4MISA

The structure of brucella abortus plic in the orthorombic crystal form
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
b'AMGEITIKLPDSVKVSTNSILYKCGAKDLSVTYYNAGDISLAKLELEDETVVASNVISGSGAKYAGSVYIWWTKGKTASLYNLIDNPEEDKPISCVEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Structural basis for the inhibition of human lysozyme by PliC from Brucella abortus
pubmed doi rcsb
source organism Brucella abortus bv. 1
molecule tags Hydrolase inhibitor
total genus 13
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09864 MliC Membrane-bound lysozyme-inhibitor of c-type lysozyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.200 Mainly Beta Beta Barrel Lipocalin Lipocalin 4misA01
2F09A 3F6ZB 3OE3A 4MIRA 4MISA 4ML7B
chains in the Genus database with same CATH superfamily
1SY2A 3PP6A 2FR3A 4K19A 4ON1A 1QQSA 1SXUA 4U46A 4BCSA 1JBHA 1KGLA 4ZR2A 3P6HA 5B29A 2MJIA 4QRLA 3U9PC 1ALBA 3HK1A 4U8UO 1Y55X 1EIOA 4GDAA 4I3DA 1JMXA 2OL7A 1Y53X 2MWHA 4Y0QA 2CAMA 2ANSA 1UREA 3CKFA 3NR3A 3O19A 2WR6A 4OMXA 4ORXA 4TNNA 4ZHDA 5HAEA 5LKEA 3WJCA 4RUUA 1SRJA 2RTJA 4GGTA 2YMSA 2KTDA 4EEJA 4NNSA 4Z27A 4GD9A 3D4RA 3WBGA 2A13A 4I60A 1B8EA 4I6SA 3RBYA 5BYPA 2I5VO 5IRWA 5D8JA 1ZNDA 1FEMA 2QCBA 4CV7A 3F6ZB 4IMOA 3ZW1B 3CBCA 1BSYA 3C76X 4TKHA 1SWKA 2X34A 4DNEA 2FHNX 3HWGA 1HQPA 1W5RA 1S44A 1SY3A 1VWHB 3BS2A 1TOWA 4O4OA 1SA8A 4EQAC 2L9CA 4LKPA 2Q4NA 4YGZA 4NV7A 1VWPB 4BGFA 2FWVA 2WQ9A 1X89A 4U9CA 4QYPA 1G74A 4Y5DA 3STNA 3UAQA 2IZLB 2OZQA 4GZVA 1RLBE 1SRGA 5FFHA 4CDEA 4BX6A 1SXXA 4XMDA 1E02A 1SLEB 3MX7A 5K06A 2WEWA 2R56A 2OF9A 3RKGA 5LJHA 2RTBB 4QYNA 4ZH9A 2FKJA 1VWOB 4IB7A 4KH8A 4BJ8A 1LCVA 1OEEA 1D3SA 4OKAA 2RTIB 2X46A 3RSWA 3D96A 5D47A 1GXAA 4O3ZA 1SRHA 3P6FA 1AVGI 4BVMA 3RDOA 4GGZA 4TJZA 3TGAA 4ZHFA 3T2XA 3PQSA 3ZW0B 4ODDA 3P6GA 2RTEB 1ML7A 1KT3A 1P6PA 4IB9A 2W2BA 4IB8A 1KL3A 5CYBA 4ES7A 1IKJA 1NGLA 2LBVA 1N9MA 2DJFA 2DJGA 3B2JA 2BS6A 3STKA 1A3YA 2NNDA 2QM9A 4ORRA 4XMEA 2HNXA 2JOZA 2NNEA 1ZNLA 4QZUA 2Y3EA 3FR4A 2MM3A 4XMFA 3FA8A 3FENA 1B4MA 2AT6X 1D2UA 3RDSA 2MHDA 2G78A 4A1YA 1RBPA 1NQNA 4QAEA 5BVSA 3ZUOA 4YVBA 1DFVA 2Q39A 3D97A 2A3FX 2RQ0A 4NYRA 5H8TA 2GJ5A 1GX9A 1R0UA 1SWQA 2NP1A 2IZCB 1G7NA 2VFBA 3JQOA 3RDQA 5HCEC 4CPHA 5IXGA 4U8UM 2RTRB 3RWXA 3APWA 3NPOA 2CM4A 4ZGUA 1E5PA 3MG5A 4ORWA 1FE3A 1STSB 3CQNA 3VG2A 1ADLA 2F01A 2WUTA 1AQBA 1AVDA 2AT8X 4GE1A 4ALBA 2GC9A 1E2TA 5F6ZA 2R73A 4LQZA 1UYNX 4ZJ0A 1SWUA 5D48A 5AQ6A 3APXA 4CPIA 1IKEA 3VG7A 4QGVA 1LCZA 1HBQA 4GNWA 2A0AA 3VE2A 2IZAA 5H9AA 4AZOA 1PTSA 3AKMA 3HWFA 3EM0A 3UEWA 5B5FA 1SLDB 4I95A 4OEMA 1Z24A 2RTOB 3LV4A 3SZIA 1LF7A 1MDCA 4NNTA 1IIUA 3KQ0A 1LKEA 2HZRA 1IW2A 2A2UA 5HZ5A 2K23A 4O4SA 3FELA 1PEEA 3BU9A 3BY0A 4N7CA 1BRPA 5B5GA 4A1HA 3RE5A 3BDRA 1VWJB 4CDFA 1SY0A 2IZBA 1JJUA 2RTMA 3KVNA 1KT5A 4IABA 3FMZA 1CBRA 3VG5A 4GDZA 2RTGB 1OEKA 2ASNX 4GETA 4KT5A 2LB6A 4IMNA 1KL5A 1VYGA 2OVSA 1UZ2X 3FR2A 4PSQA 4QQ1A 4I3CA 2GTLO 2KW1A 4XMCA 4YKMA 4XMGA 1GKAB 3EMMA 4BOEA 1BRQA 2QO6A 1T8VA 4YCEA 1A57A 1SWHA 1SRIA 1GT5A 2AMMX 4ORUA 2X8FA 3S5XA 5LJEA 2N93A 3NX2A 2AT3X 5L8OA 3S26A 1LFOA 2Q9SA 4ID2A 1SWPA 4YCHA 5LJGA 3UEVA 2QMIA 5IO6A 3VG6A 5B10O 5H9LA 3WJEA 2QO5A 4IRWA 3EBKA 3NBXX 5AEOA 1QG5A 3VU1A 2FS7A 3SAOA 3B2KA 1LPJA 1ZNGA 1HN2A 2RTNB 2F09A 3BX8A 1RXKA 4Y0SA 4GU8A 2IZEB 1SWJA 2RTKA 3B2IA 1OBUA 3P02A 4YBUA 1I05A 2DM5A 1SWDA 3PQUA 3S5VA 1DF8A 4COTA 4N7DA 1N4JA 5H9KA 2IZJA 2OY5O 1DF3A 2XSTA 2RA6A 1JQPA 3S60A 3ZWEA 2Y32A 1JV4A 1SWFA 2X32A 3OJYC 1QFVA 1GX3A 2AF5A 4HPAA 3EW1A 4U3QA 1SWGA 1EQDA 1LNMA 1LIFA 2W2FA 2ACPX 4HPBA 3HPEA 3ZW2A 4NYQA 1KXOA 4AZNA 5IO7A 2RTHB 4JHQA 2O62A 1SLGB 3V8UA 5KIDA 2FT9A 1SRFA 4ORYA 1E00A 4YKOA 3E3CA 3CR6A 3CMPA 2L68A 1BM5A 1S2PA 4KC8A 1PMPA 4ZHCA 3KFHA 1DZPA 2G8CO 4MISA 1GT1A 4O4UA 2OY1O 1A18A 2POAA 2C4IA 2Q2MA 2BC3A 1NBXA 2FKGA 1FELA 1KQXA 3ELZA 5EEDA 3JSQA 1LICA 3Q34A 2RCQA 4CPFA 3WYPA 5DG4A 2KD2A 3AEHA 3CWKA 1WUBA 1X8UA 1BJ7A 1GT3A 1PM1X 2CBRA 4PJ2A 1RXJA 1BSOA 2FRSA 5IRUA 5K68A 4DQ3A 1SLFB 4INNA 2ZSCA 5C0NA 1QWDA 2IZFB 5IRAA 3I0AA 3WJDA 2IZHB 3MM0A 1KT6A 4Z28A 1LDQA 4ZH6A 1FJ1E 1LUQA 3BX7A 1OEJA 4MVLA 3TF6A 2GTLM 1YIVA 4QGWA 2BS5A 5HTDA 1DZKA 1TW4A 5AJBA 3OD9A 1HQQA 1NC9A 4HPCA 1GT4A 3HOLA 3VHMA 3PK2A 2C1QA 4A8ZA 2WQAE 1OPAA 2GTFX 2RTQB 3G7XA 1MVGA 4LZUA 3F9DA 1MEPA 1ERXA 3APUA 3D9WA 2FS6A 4WBKA 1ZNEA 4OS8A 4BX7B 2HZQA 4JGLA 5B2AO 5HTEA 1O1VA 1VWGB 1L6MA 1U18A 5HZ6A 3O22A 3T6LA 4NP1A 1QY2A 1EI5A 3OBLA 4JNJA 3RY2A 3F8AA 1YWAA 1ZRYA 2BT9A 2EU7X 3AUMO 4OS3A 1HXLA 2RTLA 3B2LA 3D95A 4Y0PA 5B11O 4AYHA 1LELA 2ALLX 1LIBA 4EDEA 3HWDA 4O4XA 1N9YA 1K3BA 3TGCA 1LDOA 5AJCA 1VPRA 3SLOA 1JMZA 2IZGB 4FGIB 4O9SA 5LJDA 4ARHA 4OMWA 3WZNA 2OFAA 5H9NA 4BX5B 2FGSA 5BVQA 4CK4A 3FW4A 3FYFA 2KT4B 3VG3A 5FAZA 2CZUA 4YFRA 2AH7X 1QABE 2X56A 2KTSA 2X8TA 3BSZE 3CBSA 4WHIA 4YDAA 3CKGA 3SOTA 3UEUA 1DZJA 5LJKA 1JZUA 1MK5A 1HMRA 1YWCA 3N91A 4YFPA 4CSBA 1SWAA 3ZW0A 1I4UA 1OPBA 2G7BA 3RDXA 1SXYA 5LJBA 3QQ2A 1EPAA 3BU1A 3JS1A 2JMBA 2MO5A 1AELA 3EC5A 1W6FA 4L3RA 1BSQA 3PDFA 4GKCA 5FQ6E 5B27A 2FTBA 3WJBA 4B55A 4MEEA 1MX7A 2PY1A 4YFQA 2JN3A 4HWMA 4QZTA 1HBPA 1JJXA 3U03A 1TXLA 1FENA 1RAVA 3H3IA 3FR5A 4NW4A 1VWNB 2RTFB 1QFTA 3HTYA 3SZJA 4EFGA 1CRBA 3EW2A 4TLJA 1XCAA 2L5PA 5L8IA 3RDMA 3VPJE 1BLRA 3BLGA 2K62A 4GGRA 4TKJA 5EZ2A 3SZHA 5CE4A 2AT5X 4CPEA 3DSZA 4XMHA 3TZSA 4Z2VA 1JIWI 3FA6A 1GM6A 2A5CA 3WYQA 2WSJA 4YBPA 2AT0X 1IFBA 4Y59A 5F7GA 3VE1A 1IFCA 3FA9A 2X45A 3HOEA 4TKBA 1SWEA 2LA7A 3LHNA 4ZGFA 2AVIA 2AL0X 2OF8A 1Y9TA 1EXSA 4D6BA 2C1SA 3SLTA 2OFRX 1X71A 2RTAA 3PECA 2WEXA 3MBTA 2GTLN 2P8GA 3C77X 1DC9A 1E06A 4D6AA 3WJFA 3I17A 1I06A 3IFBA 1VWMB 1Y0GA 4AZRA 1GX8A 1XKIA 1KL4A 1RSTB 2RN4A 5IO5A 1YWBA 2CM9A 1N0SA 1VYFA 2UYWA 3FEPA 4YGHA 3NQ3A 4AZMA 5L3YA 1JYJA 2M4LA 1AVEA 4QNIA 2X8SA 3VHHA 4M7MA 4FBRA 4Z2PA 1DV9A 1SXWA 3OE3A 3STMX 2FR2A 5HWZA 5D45A 5F2BA 3NADA 4BX6B 1SWRA 4RUNA 1SWOA 4CDDA 5FENA 1SY1A 2ACOA 4U8UN 2FHLA 5LKFA 1LIEA 4GUZA 1MUPA 3PH6A 5FQ7E 1N7YA 1SWBA 1VWIB 4LZVA 4C5PA 4I9SA 1N43A 5HCDC 1GKAA 2OVEA 4MVIA 5HCCC 4IBAA 3VHIA 2I5ZO 3WXQA 1ACDA 1YP6A 1VWQB 3KZAA 3UEXA 3HWEA 5LJCA 4KIIA 4WFUA 3NQ9A 3TGBA 4KCAA 3FDCA 3ZUIA 4GJSA 1VWFB 1YP7A 3WVMA 3EBWA 1CJ5A 1CBQA 2RTDB 1EUOA 4NLIA 5CSEA 2QOMA 4EXZA 2OL6O 1Y52X 1CBSA 3P6EA 1MOYA 4LKTA 4NLJA 4IB6A 4WFVA 5BVTA 2PI3O 2W2AA 2WPUA 4YDBA 2BSZA 5DPQA 2OL8O 1K24A 3T6FA 1DZMA 2QO4A 1CBIA 3IA8A 2LKKA 5FQ8E 1VYOA 1G5WA 2LFOA 1MM9A 1KZXA 2GH7A 4CPHB 1X8NA 1STRB 1VWBB 1KOIA 3QKGA 4AZQA 4I9RA 4GJVA 1BWYA 1I9HA 3RZYA 2JW1A 1KZWA 3KFIA 5F6BA 3WZOA 4YMYA 1GGLA 1OSPO 3ZI8A 3L4RA 4ML7B 5F1EA 4ZHGA 2IZIA 4FBVA 2Y3FA 5F58A 3ZQ3A 3SLJA 2FLJA 2JU8A 3ZW1A 4R0BA 2IFBA 5HA1A 1X8PA 1ERBA 3B2HA 4KC7A 1SWNA 1S7DA 1HXZA 4OELA 5HA0A 1B56A 2BHVA 3PH5A 4HPDA 4EKVA 2LBAA 1BEBA 1BBPA 2MF6A 2XKLA 3NX1A 3P6DA 4O49A 1EPBA 2VDFA 2IZDB 2OY7A 4GK9A 1W4TA 1HMTA 1RSUB 3GAQA 4ORSA 4YGGA 2X55A 4Y0RA 4MVKA 2E4JA 3X00A 1SWSA 1KFFA 2OY8A 1U0XA 1O8VA 1NDJA 4UU3A 2RCTA 4UU2A 4MVEA 2A2GA 1T68X 4HFOA 2VFCA 3AKNA 1EIIA 2A8GA 1VWRB 1VWEB 1JYDA 3NP1A 1HY2A 3PPTA 4L1NA 1QY1A 2CBSA 4ZCBA 3KFFA 3O2YA 5CHKA 2CZTA 4DQ4A 4IAXA 4M6SA 5D4AA 1UYOX 2OFMX 3FLLA 4I3BA 5KICA 3K3LA 3FIDA 1SWCA 4AZPA 1EALA 3WOVA 1WBIA 1KQWA 2BLGA 3APVA 4GH7A 2OVDA 4BQUA 1FTPA 3FEKA 3FIQA 2Z4IA 1NP1A 4JO6A 1PBOA 2HYSA 3WZPA 1SWLA 1EW3A 5L8NA 4BX7A 4TQ2A 4FQBB 3WJGA 2OYBO 2Z4HA 4Z6JA 3ELXA 1X8OA 1RXHA 3RDUA 2R74A 1OBPA 4ALOA 3PEDA 1AB0A 2RTCB 1YUPA 3ZZVA 1VWAB 1B0OA 1TOUA 1QY0A 1VWDB 5B3MO 3T2WA 3KFGA 3VGWA 3WZQA 4ZHHA 1SMPI 1ICMA 2HLVA 4YH0A 1O1UA 5HZ8A 2IZKA 2HKDA 3FW5A 2L67A 2Q2PA 4IAWA 5HZ9A 1NQMA 1OBQA 1VWLB 1LCWA 3RE6A 4CDCA 2JU7A 2OVAA 2X4MA 1T0VA 2UZ2A 3BRNA 4MIRA 4O3WA 2G5LA 2AKQA 2QOSC 5EDCA 4AW8A 1IJ8A 1MX8A 5JD2A 2HMBA 5HZQA 4BX5A 4QGXA 1JJJA 2RD7C 3FA7A 1ZNKA 4NV8A 1H91A 1YWDA 3C78X 3EYCA 3GE2A 2JGSA 3MVFA 2ZAGA 4BBOA 1VWKB 1TVQA 1X8QA 3CQRA 2ZAIA 4FBOA 3RY1A 1I78A 3NQKA 1SWTA 1HMSA 2G79A 1NP4A 4O3YA 1Y9LA 3T1DA 5EEEA 4A60A 2F73A 2RTPB 2NNQA 5KHPA 3DTQA 5K67A 4GRJA 2YG2A 1ZNHA 4DCBA 4ZFXA 1KT7A 1VWCB 4GNYA 4Z2OA 3U0DA 1LIDA 1FDQA 3VG4A 4OS0A 3P6CA 1I04A 5EPQA 1SREA 1KT4A 5EDBA 1PBYA 2WWPA 5JR8A 3P24A 2A5BA 5HBSA 2OFBA 1G85A 1ICNA 1U17A 2JU3A 1STPA 3LTWA 4O3XB 3Q6LA 1A2DA
chains in the Genus database with same CATH topology
1SY2A 3PP6A 2FR3A 4K19A 4ON1A 1QQSA 1SXUA 1KGLA 1JBHA 4ZR2A 3P6HA 5B29A 2MJIA 4QRLA 1ALBA 3HK1A 4U8UO 1EIOA 4I3DA 2MWHA 4Y0QA 2ANSA 1UREA 3NR3A 3O19A 4OMXA 2WR6A 4ORXA 4TNNA 4ZHDA 5HAEA 5LKEA 3WJCA 4RUUA 2YMSA 2KTDA 4EEJA 4NNSA 3D4RA 3WBGA 2A13A 5BYPA 1B8EA 4I6SA 3RBYA 5D8JA 1ZNDA 1FEMA 4CV7A 3F6ZB 4IMOA 3ZW1B 3CBCA 1BSYA 3C76X 4TKHA 3HWGA 1HQPA 3BS2A 1S44A 1SY3A 4O4OA 4EQAC 1TOWA 1SA8A 2L9CA 4LKPA 2Q4NA 4YGZA 2FWVA 2WQ9A 1X89A 4U9CA 4QYPA 1G74A 3STNA 3UAQA 2OZQA 4GZVA 1RLBE 5FFHA 1SXXA 4XMDA 1E02A 3MX7A 5K06A 2WEWA 2R56A 3RKGA 5LJHA 4QYNA 4ZH9A 4IB7A 4KH8A 1OEEA 1D3SA 2X46A 3RSWA 3D96A 5D47A 1GXAA 4O3ZA 3P6FA 4BVMA 1AVGI 4TJZA 3TGAA 4ZHFA 3PQSA 3ZW0B 4ODDA 3P6GA 1ML7A 1KT3A 1P6PA 4IB9A 2W2BA 4IB8A 5CYBA 4ES7A 1IKJA 1NGLA 2LBVA 3B2JA 2BS6A 3STKA 1A3YA 2NNDA 2QM9A 4ORRA 4XMEA 2HNXA 2JOZA 2NNEA 1ZNLA 4QZUA 3FR4A 4XMFA 2MM3A 3FA8A 3FENA 1B4MA 2AT6X 1D2UA 2MHDA 2G78A 4A1YA 1RBPA 4QAEA 5BVSA 3ZUOA 1DFVA 2Q39A 3D97A 2A3FX 2RQ0A 4NYRA 5H8TA 2GJ5A 1GX9A 2NP1A 1R0UA 3JQOA 1DF3A 1G7NA 5HCEC 4U8UM 3RWXA 3APWA 3NPOA 2CM4A 4ZGUA 1E5PA 4ORWA 1FE3A 3CQNA 3VG2A 1ADLA 2WUTA 1AQBA 2AT8X 4GE1A 4ALBA 2GC9A 5F6ZA 2R73A 4LQZA 4ZJ0A 5D48A 5AQ6A 3APXA 4QGVA 1IKEA 3VG7A 1HBQA 4GNWA 2A0AA 3VE2A 4AZOA 5H9AA 3AKMA 3HWFA 3EM0A 3UEWA 4I95A 1Z24A 3LV4A 1LF7A 1MDCA 4NNTA 1IIUA 3KQ0A 1LKEA 2HZRA 1IW2A 2A2UA 5HZ5A 2K23A 4O4SA 3FELA 1PEEA 3BU9A 3BY0A 4N7CA 1BRPA 4A1HA 3BDRA 1SY0A 1KT5A 4IABA 3FMZA 1CBRA 3VG5A 4GDZA 4GETA 1OEKA 2ASNX 4KT5A 2LB6A 4IMNA 1VYGA 2OVSA 1UZ2X 3FR2A 4PSQA 4QQ1A 4I3CA 2GTLO 2KW1A 4XMCA 4YKMA 4XMGA 1GKAB 3EMMA 4BOEA 1BRQA 2QO6A 1T8VA 4YCEA 1A57A 1GT5A 2AMMX 4ORUA 2X8FA 3S5XA 5LJEA 2N93A 3NX2A 2AT3X 5L8OA 3S26A 1LFOA 2Q9SA 4ID2A 4YCHA 5LJGA 3UEVA 2QMIA 5IO6A 3VG6A 5H9LA 3WJEA 2QO5A 3EBKA 3NBXX 5AEOA 1QG5A 3VU1A 2FS7A 3SAOA 3B2KA 1LPJA 1ZNGA 1HN2A 2F09A 3BX8A 4Y0SA 4GU8A 3B2IA 1OBUA 3P02A 4YBUA 1I05A 2DM5A 3PQUA 3S5VA 4COTA 4N7DA 5H9KA 2XSTA 2RA6A 3S60A 3ZWEA 1JV4A 3OJYC 1QFVA 4HPAA 4U3QA 1EQDA 1LNMA 1LIFA 2W2FA 2ACPX 4HPBA 3ZW2A 4NYQA 1KXOA 4AZNA 5IO7A 2O62A 3V8UA 5KIDA 2FT9A 4ORYA 1E00A 4YKOA 3E3CA 3CR6A 3CMPA 2L68A 1BM5A 1S2PA 4KC8A 1PMPA 4ZHCA 3KFHA 1DZPA 4MISA 1GT1A 4O4UA 2POAA 1A18A 2Q2MA 1FELA 1KQXA 3ELZA 5EEDA 3JSQA 1LICA 2RCQA 5DG4A 2KD2A 3CWKA 1BJ7A 1GT3A 1PM1X 1X8UA 2CBRA 4PJ2A 4DQ3A 1BSOA 2FRSA 4INNA 5C0NA 1QWDA 3I0AA 3WJDA 1KT6A 3TF6A 4ZH6A 3BX7A 1OEJA 4MVLA 2GTLM 1YIVA 4QGWA 2BS5A 5HTDA 1DZKA 1TW4A 5AJBA 3OD9A 4HPCA 1GT4A 3HOLA 4A8ZA 2WQAE 1OPAA 2GTFX 3G7XA 1MVGA 4LZUA 3F9DA 1ERXA 3APUA 4WBKA 2FS6A 1ZNEA 4OS8A 2HZQA 4JGLA 5HTEA 1O1VA 1L6MA 1U18A 5HZ6A 3O22A 4NP1A 1QY2A 1EI5A 3OBLA 3F8AA 1YWAA 1ZRYA 2BT9A 2EU7X 4OS3A 3D95A 3B2LA 4AYHA 4Y0PA 2ALLX 1LIBA 4EDEA 3HWDA 4O4XA 3TGCA 5AJCA 1VPRA 4FGIB 4O9SA 5LJDA 4ARHA 4OMWA 5H9NA 4CK4A 5BVQA 3FW4A 3FYFA 2KT4B 3VG3A 5FAZA 2CZUA 4YFRA 2AH7X 1QABE 2X8TA 2KTSA 3BSZE 3CBSA 4WHIA 4YDAA 3SOTA 3UEUA 3U9PC 1DZJA 5LJKA 1JZUA 1HMRA 1YWCA 3N91A 4YFPA 4CSBA 3ZW0A 1I4UA 1OPBA 2G7BA 1SXYA 5LJBA 1EPAA 3BU1A 3JS1A 2JMBA 2MO5A 1AELA 4L3RA 1BSQA 4GKCA 5FQ6E 3WJBA 5B27A 2FTBA 1MX7A 2PY1A 4YFQA 2JN3A 4HWMA 4QZTA 1HBPA 1JJXA 3U03A 1TXLA 1FENA 3H3IA 3FR5A 4NW4A 1QFTA 3HTYA 4EFGA 1CRBA 4TLJA 1XCAA 2L5PA 5L8IA 3VPJE 1BLRA 3BLGA 2K62A 4TKJA 5EZ2A 3TZSA 5CE4A 2AT5X 3DSZA 4XMHA 1JIWI 3FA6A 1GM6A 4YBPA 1DV9A 2WSJA 2AT0X 1IFBA 5F7GA 3VE1A 1IFCA 3FA9A 2X45A 3HOEA 4TKBA 2LA7A 3LHNA 4ZGFA 2AL0X 1Y9TA 1EXSA 4D6BA 2OFRX 1X71A 3PECA 2WEXA 3MBTA 2GTLN 2P8GA 3C77X 1DC9A 1E06A 4D6AA 3WJFA 3I17A 1I06A 3IFBA 4AZRA 1GX8A 1XKIA 2RN4A 5IO5A 1YWBA 2CM9A 1N0SA 1VYFA 3FEPA 4YGHA 4AZMA 3NQ3A 1JYJA 2M4LA 4QNIA 2X8SA 4M7MA 4FBRA 1SXWA 3OE3A 3STMX 2FR2A 5HWZA 5D45A 3NADA 4RUNA 5FENA 1SY1A 2ACOA 4U8UN 5LKFA 1LIEA 1MUPA 3PH6A 5FQ7E 4LZVA 4I9SA 5HCDC 1GKAA 2OVEA 4MVIA 5HCCC 4IBAA 3WXQA 1ACDA 1YP6A 3KZAA 3UEXA 3HWEA 5LJCA 4KIIA 4WFUA 3NQ9A 3TGBA 4KCAA 3ZUIA 3WVMA 1YP7A 1CJ5A 3EBWA 1CBQA 1EUOA 4NLIA 4EXZA 1CBSA 3P6EA 4LKTA 4NLJA 4IB6A 4WFVA 5BVTA 2W2AA 4YDBA 5DPQA 1DZMA 2QO4A 1CBIA 3IA8A 2LKKA 5FQ8E 1G5WA 2LFOA 1X8NA 1KOIA 3QKGA 4AZQA 4I9RA 1BWYA 3RZYA 1KZWA 2JW1A 3KFIA 5F6BA 4YMYA 1GGLA 3ZI8A 3L4RA 4ML7B 5F1EA 4ZHGA 4FBVA 5F58A 3ZQ3A 2FLJA 2JU8A 3ZW1A 4R0BA 2IFBA 5HA1A 1X8PA 1ERBA 3B2HA 4KC7A 1S7DA 5HA0A 1B56A 2BHVA 3PH5A 4HPDA 2LBAA 1BEBA 1BBPA 3NX1A 2XKLA 3P6DA 4O49A 1EPBA 4GK9A 1HMTA 3GAQA 4ORSA 4YGGA 4Y0RA 4MVKA 2E4JA 1U0XA 1O8VA 4UU3A 2RCTA 4UU2A 4MVEA 2A2GA 1T68X 4HFOA 3AKNA 1EIIA 1JYDA 3NP1A 3PPTA 4L1NA 1QY1A 2CBSA 4ZCBA 3KFFA 3O2YA 4DQ4A 2CZTA 4IAXA 4M6SA 5D4AA 2OFMX 3FLLA 4I3BA 5KICA 3K3LA 4AZPA 1EALA 3WOVA 1KQWA 2BLGA 3APVA 4GH7A 2OVDA 4BQUA 1FTPA 3FEKA 3FIQA 2Z4IA 1NP1A 1PBOA 2HYSA 1EW3A 5L8NA 4TQ2A 4FQBB 3WJGA 2Z4HA 3ELXA 1X8OA 4ALOA 2R74A 1OBPA 3PEDA 1AB0A 1YUPA 3ZZVA 1B0OA 1TOUA 1QY0A 4ZHHA 3KFGA 1SMPI 1ICMA 2HLVA 4YH0A 1O1UA 5HZ8A 3FW5A 2L67A 2Q2PA 4IAWA 5HZ9A 1OBQA 1KZXA 2JU7A 2OVAA 3BRNA 1T0VA 4O3WA 4MIRA 2AKQA 2QOSC 5EDCA 4AW8A 1MX8A 1JJJA 2HMBA 5HZQA 4QGXA 2RD7C 3FA7A 1ZNKA 1H91A 1YWDA 3C78X 3EYCA 3GE2A 3MVFA 2ZAGA 1TVQA 1X8QA 3CQRA 2ZAIA 4FBOA 3NQKA 1HMSA 2G79A 1NP4A 4O3YA 1Y9LA 3T1DA 5EEEA 4A60A 2F73A 5KHPA 2NNQA 3DTQA 4GRJA 2YG2A 1ZNHA 4ZFXA 1KT7A 4GNYA 3U0DA 1LIDA 1FDQA 3VG4A 4OS0A 3P6CA 1I04A 5EPQA 1KT4A 5EDBA 2WWPA 5JR8A 3P24A 5HBSA 1G85A 1ICNA 1U17A 2JU3A 4O3XB 3Q6LA 1A2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F09 A;  3F6Z B;  3OE3 A;  4MIR A;  4MIS A;  4ML7 B; 
#chains in the Genus database with same CATH topology
 1SY2 A;  3PP6 A;  2FR3 A;  4K19 A;  4ON1 A;  1QQS A;  1SXU A;  4U46 A;  4BCS A;  1JBH A;  1KGL A;  4ZR2 A;  3P6H A;  5B29 A;  2MJI A;  4QRL A;  3U9P C;  1ALB A;  3HK1 A;  4U8U O;  1Y55 X;  1EIO A;  4GDA A;  4I3D A;  1JMX A;  2OL7 A;  1Y53 X;  2MWH A;  4Y0Q A;  2CAM A;  2ANS A;  1URE A;  3CKF A;  3NR3 A;  3O19 A;  2WR6 A;  4OMX A;  4ORX A;  4TNN A;  4ZHD A;  5HAE A;  5LKE A;  3WJC A;  4RUU A;  1SRJ A;  2RTJ A;  4GGT A;  2YMS A;  2KTD A;  4EEJ A;  4NNS A;  4Z27 A;  4GD9 A;  3D4R A;  3WBG A;  2A13 A;  4I60 A;  1B8E A;  4I6S A;  3RBY A;  5BYP A;  2I5V O;  5IRW A;  5D8J A;  1ZND A;  1FEM A;  2QCB A;  4CV7 A;  3F6Z B;  4IMO A;  3ZW1 B;  3CBC A;  1BSY A;  3C76 X;  4TKH A;  1SWK A;  2X34 A;  4DNE A;  2FHN X;  3HWG A;  1HQP A;  1W5R A;  1S44 A;  1SY3 A;  1VWH B;  3BS2 A;  1TOW A;  4O4O A;  1SA8 A;  4EQA C;  2L9C A;  4LKP A;  2Q4N A;  4YGZ A;  4NV7 A;  1VWP B;  4BGF A;  2FWV A;  2WQ9 A;  1X89 A;  4U9C A;  4QYP A;  1G74 A;  4Y5D A;  3STN A;  3UAQ A;  2IZL B;  2OZQ A;  4GZV A;  1RLB E;  1SRG A;  5FFH A;  4CDE A;  4BX6 A;  1SXX A;  4XMD A;  1E02 A;  1SLE B;  3MX7 A;  5K06 A;  2WEW A;  2R56 A;  2OF9 A;  3RKG A;  5LJH A;  2RTB B;  4QYN A;  4ZH9 A;  2FKJ A;  1VWO B;  4IB7 A;  4KH8 A;  4BJ8 A;  1LCV A;  1OEE A;  1D3S A;  4OKA A;  2RTI B;  2X46 A;  3RSW A;  3D96 A;  5D47 A;  1GXA A;  4O3Z A;  1SRH A;  3P6F A;  1AVG I;  4BVM A;  3RDO A;  4GGZ A;  4TJZ A;  3TGA A;  4ZHF A;  3T2X A;  3PQS A;  3ZW0 B;  4ODD A;  3P6G A;  2RTE B;  1ML7 A;  1KT3 A;  1P6P A;  4IB9 A;  2W2B A;  4IB8 A;  1KL3 A;  5CYB A;  4ES7 A;  1IKJ A;  1NGL A;  2LBV A;  1N9M A;  2DJF A;  2DJG A;  3B2J A;  2BS6 A;  3STK A;  1A3Y A;  2NND A;  2QM9 A;  4ORR A;  4XME A;  2HNX A;  2JOZ A;  2NNE A;  1ZNL A;  4QZU A;  2Y3E A;  3FR4 A;  2MM3 A;  4XMF A;  3FA8 A;  3FEN A;  1B4M A;  2AT6 X;  1D2U A;  3RDS A;  2MHD A;  2G78 A;  4A1Y A;  1RBP A;  1NQN A;  4QAE A;  5BVS A;  3ZUO A;  4YVB A;  1DFV A;  2Q39 A;  3D97 A;  2A3F X;  2RQ0 A;  4NYR A;  5H8T A;  2GJ5 A;  1GX9 A;  1R0U A;  1SWQ A;  2NP1 A;  2IZC B;  1G7N A;  2VFB A;  3JQO A;  3RDQ A;  5HCE C;  4CPH A;  5IXG A;  4U8U M;  2RTR B;  3RWX A;  3APW A;  3NPO A;  2CM4 A;  4ZGU A;  1E5P A;  3MG5 A;  4ORW A;  1FE3 A;  1STS B;  3CQN A;  3VG2 A;  1ADL A;  2F01 A;  2WUT A;  1AQB A;  1AVD A;  2AT8 X;  4GE1 A;  4ALB A;  2GC9 A;  1E2T A;  5F6Z A;  2R73 A;  4LQZ A;  1UYN X;  4ZJ0 A;  1SWU A;  5D48 A;  5AQ6 A;  3APX A;  4CPI A;  1IKE A;  3VG7 A;  4QGV A;  1LCZ A;  1HBQ A;  4GNW A;  2A0A A;  3VE2 A;  2IZA A;  5H9A A;  4AZO A;  1PTS A;  3AKM A;  3HWF A;  3EM0 A;  3UEW A;  5B5F A;  1SLD B;  4I95 A;  4OEM A;  1Z24 A;  2RTO B;  3LV4 A;  3SZI A;  1LF7 A;  1MDC A;  4NNT A;  1IIU A;  3KQ0 A;  1LKE A;  2HZR A;  1IW2 A;  2A2U A;  5HZ5 A;  2K23 A;  4O4S A;  3FEL A;  1PEE A;  3BU9 A;  3BY0 A;  4N7C A;  1BRP A;  5B5G A;  4A1H A;  3RE5 A;  3BDR A;  1VWJ B;  4CDF A;  1SY0 A;  2IZB A;  1JJU A;  2RTM A;  3KVN A;  1KT5 A;  4IAB A;  3FMZ A;  1CBR A;  3VG5 A;  4GDZ A;  2RTG B;  1OEK A;  2ASN X;  4GET A;  4KT5 A;  2LB6 A;  4IMN A;  1KL5 A;  1VYG A;  2OVS A;  1UZ2 X;  3FR2 A;  4PSQ A;  4QQ1 A;  4I3C A;  2GTL O;  2KW1 A;  4XMC A;  4YKM A;  4XMG A;  1GKA B;  3EMM A;  4BOE A;  1BRQ A;  2QO6 A;  1T8V A;  4YCE A;  1A57 A;  1SWH A;  1SRI A;  1GT5 A;  2AMM X;  4ORU A;  2X8F A;  3S5X A;  5LJE A;  2N93 A;  3NX2 A;  2AT3 X;  5L8O A;  3S26 A;  1LFO A;  2Q9S A;  4ID2 A;  1SWP A;  4YCH A;  5LJG A;  3UEV A;  2QMI A;  5IO6 A;  3VG6 A;  5B10 O;  5H9L A;  3WJE A;  2QO5 A;  4IRW A;  3EBK A;  3NBX X;  5AEO A;  1QG5 A;  3VU1 A;  2FS7 A;  3SAO A;  3B2K A;  1LPJ A;  1ZNG A;  1HN2 A;  2RTN B;  2F09 A;  3BX8 A;  1RXK A;  4Y0S A;  4GU8 A;  2IZE B;  1SWJ A;  2RTK A;  3B2I A;  1OBU A;  3P02 A;  4YBU A;  1I05 A;  2DM5 A;  1SWD A;  3PQU A;  3S5V A;  1DF8 A;  4COT A;  4N7D A;  1N4J A;  5H9K A;  2IZJ A;  2OY5 O;  1DF3 A;  2XST A;  2RA6 A;  1JQP A;  3S60 A;  3ZWE A;  2Y32 A;  1JV4 A;  1SWF A;  2X32 A;  3OJY C;  1QFV A;  1GX3 A;  2AF5 A;  4HPA A;  3EW1 A;  4U3Q A;  1SWG A;  1EQD A;  1LNM A;  1LIF A;  2W2F A;  2ACP X;  4HPB A;  3HPE A;  3ZW2 A;  4NYQ A;  1KXO A;  4AZN A;  5IO7 A;  2RTH B;  4JHQ A;  2O62 A;  1SLG B;  3V8U A;  5KID A;  2FT9 A;  1SRF A;  4ORY A;  1E00 A;  4YKO A;  3E3C A;  3CR6 A;  3CMP A;  2L68 A;  1BM5 A;  1S2P A;  4KC8 A;  1PMP A;  4ZHC A;  3KFH A;  1DZP A;  2G8C O;  4MIS A;  1GT1 A;  4O4U A;  2OY1 O;  1A18 A;  2POA A;  2C4I A;  2Q2M A;  2BC3 A;  1NBX A;  2FKG A;  1FEL A;  1KQX A;  3ELZ A;  5EED A;  3JSQ A;  1LIC A;  3Q34 A;  2RCQ A;  4CPF A;  3WYP A;  5DG4 A;  2KD2 A;  3AEH A;  3CWK A;  1WUB A;  1X8U A;  1BJ7 A;  1GT3 A;  1PM1 X;  2CBR A;  4PJ2 A;  1RXJ A;  1BSO A;  2FRS A;  5IRU A;  5K68 A;  4DQ3 A;  1SLF B;  4INN A;  2ZSC A;  5C0N A;  1QWD A;  2IZF B;  5IRA A;  3I0A A;  3WJD A;  2IZH B;  3MM0 A;  1KT6 A;  4Z28 A;  1LDQ A;  4ZH6 A;  1FJ1 E;  1LUQ A;  3BX7 A;  1OEJ A;  4MVL A;  3TF6 A;  2GTL M;  1YIV A;  4QGW A;  2BS5 A;  5HTD A;  1DZK A;  1TW4 A;  5AJB A;  3OD9 A;  1HQQ A;  1NC9 A;  4HPC A;  1GT4 A;  3HOL A;  3VHM A;  3PK2 A;  2C1Q A;  4A8Z A;  2WQA E;  1OPA A;  2GTF X;  2RTQ B;  3G7X A;  1MVG A;  4LZU A;  3F9D A;  1MEP A;  1ERX A;  3APU A;  3D9W A;  2FS6 A;  4WBK A;  1ZNE A;  4OS8 A;  4BX7 B;  2HZQ A;  4JGL A;  5B2A O;  5HTE A;  1O1V A;  1VWG B;  1L6M A;  1U18 A;  5HZ6 A;  3O22 A;  3T6L A;  4NP1 A;  1QY2 A;  1EI5 A;  3OBL A;  4JNJ A;  3RY2 A;  3F8A A;  1YWA A;  1ZRY A;  2BT9 A;  2EU7 X;  3AUM O;  4OS3 A;  1HXL A;  2RTL A;  3B2L A;  3D95 A;  4Y0P A;  5B11 O;  4AYH A;  1LEL A;  2ALL X;  1LIB A;  4EDE A;  3HWD A;  4O4X A;  1N9Y A;  1K3B A;  3TGC A;  1LDO A;  5AJC A;  1VPR A;  3SLO A;  1JMZ A;  2IZG B;  4FGI B;  4O9S A;  5LJD A;  4ARH A;  4OMW A;  3WZN A;  2OFA A;  5H9N A;  4BX5 B;  2FGS A;  5BVQ A;  4CK4 A;  3FW4 A;  3FYF A;  2KT4 B;  3VG3 A;  5FAZ A;  2CZU A;  4YFR A;  2AH7 X;  1QAB E;  2X56 A;  2KTS A;  2X8T A;  3BSZ E;  3CBS A;  4WHI A;  4YDA A;  3CKG A;  3SOT A;  3UEU A;  1DZJ A;  5LJK A;  1JZU A;  1MK5 A;  1HMR A;  1YWC A;  3N91 A;  4YFP A;  4CSB A;  1SWA A;  3ZW0 A;  1I4U A;  1OPB A;  2G7B A;  3RDX A;  1SXY A;  5LJB A;  3QQ2 A;  1EPA A;  3BU1 A;  3JS1 A;  2JMB A;  2MO5 A;  1AEL A;  3EC5 A;  1W6F A;  4L3R A;  1BSQ A;  3PDF A;  4GKC A;  5FQ6 E;  5B27 A;  2FTB A;  3WJB A;  4B55 A;  4MEE A;  1MX7 A;  2PY1 A;  4YFQ A;  2JN3 A;  4HWM A;  4QZT A;  1HBP A;  1JJX A;  3U03 A;  1TXL A;  1FEN A;  1RAV A;  3H3I A;  3FR5 A;  4NW4 A;  1VWN B;  2RTF B;  1QFT A;  3HTY A;  3SZJ A;  4EFG A;  1CRB A;  3EW2 A;  4TLJ A;  1XCA A;  2L5P A;  5L8I A;  3RDM A;  3VPJ E;  1BLR A;  3BLG A;  2K62 A;  4GGR A;  4TKJ A;  5EZ2 A;  3SZH A;  5CE4 A;  2AT5 X;  4CPE A;  3DSZ A;  4XMH A;  3TZS A;  4Z2V A;  1JIW I;  3FA6 A;  1GM6 A;  2A5C A;  3WYQ A;  2WSJ A;  4YBP A;  2AT0 X;  1IFB A;  4Y59 A;  5F7G A;  3VE1 A;  1IFC A;  3FA9 A;  2X45 A;  3HOE A;  4TKB A;  1SWE A;  2LA7 A;  3LHN A;  4ZGF A;  2AVI A;  2AL0 X;  2OF8 A;  1Y9T A;  1EXS A;  4D6B A;  2C1S A;  3SLT A;  2OFR X;  1X71 A;  2RTA A;  3PEC A;  2WEX A;  3MBT A;  2GTL N;  2P8G A;  3C77 X;  1DC9 A;  1E06 A;  4D6A A;  3WJF A;  3I17 A;  1I06 A;  3IFB A;  1VWM B;  1Y0G A;  4AZR A;  1GX8 A;  1XKI A;  1KL4 A;  1RST B;  2RN4 A;  5IO5 A;  1YWB A;  2CM9 A;  1N0S A;  1VYF A;  2UYW A;  3FEP A;  4YGH A;  3NQ3 A;  4AZM A;  5L3Y A;  1JYJ A;  2M4L A;  1AVE A;  4QNI A;  2X8S A;  3VHH A;  4M7M A;  4FBR A;  4Z2P A;  1DV9 A;  1SXW A;  3OE3 A;  3STM X;  2FR2 A;  5HWZ A;  5D45 A;  5F2B A;  3NAD A;  4BX6 B;  1SWR A;  4RUN A;  1SWO A;  4CDD A;  5FEN A;  1SY1 A;  2ACO A;  4U8U N;  2FHL A;  5LKF A;  1LIE A;  4GUZ A;  1MUP A;  3PH6 A;  5FQ7 E;  1N7Y A;  1SWB A;  1VWI B;  4LZV A;  4C5P A;  4I9S A;  1N43 A;  5HCD C;  1GKA A;  2OVE A;  4MVI A;  5HCC C;  4IBA A;  3VHI A;  2I5Z O;  3WXQ A;  1ACD A;  1YP6 A;  1VWQ B;  3KZA A;  3UEX A;  3HWE A;  5LJC A;  4KII A;  4WFU A;  3NQ9 A;  3TGB A;  4KCA A;  3FDC A;  3ZUI A;  4GJS A;  1VWF B;  1YP7 A;  3WVM A;  3EBW A;  1CJ5 A;  1CBQ A;  2RTD B;  1EUO A;  4NLI A;  5CSE A;  2QOM A;  4EXZ A;  2OL6 O;  1Y52 X;  1CBS A;  3P6E A;  1MOY A;  4LKT A;  4NLJ A;  4IB6 A;  4WFV A;  5BVT A;  2PI3 O;  2W2A A;  2WPU A;  4YDB A;  2BSZ A;  5DPQ A;  2OL8 O;  1K24 A;  3T6F A;  1DZM A;  2QO4 A;  1CBI A;  3IA8 A;  2LKK A;  5FQ8 E;  1VYO A;  1G5W A;  2LFO A;  1MM9 A;  1KZX A;  2GH7 A;  4CPH B;  1X8N A;  1STR B;  1VWB B;  1KOI A;  3QKG A;  4AZQ A;  4I9R A;  4GJV A;  1BWY A;  1I9H A;  3RZY A;  2JW1 A;  1KZW A;  3KFI A;  5F6B A;  3WZO A;  4YMY A;  1GGL A;  1OSP O;  3ZI8 A;  3L4R A;  4ML7 B;  5F1E A;  4ZHG A;  2IZI A;  4FBV A;  2Y3F A;  5F58 A;  3ZQ3 A;  3SLJ A;  2FLJ A;  2JU8 A;  3ZW1 A;  4R0B A;  2IFB A;  5HA1 A;  1X8P A;  1ERB A;  3B2H A;  4KC7 A;  1SWN A;  1S7D A;  1HXZ A;  4OEL A;  5HA0 A;  1B56 A;  2BHV A;  3PH5 A;  4HPD A;  4EKV A;  2LBA A;  1BEB A;  1BBP A;  2MF6 A;  2XKL A;  3NX1 A;  3P6D A;  4O49 A;  1EPB A;  2VDF A;  2IZD B;  2OY7 A;  4GK9 A;  1W4T A;  1HMT A;  1RSU B;  3GAQ A;  4ORS A;  4YGG A;  2X55 A;  4Y0R A;  4MVK A;  2E4J A;  3X00 A;  1SWS A;  1KFF A;  2OY8 A;  1U0X A;  1O8V A;  1NDJ A;  4UU3 A;  2RCT A;  4UU2 A;  4MVE A;  2A2G A;  1T68 X;  4HFO A;  2VFC A;  3AKN A;  1EII A;  2A8G A;  1VWR B;  1VWE B;  1JYD A;  3NP1 A;  1HY2 A;  3PPT A;  4L1N A;  1QY1 A;  2CBS A;  4ZCB A;  3KFF A;  3O2Y A;  5CHK A;  2CZT A;  4DQ4 A;  4IAX A;  4M6S A;  5D4A A;  1UYO X;  2OFM X;  3FLL A;  4I3B A;  5KIC A;  3K3L A;  3FID A;  1SWC A;  4AZP A;  1EAL A;  3WOV A;  1WBI A;  1KQW A;  2BLG A;  3APV A;  4GH7 A;  2OVD A;  4BQU A;  1FTP A;  3FEK A;  3FIQ A;  2Z4I A;  1NP1 A;  4JO6 A;  1PBO A;  2HYS A;  3WZP A;  1SWL A;  1EW3 A;  5L8N A;  4BX7 A;  4TQ2 A;  4FQB B;  3WJG A;  2OYB O;  2Z4H A;  4Z6J A;  3ELX A;  1X8O A;  1RXH A;  3RDU A;  2R74 A;  1OBP A;  4ALO A;  3PED A;  1AB0 A;  2RTC B;  1YUP A;  3ZZV A;  1VWA B;  1B0O A;  1TOU A;  1QY0 A;  1VWD B;  5B3M O;  3T2W A;  3KFG A;  3VGW A;  3WZQ A;  4ZHH A;  1SMP I;  1ICM A;  2HLV A;  4YH0 A;  1O1U A;  5HZ8 A;  2IZK A;  2HKD A;  3FW5 A;  2L67 A;  2Q2P A;  4IAW A;  5HZ9 A;  1NQM A;  1OBQ A;  1VWL B;  1LCW A;  3RE6 A;  4CDC A;  2JU7 A;  2OVA A;  2X4M A;  1T0V A;  2UZ2 A;  3BRN A;  4MIR A;  4O3W A;  2G5L A;  2AKQ A;  2QOS C;  5EDC A;  4AW8 A;  1IJ8 A;  1MX8 A;  5JD2 A;  2HMB A;  5HZQ A;  4BX5 A;  4QGX A;  1JJJ A;  2RD7 C;  3FA7 A;  1ZNK A;  4NV8 A;  1H91 A;  1YWD A;  3C78 X;  3EYC A;  3GE2 A;  2JGS A;  3MVF A;  2ZAG A;  4BBO A;  1VWK B;  1TVQ A;  1X8Q A;  3CQR A;  2ZAI A;  4FBO A;  3RY1 A;  1I78 A;  3NQK A;  1SWT A;  1HMS A;  2G79 A;  1NP4 A;  4O3Y A;  1Y9L A;  3T1D A;  5EEE A;  4A60 A;  2F73 A;  2RTP B;  2NNQ A;  5KHP A;  3DTQ A;  5K67 A;  4GRJ A;  2YG2 A;  1ZNH A;  4DCB A;  4ZFX A;  1KT7 A;  1VWC B;  4GNY A;  4Z2O A;  3U0D A;  1LID A;  1FDQ A;  3VG4 A;  4OS0 A;  3P6C A;  1I04 A;  5EPQ A;  1SRE A;  1KT4 A;  5EDB A;  1PBY A;  2WWP A;  5JR8 A;  3P24 A;  2A5B A;  5HBS A;  2OFB A;  1G85 A;  1ICN A;  1U17 A;  2JU3 A;  1STP A;  3LTW A;  4O3X B;  3Q6L A;  1A2D A; 
#chains in the Genus database with same CATH homology
 1SY2 A;  3PP6 A;  2FR3 A;  4K19 A;  4ON1 A;  1QQS A;  1SXU A;  1KGL A;  1JBH A;  4ZR2 A;  3P6H A;  5B29 A;  2MJI A;  4QRL A;  1ALB A;  3HK1 A;  4U8U O;  1EIO A;  4I3D A;  2MWH A;  4Y0Q A;  2ANS A;  1URE A;  3NR3 A;  3O19 A;  4OMX A;  2WR6 A;  4ORX A;  4TNN A;  4ZHD A;  5HAE A;  5LKE A;  3WJC A;  4RUU A;  2YMS A;  2KTD A;  4EEJ A;  4NNS A;  3D4R A;  3WBG A;  2A13 A;  5BYP A;  1B8E A;  4I6S A;  3RBY A;  5D8J A;  1ZND A;  1FEM A;  4CV7 A;  3F6Z B;  4IMO A;  3ZW1 B;  3CBC A;  1BSY A;  3C76 X;  4TKH A;  3HWG A;  1HQP A;  3BS2 A;  1S44 A;  1SY3 A;  4O4O A;  4EQA C;  1TOW A;  1SA8 A;  2L9C A;  4LKP A;  2Q4N A;  4YGZ A;  2FWV A;  2WQ9 A;  1X89 A;  4U9C A;  4QYP A;  1G74 A;  3STN A;  3UAQ A;  2OZQ A;  4GZV A;  1RLB E;  5FFH A;  1SXX A;  4XMD A;  1E02 A;  3MX7 A;  5K06 A;  2WEW A;  2R56 A;  3RKG A;  5LJH A;  4QYN A;  4ZH9 A;  4IB7 A;  4KH8 A;  1OEE A;  1D3S A;  2X46 A;  3RSW A;  3D96 A;  5D47 A;  1GXA A;  4O3Z A;  3P6F A;  4BVM A;  1AVG I;  4TJZ A;  3TGA A;  4ZHF A;  3PQS A;  3ZW0 B;  4ODD A;  3P6G A;  1ML7 A;  1KT3 A;  1P6P A;  4IB9 A;  2W2B A;  4IB8 A;  5CYB A;  4ES7 A;  1IKJ A;  1NGL A;  2LBV A;  3B2J A;  2BS6 A;  3STK A;  1A3Y A;  2NND A;  2QM9 A;  4ORR A;  4XME A;  2HNX A;  2JOZ A;  2NNE A;  1ZNL A;  4QZU A;  3FR4 A;  4XMF A;  2MM3 A;  3FA8 A;  3FEN A;  1B4M A;  2AT6 X;  1D2U A;  2MHD A;  2G78 A;  4A1Y A;  1RBP A;  4QAE A;  5BVS A;  3ZUO A;  1DFV A;  2Q39 A;  3D97 A;  2A3F X;  2RQ0 A;  4NYR A;  5H8T A;  2GJ5 A;  1GX9 A;  2NP1 A;  1R0U A;  3JQO A;  1DF3 A;  1G7N A;  5HCE C;  4U8U M;  3RWX A;  3APW A;  3NPO A;  2CM4 A;  4ZGU A;  1E5P A;  4ORW A;  1FE3 A;  3CQN A;  3VG2 A;  1ADL A;  2WUT A;  1AQB A;  2AT8 X;  4GE1 A;  4ALB A;  2GC9 A;  5F6Z A;  2R73 A;  4LQZ A;  4ZJ0 A;  5D48 A;  5AQ6 A;  3APX A;  4QGV A;  1IKE A;  3VG7 A;  1HBQ A;  4GNW A;  2A0A A;  3VE2 A;  4AZO A;  5H9A A;  3AKM A;  3HWF A;  3EM0 A;  3UEW A;  4I95 A;  1Z24 A;  3LV4 A;  1LF7 A;  1MDC A;  4NNT A;  1IIU A;  3KQ0 A;  1LKE A;  2HZR A;  1IW2 A;  2A2U A;  5HZ5 A;  2K23 A;  4O4S A;  3FEL A;  1PEE A;  3BU9 A;  3BY0 A;  4N7C A;  1BRP A;  4A1H A;  3BDR A;  1SY0 A;  1KT5 A;  4IAB A;  3FMZ A;  1CBR A;  3VG5 A;  4GDZ A;  4GET A;  1OEK A;  2ASN X;  4KT5 A;  2LB6 A;  4IMN A;  1VYG A;  2OVS A;  1UZ2 X;  3FR2 A;  4PSQ A;  4QQ1 A;  4I3C A;  2GTL O;  2KW1 A;  4XMC A;  4YKM A;  4XMG A;  1GKA B;  3EMM A;  4BOE A;  1BRQ A;  2QO6 A;  1T8V A;  4YCE A;  1A57 A;  1GT5 A;  2AMM X;  4ORU A;  2X8F A;  3S5X A;  5LJE A;  2N93 A;  3NX2 A;  2AT3 X;  5L8O A;  3S26 A;  1LFO A;  2Q9S A;  4ID2 A;  4YCH A;  5LJG A;  3UEV A;  2QMI A;  5IO6 A;  3VG6 A;  5H9L A;  3WJE A;  2QO5 A;  3EBK A;  3NBX X;  5AEO A;  1QG5 A;  3VU1 A;  2FS7 A;  3SAO A;  3B2K A;  1LPJ A;  1ZNG A;  1HN2 A;  2F09 A;  3BX8 A;  4Y0S A;  4GU8 A;  3B2I A;  1OBU A;  3P02 A;  4YBU A;  1I05 A;  2DM5 A;  3PQU A;  3S5V A;  4COT A;  4N7D A;  5H9K A;  2XST A;  2RA6 A;  3S60 A;  3ZWE A;  1JV4 A;  3OJY C;  1QFV A;  4HPA A;  4U3Q A;  1EQD A;  1LNM A;  1LIF A;  2W2F A;  2ACP X;  4HPB A;  3ZW2 A;  4NYQ A;  1KXO A;  4AZN A;  5IO7 A;  2O62 A;  3V8U A;  5KID A;  2FT9 A;  4ORY A;  1E00 A;  4YKO A;  3E3C A;  3CR6 A;  3CMP A;  2L68 A;  1BM5 A;  1S2P A;  4KC8 A;  1PMP A;  4ZHC A;  3KFH A;  1DZP A;  4MIS A;  1GT1 A;  4O4U A;  2POA A;  1A18 A;  2Q2M A;  1FEL A;  1KQX A;  3ELZ A;  5EED A;  3JSQ A;  1LIC A;  2RCQ A;  5DG4 A;  2KD2 A;  3CWK A;  1BJ7 A;  1GT3 A;  1PM1 X;  1X8U A;  2CBR A;  4PJ2 A;  4DQ3 A;  1BSO A;  2FRS A;  4INN A;  5C0N A;  1QWD A;  3I0A A;  3WJD A;  1KT6 A;  3TF6 A;  4ZH6 A;  3BX7 A;  1OEJ A;  4MVL A;  2GTL M;  1YIV A;  4QGW A;  2BS5 A;  5HTD A;  1DZK A;  1TW4 A;  5AJB A;  3OD9 A;  4HPC A;  1GT4 A;  3HOL A;  4A8Z A;  2WQA E;  1OPA A;  2GTF X;  3G7X A;  1MVG A;  4LZU A;  3F9D A;  1ERX A;  3APU A;  4WBK A;  2FS6 A;  1ZNE A;  4OS8 A;  2HZQ A;  4JGL A;  5HTE A;  1O1V A;  1L6M A;  1U18 A;  5HZ6 A;  3O22 A;  4NP1 A;  1QY2 A;  1EI5 A;  3OBL A;  3F8A A;  1YWA A;  1ZRY A;  2BT9 A;  2EU7 X;  4OS3 A;  3D95 A;  3B2L A;  4AYH A;  4Y0P A;  2ALL X;  1LIB A;  4EDE A;  3HWD A;  4O4X A;  3TGC A;  5AJC A;  1VPR A;  4FGI B;  4O9S A;  5LJD A;  4ARH A;  4OMW A;  5H9N A;  4CK4 A;  5BVQ A;  3FW4 A;  3FYF A;  2KT4 B;  3VG3 A;  5FAZ A;  2CZU A;  4YFR A;  2AH7 X;  1QAB E;  2X8T A;  2KTS A;  3BSZ E;  3CBS A;  4WHI A;  4YDA A;  3SOT A;  3UEU A;  3U9P C;  1DZJ A;  5LJK A;  1JZU A;  1HMR A;  1YWC A;  3N91 A;  4YFP A;  4CSB A;  3ZW0 A;  1I4U A;  1OPB A;  2G7B A;  1SXY A;  5LJB A;  1EPA A;  3BU1 A;  3JS1 A;  2JMB A;  2MO5 A;  1AEL A;  4L3R A;  1BSQ A;  4GKC A;  5FQ6 E;  3WJB A;  5B27 A;  2FTB A;  1MX7 A;  2PY1 A;  4YFQ A;  2JN3 A;  4HWM A;  4QZT A;  1HBP A;  1JJX A;  3U03 A;  1TXL A;  1FEN A;  3H3I A;  3FR5 A;  4NW4 A;  1QFT A;  3HTY A;  4EFG A;  1CRB A;  4TLJ A;  1XCA A;  2L5P A;  5L8I A;  3VPJ E;  1BLR A;  3BLG A;  2K62 A;  4TKJ A;  5EZ2 A;  3TZS A;  5CE4 A;  2AT5 X;  3DSZ A;  4XMH A;  1JIW I;  3FA6 A;  1GM6 A;  4YBP A;  1DV9 A;  2WSJ A;  2AT0 X;  1IFB A;  5F7G A;  3VE1 A;  1IFC A;  3FA9 A;  2X45 A;  3HOE A;  4TKB A;  2LA7 A;  3LHN A;  4ZGF A;  2AL0 X;  1Y9T A;  1EXS A;  4D6B A;  2OFR X;  1X71 A;  3PEC A;  2WEX A;  3MBT A;  2GTL N;  2P8G A;  3C77 X;  1DC9 A;  1E06 A;  4D6A A;  3WJF A;  3I17 A;  1I06 A;  3IFB A;  4AZR A;  1GX8 A;  1XKI A;  2RN4 A;  5IO5 A;  1YWB A;  2CM9 A;  1N0S A;  1VYF A;  3FEP A;  4YGH A;  4AZM A;  3NQ3 A;  1JYJ A;  2M4L A;  4QNI A;  2X8S A;  4M7M A;  4FBR A;  1SXW A;  3OE3 A;  3STM X;  2FR2 A;  5HWZ A;  5D45 A;  3NAD A;  4RUN A;  5FEN A;  1SY1 A;  2ACO A;  4U8U N;  5LKF A;  1LIE A;  1MUP A;  3PH6 A;  5FQ7 E;  4LZV A;  4I9S A;  5HCD C;  1GKA A;  2OVE A;  4MVI A;  5HCC C;  4IBA A;  3WXQ A;  1ACD A;  1YP6 A;  3KZA A;  3UEX A;  3HWE A;  5LJC A;  4KII A;  4WFU A;  3NQ9 A;  3TGB A;  4KCA A;  3ZUI A;  3WVM A;  1YP7 A;  1CJ5 A;  3EBW A;  1CBQ A;  1EUO A;  4NLI A;  4EXZ A;  1CBS A;  3P6E A;  4LKT A;  4NLJ A;  4IB6 A;  4WFV A;  5BVT A;  2W2A A;  4YDB A;  5DPQ A;  1DZM A;  2QO4 A;  1CBI A;  3IA8 A;  2LKK A;  5FQ8 E;  1G5W A;  2LFO A;  1X8N A;  1KOI A;  3QKG A;  4AZQ A;  4I9R A;  1BWY A;  3RZY A;  1KZW A;  2JW1 A;  3KFI A;  5F6B A;  4YMY A;  1GGL A;  3ZI8 A;  3L4R A;  4ML7 B;  5F1E A;  4ZHG A;  4FBV A;  5F58 A;  3ZQ3 A;  2FLJ A;  2JU8 A;  3ZW1 A;  4R0B A;  2IFB A;  5HA1 A;  1X8P A;  1ERB A;  3B2H A;  4KC7 A;  1S7D A;  5HA0 A;  1B56 A;  2BHV A;  3PH5 A;  4HPD A;  2LBA A;  1BEB A;  1BBP A;  3NX1 A;  2XKL A;  3P6D A;  4O49 A;  1EPB A;  4GK9 A;  1HMT A;  3GAQ A;  4ORS A;  4YGG A;  4Y0R A;  4MVK A;  2E4J A;  1U0X A;  1O8V A;  4UU3 A;  2RCT A;  4UU2 A;  4MVE A;  2A2G A;  1T68 X;  4HFO A;  3AKN A;  1EII A;  1JYD A;  3NP1 A;  3PPT A;  4L1N A;  1QY1 A;  2CBS A;  4ZCB A;  3KFF A;  3O2Y A;  4DQ4 A;  2CZT A;  4IAX A;  4M6S A;  5D4A A;  2OFM X;  3FLL A;  4I3B A;  5KIC A;  3K3L A;  4AZP A;  1EAL A;  3WOV A;  1KQW A;  2BLG A;  3APV A;  4GH7 A;  2OVD A;  4BQU A;  1FTP A;  3FEK A;  3FIQ A;  2Z4I A;  1NP1 A;  1PBO A;  2HYS A;  1EW3 A;  5L8N A;  4TQ2 A;  4FQB B;  3WJG A;  2Z4H A;  3ELX A;  1X8O A;  4ALO A;  2R74 A;  1OBP A;  3PED A;  1AB0 A;  1YUP A;  3ZZV A;  1B0O A;  1TOU A;  1QY0 A;  4ZHH A;  3KFG A;  1SMP I;  1ICM A;  2HLV A;  4YH0 A;  1O1U A;  5HZ8 A;  3FW5 A;  2L67 A;  2Q2P A;  4IAW A;  5HZ9 A;  1OBQ A;  1KZX A;  2JU7 A;  2OVA A;  3BRN A;  1T0V A;  4O3W A;  4MIR A;  2AKQ A;  2QOS C;  5EDC A;  4AW8 A;  1MX8 A;  1JJJ A;  2HMB A;  5HZQ A;  4QGX A;  2RD7 C;  3FA7 A;  1ZNK A;  1H91 A;  1YWD A;  3C78 X;  3EYC A;  3GE2 A;  3MVF A;  2ZAG A;  1TVQ A;  1X8Q A;  3CQR A;  2ZAI A;  4FBO A;  3NQK A;  1HMS A;  2G79 A;  1NP4 A;  4O3Y A;  1Y9L A;  3T1D A;  5EEE A;  4A60 A;  2F73 A;  5KHP A;  2NNQ A;  3DTQ A;  4GRJ A;  2YG2 A;  1ZNH A;  4ZFX A;  1KT7 A;  4GNY A;  3U0D A;  1LID A;  1FDQ A;  3VG4 A;  4OS0 A;  3P6C A;  1I04 A;  5EPQ A;  1KT4 A;  5EDB A;  2WWP A;  5JR8 A;  3P24 A;  5HBS A;  1G85 A;  1ICN A;  1U17 A;  2JU3 A;  4O3X B;  3Q6L A;  1A2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...