4MIWA

High-resolution structure of the n-terminal endonuclease domain of the lassa virus l polymerase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
170
structure length
170
Chain Sequence
b'MEEDIACVKDLVSKYLVDNERLSRQKLAFLVQTEPRMLLMEGLKLLSLCIEVDSCNANGCEHNSEDKSVERILHDHGILTPSLCFVVPDGYKLTGNVLILLECFVRSSPANFEQKYIEDFKKLEQLKEDLKSVDINLIPLIDGRTSFYNEQIPDWVNDKLRDTLFSLLKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase L
publication title High-resolution structure of the N-terminal endonuclease domain of the lassa virus L polymerase in complex with magnesium ions.
pubmed doi rcsb
source organism Lassa virus
molecule tags Viral protein, transferase
total genus 61
structure length 170
sequence length 170
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4miwA02
3JSBA 5J1NA 5IZHA 4MIWA 5J1PA 4I1TA
chains in the Genus database with same CATH superfamily
3QWUA 2HQIA 4ECQA 3AT1B 4G1IA 4FYWB 3JQJA 1AFJA 2H54B 3SBMA 3NS6A 2ZM6F 3C46A 5A6PA 4ZVOB 5BYQA 1TK5A 3IA0A 1JLEB 4HR2A 4I68A 1LWEB 1S6OA 3DI6A 3FMWA 2XS2A 1RK8A 3MTKA 4KV8A 1HNIB 1Y5IB 5IV4A 2I0XA 2KT3A 4H4OA 3HSDA 4ICLA 1IKVA 5EHHA 3MECA 4C8MA 1DLOB 4YHHJ 1ZM4A 4DR2F 4YY3F 2BKOA 1R7IA 4AQYF 1FFGB 3DM2B 3H2UB 3GP9A 4DSJA 2GQCA 2MQMA 4KKOA 2NXUA 3JXOA 3T6BA 1N52B 1RT2A 4GC7A 2C1EB 2BDPA 3FRYA 4NYOA 4EO6A 2YKPA 4O4GA 5L1LA 4FF4A 4OI3A 4WFAQ 4DX8H 3AQOA 4N77A 1UVMA 5A2QY 1NZAA 1S4FA 2HBYB 2ZZNA 2C22A 3W7BA 2BUNA 2V0NA 3BKTA 3NGDA 2AJFE 1TFYA 4F8RA 4WTOB 5F8GA 2IM3A 1F9EB 2J9DA 2MKKA 4EUVA 5C24A 2H4YB 1HBOB 2LCWA 4WK3A 3A8KA 1R31A 2ZBRA 4NE9C 2VQEF 1YJ9S 2QMWA 3OT9A 1SQEA 2QL5B 3OFGA 1RWUA 3SSSA 4OHYA 1DY3A 3GSIA 2HGLA 2ZH3A 1U2FA 4USMA 2ZHBA 3N6MA 2V4RA 3IN5A 3U02A 4BWMA 2PI5A 2OEMA 4JV5J 4NMXA 3OR1A 3BKFA 2JEFA 4UQTA 5DZ6A 5AE2A 4A4JA 3F56A 2RDIA 2L3MA 2C2DA 2ZBCA 2IAJA 4X4TA 3T5HA 3D1OA 4O0NA 7FDRA 2BJ1A 4DX5A 3G96A 2Z8QA 2XMKA 2RH3A 2GO8A 4J9KA 4TN2A 3SQGA 1HI1A 4DCOB 3AOAA 3GMGA 3P45B 2DT9A 5KFBA 4C11A 2QL9B 3DI6B 4NRUA 4DV3F 5J2QA 4GMKA 3EPIA 4Q8EA 3M6UA 1KD1T 2GVDA 4KV8B 3AJ1A 4RW8A 4LF8J 5GAHI 4H4OB 3R2DJ 5E3AA 4ICLB 1IKVB 5C7PA 3CCVS 3HP6A 2HVEA 3MPYA 4WK1A 1IJFB 3OV7A 4KH1B 3PRBA 4KKOB 3W9HA 1S12A 3ZC4A 2EXUA 1B7FA 2R2SA 2OP5A 2LQBA 1IN0A 3GYXB 1IVZA 2VB6A 2MZQA 1JWWA 1YG0A 1R8AA 2GNKA 1I51B 1CVJA 1Q7YT 3OSPA 2KVIA 2CVIA 3K5PA 5A0YB 1RZMA 4M5KA 2Z2LA 3R8YA 1NK8A 2D69A 4LBHA 1QE1A 3I0SB 4LBPA 5HLFA 2FHMA 3OFHA 4ED5A 2R7OA 2KFZA 3VZIA 1NHUA 4DPTA 4JI5F 1V3RA 1F60B 2FHOB 2VFTA 4P2MA 5C24B 5F8NA 1I3OB 2I9SA 1JKHB 1VQOS 3EVOA 4JP8A 2B8PA 4NCGB 3MOJB 2HAFA 3UDLA 3NLCA 4ED0A 3E51A 3JSMA 2OO4A 2FY8A 4F4XA 1CQMA 2J0SD 2FLPA 3VAJA 5CAAA 5B09A 2UXBF 3IM9A 2CDQA 2AEFA 2BJ9A 1WHVA 1Q53A 4F4WA 4NLUA 1RB0A 1SC6A 4L72B 3R7BB 1S9EA 3GJRB 3THTA 1HA1A 3G8TA 3SFUA 2B6AA 3GLJA 4ZKAA 3CO0P 2GMLA 1AW0A 1SJ1A 2I2YA 3ZZZA 4KAIA 1IJEB 2I1RA 4LSZB 3KFWX 4C11B 2D3OR 2RIJA 1U1LA 3G71S 4X4RA 3MMCA 2R8KA 3DFEA 4Q44A 1HKAA 4QU6A 2GVDB 3KK2A 4M5DA 5KFJA 4LF9J 3MF5A 1SC4B 5E3QA 1CEZA 5J2PB 5L46A 4MKAA 4FBUA 5ETSA 1S0NA 2B8QA 1RT1A 1RA7A 4PAAA 2ZEJA 1C1CB 1G4CA 1FKPA 1GMUA 2XSFA 3QFHA 1WC5A 1YRXA 3A12A 1K1SA 2O01C 2CG4A 3MD3A 1F2GA 3KLEA 1NH7A 4ES3A 5IM0A 2UV8G 2AZ1A 3OTDA 3FBEA 1U09A 2Q43A 3SFGA 1ZETA 1RAAB 4DR7F 2E7XA 3CD6S 2HQDA 2A6MA 4ZLLA 1QE1B 5HLFB 1WKJA 1GXLA 4N8NA 4CM0A 4KFBA 4LSNA 2MPUA 2DEJA 3T5LA 4NL5A 4NZ7A 2K8GA 1Q95G 4DV0J 2OELA 3AOCA 4QIEA 3MR2A 1GX5A 2QYGA 2QMXA 1XMQJ 4TQRA 2EFQA 4CZCA 4HKQA 3JSMB 1RWWB 2ROGA 2YX4A 3SV4A 2BQ3A 2FVQA 2HEKA 3HHLA 2W7PA 3GFXA 2HRTA 1RHKB 2CADA 1TFWA 2MQNA 2V8PA 4K4WA 2ZM6J 2AF6A 4WIQA 1KFSA 3I4HX 3R7SB 1FNMA 4UF4A 3M7VA 4QU7A 3JB9k 2AGOA 1NH8A 1H73A 2EPIA 5L9XA 3GV8B 3ZTOA 2B6AB 3HPOA 4AXIA 3B4DA 1RKIA 2YQ1A 1FE0A 1L3UA 1FDAA 1M5HA 1VOMA 4JV2A 2HFZA 3PY8A 2BJDA 4QWCA 4I2QA 3KUEA 4YY3J 3MMCB 2NPIA 2LEBA 3I5BA 3KK2B 4M5DB 3ZTSA 2CPEA 2ROEA 3VAKA 3ELHA 2VD3A 3CPWR 1X0PA 1V5IB 2BRLA 1Q8IA 2NPFA 3VZHA 2A1BA 1RWXB 4X66F 3JYTA 2ZFHA 2BE9B 1KVJA 2HHSA 3SQOP 1FKPB 3LW5C 3TZYA 4DL7A 3CIZA 4GO5X 1U25A 3TVZA 1KQFB 1U1NA 4WKRA 3KLEB 4PZVA 1RE1B 4ID5A 2DTJA 4OFZA 2M3DA 1VBYA 4IO1A 1LW2A 1YBTA 1U6FA 4X64J 3IRWP 3A3OB 4Y3CA 5IXUA 2YKOA 3HULA 6FD1A 4M95A 2N7YA 4KFBB 3NGSA 4YR2A 2UUBJ 1WORA 1BGXT 4O3RA 4LR8A 3C8YA 1FRJA 1UWAA 3R27A 5EN1A 2M8HA 2B9WA 2GIQA 1SI9A 2MLXA 4P2FA 4WBFA 3Q0AA 5HVGA 2EBEA 1ZS6A 5CYMB 2UXDJ 4Y2CA 1DTQA 4RWWA 3DHXA 2CNOB 3PR5B 3OL9A 2J0XA 5KFAA 2EFVA 3TI0A 4ED8A 3CD7A 1RGVA 3HHLB 1HQUA 2W2OP 4USUA 4QYZK 1CJUA 1REVA 3CO9A 2MSSA 3TQ1A 2FJAB 1G3OA 2B3TB 3GJSB 3M2VB 2B5JB 4ZLJA 2IPOB 2ALYB 4I67A 3UN3A 3BKUA 4DV3J 3HKZD 1SQGA 2ZBPA 2LQ5A 3DLHA 3MGJA 3K7RA 3D67A 2UV8A 1QTNB 1FWPA 3CWJA 1T11A 1UJ6A 4BC7A 2RS8A 2JZ5A 4J9LA 1D8YA 1RAFB 2F4FA 2CQ3A 2VJUA 3O8WA 2E9ZA 2CPZA 3GIRA 3TEGA 5HL7Q 1IBKJ 4N47A 3I96A 1X31C 2MKCA 3ET6A 4C48A 2KO1A 2HS3A 3MEGA 2YWGA 5LXRA 3E3XA 2AJ1A 3NKYA 3PX6A 2RT3A 2GA7A 1N36F 1NDPA 3DLBA 2GX8A 3E01A 3QO9A 5KFFA 1VR6A 1UA0A 3HHEA 2QG9B 2IY5B 1U0HB 2AYEA 1SJ4P 4ANEA 4LF5F 1IM6A 2RRAA 3PHTA 3LWMA 4LRFA 4N76A 1YKWA 2GV1A 2GHPA 3ULHA 4M5NA 1NK0A 1TVRA 1F9HA 4C8ZA 1HARA 3GPAA 2CAJA 3IS9B 1RTIA 5E2QA 1T7PA 3O2IA 1S1VA 5SZTA 4DL6A 1PSDA 3U7JA 2DPJA 5IFMA 3KLGA 4UUWA 1PJ6A 2MKIA 3BBCA 3MCSA 4DR3F 2XSJB 3H40A 1VK3A 4FBTA 2GAGC 2I8EA 5KFRA 1HQUB 3R5BA 3CCES 4ZK7M 2A0FB 1HBNA 1LNQA 4I1TA 5JJBA 1FVQA 4CLPA 4NYPA 5F41A 2GMJA 3MD1A 2YPZA 3ILOA 4P2SA 1RHJB 3BYRA 3VF0B 2EK6A 2J9DE 2W7OA 3EZUA 5KOXA 5KFTA 3DN9A 4DG1B 1C4AA 5CA5A 1VRUA 2N4CA 5IOLA 3K57A 4LR9A 3DRSA 3SXLA 1OJ4A 2AEMA 3C2PA 2VG7A 3AB2B 5KT2A 3DRPB 1SH0A 4ZVUB 1S6PA 2KXHA 3JTNA 2P6TA 3SDEA 1S9FA 3EWGA 2ILZA 2HK2A 4OX9F 3BJYA 1S4EA 4PG7A 2P5VA 2AV5A 2Z56B 3ZNJ1 2BRKA 3PW2A 4ZPAA 2MXYA 3ET6B 2RUSA 4AD6A 4ID8A 2DKOB 2DNNA 1J5OA 2J7KA 4O0IA 1RQ0A 3CMAS 5EX0A 3QIDA 2B4PA 3DMJB 4B9SA 3QQCD 1JJCB 3GJTB 3E01B 3HHLC 4UQGA 5E41A 1HBUA 4IH7A 4F50A 1RDRA 2Q1LA 2I38A 4ECRA 3AY0A 1O6XA 2FJEB 4QIWD 1RAJA 5AXNA 1OQ3A 3AXKA 4AT1B 4F3OA 1U6ZA 4EWTA 3FBCA 3UN5A 1S1VB 5ETMA 3HVRA 2WSFC 5DO2A 2E5LF 1B7YB 1IKYA 4LMZA 3NP5A 4MIAA 4FNIA 2HGNA 4QWAA 1EB0A 1URRA 2XQCA 3BQ2A 4XPCA 1MLAA 4OYMA 2WVBA 4ZOSA 2NYHA 2V63A 5LJ3Y 1T03A 5BYSA 1HBNB 2LEPA 3N01A 2F8MA 2JRSA 3IFEA 2AX1A 2IJRA 4DMZA 3G8SA 1U0SA 2DR8A 3FNNA 1WC0A 3KYLA 1OY8A 3AJ2A 4O44A 1YJVA 4Q0BB 4GC6A 1UVLA 3MAQA 3HKWA 3R5DA 3MWBA 2ZVIA 4B3RF 1JLCA 1FK9A 1W2BR 3NBPA 5AE3A 1X9MA 4DL3A 5FDLB 3DRSB 4AFFA 4HACA 2HVDA 2PEHA 2VG7B 1Y10A 5CABA 1GK8A 1S6PB 2QLBB 1S7IA 3CJ8A 1CJVB 1KS2A 5K14A 3SDEB 4TU7A 1W2IA 4YDDB 5CHCB 3MM9B 5KFSA 3EICA 1XMOF 2OSQA 1W25A 4E8UA 2C3PA 3RG6A 2CJKA 4FF2A 4N5SA 1Q81T 1VGYA 1QTMA 2DGTA 1FNXH 4JV1A 1S6QA 4OI0A 2VPZB 1UWBA 1LOUA 4JI2F 2DY9A 1R0BG 1JXEA 1J5OB 5C25A 3CC7S 2KL8A 2K2PA 4WP3A 4V19X 4NCAA 2BX6A 2EEYA 3BGFA 1HPZA 4DU7A 1WOOA 4N7TA 3PYDA 1PO6A 4FXDA 4TKTA 1VBZA 3OXFA 1T05A 2IIHA 2JDJA 1HBUB 4ZDNA 4O3OA 3QIPA 2HYIB 3M9NB 2VG6A 3H42A 4ECZA 3PJ9A 2KHDA 1X0FA 4RUCA 2Y0BB 5CYQA 2GMHA 1RT3A 3BB5A 4ECUA 1TL7B 2FVPA 2N4DA 4DPOA 4A8WA 5B0EA 5AXKA 1NPRA 1IKYB 4JV0A 4DV6F 4DUYJ 2CPJA 5K8NA 2UVVA 4OZJA 2GFFA 3SIPB 4C3MA 3J7YU 4JI6J 1DTTA 2IVYA 2QSFA 3OFFA 1HR0F 2XWYA 3OVSA 4OZNA 1FWLA 3D54A 1XNQF 1FA0A 1NPPA 1FTCA 4GKKF 2BKPA 2IYIA 3OL7A 4JI1F 1RUSA 2B9XA 2UVRA 2X3GA 4Q2MA 4A48A 2N3OA 3LPYA 3DOKA 1DJ0A 3WQPA 1GH8A 2QLFB 3EGZA 3I9V9 1APSA 4MTPA 4DZ6A 3M8RA 4QIVA 3NBPB 2PMHA 2KH9A 2IYGA 3I31A 3KK3A 2Q6BA 2FIUA 2YNGA 1XK8A 3CCZA 4I2PB 2U2FA 2YKAA 3MURP 3P5TL 3IC1A 3QAUA 3NNCA 4OQJA 5HQLA 2OEJA 2ZJRQ 3DGPA 3N9UC 2G1DA 2LECA 3BN4A 4CO0A 4X65J 1S6QB 2GQQA 1UWBB 3G82B 4RW6A 2PFFB 4DLGA 3OD2A 1S49A 2UUCJ 5C25B 2QC3A 3M8ZA 1NK5A 4LFCJ 1WG1A 3EX7B 3W3SA 1HPZB 4JI0F 1LXJA 5D0HA 2B7CB 4CI0B 3TNVA 1WDDA 5BR8J 2HRYA 2C2OB 2J5AA 5EUHA 3EXYA 3CJTA 4DLEA 3M9MB 1REGX 2CZ4A 3QIPB 4QZVB 2VG6B 4PR6A 4FNHA 4PWUA 4I7FA 2F5GA 1QAXA 2MJUA 2VBZA 2J9CA 2HHPA 1P6TA 5A76A 2MKJA 4PQAA 4Y2IA 1FF2A 2E5JA 4ITSA 2E5GA 3IWLA 2OHDA 4YUDA 2LDIA 2HNZB 2R8GA 2GAHC 1DTTB 3Q23A 2QL7B 2W4CA 4EZ9A 1AZSA 2PD1A 2V69A 3OR2A 2OMLA 4DF4A 2C2NA 1IR1A 4GVLA 3KJVA 1ROFA 3I5AA 1UEUA 4ECYA 4YB6A 3VAFA 1IKWA 1LK7A 5GAGU 1N5TA 2IM2A 4FYYB 2J6SA 2BABA 4IG3A 1WHXA 5ETLA 1HNWF 4QWDA 1S97A 1S99A 3KK3B 4J37A 5KFGA 3GYGA 4RZRA 5H9EK 3M1VA 2OD4A 5D0RA 2R9LA 4IH6A 1T02A 3GYNA 1JXVA 5L8RC 1CBKA 1NPKA 3KHHA 4K4SA 2YWKA 4MAKA 5KFDA 1KLNA 1EP4A 2RF2A 2BMBA 5L1JA 1OSCA 4P73A 1WF2A 5D3GB 3AA8A 2NYIA 2KYXA 3CDBA 5D77A 2UP1A 3Q2SC 2R7SA 2HLTA 4ZVTB 2LMIA 1IR0A 5ETNA 3KHGA 4RW6B 3R5CA 2HLUA 3QLHA 3CJRA 1N5VA 1FWKA 4OYBA 2VU5A 2F7VA 4JOUA 1SKSA 4LRAA 3PRDA 4R0JA 2MQLA 5KFNA 2ZH1A 3GZ7A 4F26A 1CJKB 5D15A 5BXIA 2EVZA 1NB2A 1RTDB 4I7FB 2E5LJ 4NCBA 3V4IB 3KNAA 3M2UA 5K5MA 4LRDA 1ZYQA 2HBRB 2VFRA 3A3NB 3MDFA 1S1UA 1Y7PA 2BJ8A 4KQZA 1UW4A 1UKUA 1S10A 4OI4A 5I3UB 3MAAA 5LMNF 4K59A 4FVMA 5THWA 2A10A 1JX4A 2DIVA 2HFVA 2ILYA 4OZ5A 4U7UD 2YTCA 2DIUA 1KVIA 4CO1A 1VBXA 2PFDA 1VQ5S 1DQAA 4H4KA 1U1RA 1AZSB 1NJIT 2QFJA 5FLXY 2BJEA 3DXBA 4FYXB 4M63A 1R8PA 2ZOFA 4OYZA 1GT8A 3KJVB 1RA6A 1H2TZ 2OPSA 3HJVA 4KGKA 1IKWB 1RBOB 1T0TV 2KVQE 1G2EA 2MEWA 1EJ7L 4C8YA 2H5EA 1EKRA 5ETOA 2FVRA 1RXOB 3NGKA 2AP6A 4MH8A 3ENVA 3NG8A 3W65A 1ZA1B 1S72S 2FC9A 3GILA 1EP4B 2RF2B 2UVWA 4QOTA 3HJFA 4C8KA 4ZA1A 2PA3A 2VC1A 2ZUGA 5DGAA 1VC5A 1NAQA 1SL0A 1G7CB 3MR7A 4ZP8A 3WC0A 3AODA 1TV6A 5I42A 4GVBA 1N33J 3QLHB 1X4CA 3D5MA 4Y2AA 2JFKA 1C1BA 2FY1A 2IJNA 3LH2S 3P8BB 2CVEA 2DNGA 4BBYA 1H72C 4NLSA 3TX8A 1WTFA 1VK8A 3MPVA 4CO5A 3BPDA 1X4FA 2RMLA 1S1WA 4U7UK 5J1PA 1FEHA 1QSSA 2FUG9 2VJVA 3M2UB 2HNDA 2E1PA 1ITPA 1PC5A 1S1UB 1IWGA 1UTAA 1X5PA 2L9DA 1RWMB 3Q2TC 3H98A 1KQGB 3G87A 2JEGA 3R9LA 3MAAB 2UXCF 1XNQJ 1VQKS 2IC3A 3P4UB 1Q82T 4HVZA 4R0EA 1HL6A 2ALZA 4RJVA 2R2RA 3T9NA 3W66A 2C2ZB 1IBMJ 4QQBA 4CO2A 1L3KA 1WC6A 3TAPA 3L7OA 1U8WA 3UCZP 2V2QA 3LA0A 3VR1A 2QX0A 1KHWA 2OPSB 4OHXA 1HMVA 2BW2A 4IOBA 5KG3A 4LF4J 3CJ3A 1RHMB 1PGZA 1VQNS 4LF7F 1RJJA 1Q8LA 1UCNA 3G86A 3M6XA 4F7VA 4IYQA 1L3TA 2FLNA 2DRAA 4HDHA 2G1HA 3VVTA 5C2CA 2NUUG 1Q0NA 3M2RB 3Q8UA 5H9FJ 3HHKA 4NOHA 2YWHA 3H90A 1WSRA 2ZBIA 2A18A 2HVHA 2DB1A 4CLUA 4WFZA 5DETA 3R6LB 3DLEA 2XMMA 4U9RA 5I42B 4ZPTR 4WP9A 4GVBB 3DLGA 1IQZA 3OXGA 3EMTA 4DR4F 2IHR1 1X60A 3T1YF 1C1BB 2ZH2A 5IWAJ 4YR0A 3LO3A 1R8HA 4DX6A 4OZ0A 1R89A 1B70B 1F0XA 3KOAA 4IH5A 4NLRA 2F65A 3ILLA 3W5XA 4ZVPB 1TUVA 5LMUJ 3PV8A 2YPYA 2HVIA 5LOQA 4D3GA 1PYSB 1S1WB 2BXJA 1JLQA 4A46A 2QMUB 4MK8A 5KFKA 2HNDB 5JXSA 3KUHA 1LFPA 1YVFA 1I5OB 4NZ0A 1AROP 2FGCA 3ILIA 1LWCB 2M8DB 1VMBA 1T9VA 3QGIA 2G13A 2Z2MA 4H4MA 3NMAA 4TLRA 4P72A 1VIXA 1ZAWA 3OTEA 1N34J 1PG5B 2L9NA 1F5BA 4OZ3A 3OJSA 4DBQA 4Z2XA 2NQPA 5HK4A 4M94A 5LSLA 1AUSL 1HNWJ 3H2LA 3M9OB 5G4DA 4USIA 4L3KA 2NXNA 4B9TA 3BR9A 2OPQA 2G4BA 4KH0B 1KR4A 2BANA 2OPRB 3TANA 4NI2B 3M32A 3PX4A 1PBUA 3PJWA 4GKJF 3PVXA 2FJXA 2VZ9A 2VC0A 4Q2LA 2AJ0A 1KTQA 3WX8A 4DV4F 2XYPB 5EWGA 2DR6A 4LREA 3A3PB 3HFVA 5D8HB 4IKAA 5HROA 3EVMA 2FHJA 3DLEB 4LVNP 2ZZTA 2QLJB 2QZ8A 5B7WA 2HHHJ 3DLGB 3G2XA 2LU1A 3D4JA 4O3PA 3GB0A 2ZH6A 1DHMA 4GRSA 4KPYA 3FEYB 2JVRA 3VGVA 1F1BB 2HQGA 1XR7A 1KC8T 4JI7J 3UCGA 4KSEB 2ZJQQ 4J9UE 3D68A 1QAIA 5HP1A 2W4DA 3UCUP 3WZ0A 4ZMMA 4H4KC 5KFQA 2Y0SD 4BHQA 4PUOB 2A2DA 4KGMA 3KLHB 1BQXA 1M5KC 1JLQB 2EKYA 4UOCA 5LMNJ 2J6UA 1UAWA 3KG1A 2HHWA 5DJBA 2G2YA 1JLAA 5G0RB 2H48B 1R43A 4PXDA 3C66A 3PW5A 2XMVA 4H4MB 3P49B 2XS7A 3FCWA 2NR0A 3UR3C 2CPHA 4QR2A 3RAMA 5L1KA 3PZPA 4A8SA 4B3TF 4K2XA 1JQGA 3BGRA 2HWHA 3OUYB 1VQYA 4CCHA 2XMJA 3C16B 5T14A 2ZKTA 4KO0A 2AJQA 1CJTB 4ECXA 3H5XA 2FDNA 3LANA 2YKNB 1R0AB 1T3OA 3W8GA 4RU2A 4C0OC 1VYAA 2AYBA 1XBWA 2CG8A 1TUGB 2OPQB 3V6KA 3IBCB 2JWNA 4YN3B 2Y9HA 3M30A 3M32B 4RNNA 5FIIA 2WSEC 2PEBA 2FB0A 4AL5A 3EGNA 4X4UA 5KFIA 4USTA 3HO1A 2R8HA 3AA9A 1SQFA 5SUHA 3FFIA 3F0NA 1BMQB 3VQSA 1NXIA 1S0VA 3CGIA 5E5NA 1DBDA 4O4RA 1U1PA 5HROB 5KFYA 1J5EJ 2J8AA 4BDPA 2AW0A 5JMNA 1Q4RA 1U48A 2YWWA 4NPOA 2IFXA 4CLSA 2DJWA 3RBXA 4ELVA 4WWSA 1KLMA 4XAKA 1K1QA 4JBCA 1LWFA 1RWPB 2BV3A 3FCHA 3UNYA 2KG1A 3IBFB 3BF4A 5HP1B 2FJVA 1YJNS 1U45A 2XZDB 4KGZB 4QPTA 1FRMA 4YMEA 9RUBA 1N0VC 4DSKA 1NK7A 4WXOA 5A8RA 3IR7B 3ILJA 1TELA 2YY3A 3KHLA 1JLAB 2LXIA 2BA9A 2JC1A 1S7HA 1G6BA 4ZP9A 3POTA 3JSBA 2BE7D 3PYFA 2MQQA 3NRBA 2QSWA 3C3LA 1ICEB 4E2FB 2EFOA 3D2WA 3BEGB 2QRRA 3MI7X 1KP6A 2J9EA 1QY7A 4EBCA 3BGRB 4HL9A 3W60A 2FYXA 3RB0A 4K4ZA 4C8NA 3UR0A 2VV5A 1VQSA 3JAMY 2YH0A 4KO0B 1X9SA 2UUAJ 3TYTA 4JV5F 2ZZMA 5I3QA 2QN6B 1PC4A 3ZFVA 1HWJA 1ZM3A 3G6XA 3H8YA 3F41A 2MKHA 4EU0A 5KFVA 1VC0A 5A8KA 5E3PA 4A8MP 1MWZA 2RKIA 1YI2S 4UW2A 2YNIB 3ZZYA 2YXLA 3FFIB 2D3UA 4C3LA 1EETB 4ZP6A 1RAIB 4M8LA 2CJAA 1AFIA 1HQEB 4DR4J 3T1YJ 1Q86T 1WUUA 3UE2A 2GCFA 4I4BA 2XYGB 3DU5A 1FD2A 1X5OA 3D3CJ 2IBKA 1KLMB 1S1XA 1VQ4S 1LWFB 1TZ0A 2D7SA 5EWEA 5LM7E 3CCTA 1NEEA 4OJ1A 2EFPA 2GVZA 4ENOA 2BE2A 4Q43A 2ZC3A 3FZBA 3G9CA 4M5LA 3KK1A 3PXGa 2VICA 1AUDA 4KR0B 5E33A 4ZPBA 2XB2D 1VISA 4A8KA 5A8RB 4USWA 2ASJA 2AIRB 1FKAF 2WONA 1H74A 2GC8A 1SUQA 3T6JA 2AKWB 3VGSA 4OLOA 2L41A 1EQ0A 4OYAA 3UDEA 3LP0B 3MCNA 3VTIA 2V2ZA 2MLZA 3QT7A 4DL5A 2YNFA 4F4YA 2W2NP 5F8IA 1CC7A 1FVSA 3A13A 2EW9A 4HH0A 2C42A 5CZXA 1TQLA 3FRZA 3MPUB 2OPPA 4Y65A 5DZ7A 5EDWA 4LFBF 1U2RA 2KT2A 3QMQA 3CCQS 4KE5A 4W4MA 1Q16B 1M1GA 4YB1P 1BLUA 1SIZA 4J9MA 4IR1A 1IXKA 3ZTPA 3CEDA 1D09B 5HI7A 1JLEA 1Z2ZA 3IWNC 3MM5B 3KJQB 2ASDA 2X1BA 3CJ2A 5A8KB 4DV4J 4DPYA 4F02A 5ETTA 4TU9A 2RKIB 1T94A 4JYAF 2LXUA 5HSPA 3PYGA 4HDGA 4KHRA 1X4AA 2VFSA 3DM2A 1E6YA 1FESA 2MDAA 1YJTA 4Y2MA 2FJWA 3MMBB 4LF9F 3NCPA 2ERRA 4K4YA 4PYAA 3L7PA 4B3OA 4LFAF 3W63A 1KNZA 1FRLA 2J7UA 4RNMA 5LJ5Y 3DLKA 9ATCB 1D0EA 4DR5J 2KYZA 3IBWA 1N5SA 4OYOA 2KHCA 3CDWA 1Y11A 2GVZB 4A8XA 2BE2B 2CXEA 3KK1B 4U8YA 1DURA 5E3CA 3ISND 1QAYA 1LV5A 5B0BA 1HBOA 2FJBB 2C28A 3RAQA 3DKDA 2FZGB 1W7WA 2G0CA 4QPXA 2WONB 1L3VA 2L08A 2D41A 1FD8A 4NXNJ 1YBAA 4DV0F 1B0TA 3GIJA 3VAHA 3NAHA 4K0KJ 2BJ7A 2D9OA 2JFDA 2ZH8A 1WKKA 4WZQA 1JMTA 1NUEA 4P2XA 4YR3A 4G1PA 5MAOA 2YNFB 5F8HA 1NJZA 2C3OA 2HFSA 4JB8B 4RO0A 2QT7A 1Z4UA 2C3YA 1WWHA 5ETVA 5H9FK 3ETMA 2OPPB 4LF6J 2MLYA 1UEKA 2NSBA 3D66A 3K8WA 4P7TA 4KBIA 2FGOA 1QD1A 3CCSS 2P6SA 1YQHA 2LQ9A 1IQTA 3FSIA 1M5PC 3NCRA 4B08A 4EFAC 1YZ7A 4AUKA 2HRUA 3DLJA 3RTVA 1R0CB 4UZBA 1PKUA 2A3JA 3V6DA 3V6JA 2KI2A 3LGHA 3K58A 1LWXA 2ACMA 2EK1A 2RE1A 3AOBA 3HHLD 2DNYA 5HMZA 4DQIA 1E6YB 4KY3A 4EMDA 1U7LA 2K1RA 1NRKA 1N6QA 3CJSA 1YJRA 4CH0S 4WU3A 3QGPA 4B3OB 5B0DA 3RAXA 1YLXA 1JLBA 3KJFB 3TA1A 4JI4J 1JJHA 1UZDA 2LKZA 2MYFA 1MROA 3DLKB 2DNMA 1Q78A 5A0YA 3QSYB 4DI6A 3PIPQ 3EXCX 2G2ZA 4NLDA 2DGXA 2H5JB 1FXDA 3I0SA 2VPYB 4WXWA 1XNRJ 1WG4A 3J81U 3LTOA 4QR1A 3GFHA 3H59A 4X64F 4PG4A 1JKHA 2VODA 4DFMA 1JLFB 3BSNA 4ED1A 3IAM9 2UUBF 2K7JA 4NCGA 1TL1B 1OSDA 3HM9A 2GHVC 1LFWA 2WTFA 1XR6A 5LSOA 2F4VF 2UXDF 1N5YB 3BM7A 3EPGA 2W24A 2GJFA 2OD6A 4PRFA 1O8BA 2CJYB 5A8WB 4ECTA 3P96A 3X1LB 2SXLA 3UD5A 4CLYA 5ETQA 3W5YA 2HKEA 4YB7A 3TUJC 1U1OA 2AD9A 4LQ3A 2BEFA 5ETKA 3AD9C 1YRTA 4V19J 4OYWA 5KG1A 4RBUA 1T9WA 3QJLA 3NMRA 2FC8A 5IT0A 5KFCA 2PE8A 4IDKA 4PWWA 3OPKA 1WJ9A 3GV5B 3V6DB 1MW7A 4RKUC 2H51B 2CJBA 1S5ZA 5J2PA 2NXJA 1VIOA 5GMEA 2CPIA 1P9YA 4ANCA 3HX9A 2XLJA 2FTRA 3UDCA 3C6UA 2K1RB 3L09A 1VJQA 2MY8A 4QJVA 1N6QB 1C1CA 3BDEA 4X4QA 2DGWA 5U47A 2XMAA 2K06A 1JLBB 3UDVA 1UVKA 4WP8A 4N41A 5T7LA 3R2CJ 1UVNA 5C2GA 3DOMA 1MROB 2GZOA 1IBKF 3TVYA 3VVUA 4KGXB 4RUHA 1YZ6A 1M0SA 3K5NA 3GCWP 1UPPA 2RQMA 3VGTA 3CDUA 3W64A 1RWKB 3LALA 1NSPA 5J1EA 1Z2LA 2DBBA 4DUZJ 3NAIA 2OEKA 2XLKA 2XHWA 2IMWP 1WI6A 1Z1ZA 4I0WA 2LU2A 1XERA 5T41A 2BVZA 4D3HA 2HW3A 3KUGA 2RUGA 4ZVRB 1CC8A 1YJ7A 1T9YA 3BQ1A 2BACA 2Y8YA 4B02A 2ZNZA 4DCPB 1HWIA 3IGVA 1UP1A 2O3DA 4FYVB 4LFBJ 2PIIA 4KIAA 2HFUA 1B0PA 1N4LA 1KOHA 2APOA 3AHPA 4R25A 1CS4A 2OFHX 2HBQB 3AD7C 2HIYA 3CDEA 3PX0A 4F04B 4OI6A 3Q83A 4CLKA 5DS7A 4DXLA 2DGVA 3R1HA 2XZWA 5HN0A 5F3ZA 1NNDA 1SIWB 3VV2B 1DRZA 3MUVP 1CLFA 4JYAJ 4X4NA 1R6VA 2DCUB 3T41A 1RAEB 1GXUA 5CQGA 2B4UA 2AX0A 4IDKB 3PW7A 1KKHA 3T1HJ 3W1YC 2J6TA 4PABA 1A6LA 2VPXB 4LFAJ 2H9ZA 3G8QA 3K5MA 1G1XA 2MQOA 1NKCA 4IFVB 5JVGQ 3C6UB 3FSYA 4CDIA 3UD4P 1R6YA 3AXMA 3TUPA 1BHNA 2CQ1A 5T7LB 4FXVA 3MFHA 2W9CB 1LK5A 3IR6B 1TMMA 3DOMB 5B0CA 1DQ8A 4OHVA 1KTVA 1GEHA 1P27B 5ITHA 2CJQA 1SC3B 1D9DA 1F5AA 2WB4A 1YDLA 2OH2A 2BJ3A 3QBCA 4AE5A 5J1EB 1NJYA 3TAMA 4DR1F 1ZM2A 1Q7LB 5HMXA 3OBIA 4ZJOA 4FP9A 1GMWD 2KM8B 3I5CA 2VH7A 5GAEU 4QWBA 2JL9A 4OIXA 2CWXA 2BR0A 1F5CA 4S0MA 5CYMA 4C7QA 1YRUA 4ZLPA 2XNQA 3H20A 5FJ4A 2W2QP 2AGPA 4K5SA 2XMWA 4CYUA 5KG6A 2DNOA 4C6AA 1X5SA 4Y6IA 3K0JA 5KOWA 1CS4B 3QFWA 3M2VA 3AQPA 2B5JA 4ZPCA 5IT9U 2E1CA 2KZMA 2H4WB 3IR5B 5L1IA 2F1FA 3TZZA 3J7A1 3CXCR 5GMDA 1MU2B 2QA4G 1QJHA 3OW2R 5CCLA 1WOSA 2E5HA 4DQQA 4I56A 2KG0A 4I64A 2VFUA 4RU9A 1CULA 3GONA 2VOPA 2DHSA 2MZRA 4NLXA 2ACYA 3I87A 2Q79A 4DWIA 1H7WA 3C6TA 2DR7A 1VQPS 3ZTRA 2CPFA 1BQNB 2ZUAA 4NLPA 4J90A 2ZH5A 2PA8D 3R5AA 3A1YG 3K89A 3M6WA 2EG1A 4EBDA 2ASYA 1OS5A 3HDSA 4OLPA 1B4SA 1RT4B 1U24A 4RWXA 5JVHQ 3FBBA 1WACA 2W9BB 3BR8A 4QYRA 4KB7A 3TO8A 4RBVA 3NWRA 2G9OA 1U0HA 2CQ4A 2E5IA 2IMOA 4ZIVA 4MKYA 2V8DA 4ZN1A 2NXCA 3DRYA 2MMYA 3A4TA 1LW0A 3TAMB 3HLUA 1UA1A 1YJWS 5AJ3J 1ZPWX 3WBZA 2E44A 2W2MP 2WOMB 1C4CA 2F4VJ 1W26A 3IS9A 3S1TA 1TU0B 2L48A 2RU9A 1TL3A 3N6NA 4ED6A 2C3UA 2MHEA 3DNCA 3TZWA 2XSJA 3FQLA 2BYCA 2VBYA 3ZZ0A 2P9CA 3SI8A 4FPRA 1HD0A 3PHEA 4CYUB 1U1MA 4OX7A 3CCMS 1ZAXA 2E7VA 1WKLA 4KRWA 3D0IE 4J9NA 3GTYX 4DUYF 4F4AA 2R7VA 4X62J 3PO4A 4G65A 1WNEA 1LEOA 4FXWA 4JI6F 1FRIA 3GIIA 4L76A 1VHIA 4OZLA 2DYAA 2V34A 4DG1A 2U1AA 2QGFB 3PFOA 5KT7A 3THPA 2K7KA 3QNWB 4K8RA 4ES2A 3HHDA 2ZE2B 3NY0A 1CULB 1NU4A 3DRPA 4DQSA 2HQFA 2KTQA 2NCKL 4CNZA 4ZPWR 3ZZTA 1VFJA 1TKTA 4F0HA 4RBTA 4L6V3 3C6TB 1FE4A 5KT5A 4ED2A 3PACA 4DL0C 1KQSR 2ZD1A 3MM6B 6FDRA 3TR5A 3MHYA 2OSRA 4PWDA 3GJQB 3FKBA 4OI1A 4F4KA 2KM8C 2IJFA 4NYZA 3FEZA 1NKBA 1QM9A 3PKMA 1RTJA 4CLTA 1SCJB 2KRRA 1SBRA 3DMJA 4X65F 3W62A 3R7NB 3TX0A 2XULA 2WZ1A 2UUCF 5DDRC 3M8YA 4LFCF 4E98A 2CQCA 5AXLA 1CSJA 4LR7A 3HI9A 2WK4A 1LW0B 5F0UA 3ISZA 5BR8F 3CDAA 2IRXA 2HHVA 1V3ZA 4QIFA 2DNRA 3TOQA 1FDDA 4NEYA 1K0VA 4MYUA 1TL3B 3PTWA 1FXLA 3TVKA 3F44A 1Q1KA 1P1TA 2BW7A 2LVWA 3ZTQA 3SEOA 2IM0A 2V94A 4R5PA 1MG7A 1UETA 3ISNC 1SH2A 2CZ9A 4IQXA 1BC6A 1J27A 4WPAA 4ZITA 1R3NA 3IWXA 4J5OA 1BQMB 4Q0BA 4ZHRB 4NWBA 3CULA 3G4SS 1PYTA 1N32J 2CQBA 1VQMS 3PW0A 3JQMA 4QYZJ 3TZXA 2R7TA 5FDLA 1WELA 3DOLB 2ZDOA 2P8IA 1B99A 2ABYA 3BQ0A 1FEEA 2HWIA 2IBOA 3T1AA 3ENWA 3IO1A 2NS1B 3I9ZA 2GQ2A 1CJVA 3BN7A 5KAKA 1UZHA 3V81B 2O67A 1TKTB 1GMWA 4OYPA 3MM9A 4U96A 3ENQA 1UPMB 5KFXA 1RISA 5GADU 4CRJA 1YBUA 3B54A 4ZP7A 2ZD1B 1HNZJ 4PWDB 4PG6A 4DSEA 4P52A 2Y1RI 1I6JA 2PC6A 2YQ0A 3W61A 3DDNA 2XY5A 3ZZOA 1JIHA 3IRXA 1HBMA 2E1RA 1RTJB 2V2VA 2G0JA 3D6HB 2RQCA 3K5LA 1PIEA 5D4LA 4DR1J 1MN7A 4C2MA 3GCXP 1ZTTA 2HZAA 2Y3YA 2H5IB 1IBCB 3BDPA 2XGPA 4KHPF 2ZJPQ 1ZZFA 1XQIA 1UEVA 1FJGJ 2JLEA 5B08A 3CJKB 4F67A 3CC2S 1TL7A 4DV7J 1PAUB 4C8OA 4CTAA 4YQWA 3NNHA 3LP2A 2KJWA 4RLEA 2O66A 2O1PA 1H98A 4R5PB 2M7SA 3HXMA 3NS5A 4JUZA 3H5YA 2B4OA 5K8PA 1I1GA 3N0VA 3D1QA 2RAQA 5AE1A 3B6BA 4WJBA 5DG8A 1Y5LB 4UOHA 3KLIA 4CO4A 1K8AT 1N5QA 1Q5YA 5LXYA 5GAHU 4C3KA 1JXLA 3UVJA 3BGUA 1RU2A 3FCVA 2R42A 4XPEA 1WSVA 2K3KA 2HS0A 3CE8A 3RRGA 1WHYA 3PYEA 1RI7A 4I2PA 5D6GA 1ZPVA 3UNGC 3GU0A 3TA2A 1SL2A 1X9WA 1KVKA 3B8HA 2PO4A 3QT8A 1GTEA 2DH7A 2VOOA 3K59A 3J80U 3UI3A 2HVZA 4WF9Q 2DRBA 4QW9A 1PBAA 2XTJP 4U7CA 3U1LA 4PPZA 5GADI 4WFXA 3G82A 3MPWA 4RW4B 2HHQA 3QJPA 3IRXB 1HBMB 1ACMB 4LF2A 1L5UA 2R7UA 2FZCB 1HWKA 2FD2A 2CWKA 1VLYA 1SKRA 3AD8C 1O5JA 1T9TA 1N33F 4X4SA 1IM4A 1EZZB 3RZAA 3BGLA 1K0TA 3EYZA 4PXCA 4WFNQ 1RYSA 2CYYA 4KC5A 3JSRA 2QTWA 4DUTA 2FVSA 3LAKA 3CD5A 3LWLA 1M5OC 4WTYA 2VA3A 2MGZA 1X4BA 2OFGX 5J2MB 2G0IA 2F3JA 2J76E 2IA0A 1C2PA 4CTAB 4LRBA 2FPHX 3LP2B 3QATA 2HNZA 3M4XA 4K5RA 3KLVA 3GV7B 2CFXA 1IKXA 4NASA 2AMCB 3BV8A 3DDIA 4DDFA 1VBKA 4P74A 4UTGA 2DISA 4URSA 3KLIB 5IC6B 2DNHA 1WEYA 2AEJA 4KGVB 1RWVB 1IBMF 3N5BA 2ZWPA 4AXJA 4JI8J 3UVJB 1YTYA 3I82A 2CQGA 1ZM9A 2GHWA 5AXMA 2B9YA 3MECB 3VHQA 2H3EB 3R1LA 1FERA 1HNXJ 4LF4F 3QGGA 2HFNA 1AA1B 2JH3A 4OMFG 2BBEA 1WI8A 1PJ7A 1A7GE 1RT2B 4YB5A 4DQRA 5KFWA 5D3GA 3AAWB 3VAIA 4O4GB 2E29A 4ZPDA 2V8VA 3FDSA 3CB4A 4C0HA 2B9EA 2HURA 4X4VA 3JAMU 4ANDA 3MMJA 4M5IA 3PDNA 3Q8YA 3FVYA 4DS4A 4JI3J 4I6WA 2WVCA 1AB8A 2PMZD 1NK6A 2WBMA 4KYZA 4RX6A 4K4VA 3OFEA 1MMNA 3RB3A 1CJKA 4DV5J 3KNGA 2QA4S 1B3TA 2W8LA 4CH1A 2N7CA 2CQ2A 3N79A 1YX2A 5IWAF 3VWSA 2AJ2A 1XEZA 3HMJG 1RTDA 1WOPA 4KPCA 4NA1A 4CP5A 1DFDA 3V4IA 2QA2A 4OZ2A 4NX9A 5KT3A 1IBLJ 5H1SV 4RNHA 4YEAA 2YNHA 3CSKA 5LMUF 2MGZB 4U8VA 4A47A 3EGWB 1UMJA 1OY6A 1ELOA 5I3UA 2J8SA 3W9JA 3N4WA 5KG5A 3OR1B 1PJ5A 2YKMA 4QBUA 1D8ZA 5M2PA 1NO8A 2HQCA 3BO4A 2JOQA 2IAJB 1IKXB 3PNIA 2V50A 2OTLS 5K9FA 5C5JA 3J7YI 5HVFA 2XLIA 1TK8A 4HTJA 2ATCB 1CPZA 3QRRA 2MZJA 3W9IA 4M5HA 4B9UA 2RHQB 3SQGB 2VONA 4LT6A 4DHVA 2XMTA 2QLWA 3FMBA 2DR5A 1N34F 4ATNA 5J2QB 1YK9A 3EE3A 4F3QA 3H4DA 2R7QA 1JNZB 3G6YA 1GAOA 3DRRA 3OL6A 3I6PA 4RW8B 4I69A 4EYIB 4Z7CA 4X2BA 1TKZA 4M5JA 2DGQA 2ZH7A 3BPSP 4QW8A 1DQ9A 3Q24A 4EZ6A 3HVAA 2F40A 3MEKA 3BYPA 1GNKA 1N8RT 2XO6A 4O23A 2ZHOA 2DGUA 2AYGA 2JJ4D 2PT0A 2RD5C 3IXQA 3OJUA 3UD3P 4FF3A 2DHGA 4ED7A 2KDOA 2B0GA 1LKZA 2AT1B 3NOCA 4HLBA 2E1AA 3IMQJ 1ZA2B 4ZN3A 4IQMA 4AL7A 1KEKA 4CNYA 1MMDA 3W2WA 2ZWOA 4G3IA 2D3ZA 1RSCA 2JSXA 3D0HE 3E2EA 1SKUB 7AT1B 4HYKA 3HFZB 2HHHF 3R5JB 2DNZA 1GMVA 4KHPJ 3EVWA 2PGCA 2VASA 1EIYB 3UO0A 4DCJB 1UW9A 2RDDA 3CUNA 3NXZA 3PEHA 1S76D 2MTLA 4JI7F 3SCJE 3RBEA 3NEKA 1FXRA 4LIRA 3A8EA 2YNHB 4K7QA 1XJWB 2VDIA 2GS8A 1ZAVA 5GVQA 2FHJD 4RNOA 1WDTA 2J7WA 1PYOB 2YBVA 4EK2A 1RAHB 2YKMB 2M5YA 2PI4A 3RR7A 3RU0A 5DG7A 2VA2A 1TAQA 1X8DA 4OX6A 1S9EB 1D9FA 3PEJA 1RAOA 3TEHB 1S0OA 2RHSB 2XG8A 5KG0A 3I56S 1L3SA 5DDOC 1QUVA 5LL6d 4WE1A 4FN5A 1K44A 4TNOA 5CCMA 4DN0A 1OWXA 4FYDA 4HI2A 4DR2J 4AQYJ 1XTZA 2OAUA 4XIUA 2M2BA 3THVA 4I6AA 3K5OA 3DRRB 5F0WA 3H5SA 4P6QA 4EO8A 2NZ4A 4P9SA 1JLGA 1TKZB 5GAGI 2X3DA 3PO5A 1HI0P 1RT1B 3MCOA 5CXTA 4KT0C 3M2RA 2W2PP 2LDYA 1S9GA 2XI3A 2Y1JA 1M1KT 1OPIA 2B4VA 5HATA 2QEXS 4DFJA 4DEZA 3KG0A 2G2OA 5IM0B 1HHTP 3DHWC 5H9EJ 2Q66A 4DF8A 1Y4ZB 3C14A 1QVGR 3TJ8A 4FVCA 2XY7A 5F8JA 4F25A 2VQEJ 1KONA 4LSNB 1V6HA 3W2WB 4ILMA 1QAJA 2A2CA 4FKYA 1J5EF 2CQDA 3P3DA 2JHEA 2HHXA 2HQ3A 4TQSA 2I6WA 2OMOA 2VG5A 4HI1A 4YOEA 2R7XA 3RYLA 4NMLA 1NDLA 4QWEA 1NSKL 2C2EA 2DHHA 1T8EA 3T5KA 3GQCA 2E7WA 1SVDA 2Z0GA 2RJZA 1SC1B 3WDOA 4U67Q 5DQIA 1QVFR 4V1Ak 4X84A 5CZVA 2M88A 1P8GA 3MEEA 1H6KX 1LWCA 1HYSA 5B0FA 3DDKA 3V2UC 3GR0A 1NB7A 3QPIA 1D9AA 5HMYA 1NKEA 3BS9A 4Y28C 5A2QU 3D6TB 4EGLA 4DL4A 4IG0A 4F36A 3KJNB 1PILA 4CH7A 2UU9F 4WE1B 2V4QA 4DV2F 3AH6A 4TYBA 5KFHA 4RL1A 2CKWA 4I2QB 1OYDA 3CMES 2ZNYA 4F0KA 3GG1A 4DFKA 5DGBA 2OPRA 3PW4A 3OLBA 4YDXA 3I4PA 2Y1IA 4NI2A 2UUAF 3HHNB 1JLGB 2FHKA 2QFIA 3OQ2A 3GIKA 2VUGA 2X1GA 4XO0A 3TUZC 1DARA 3TA0A 4ED3A 3JYTB 2K3IA 3WHIA 2KXFA 5F8LA 2WCXA 1FI4A 1NJXA 1VCTA 4HHHA 2WVEA 2F9JA 2JX2A 1S9GB 4KHMA 5I3PA 4DN9A 1YIJS 2CRLA 3VAGA 1JB0C 2HGMA 3RRKA 3OTCA 1QDUB 1WC1A 3WC2A 4J9RA 4ID5B 1TTHB 4JI5J 3HSZA 3C14B 3LP1A 1LW2B 4RUAA 2M70A 2CPXA 2R4FA 5DLGA 3CCRS 2IVMA 1UJ5A 4CM2A 3CVKA 2PMWA 2HNYA 1NDCA 3IAS9 5D4OA 2CA9A 1S77D 3M8SA 4RPFA 2YQ3A 2BZ2A 1PCAA 3BBBA 2WSCC 2VG5B 3NGTA 3RW6A 3EDRB 2JVOA 1U8SA 3OXLA 2XC9A 5IS2A 1TMJA 4NLVA 1GQEA 2VIHA 5I4MA 3SYZA 3MTJA 1UFKA 4PUOA 3KLHA 1HD1A 3NL0A 2UXBJ 1DTQB 3Q8QB 2W1BA 2BKNA 1K73T 2DK2A 5G0RA 2AYMA 3MEEB 3TWZA 3MM7A 4NRTA 2LQ8A 3U27A 3U1MA 2H65B 4WFBQ 2HBZB 1HYSB 4Z37A 3FQKA 1CJUB 1REVB 3H25A 3GFZA 2L9WA 4DJBA 1U26A 3TJ9A 4USKA 2B56A 2XHCA 2NLWA 4IG0B 2DXDA 3OUYA 3C16A 3QGHA 3BGOP 3H4BA 8RUCA 5JUMA 2ZOMA 3DXSX 1CJTA 1FNOA 1U2CA 3OVAA 2YKNA 1R0AA 3ONQA 4UOFA 1DAXA 4PQUA 1SB6A 4IOAQ 1KFDA 3G6VA 5AT1B 2D74B 3M8WA 1N48A 2CQIA 1U6BA 5HQ8A 2Z4PA 2PDAA 3B4MA 1RADB 2GW8A 1FJCA 2W9AA 4K2JA 2QJ3A 3CJ0A 1WC3A 2EC2A 3LGNA 6AT1B 3HCXA 4J9QA 3FUYA 1B0VA 5D4PA 4ZLNA 1EHWA 2XYHB 4P10A 1U49A 4DR7J 1FX4A 3MEGB 1U4BA 2KZZA 3DYAA 2Z57B 1JJ4A 1S6UA 2F8HA 2D1CA 5KFOA 1F3VA 2V68A 1RWNB 3LP1B 5D78A 4UT4A 1SPBP 3T3FA 4DFPA 2F9DA 2W01A 3QO9B 2EFNA 2ZBQA 1RAGB 4FDFA 1XWLA 2HNYB 1RKJA 2JEIA 4DL2A 2FVCA 3SSQA 3M8QA 4WIIA 3C15A 4URQU 1VC6A 4CLZA 3V4MA 2D3O1 2R8IA 2CQHA 1S0MA 3PR4A 1TVRB 4DR5F 2HHTA 3F73A 3HF5A 2WB1D 1WG5A 1FRXA 1RTIB 2GO9A 3DC2A 3KLGB 4KTQA 5DM6Q 4LJMA 4NLTA 2MQPA 4ZVGA 3MM7B 2JLGA 3M05A 5K8MA 1NSAA 3J81j 4USVA 2VL1A 1J2VA 3RUBL 7FD1A 5IQ6A 4PXBA 2XCPA 3CF5Q 2RILA 1RYRA 1JK9B 1Y3JA 4NXNF 2UVUA 2XZTB 5C42A 3MXHP 2VDHA 1EKSA 2NZCA 4K0KF 3HD2A 4MFBA 1OY9A 2KU7A 3ZNUA 5EGYA 1KWMA 1VRUB 1X4EA 1A9NB 1RBLA 3ZZPA 2CNKB 2UUTA 2B43A 2CUYA 3HVTA 4PQUB 3J81Y 3C19A 3KKFA 4X66J 1EAYC 3SMZA 1SJFA 2A6OA 3Q8VA 4LF6F 5M2UA 3ZO7A 1R27B 2ZDPA 4B9NA 3NOGA 3NNAA 3CW2C 2H1YA 5ETRA 2YNIA 3CD0A 3CCUS 1V3SA 4HTIA 2PSZA 1LXNA 2V5HG 4MKVA 1EETA 3MR5A 1HQEA 2IA6A 3DYAB 3SCKE 4L75A 3BZQA 5KFUA 5KFZA 4ETZA 3MEDA 3CJ5A 3OLAA 2Z2YB 2HMIA 2VFVA 3NCQA 5D0EA 5HBMA 2OGUA 1BE4A 3AJDA 4O3QA 3BSAA 1OO0B 1OYEA 3HSGA 2MSTA 2W8KA 1FKOA 2DGOA 3NGRA 5CH7B 3M8QB 5CD4A 3C15B 1OQ6A 4J91A 3FGVA 3N5FA 4JI4F 3LQVA 4MIWA 3L3CA 3R3TA 3QYYA 5ADZA 2KFNA 5RUBA 1S79A 3QAEA 3O3LA 2XI2A 3BO2A 2BM0A 3O1LA 1Q79A 4ELUA 1F2HA 4B3MF 1VQLS 3S8SA 1XNRF 3UPFA 3FEXB 2DH8A 2FLOA 2F63A 1SXLA 4LVOP 3KG4A 4A8YA 2C2MB 1T03B 3LP0A 1TL4A 2CJ9A 3CTRA 4CLFA 2UU9J 1WEZA 4DV2J 2ROPA 1YWXA 2MZTA 2X1AA 3KDOA 3O5TB 2LYVA 4LRCA 4O44B 2DXEA 5C42B 4ZJQA 2HWTA 1U1QA 5EWFA 1EARA 2X1FA 4DR6F 4MFBB 2JC0A 4C97A 3RB4A 1VQ7S 2V8GA 4YFUA 3CNQP 1JLCB 2J0QD 1FK9B 4Y2KA 1Y3KA 4F3MA 4FS2A 2BQRA 2KJVA 1RCOB 3EUNA 3HD1A 3HZEA 3JS9A 3PCOB 4HACB 3HVTB 2W25A 2DPIA 1E6VA 3FBFA 2XS5A 3CIMA 2YKQA 2QLXA 4NA3A 3MM5A 2Z30B 8ATCB 3KWMA 5K14B 3Q8PB 4M1KA 2HSEB 4DPWA 1WEXA 3VGUA 5CD4H 1HQ2A 2LA6A 1ZH5A 2KT5A 2LXFA 2M4MA 3M6VA 4WU2A 2IVFB 2Y8WA 2EBGA 2KB2A 2DNQA 2DXFA 1NHKL 3Q89A 3MPDA 5KT4A 2WW4A 1N36J 4NLGA 1YJUA 2WHOA 4W98A 1HWUA 3TJAA 4DSLA 1QLNA 3D7SB 5HMWA 4CQ1A 1TKDA 3OSNA 4OYXA 3MMBA 1KHVA 1RT5A 2CQPA 1KOOA 2XM3A 4LF5J 2V2KA 3MEDB 5J1NA 4TU8A 3PJXA 1QUPA 4Q8FA 4OX8A 2HMIB 5HBMB 2LLZA 1MNEA 1T05B 2XEXA 2AJ4A 4B9VA 1FKOB 4Y34A 4EEYA 4FPIA 4NLOA 3JTPA 3H2VE 3KDNA 4FKXA 4ZIWA 3CCLS 1NSQA 3ITHA 3ZXWA 2MZSA 4DR3J 1NBEB 1V5VA 5CYQB 2OTJS 1RT3B 5KFLA 1B64A 1VQ8S 2V9KA 4B9LA 2QIFA 4OV6A 4WFYA 4DSFA 1XR5A 4LUBA 4HHUA 3A8IA 4DUZF 2CIMA 1BWEA 1HI8A 1ZOTA 1U47A 1A0OB 1M1HA 2R3VA 1VS3A 4MMOA 3FSXA 2HIQA 1UJ4A 4OHZA 4UZCA 1JNRB 1F3FA 5KFPA 4F0MA 2YVSA 1VHFA 3MM8A 2KKHA 1SJ3P 3HZGA 2OIHA 2RVJA 3M8PA 4OJ3A 1Q5VA 3DOKB 4DQPA 3Q22A 2MJNA 3IM8A 5KT6A 2AU0A 3S01A 2DHAA 4J9OA 1E6VB 3EJMA 3A8JA 2YNGB 2N82B 4OX9J 2WBRA 2MY7A 1KDNA 5E7OB 4WKYA 1BXNA 2GIRA 4HT5A 1NMEB 4TY8A 2CPDA 3TARA 1GX6A 3US5A 1QSLA 4RR5A 2MQ8A 2IM1A 4R8UA 3HT3A 2AQ4A 4TLQA 2DGSA 3DGPB 2UUWA 4CIOA 3CC4S 4NA2A 3T1HF 2EI5A 5HO4A 1RT5B 2NXEA 3D6MB 3VCDA 1Y5NB 4FZVA 1HHSA 3FK4A 3KXDA 4G6VB 4C9DA 3VALA 2O5DA 3E8OA 4FS1A 2ZITA 3P5BP 5IT9Y 1O0PA 1RT7A 4NLYA 3R5GA 4AL6A 4TY9A 1FHTA 2I5JA 1T3NA 2X7IA 4L73A 3JSYA 4QCLA 1P1LA 2CQ0A 1S1TA 3R97A 2YWFA 1IUJA 3ITHB 5CYJA 5DG9A 3DGVA 1H3DA 2BOAA 1RABB 4CO3A 1XN9A 4DS5A 4ZVSB 1JLFA 5MLCV 2M52A 3EGVA 2HG4A 4F2RA 4FF1A 1TL1A 4A8FA 2DRDA 3QSIA 1JJ2R 3KMQA 1WF1A 5DDPC 1WF0A 2P9EA 3MCMA 2JLFA 2VQFF 2RRBA 5KG4A 4ZVFA 4ECVA 1FDNA 5M2RA 4IRKA 4B3RJ 1IR2A 1HFEL 2VBWA 3OL8A 1N5YA 3GG0A 3OR2B 3MM8B 1FT8A 2COLA 5GMKa 2HZCA 3M8PB 3O44A 5A8WA 5LT5A 5IC4B 2C2RA 1URNA 1T95A 2IDLA 4ALZA 1K9MT 3SCIE 1MWYA 4IG3B 5B0AA 2P9GA 1RCXB 4UUXA 1TL5A 2LEAA 8AT1B 4USHA 1XMOJ 5DQGA 3M1VB 1RBAA 3Q8RB 1S59A 1FFSB 3H5UA 1AYEA 4MKBA 4OHWA 4TY8B 3GWCA 1UL3A 1C0UA 2Z58B 2QA1A 4JI2J 2ASLA 3LUYA 3OTOF 3PG9A 3D3BJ 4PPDA 4R8UB 2CNLB 3ETOA 5LSRA 2MB0B 4X4PA 4XDDA 3HFKA 1DZ5A 2ZKUA 4LIWA 5DQHA 3DRXA 3L95X 5KTQA 4EBEA 3MMAA 4IR9A 3V5RA 3RBDA 2ZOGA 3RR8A 3PFEA 4PG5A 5FD1A 2AGQA 1RT7B 1GXTA 1MN9A 2RB7A 3R6GB 2I5JB 1VJWA 3U1NA 1BY9A 1SV5A 4ER8A 3RRHA 4X4OA 1H2VZ 4G1QA 1S1TB 4B3MJ 1KBRA 5K8OA 4DV6J 4CT8A 2DY1A 3LGMA 1FO1A 1NCLA 1HR0J 4CWBA 4RNFA 2AHOB 1WHWA 4DV1F 2HK3A 4B3SF 5BYRA 2KFYA 3BH6B 4DU8A 3SV3A 4GKKJ 2JEJA 4JI1J 3OTBA 2VF3A 1RT6A 1KQKA 1FJ7A 2GJIA 4DR6J 5AJ3F 2LQJA 3BREA 3B78A 4ZS6A 3BSOA 3QT6A 2FZKB 3WIUA 5F3TA 3LOUA 4C0BA 1F6TA 4IFYA 2ADCA 1YSJA 1M90T 1VQ9S 2LFVA 2VKRA 1YHQS 1Y0HA 2BQUA 3N6LA 3ADAC 4HEA9 1V9OA 1NHVA 2NSCA 4AYBD 4Y0FA 4X62F 5HJYA 3RW7A 3TP2A 4ETXA 2RNEA 1CQNA 2RSQA 2EWHA 3FZ2A 2ZH4A 1C0UB 1NLKL 3NS7B 2WRMA 4J7CA 4A8OA 1FDBA 5D0GA 2DNPA 4JI0J 3ENAA 1FRKA 3J7AN 1TV6B 4WCEQ 3LF0A 4IFVA 3W2VA 1OIAA 2DEIA 5A6WA 2FLLA 3TQEA 4XTTA 1Y9OA 1NK4A 3MMAB 1RHQB 1X4DA 2ZH9A 4RUBA 4K4UA 2QE5A 2W9CA 4E0DA 3D9BA 4TVAB 3I0RA 3GIMA 5E3RA 1FX2A 4M5GA 4MK9A 1SV5B 4G1QB 4ZVQB 3KLFA 1NJWA 5BJRA 1RWOB 4U95A 4PEOA 4IOCQ 1OMSA 3GSDA 1UVJA 3J7ZT 3KMSA 4Q5VA 3PM9A 2J0WA 3HT0A 3J7Z5 3JQKA 1O51A 2CNNB 2IC3B 1FCAA 1RLCL 3X3UA 1UFLA 1RT6B 5DLFA 3TAQA 4QIGA 4N56A 3SCLE 2R7RA 1T9XA 1XIQA 2F8EX 3VAMA 3KTQA 5IT4A 2P2CB 4IFYB 1ZZNA 4ZCKA 3MOZA 1LQ9A 4UOGA 2M9KA 4MYTA 4Q45A 3L7UA 1HMVB 2V67A 3RGIA 1H38A 1XMBA 3HK2A 3UFCX 1ZTWA 3PKYA 3NWGA 2OUGA 2R2TA 3B82A 4HHJA 1MU2A 5KG2A 5DDQC 3W8PA 1EX8A 4LF1A 2C3MA 4NEZA 5IZHA 2B7BB 2IRUA 1CG2A 4BCAA 3BO3A 1BUXA 1N32F 5D4NA 2OJ3A 1UVIA 4LBIA 5KFMA 3HSJA 1TAUA 4XK8C 4C98A 3IP0A 2RQ4A 4YS2A 4KJIA 1VRQC 2HFOA 3BH7B 1BQNA 3FJ2A 4W90B 2LP4A 3BBFA 3W2VB 2AWZA 3AFGA 4U6PA 3H0PA 4MK7A 2XO7A 1RT4A 2CJXB 4OZ1A 1YGYA 2BOPA 1HNZF 3I0RB 1BD6A 3EM1A 3UW1A 3I55S 2W9BA 2ATLA 1TKXA 4UY8T 2EC0A 4DPXA 2V6AA 1PAEX 3DLLQ 2BM1A 3KLFB 2Q6CA 2YH1A 4UY85 1N54B 3UQSA 2YX1A 2Y1LB 4P71A 4IO9Q 1XC9A 1H2UX 3UN2A 3MR6A 5K20B 3KHRA 1RP5A 3QJJA 2QV6A 3AB4B 4HT7A 4ZVHA 2W4PA 4EI2A 3QT5A 2VQFJ 3RBZA 4OV1A 4NXMF 2WOMA 3MR3A 3IG1A 2QO3A 3J80Y 2VPWB 2CPYA 1HIYA 1H7XA 1SL1A 4O3SA 1EQMA 3NGUA 1D1UA 3SZ2A 1KN6A 2XCAA 1FJGF 1I94F 1FFWB 2V8HA 4DV7F 5E0OA 1TP7A 3CCJS 2DCLA 3S6EA 2HPUA 2OLWA 4C4WA 5HAOA 5ETPA 3I32A 3D6FB 2HZVA 1SKWA 1R8BA 3RB6A 4F4ZA 2DO0A 2BANB 3CT9A 2DHXA 1FTRA 2KN4A 2EFGA 4IRCA 3OTOJ 4PKDB 2IRYA 4L3NA 4C8LA 3D28A 4CLWA 2ZVSA 4K50A 2ZE2A 2DITA 2IDEA 1P9QC 2DNLA 3MAHA 4PYDA 2FJDB 3ICLA 1U02A 2FQQB 3HVWA 3OHBA 2WAQD 5KG7A 3GR1A 1HWLA 1U1KA 1H0HB 2XBPA 4YHHF 1HHQA 4P75A 3MM6A 1SH3A 3DU6A 5B0GA 1RACB 1X5TA 2OKQA 3W5ZA 2DR9A 3JTOA 5DRKA 2E9TA 1Y00A 5FLXU 1RU1A 1M5SA 2M0GB 2R2UA 2XY6A 4XDCA 4NLWA 4BS2A 2RS2A 1QSYA 2RQKA 1VRTA 2N3LA 1TKXB 4LQ9A 4ILRA 4L74A 4MT1A 4OYIA 1AT1B 2C2KB 1NM2A 4OL8A 2KRBA 4DV1J 4B3SJ 4O3NA 2UXCJ 4NZ6A 1YITS 2RRNA 3H7HB 2ADBA 1HNVA 4GO7X 2CZVC 4I6YA 1MSWD 4BC9A 2RDJA 2GGPA 4PG8A 2E1MC 1SJQA 2POKA 1OPZA 4YP3A 3MFIA 4PCQA 3IG1B 2GIFA 1FRHA 2EKNA 2MZ1A 5GAEI 3OHAA 4QR0A 4WZMA 1NZ8A 4LF7J 3UWTA 2Q3PA 4ES1A 3PIOQ 1N88A 1VDHA 4NLQA 3TW0A 2ZHAA 3MUTP 1BQMA 1GTHA 4ZHRA 3M30B 4J9SA 3ZZRA 5KFEA 2QYCA 3O6QA 4WYWA 2B51A 2XWXA 2OI2A 3DOLA 5L39A 4ECWA 5IQQA 4URGA 1FJEB 4ERDA 3MZIA 5F9NA 4JI8F 5F9LA 4LF8F 2LA4A 4RW7A 1KRPA 1BWVA 3V81A 5EX3A 2UZAA 1S57A 4ZCLA 2V4JA 4LSLA 3WIVA 1HNXF 2XMUA 3CJQA 1MWQA 4DZDA 4MJKA 3T19A 3T9ZA 3QWPA 2VBXA 4B9MA 5IV3A 2CDRB 5DM7Q 3BSCA 1RTHA 1NK9A 5J2NA 1WD6A 2DH9A 1RHRB 4BWJA 4USJC 3FC9A 1VRTB 2DNKA 1GFWB 3P6YC 3SSRA 4W92B 1WTBA 1X7VA 4JI3F 2R8JA 4ZCIA 5L38A 3TUIC 3EZOA 1C0TA 4ZPVR 2DO4A 2YX7A 4TXSA 1HNVB 1R8CA 5HQMA 1KSPA 1ZBTA 3POTB 4DV5F 4ILLA 2DD8S 2HS4A 2W7AA 2GGPB 4A8QA 4M5MA 2PN6A 3CJKA 2XNRA 4IRDA 1RLDA 1IWAA 2MHNA 3TRGA 4TYAA 3GE9A 1UFWA 1HLWA 3QZ8A 4ECSA 1IBLF 2AZ3A 3CMQA 3V6HA 4RW9A 4PXEA 4K4TA 1N0UA 2WW8A 2VHGA 3L4BC 1HW8A 1Q8KA 4OI2A 1S48A 2Z2ZA 1VQ6S 2JNJA 4GKJJ 2DVIA 3G6ES 3K2YA 3Q86A 3EDQB 4CT9A 3D1HA 1TK0A 4J9PA 3GFYA 1MMLA 1LWEA 3PRVA 4WYLA 1VLOA 2D9PA 3VQTA 1RTZA 1D3WA 2KXNB 4ELTA 1HNIA 1X4HA 1ULRA 1WC4A 3QZ7A 3L9ZA 4J9VA 4DPUA 5HANA 1DLOA 3CCWA 5L9NA 3WX4A 2R7WA 3LPEA 1T9UA 2E9RX 2HHUA 2MKSA 4OJHA 2X51A 4MIBA 4RW7B 5HJXA 1SJRA 2WVDA 2V4JB 4DSIA 2EG2A 4LSLB 4P7VA 4F2SA 4N8OA 1K47A 2NREA 1S1XB 4ZCMA 4RW4A 3D0GE 1Q8BA 1RTHB 1N56A 5J2NB 4HH1A 4B17A 3K17A 2NUHA 3Q8SB 4K4XA 4H54A 1X4GA 2XGQA 3T5JA 3RJMB 3N28A 3QRQA 3LAMA 4CLLA 3QRPA 1NDKA 2HAIA 3OVBA 2VKZG 4NXMJ 4ED4A 5HVHA 1C0TB 2WVFA 3S7RA 4DX7A 1SUQB 3CJ4A 4OJGA 1HW9A 4EYHB 1TR0A 4B3TJ 1RHUB 4BLGA 2GJ2A 4ZJLA 3K8VA 2YWEA 3MUMP 2RU3A 1I94J 5F8MA 3ZZUA 3IGNA 3DCAA 5J2MA 2E66A 4Y00A 4DOZA 4Z7YA 1F9FA 2V9WA 4Q7AA 1XMQF 3EZ5A 1TUWA 1M5VC 4IUFA 2ZC4A 2MKYA 4RW9B 1VI7A 1AXQA 4ZVEA
chains in the Genus database with same CATH topology
3QWUA 2QFJA 2HQIA 5KOWA 2BJEA 5FLXY 3DXBA 4ECQA 3MXHP 4G1IA 4M63A 1R8PA 3M2VA 3AQPA 2B5JA 2ZOFA 4K0KF 4ZPCA 1AFJA 4MFBA 3NS6A 2E1CA 1GT8A 2KU7A 3KJVB 2ZM6F 2KZMA 5EGYA 3C46A 3IR5B 1RA6A 1VRUB 1H2TZ 5L1IA 2OPSA 2F1FA 5A6PA 1X4EA 3J7A1 4KGKA 1IKWB 5BYQA 3CXCR 1A9NB 1TK5A 2VA2A 1MU2B 3ZZPA 2QA4G 3IA0A 1G2EA 1JLEB 2UUTA 4I68A 1LWEB 2B43A 3HVTA 1S6OA 4PQUB 3J81Y 1QJHA 3KKFA 3OW2R 3DI6A 3FMWA 5CCLA 2XS2A 1RK8A 2H5EA 4C8YA 2E5HA 3MTKA 4KV8A 3SMZA 4DQQA 1SJFA 1HNIB 1Y5IB 4I56A 4LF6F 2FVRA 2I0XA 2KG0A 2KT3A 5M2UA 1R27B 4I64A 4H4OA 2VFUA 4RU9A 2ZDPA 2VOPA 2DHSA 4ICLA 1IKVA 2MZRA 5EHHA 3NGKA 3MECA 4C8MA 2AP6A 1DLOB 4B9NA 4NLXA 2ACYA 4MH8A 3ENVA 3NG8A 1ZM4A 3NNAA 4DR2F 3I87A 2Q79A 4YY3F 1R7IA 4AQYF 1S72S 2FC9A 3GILA 3DM2B 1EP4B 2RF2B 3H2UB 2UVWA 2YNIA 3CD0A 4DSJA 3CCUS 1V3SA 2GQCA 4HTIA 4QOTA 2PSZA 1LXNA 4DWIA 3HJFA 4C8KA 1H7WA 4ZA1A 3C6TA 2DR7A 1VQPS 2CPFA 2MQMA 2PA3A 2NXUA 4KKOA 2V5HG 2VC1A 1EETA 2ZUGA 3MR5A 5DGAA 1VC5A 3T6BA 1N52B 1NAQA 1RT2A 1BQNB 4GC7A 1HQEA 4NLPA 1SL0A 1G7CB 2BDPA 2ZH5A 2PA8D 3FRYA 3R5AA 4NYOA 3A1YG 2IA6A 3M6WA 4EO6A 3DYAB 2YKPA 2EG1A 4ZP8A 3SCKE 1TV6A 4O4GA 3WC0A 4EBDA 3BZQA 5L1LA 5KFUA 4FF4A 4OI3A 4WFAQ 2ASYA 4DX8H 3AQOA 1OS5A 5I42A 4N77A 5KFZA 4ETZA 3HDSA 3QLHB 3MEDA 1UVMA 5A2QY 3CJ5A 3OLAA 1NZAA 1X4CA 4OLPA 3D5MA 4Y2AA 2JFKA 1RT4B 1S4FA 2HMIA 1C1BA 2VFVA 3NCQA 5HBMA 1U24A 2ZZNA 2FY1A 4O3QA 3BSAA 1OO0B 4RWXA 5JVHQ 2C22A 3W7BA 2BUNA 2V0NA 2IJNA 3LH2S 1WACA 1M5OC 2MSTA 2W9BB 3BR8A 2W8KA 2CVEA 4QYRA 1FKOA 2DGOA 3NGDA 2AJFE 2DNGA 4BBYA 1TFYA 5CH7B 4F8RA 4KB7A 3M8QB 5F8GA 2IM3A 4NLSA 3TO8A 1OQ6A 3TX8A 1WTFA 4RBVA 2G9OA 3FGVA 3N5FA 1VK8A 2J9DA 2CQ4A 2E5IA 2MKKA 3MPVA 2IMOA 4JI4F 3LQVA 4MIWA 4CO5A 4EUVA 5C24A 4MKYA 2V8DA 3L3CA 1HBOB 2LCWA 3R3TA 1X4FA 2RMLA 3QYYA 5ADZA 1S1WA 4WK3A 4U7UK 5J1PA 2KFNA 1R31A 1S79A 1FEHA 3DRYA 2MMYA 2VQEF 1QSSA 1LW0A 2FUG9 3TAMB 3QAEA 3O3LA 3HLUA 1YJ9S 3M2UB 1UA1A 2HNDA 2XI2A 3BO2A 2QMWA 1SQEA 2BM0A 1YJWS 3O1LA 1PC5A 1Q79A 1S1UB 1ZPWX 4ELUA 3WBZA 2E44A 1X5PA 3OFGA 1RWUA 2L9DA 2WOMB 4B3MF 1VQLS 3Q2TC 1C4CA 3H98A 3IS9A 3S1TA 3S8SA 1KQGB 3SSSA 3UPFA 1XNRF 3FEXB 2L48A 4OHYA 2DH8A 2RU9A 2JEGA 2HGLA 2ZH3A 1U2FA 1TL3A 2ZHBA 3N6MA 2FLOA 2V4RA 2UXCF 1VQKS 2IC3A 3N6NA 3IN5A 4ED6A 1Q82T 1SXLA 2C3UA 4HVZA 2MHEA 3U02A 4R0EA 4LVOP 3DNCA 4BWMA 3KG4A 4A8YA 2XSJA 1T03B 3FQLA 2BYCA 3LP0A 2PI5A 1HL6A 1TL4A 2VBYA 2ALZA 2CJ9A 3ZZ0A 2P9CA 3SI8A 3CTRA 4FPRA 1HD0A 2R2RA 3PHEA 1U1MA 4OX7A 1WEZA 3OR1A 3CCMS 2ROPA 1ZAXA 1YWXA 4UQTA 3T9NA 2JEFA 2MZTA 5AE2A 4A4JA 4QQBA 4CO2A 1L3KA 2X1AA 3F56A 3O5TB 3TAPA 2LYVA 2RDIA 4KRWA 2L3MA 3D0IE 4O44B 3L7OA 5C42B 4J9NA 2C2DA 2ZBCA 4DUYF 2IAJA 2HWTA 4X4TA 1U1QA 2R7VA 5EWFA 3UCZP 3PO4A 2X1FA 3T5HA 4DR6F 3D1OA 7FDRA 1WNEA 4MFBB 2JC0A 4C97A 4FXWA 4JI6F 3G96A 3RB4A 2Z8QA 3VR1A 2XMKA 2RH3A 1KHWA 1VQ7S 2OPSB 2V8GA 1FRIA 4OHXA 4YFUA 3GIIA 1HMVA 2BW2A 1JLCB 2J0QD 1FK9B 2GO8A 4IOBA 4OZLA 4Y2KA 1Y3KA 4TN2A 3SQGA 4F3MA 4J9KA 5KG3A 4FS2A 2BQRA 2KJVA 1HI1A 3EUNA 4DG1A 3GMGA 2U1AA 3CJ3A 3HZEA 1PGZA 3PFOA 2DT9A 3HVTB 2W25A 5KFBA 2DPIA 4LF7F 1VQNS 1E6VA 1RJJA 4C11A 5KT7A 1Q8LA 2XS5A 3CIMA 3DI6B 4NRUA 4DV3F 3THPA 2YKQA 5J2QA 3G86A 4GMKA 2QLXA 3EPIA 4Q8EA 2K7KA 3M6UA 1KD1T 4KV8B 3M6XA 3AJ1A 4NA3A 4IYQA 3MM5A 4ES2A 4RW8A 3HHDA 2ZE2B 5GAHI 3KWMA 5K14B 4H4OB 4M1KA 3Q8PB 1L3TA 2FLNA 2DRAA 5E3AA 4HDHA 4ICLB 1IKVB 1NU4A 1WEXA 3DRPA 4DQSA 5CD4H 2NUUG 2LA6A 3M2RB 1ZH5A 2KT5A 2LXFA 5H9FJ 2KTQA 4CNZA 2M4MA 3M6VA 3HHKA 4WU2A 4ZPWR 2IVFB 3ZZTA 3HP6A 3CCVS 3MPYA 4WK1A 1IJFB 1VFJA 1TKTA 2EBGA 2KB2A 4RBTA 2DNQA 4L6V3 4NOHA 2YWHA 5KT4A 3C6TB 1FE4A 5KT5A 3OV7A 4ED2A 3PRBA 2ZBIA 4KKOB 2A18A 4NLGA 1YJUA 2WHOA 2HVHA 1HWUA 3PACA 2DB1A 3ZC4A 4DL0C 1KQSR 4DSLA 4WFZA 1QLNA 2ZD1A 3MM6B 6FDRA 5HMWA 1B7FA 4CQ1A 3TR5A 3MHYA 2OSRA 5DETA 1TKDA 4PWDA 2R2SA 2OP5A 4OI1A 2LQBA 4F4KA 3OSNA 3MMBA 1KHVA 3DLEA 1IN0A 3GYXB 1RT5A 2KM8C 2CQPA 2IJFA 1KOOA 2VB6A 4NYZA 2MZQA 2XMMA 3FEZA 4U9RA 1JWWA 5I42B 4ZPTR 2V2KA 1IQZA 3DLGA 1YG0A 3MEDB 3OXGA 1NKBA 1R8AA 2GNKA 5J1NA 1CVJA 1QM9A 1Q7YT 4TU8A 3OSPA 2KVIA 3PJXA 2CVIA 3K5PA 3PKMA 1QUPA 4DR4F 4Q8FA 2IHR1 5A0YB 1RTJA 4OX8A 3T1YF 2HMIB 1C1BB 2ZH2A 2Z2LA 5HBMB 4YR0A 2LLZA 2KRRA 1NK8A 1SBRA 3DMJA 1MNEA 4X65F 1T05B 1QE1A 3I0SB 2XEXA 3LO3A 5HLFA 2AJ4A 1R8HA 4B9VA 4OZ0A 2FHMA 1R89A 1FKOB 4Y34A 1F0XA 3OFHA 4EEYA 4ED5A 4NLOA 3KOAA 2R7OA 2KFZA 3VZIA 3JTPA 1NHUA 2XULA 3H2VE 4IH5A 4NLRA 4JI5F 1V3RA 2UUCF 1F60B 2FHOB 2VFTA 5DDRC 1TUVA 5C24B 5F8NA 3PV8A 4E98A 3CCLS 4LFCF 2HVIA 2CQCA 2I9SA 4D3GA 3ITHA 1S1WB 5AXLA 1JKHB 2BXJA 2MZSA 1VQOS 1CSJA 1JLQA 3HI9A 4A46A 2WK4A 1LW0B 4MK8A 5F0UA 3ISZA 5BR8F 5CYQB 5KFKA 2OTJS 1RT3B 2HNDB 3CDAA 5KFLA 4NCGB 5JXSA 3MOJB 2IRXA 1B64A 3UDLA 1VQ8S 2V9KA 4B9LA 1LFPA 2HHVA 3NLCA 1YVFA 1V3ZA 4ED0A 4NZ0A 4QIFA 1AROP 2DNRA 2FGCA 2QIFA 4WFYA 3E51A 3TOQA 1FDDA 1LWCB 2M8DB 1VMBA 4DSFA 1XR5A 4LUBA 1K0VA 3JSMA 3QGIA 2G13A 2OO4A 4MYUA 1TL3B 4F4XA 1FXLA 3TVKA 1CQMA 3F44A 2J0SD 1Q1KA 2Z2MA 2FLPA 1P1TA 4H4MA 4DUZF 2CIMA 3NMAA 1HI8A 1ZOTA 1BWEA 3VAJA 4TLRA 2LVWA 5B09A 1U47A 2UXBF 1VS3A 3SEOA 4MMOA 2IM0A 2CDQA 3FSXA 1VIXA 1ZAWA 2HIQA 2V94A 4R5PA 1UJ4A 3OTEA 4OHZA 1WHVA 1JNRB 1Q53A 4F4WA 5KFPA 4NLUA 1UETA 1SC6A 2L9NA 1F5BA 2YVSA 3ISNC 1S9EA 4L72B 1VHFA 1SH2A 3THTA 1HA1A 3G8TA 4IQXA 3OJSA 3MM8A 2KKHA 1SJ3P 3SFUA 1BC6A 3HZGA 2OIHA 4DBQA 4Z2XA 2B6AA 2RVJA 2NQPA 3M8PA 4OJ3A 3DOKB 4DQPA 5LSLA 4M94A 3H2LA 4ZKAA 1R3NA 3IWXA 3M9OB 4J5OA 5G4DA 4USIA 1BQMB 3Q22A 4Q0BA 2GMLA 2MJNA 1AW0A 1SJ1A 2I2YA 3ZZZA 4KAIA 1IJEB 4ZHRB 5KT6A 4NWBA 2AU0A 3CULA 3G4SS 4B9TA 3S01A 2CQBA 1VQMS 2I1RA 3BR9A 3PW0A 2OPQA 2DHAA 2G4BA 4J9OA 4QYZJ 1E6VB 1KR4A 3KFWX 4C11B 2BANA 2D3OR 2RIJA 2YNGB 2OPRB 1U1LA 3G71S 4X4RA 3MMCA 2N82B 3TANA 2R8KA 3DFEA 4Q44A 4QU6A 2WBRA 2R7TA 2MY7A 3M32A 5FDLA 3PX4A 3PJWA 3KK2A 5E7OB 4M5DA 4WKYA 5KFJA 4GKJF 3PVXA 2GIRA 2FJXA 1WELA 3DOLB 4HT5A 2VZ9A 2ZDOA 2VC0A 4TY8A 2ABYA 3BQ0A 2CPDA 1FEEA 4Q2LA 3TARA 3MF5A 2HWIA 1GX6A 2IBOA 3T1AA 3ENWA 5E3QA 1CEZA 3IO1A 2NS1B 3I9ZA 5J2PB 2AJ0A 2GQ2A 3US5A 1QSLA 4MKAA 2IM1A 4R8UA 3HT3A 3BN7A 5KAKA 2AQ4A 4FBUA 4TLQA 2DGSA 3V81B 2PI4A 1KTQA 1S0NA 2O67A 1TKTB 1RT1A 3MM9A 4DV4F 2UUWA 3ENQA 5EWGA 4CIOA 1RA7A 5KFXA 1RISA 5GADU 3CC4S 1C1CB 5D8HB 1FKPA 4IKAA 2XSFA 2ZD1B 4ZP7A 4NA2A 5HROA 4PWDB 4PG6A 1YRXA 3T1HF 4DSEA 2EI5A 1K1SA 2FHJA 2Y1RI 3DLEB 5HO4A 4LVNP 2O01C 1RT5B 2CG4A 3MD3A 1F2GA 1I6JA 2PC6A 3KLEA 1NH7A 2QZ8A 3VCDA 1Y5NB 5B7WA 4FZVA 1HHSA 4ES3A 4G6VB 5IM0A 3DLGB 3DDNA 2UV8G 2LU1A 2XY5A 3OTDA 3ZZOA 4O3PA 3GB0A 2ZH6A 1DHMA 1U09A 4C9DA 1JIHA 2Q43A 3SFGA 3VALA 4KPYA 3IRXA 1ZETA 1HBMA 2E1RA 2O5DA 3E8OA 4DR7F 4FS1A 2ZITA 1RTJB 2E7XA 3FEYB 5IT9Y 1O0PA 3CD6S 2JVRA 2RQCA 3K5LA 1QE1B 1RT7A 1XR7A 5HLFB 4NLYA 5D4LA 1GXLA 4AL6A 4N8NA 4TY9A 4KFBA 1FHTA 4LSNA 2I5JA 1KC8T 2MPUA 1T3NA 3JSYA 3UCGA 4KSEB 2ZJQQ 3T5LA 4QCLA 4C2MA 1QAIA 5HP1A 2W4DA 4NL5A 1ZTTA 1P1LA 3UCUP 4NZ7A 3WZ0A 2K8GA 2CQ0A 4ZMMA 4H4KC 1S1TA 5KFQA 2YWFA 1IUJA 2Y0SD 3ITHB 4BHQA 5CYJA 4PUOB 2A2DA 4KGMA 3KLHB 4QIEA 1BQXA 1JLQB 2EKYA 4UOCA 5DG9A 3BDPA 1M5KC 1H3DA 3MR2A 2XGPA 2J6UA 1UAWA 3KG1A 4CO3A 1XN9A 1GX5A 4DS5A 4KHPF 2ZJPQ 1JLFA 5MLCV 2QMXA 5DJBA 2HHWA 2M52A 1JLAA 2HG4A 1ZZFA 5G0RB 1UEVA 1R43A 4PXDA 2JLEA 5B08A 4F2RA 4FF1A 3CJKB 4F67A 3CC2S 4TQRA 2EFQA 4CZCA 4HKQA 3C66A 1TL1A 3JSMB 4A8FA 2ROGA 3PW5A 2YX4A 1JJ2R 2XMVA 1WF1A 3KMQA 3SV4A 4H4MB 4C8OA 4CTAA 4YQWA 3NNHA 2BQ3A 2FVQA 3P49B 2XS7A 5DDPC 3HHLA 3LP2A 2KJWA 4RLEA 2W7PA 1WF0A 2NR0A 3GFXA 3UR3C 2P9EA 1TFWA 2CPHA 2O66A 2JLFA 2MQNA 2O1PA 2RRBA 4QR2A 3RAMA 2VQFF 5KG4A 4K4WA 5L1KA 4ZVFA 3PZPA 4A8SA 1H98A 4B3TF 2AF6A 4K2XA 3BGRA 4R5PB 1KFSA 4ECVA 3I4HX 2M7SA 3HXMA 3NS5A 1FDNA 5M2RA 2HWHA 4JUZA 3H5YA 2B4OA 4IRKA 1HFEL 5K8PA 2VBWA 1FNMA 3OL8A 1I1GA 3GG0A 1N5YA 3OR2B 3OUYB 4QU7A 3N0VA 3D1QA 1VQYA 4CCHA 3JB9k 2XMJA 5T14A 2ZKTA 2AGOA 1NH8A 5AE1A 3MM8B 4WJBA 2EPIA 5DG8A 1FT8A 2COLA 1Y5LB 5L9XA 4KO0A 5GMKa 3GV8B 2AJQA 2B6AB 3HPOA 4AXIA 2HZCA 3M8PB 3O44A 5A8WA 3KLIA 5LT5A 4ECXA 3H5XA 2C2RA 2FDNA 1URNA 1T95A 3B4DA 4ALZA 1RKIA 4CO4A 1K8AT 3LANA 2YKNB 1K9MT 1N5QA 3SCIE 1R0AB 1FE0A 1MWYA 1T3OA 5LXYA 5GAHU 1L3UA 4IG3B 5B0AA 2P9GA 4C0OC 1FDAA 4RU2A 1M5HA 2AYBA 1XBWA 4UUXA 1TL5A 1VOMA 4C3KA 4JV2A 1JXLA 2LEAA 3BGUA 2HFZA 3PY8A 2OPQB 2BJDA 4QWCA 4USHA 3V6KA 4I2QA 2JWNA 5DQGA 3MMCB 2NPIA 2LEBA 4XPEA 3M30A 3M1VB 3I5BA 2K3KA 2HS0A 3M32B 4RNNA 3Q8RB 5FIIA 2WSEC 3KK2B 4M5DB 2CPEA 3CE8A 2ROEA 2FB0A 3VAKA 3RRGA 2VD3A 3H5UA 4AL5A 3CPWR 1X0PA 4MKBA 1WHYA 4OHWA 4TY8B 1RI7A 3EGNA 3GWCA 4I2PA 4X4UA 5D6GA 1UL3A 5KFIA 1ZPVA 2BRLA 1C0UA 3UNGC 2QA1A 1Q8IA 3TA2A 1SL2A 3HO1A 2ASLA 3LUYA 2NPFA 3VZHA 1X9WA 2R8HA 3AA9A 3B8HA 2A1BA 2PO4A 3OTOF 5SUHA 4X66F 3FFIA