  4XMD A;  1XKI A;  3WJF A;  4A1Y A;  4ORU A;  1A57 A;  2X8F A;  3EMM A;  2W2F A;  4HWM A;  4NNS A;  2MWH A;  2FTB A;  2X46 A;  2WR6 A;  4LZV A;  3S60 A;  5KIC A;  1T68 X;  4FGI B;  2JOZ A;  5EEE A;  4QGV A;  1G5W A;  3BU9 A;  4WBK A;  3OE3 A;  1KT5 A;  4OS8 A;  3TGB A;  3IFB A;  1KQW A;  1EPA A;  1PMP A;  2MO5 A;  1OBU A;  2WEX A;  5L8N A;  3S5X A;  4M6S A;  4ZHG A;  3PQS A;  3JS1 A;  2MHD A;  5HZ8 A;  5HZQ A;  1BWY A;  2QM9 A;  3HTY A;  4Y0Q A;  1CJ5 A;  1I05 A;  2AL0 X;  2G78 A;  3RSW A;  1JIW I;  1JYD A;  1BRQ A;  1GKA A;  3S26 A;  1O1U A;  3ZW1 A;  4ON1 A;  5F7G A;  2R73 A;  4I3D A;  4GNY A;  1SA8 A;  3NAD A;  3RZY A;  2A2U A;  3HWG A;  3SAO A;  1FEM A;  2DM5 A;  1GT1 A;  2OVE A;  4GKC A;  5FQ7 E;  5AJB A;  5B27 A;  2L67 A;  3ZQ3 A;  1X8N A;  2OFR X;  4DQ4 A;  4PSQ A;  1SY0 A;  2L5P A;  1HMS A;  2ASN X;  2M4L A;  1ERX A;  5H9A A;  1OPB A;  1ZNH A;  1X8Q A;  5HWZ A;  3TF6 A;  4ZHH A;  4OMX A;  4I6S A;  1TVQ A;  2FT9 A;  4YGZ A;  2F09 A;  1QY2 A;  1ZND A;  1I06 A;  2FLJ A;  4FBR A;  1BLR A;  1B4M A;  1GM6 A;  4ORX A;  1ACD A;  2HNX A;  5AEO A;  1Z24 A;  1ALB A;  1VPR A;  1CBQ A;  1T0V A;  3HOL A;  3WJD A;  1HBQ A;  3MX7 A;  1AEL A;  3APX A;  2HZR A;  1HMT A;  3UEU A;  1U0X A;  2CM4 A;  1YUP A;  3VG7 A;  4M7M A;  1QAB E;  3CQR A;  3EM0 A;  2BT9 A;  2Q2M A;  3AKN A;  1ADL A;  3P02 A;  3FEP A;  4JGL A;  3D96 A;  4NYR A;  1L6M A;  2KT4 B;  2RCQ A;  4YDB A;  1HBP A;  1ZRY A;  3ZWE A;  1SMP I;  1X89 A;  4TKB A;  4BVM A;  1FTP A;  2RCT A;  5HTE A;  3PQU A;  3APU A;  2CBR A;  4A60 A;  1BM5 A;  3FEN A;  4ORY A;  4QGW A;  1OBQ A;  1SXU A;  4KC7 A;  4TNN A;  4Y0R A;  1X8O A;  4AZR A;  4EFG A;  3L4R A;  1JZU A;  3IA8 A;  1YWA A;  1GT4 A;  3BY0 A;  1A18 A;  1SY1 A;  4YKM A;  1LKE A;  1LF7 A;  3ZUI A;  4YH0 A;  1BJ7 A;  1GKA B;  4AZQ A;  3WBG A;  1S2P A;  3F9D A;  3VG3 A;  3ZW1 B;  1OPA A;  4XMG A;  3FLL A;  1QWD A;  1KOI A;  4QYP A;  3O19 A;  3G7X A;  4WFU A;  4U8U O;  1URE A;  4NLI A;  1U17 A;  5EDB A;  4O3Z A;  1R0U A;  3HK1 A;  2ZAI A;  3P6F A;  5H8T A;  1DFV A;  3DTQ A;  5B29 A;  4IB6 A;  2X8S A;  2GTL N;  4TJZ A;  2R56 A;  1SY2 A;  1YWB A;  2N93 A;  2GC9 A;  4UU2 A;  1G7N A;  1TOU A;  3WXQ A;  1LFO A;  3D97 A;  1OEE A;  4KCA A;  3EBK A;  3WOV A;  1SXY A;  4N7D A;  5DG4 A;  3ZI8 A;  1IFB A;  3PED A;  1HN2 A;  1NGL A;  2JU8 A;  4D6B A;  2X45 A;  2FS7 A;  1G85 A;  4O3X B;  2GTF X;  2MM3 A;  3O2Y A;  1JJJ A;  1IIU A;  1BRP A;  2WQ9 A;  2KD2 A;  4GRJ A;  4TKH A;  4FBV A;  1SY3 A;  4ODD A;  5K06 A;  5LKF A;  1KGL A;  4ORW A;  4YFR A;  1DZJ A;  2ANS A;  3TGA A;  3APW A;  4ALO A;  5HCD C;  4MIR A;  1BBP A;  4HPA A;  3VG2 A;  1IW2 A;  3JSQ A;  4I3C A;  5LJD A;  4ZFX A;  4ZR2 A;  5HZ9 A;  4R0B A;  4L1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...