4MIWA

High-resolution structure of the n-terminal endonuclease domain of the lassa virus l polymerase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
170
structure length
170
Chain Sequence
b'MEEDIACVKDLVSKYLVDNERLSRQKLAFLVQTEPRMLLMEGLKLLSLCIEVDSCNANGCEHNSEDKSVERILHDHGILTPSLCFVVPDGYKLTGNVLILLECFVRSSPANFEQKYIEDFKKLEQLKEDLKSVDINLIPLIDGRTSFYNEQIPDWVNDKLRDTLFSLLKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase L
molecule tags Viral protein, transferase
source organism Lassa virus
publication title High-resolution structure of the N-terminal endonuclease domain of the lassa virus L polymerase in complex with magnesium ions.
pubmed doi rcsb
total genus 61
structure length 170
sequence length 170
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4miwA02
5J1PA 5IZHA 3JSBA 4I1TA 4MIWA 5J1NA
chains in the Genus database with same CATH superfamily
3T6JA 5JMNA 2FVCA 2EG1A 4RPFA 1LFPA 3VVUA 2ABYA 2X3DA 1WDDA 4Z2XA 5J2MB 3H4BA 3K5OA 1ZTTA 4ZA1A 4WXOA 4CTAB 3DDNA 4DSIA 2V5HG 3MAAA 4XTTA 3D67A 2V4QA 3WC0A 4ZCKA 3B6BA 1HWLA 2FUG9 4NZ7A 3GPAA 3OR1A 1WORA 2LQ9A 3MR7A 4KBIA 4PAAA 3W5YA 2XO7A 3MCMA 1V3RA 1VQKS 1X5TA 2V69A 2B51A 3VCDA 2RRBA 4KC5A 2CQDA 1RTDB 3TJ8A 2CVIA 1GQEA 2ZH8A 1CSJA 1FX2A 2C3UA 1MROA 1TKZA 1S9GB 2DH7A 2NSBA 3EVWA 4OZLA 4RW7B 4CLTA 2MZJA 3MR3A 4DPTA 4P7VA 3I9ZA 1YBTA 1U2CA 4KHPF 2MQLA 4LIRA 4RUAA 4RL1A 5DDQC 5K8OA 3VGUA 3KG1A 4ZDNA 1KRPA 2HWIA 3GLJA 4ILLA 8RUCA 1Y0HA 2GO8A 4M5MA 5HAOA 4DR2J 1SL0A 1SJFA 4P52A 3VWSA 3WBZA 4DG1A 5HP1B 1UMJA 2IM2A 2W2NP 4BHQA 3IP0A 1J5EF 4E0DA 4B3SJ 2KI2A 3EGWB 4NLXA 1HBMA 1T02A 2MTLA 2RRAA 2MSTA 3M2RA 3QFHA 4C98A 4NA1A 4QR1A 4CO5A 5M2UA 4LVOP 3BGOP 3CCTA 2MQPA 2V8PA 2GJ2A 4UZCA 5DQGA 3GZ7A 4ZLJA 1K1SA 4FBTA 4FF1A 3S8SA 3KJFB 2UXBJ 4GKKJ 4ZCMA 2JH3A 2VDHA 4UOGA 1U24A 2DNYA 4ED2A 3DLGA 1RTHB 4FYWB 1N52B 2GFFA 3NCPA 5A6PA 3G6ES 1B3TA 3PV8A 1CLFA 4P73A 3JQJA 4O0IA 2UUAF 1AXQA 3MI7X 1OSCA 1AUDA 3M6UA 2HAIA 2FYXA 4P2MA 3VQSA 3CCQS 4FS2A 1U4BA 1PO6A 4WP3A 2KG0A 4UY85 1NSAA 2KXHA 5ETLA 3I31A 2HNDA 3S6EA 4RW6A 3BQ2A 2JX2A 1HW8A 4V19X 4JI7F 3CCLS 2GVZB 5C7PA 1U1QA 5LMNJ 1JLFB 4CLSA 2XMMA 2PGCA 3QQCD 3CIMA 2QO3A 3WDOA 1PAUB 3DU5A 4ZVUB 2DGXA 4Y3CA 3FCVA 1HQ2A 2KL8A 2H54B 1GK8A 3IXQA 3POTA 2CJXB 3CF5Q 5H9EK 3DOLB 1XR5A 4OJGA 2V8DA 5IOLA 4A48A 2VFTA 1LW0B 3NY0A 4CNZA 5HMXA 4RNNA 3R2CJ 5D4LA 1HHQA 4EO6A 1F3FA 2K7KA 4XIUA 3Q8YA 5HBMA 4DF8A 4AL5A 4F02A 1DY3A 1U26A 4MFBA 2FLOA 2H65B 3LP2A 3PACA 3AQOA 1RAAB 1OSDA 1RAHB 3LP0A 4MIWA 5IC4B 2MQQA 1HPZB 2LA4A 4X84A 2GJIA 3N6NA 3CMAS 4X4NA 3DDKA 5F8JA 3TVZA 3X1LB 3GSDA 1NPPA 1JJHA 2H4YB 2VDIA 1S4FA 3ENQA 3HHEA 4TNOA 1S7HA 2OPPA 4YHHF 3CCWA 3GB0A 5KFUA 1P27B 4LUBA 2MY8A 3FEZA 4ER8A 2FY1A 2YPYA 4DQQA 5AXKA 2AJFE 2B4VA 4RU2A 1VRUA 5D78A 3TO8A 2HGNA 4KY3A 2MZRA 4AXIA 5HVHA 2HKEA 3G8SA 2WVEA 3UD4P 3W9IA 2MLXA 3HVTA 3MM5A 1Q5YA 4AD6A 3I5AA 2G1HA 4NE9C 5JVHQ 2GVZA 5HQ8A 3MPDA 4BWJA 4OYXA 2LVWA 4R25A 1N4LA 1FJGF 5HROB 3HF5A 1JB0C 1RHRB 2IHR1 4NLYA 2QYGA 4YHHJ 1OJ4A 4DX7A 2F7VA 3T5HA 1UVKA 3N6MA 4EYHB 3MDFA 1NK9A 3KHGA 1LKZA 1H6KX 4ECWA 1SXLA 2FZCB 5AXMA 2FZGB 4O4GB 3ZTQA 1PBAA 2VG6B 3FSIA 2IDEA 1VBYA 2FC9A 5DLGA 2UU9F 2AHOB 1U0SA 3KNGA 1EP4B 3KUEA 1VBXA 4C11A 4KFBA 4DV1F 3KLEB 1ZPVA 1F5AA 2DNHA 5EWEA 2CJBA 4A8FA 3OVBA 5HK4A 3NCQA 4F0HA 1TUWA 3W65A 3HFZB 4TLRA 1E6YA 4F4KA 3NNCA 1G3OA 4WFBQ 2CA9A 4TVAB 1HNWJ 3G71S 5FJ4A 4Y00A 3HT3A 3UE2A 2YNHA 3SYZA 4B3OB 1R8BA 4KE5A 2K3KA 5F3TA 1K44A 3UN2A 4I6AA 5A8RB 4CLUA 5J2PB 2B4OA 1TU0B 3QGHA 3RB3A 3RRGA 4DL3A 2MPUA 3SV4A 2UXCF 1LFWA 5EWFA 4ELUA 2XGPA 3W61A 1VBKA 2K7JA 3TX0A 1S12A 3PYDA 4JI8J 1V6HA 1ZS6A 4F67A 2CNKB 2XZDB 2IFXA 2OEMA 5I4MA 3R5CA 4KTQA 2HQCA 2FJBB 1LWCB 1NDCA 4LSZB 1JQGA 2NYIA 3NAIA 4BS2A 4LIWA 3R7SB 1VRTB 2BJ8A 4LRFA 5DZ7A 3AH6A 4F0MA 1VQSA 2BX6A 1IJFB 1IQTA 3QRRA 2V6AA 3CO0P 2CPFA 3J80Y 1DRZA 1RLCL 1XN9A 4WWSA 1U1PA 2CDQA 3I6PA 3HKWA 4ZJOA 2CJQA 3MR5A 2DJWA 2CPJA 3ZZ0A 3KNAA 3IA0A 4USHA 1RT5B 6FDRA 3MR2A 4IRDA 2EKNA 3IC1A 1D0EA 3PNIA 2R7SA 2DR8A 2DXEA 1URNA 5KFOA 1JLGB 4LF1A 4C0BA 2QL5B 5E5NA 5D0HA 3HSGA 2K1RA 4A46A 3UCUP 4DUZJ 4USJC 2R7XA 3GONA 4A8OA 4CYUB 3H5UA 2KVIA 3MAQA 4X65J 5DM6Q 4QR2A 4KJIA 3CJ0A 1HNVA 2AJ2A 3PYGA 1JMTA 1FK9B 1U02A 1UEUA 4LSLB 5KG2A 5GAHU 3DLHA 1NKCA 4YOEA 1AW0A 3M8ZA 2J0QD 4IRKA 5B0DA 1HQEA 5B09A 4DUZF 4FKXA 1PC5A 3N5FA 3OPKA 4OZNA 1IR2A 5KFDA 3MTJA 1F1BB 1U0HB 4CLWA 3R5DA 3G96A 4KGKA 3BPDA 1JLCA 2R2UA 2W9CA 3W7BA 1Y4ZB 1N33F 4EU0A 1MW7A 1H2VZ 3FEYB 2V9WA 3F73A 2HK3A 3P5BP 4RW4B 4Z7CA 2Y8WA 1OPIA 2DO0A 2RF2B 2LA6A 4AE5A 2OI2A 3SQGB 2E5LF 3TJ9A 5IXUA 1V5IB 4B3TJ 4OX9J 1QY7A 4QU7A 1RWNB 1UFKA 5LMNF 2KFNA 2FDNA 1IKVA 2V4JB 2BUNA 1MLAA 1Q1KA 1RTZA 3OTCA 4ETXA 3D0IE 1NDLA 1SQFA 1Q8LA 3V6DA 4K4SA 1IBCB 3D6TB 3GR0A 5KFQA 1V3SA 2YNGA 2R8JA 4MAKA 4DFJA 2J6SA 3ZZRA 3IN5A 4HH0A 2Q66A 3PO5A 2ZBIA 2F4VF 5ETSA 4A8KA 3D6MB 1S0OA 1B99A 2PFFB 1XNQF 5DQHA 3R6GB 2RS2A 5CCLA 2J6UA 3CC7S 2HQFA 3DLBA 1YJRA 2IVMA 4IFYA 1YBAA 2CADA 5IZHA 2YNFA 4RNMA 4F7VA 1HA1A 3ET6A 4PRFA 3T3FA 2VD3A 2W2MP 3BGUA 3C6TB 3JTPA 4K4WA 1NJYA 2BKOA 2G2YA 3AB4B 4RW6B 3QYYA 3ZZUA 2XY5A 4WCEQ 2AGOA 3TEHB 3UD3P 1NHKL 2XHWA 3R2DJ 1KS2A 3D1OA 3M1VA 4HDHA 4Q43A 4JUZA 3FC9A 2YVSA 1KVKA 3M7VA 1Y5NB 2HG4A 1OY8A 5C42A 5MLCV 2N4DA 4I64A 3TA0A 4CCHA 1IXKA 1H2TZ 2C2ZB 4FXVA 3RW7A 1WTFA 1NH7A 3Q83A 4MFBB 2BOPA 4F04B 3JSMB 4B9VA 3QNWB 5E3QA 1VQPS 4HI2A 2VG5B 3I32A 1NU4A 4HT7A 1JK9B 5KFSA 4X4TA 2R7RA 2HNYB 3M05A 5BYQA 5J1PA 5GADI 3M8QB 4J9SA 2QLWA 2E9RX 2OPQA 3CDAA 3VR1A 1PBUA 4X66F 2H9ZA 4U7UD 1JJCB 2VG5A 3HT0A 1RWOB 2O67A 4W98A 1V9OA 3V2UC 3H4DA 1EARA 1ZOTA 1FVQA 2O1PA 5LMUJ 3RB6A 1QDUB 2VG6A 3V4MA 1M5PC 1HR0J 4OI2A 3N01A 3VAJA 4N7TA 4Q0BA 1WF2A 1HNWF 4DSJA 1PIEA 2UUWA 3L09A 1RAFB 3MCOA 4DCJB 3FRZA 3MMBB 1DURA 1QUVA 3MURP 4K4UA 3SBMA 1SJRA 5J1NA 3G8TA 2XYPB 2Y1RI 1QAXA 1E6VB 3EGVA 1FX4A 3OVAA 3TOQA 3LO3A 2GVDA 1MSWD 3TQ1A 2FGCA 1UWAA 1MWQA 2YNHB 2F5GA 2MMYA 3DDIA 5U47A 5KFZA 4YR3A 5KFIA 2XNRA 5L1IA 2Y1LB 4W90B 2EFGA 4NX9A 3W64A 2N82B 3IRWP 4OYIA 4QWDA 1NKBA 1XNRJ 1S0VA 1TMMA 1T9YA 1RWMB 3BQ1A 5HLFA 2YBVA 1WWHA 3FFIA 2XYHB 1REVB 1EP4A 4OJ3A 3I4PA 2XZTB 2Q6BA 2ZH7A 1YX2A 3FKBA 4ECVA 3W62A 3Q0AA 4IG0A 4IR9A 2R7TA 2V2VA 4YS2A 2OKQA 2RH3A 3DM2A 4YB7A 1U25A 1QTMA 3OR2A 2IM3A 3LP0B 4OJHA 2R2SA 5F8NA 3DOMB 1EETA 1TQLA 1N6QA 3N0VA 2HHHF 4IUFA 4UZBA 2YWEA 5M2PA 2VONA 3VGTA 1DTTB 3W9HA 3CD0A 1RJJA 2EEYA 3TAMB 2UUCJ 3FBCA 2WW4A 3C8YA 3GWCA 3C19A 3BZQA 3BSNA 3QPIA 4ZP6A 3W5ZA 4IOCQ 2GIRA 3DRXA 2X1AA 1U48A 4K4YA 4KSEB 1YRXA 2NZ4A 4QIWD 4DX5A 4LF7J 1KQGB 5HSPA 4B02A 2ZJPQ 2VFUA 4I56A 3D2WA 5F0WA 1RBOB 2G1DA 2Z2ZA 2KVQE 3HSJA 2HRUA 3H8YA 4DLEA 2VH7A 2J0SD 3P45B 4DV3J 3J7A1 3M32B 1LW2B 1ZBTA 1FNXH 1DJ0A 1N5VA 5HI7A 2IAJB 4R5PB 3TA2A 2HS3A 5LOQA 4FNIA 4WPAA 1EAYC 1T9VA 1FKPA 2RDDA 2XSJB 4WZQA 4CLPA 1RTHA 1CJUA 1GFWB 1CULB 1S6UA 3E01A 3MAAB 1S1VB 2O01C 2YQ1A 3BS9A 1SIWB 3S7RA 2AGPA 4LMZA 2ZM6F 4OQJA 2B9YA 3EE3A 5DDPC 2R8GA 3BF4A 5K8MA 2XQCA 2DEIA 3OTOF 2LEPA 4DR2F 1LV5A 1YWXA 3WHIA 4C11B 1R89A 3HHLB 2AX1A 4PWWA 2K1RB 3SSSA 5J1EB 5JUMA 2QC3A 1IKYB 1T03A 3CULA 2DR7A 4DV4J 1S79A 1NM2A 2ZD1A 1RWPB 2RU9A 3M8YA 1G4CA 5L1LA 1A0OB 2KKHA 2RF2A 2AV5A 5GAGU 1EKRA 2JC0A 4DPYA 2UUAJ 3AA9A 4J9LA 2XMVA 2C2EA 3T6BA 4DXLA 4DUYJ 3T1YF 4O23A 1Y10A 3NEKA 5DLFA 1WKKA 5AT1B 4CZCA 1RHMB 3QSYB 5C42B 1Q4RA 2PDAA 3QFWA 1Y5LB 2WHOA 1HD0A 3R3TA 1S1XA 1SC6A 4RLEA 3EPIA 2ASJA 5KT5A 2UXDJ 1JWWA 2DR5A 1MN9A 2WBRA 2N7YA 2ZBRA 3ZZTA 1SC3B 3OTBA 3CJ5A 3IO1A 2HLTA 1T05B 1TKTA 4OYZA 4ITSA 3TNVA 1X4HA 1OQ3A 1NK4A 1UKUA 2BE2B 2HURA 2R8IA 2XI3A 4C4WA 1GH8A 1WG5A 1M1HA 3VAFA 1H2UX 2JDJA 3M8PB 2HNZA 3D3BJ 2YH0A 4P75A 2ACMA 3DU6A 5CYJA 3NGDA 2W9CB 1HNZJ 4CI0B 1IVZA 4WFYA 3E51A 2V50A 3BN7A 2U1AA 4H4OA 3Q8QB 4ZPDA 2AW0A 6FD1A 3CC4S 2BZ2A 2OELA 2ACYA 4PZVA 2QRRA 2B43A 2G13A 4R0JA 1FK9A 2D3ZA 3PR5B 3RRHA 5KTQA 4LF7F 2YNGB 4TQRA 2GAHC 2ZOGA 2OSQA 4DQRA 1S72S 4PQUB 1SH2A 5C2GA 1IUJA 3M8WA 2DT9A 1RU1A 8ATCB 1T95A 5CYMA 4X4UA 1QM9A 4ZVRB 2I5JB 1RYRA 1YZ6A 1GTHA 1RWKB 1ZETA 1FKOA 3BGRB 2PI5A 5IS2A 1UPPA 5GADU 3RJMB 1FNOA 3SIPB 2GW8A 2X7IA 3UCZP 2BYCA 3GV7B 3AY0A 1RT7A 3CJSA 1YVFA 1Q8KA 4O4GA 4OYAA 3SDEA 1X9MA 1HNZF 1XJWB 2BRKA 3VGVA 3JB9k 1UVJA 1IN0A 3PEHA 4DR5J 2ZZNA 2DCUB 3PZPA 1FJCA 1O6XA 3OFGA 3C6UA 1Y00A 1NBEB 3CNQP 1JLCB 4U8VA 2XEXA 4QQBA 3I0SA 3MM6B 4NMXA 3B4MA 1XMOJ 2LXFA 3IBCB 1VIXA 2X1GA 3ENWA 1DBDA 4A8MP 1JXVA 2ZUAA 4D3HA 2HZCA 2HK2A 3LAMA 1Q7YT 1VJQA 4C8MA 1MMDA 1VHIA 4DI6A 3KTQA 2O5DA 1RHUB 2Z30B 4CM2A 1PILA 1D09B 2DY9A 2HNYA 4RJVA 4DR1J 4LF5J 3H2VE 2GHWA 4C9DA 5DM7Q 3O5TB 1MWZA 2XZWA 3UN3A 2QA2A 1WEYA 3V6HA 2AZ1A 3X3UA 2JEIA 3P3DA 3PFOA 4RUBA 3S01A 1R7IA 1OYDA 4XO0A 2O66A 3NRBA 2A6OA 2HIQA 2C1EB 2K2PA 3EZUA 1AUSL 2RDJA 2XWXA 4JI8F 5BYSA 3ILLA 1QJHA 4KH1B 4JI6F 2DHGA 2MKSA 4ES3A 3I82A 4JI4J 3PRBA 4Y2AA 1AROP 4IFVB 3MCNA 4LRAA 4KFBB 2VQEF 2C42A 3RZAA 3FRYA 3RW6A 4KO0A 1I1GA 1YJVA 2QL9B 1UZHA 3HJVA 3W2WA 4J5OA 2XLKA 4NMLA 5GVQA 3L7UA 1JKHA 1KR4A 3KKFA 5H9FJ 1HYSB 3EM1A 4NCGA 1M5OC 2HVHA 2C2RA 2QMUB 3MD3A 1LWFA 3DRSA 2JVOA 3HDSA 2FD2A 4M5HA 3US5A 3O2IA 9ATCB 3D54A 3MHYA 5LJ5Y 1UFLA 2MHEA 1E6VA 3ZNJ1 4ED3A 2IM1A 1S0MA 2UXBF 1KHWA 1S1TA 1U09A 1X4GA 2WB4A 2XCPA 2QEXS 3ZNUA 3RAQA 3RBZA 1WTBA 1W25A 4ECYA 4USKA 5KFYA 3G82B 3O44A 2VFVA 4I2QB 1U1NA 5ITHA 2GIFA 2RD5C 2RVJA 3PXGa 3UN5A 3SCKE 1NB7A 5H9FK 5HBMB 1RLDA 4DMZA 4MJKA 4OZ1A 2OTLS 5DG9A 4OYPA 2W4PA 3DRRA 5ADZA 1P6TA 4F26A 2UZAA 4OJ1A 4N5SA 2ALZA 1YSJA 2OPRA 4U95A 1RSCA 4TYAA 1U49A 5CAAA 1GMVA 4PXBA 3HD2A 2DIVA 2UUTA 5JJBA 2B3TB 2K8GA 2M9KA 4LF9J 1FD8A 2EK6A 4TY9A 1CULA 3Q2SC 5F9LA 4KHPJ 2Y9HA 3T1YJ 4DPXA 1YTYA 1NKEA 1RDRA 4N41A 5ETRA 2FLLA 2XY6A 2OUGA 3DFEA 3SSRA 4K4ZA 1SQGA 3T5JA 1QE1B 1SUQA 3DGPB 3UNGC 2GHPA 2V8VA 4A8WA 2XMUA 4KYZA 1G1XA 4I2QA 4B08A 4JV1A 1FVSA 1F0XA 2P8IA 3TZZA 2XMWA 4QWEA 4DV0F 4F2SA 1I51B 3CMES 4JI0F 4GKJF 2Y0BB 4NRUA 2IYGA 3BSOA 5KG0A 1HNVB 1TMJA 3UW1A 1PYOB 3KHRA 3CJ2A 3IGVA 4ECQA 3F0NA 3I4HX 1EQMA 3V6JA 3IBFB 2DNPA 2DGTA 3T9NA 4CLYA 1KEKA 1YGYA 1HI8A 2LXIA 4J9OA 4LRCA 3CW2C 4UUWA 2QFIA 1NUEA 2XYGB 2FHJA 3MEKA 2A18A 1KN6A 3D9BA 4U6PA 1KLMA 1S6PA 2HPUA 3CD5A 1QAYA 4TKTA 4EMDA 2LDYA 1R3NA 5IT4A 2JEGA 4O44B 3A13A 3BM7A 2QJ3A 3W2VA 5C2CA 3WIUA 5E3AA 1SH3A 4O3QA 3OVSA 2IJRA 2HQIA 3CDWA 1D9FA 4FKYA 4ZVPB 4AQYJ 5JXSA 4ZN1A 1RGVA 2BW2A 4OHVA 1HI1A 4Y2KA 4LREA 3M32A 4U7CA 3R97A 4EUVA 2OTJS 2W1BA 2GGPA 5LSRA 4LFBF 2XM3A 1UAWA 4K2XA 5FD1A 5ETPA 3C14A 3IS9B 4I6WA 1N56A 3PKMA 2FPHX 2G2OA 4LFAJ 4FPRA 4KGXB 4B9LA 1NNDA 1TKTB 4FF3A 1S6QB 2UV8G 3BH6B 1QD1A 1NCLA 1B0VA 4Q8FA 2RDIA 1HWJA 3DNCA 3EWGA 3OUYB 3EXCX 4EI2A 4Y0FA 3KXDA 3LGMA 4CO2A 3IR6B 4DSKA 5F8HA 3TUIC 4R5PA 4PPZA 5FIIA 2BR0A 4OI3A 4A8XA 3MPUB 1CQMA 1T8EA 1QAIA 2DR9A 1AT1B 3GJSB 1BY9A 1J2VA 1X5SA 1UFWA 4LJMA 4QCLA 4RW8B 3ONQA 3M30B 4KKOB 2J9EA 4DCOB 3ISZA 3OBIA 4IG3A 3H40A 2BVZA 2W8KA 1CC7A 1TL3B 4R0EA 3TUZC 4DV5J 3GE9A 3PW2A 3ENVA 3BO3A 3PX6A 1RBAA 2W4CA 2OPSA 4H4MA 1HHTP 5DETA 4ZK7M 1NJWA 4NCAA 1ZH5A 4K50A 3CJQA 2M8DB 3KHHA 5MAOA 2ZDOA 3GV8B 2MQ8A 3KLGB 3V81A 1RUSA 2HBYB 3AB2B 5CD4A 1K8AT 4C8KA 4I7FB 2ZFHA 1C0UB 2HEKA 1NHVA 3DXSX 3QJJA 3H2LA 1WHVA 2HYIB 3SQGA 1CVJA 3OFEA 5T14A 4XPEA 1S99A 3RU0A 2W9BB 4JI2F 4DL7A 3K2YA 4B9MA 3GU0A 1ZAXA 5KOXA 1J27A 2HFVA 1FRXA 2IYIA 2XTJP 3DLEA 2VJUA 3MOZA 2AP6A 2PO4A 3HVAA 4UQTA 3NP5A 1M5VC 3C46A 1KOHA 3IG1B 2XSFA 3G9CA 3J80U 4H4KA 4BDPA 2L9WA 3P49B 1F9EB 1FF2A 3J81j 4F2RA 4F0KA 2RQMA 1RT7B 3NWGA 4LBIA 2KFYA 2A2CA 4NASA 1SC4B 2JVRA 4RW9A 4XPCA 5IT9U 3KK2A 4KRWA 5HMZA 1SV5B 3MM8A 5CH7B 4I6YA 4HTJA 3SMZA 4NLGA 2GV1A 4C2MA 3OT9A 3J81U 1GTEA 1S4EA 4L75A 3DCAA 2QMWA 3BBBA 4USIA 1X5OA 4IDKA 4KO0B 4DPUA 2FHOB 1FRKA 1XBWA 1NRKA 1JLBA 2IC3B 2OPPB 1M0SA 3QIPB 5G0RA 3OR1B 5CABA 1CJTB 3Q89A 4ZHRA 1RWXB 5E3RA 5KFXA 2DHAA 3Q86A 3VQTA 3HSDA 3LAKA 3QGIA 4DLGA 1M90T 4KPYA 1LEOA 1UW4A 4WK1A 3B4DA 5E41A 3KWMA 4CO1A 2JOQA 2EPIA 4ZHRB 2QV6A 1BWVA 3OL7A 1WF1A 1YG0A 4DU7A 4O3PA 4EBCA 2Q3PA 1KDNA 1YJNS 2Z58B 2I5JA 2RSQA 2AX0A 3OXFA 3KK1A 1RCXB 5I3UB 5C25B 1RT3A 2J0WA 2B6AB 2HLUA 2KB2A 1FESA 2KT3A 3POTB 1TVRA 3DYAA 4X64F 3EGZA 2HHUA 3PRDA 2AZ3A 3U1LA 3ZTPA 2K06A 4Y2CA 1WEXA 3RAXA 3M4XA 1IBKJ 2J7KA 2DKOB 3MEGA 4URGA 1S1WB 1UWBB 2GMLA 2MKCA 1CJUB 2KRBA 3HD1A 3TAQA 2AJ0A 2IJNA 4ZVEA 2EFOA 5J2QA 2YKOA 2KT2A 5ETQA 5E3PA 2H48B 3BSCA 3VGSA 4QWAA 3RBDA 1TTHB 3D6FB 2DPJA 2EWHA 4P7TA 1NZAA 3BDEA 2IM0A 3GFXA 2X51A 1TUGB 3MM6A 5ETVA 4J9RA 2XB2D 1OYEA 5C24B 1X9WA 3LWLA 4ZVQB 5J2PA 1WC4A 2C2MB 3W60A 2KZZA 1XERA 2P6TA 2W4DA 3G87A 4OZJA 4TU9A 2WAQD 2G9OA 3BGLA 3D28A 5IV4A 4PCQA 1UA1A 3NCRA 2FJDB 4A8QA 4NXNF 2DTJA 3DRPA 4UOCA 3W8GA 1Q8BA 3DLGB 3RGIA 1X4FA 2RIJA 2B6AA 4OX6A 2MKIA 2VODA 4R8UA 4USVA 1BC6A 1NH8A 3QAUA 4IFVA 5RUBA 2E1PA 4DV0J 1F2GA 2W7PA 3ZZYA 1FFGB 3P4UB 4EEYA 4JYAF 4WF9Q 2AU0A 3AJ2A 4DDFA 1HPZA 3T9ZA 4K2JA 1TV6B 4J90A 3F44A 4M95A 4RBTA 2DNRA 4OHWA 2JEFA 4OHYA 1FJ7A 3AQPA 5IV3A 2AYEA 4DFMA 3JSYA 4O3NA 2C2DA 4GVLA 5EHHA 4P10A 4J9MA 5FLXY 4RNOA 5BR8F 1RHKB 3M2UA 3VTIA 2B9WA 3OHBA 5KOWA 5FLXU 2KJWA 2HNZB 4OLOA 4CH0S 4GC7A 1JNRB 5J1EA 5KT6A 2M52A 3VAGA 4F50A 3ILIA 2V8HA 2FTRA 2HHSA 2V67A 1ACMB 1FE0A 1IR0A 4IRCA 5HQMA 4DL4A 1VQNS 1LWFB 2DCLA 4FYXB 1BD6A 1D9DA 1GNKA 1AA1B 2W2OP 3QATA 4KHRA 4M5DB 4B3SF 5I3UA 4J91A 3K0JA 4ZVTB 2C28A 2QL7B 5LL6d 2CAJA 5IT0A 3GYXB 1HMVB 1DQ9A 3LW5C 4L72B 1NEEA 1MWYA 2NPIA 3QWPA 7FDRA 4X4SA 3KK1B 3BQ0A 1I94F 3ZZPA 2E5HA 4Q2MA 1LW2A 2B7CB 3O3LA 4RKUC 4AUKA 2MJUA 3H2UB 3PX0A 2ASDA 1NK8A 3KLVA 4DV5F 2J9CA 1WHWA 3W2VB 1VR6A 4O3OA 3HCXA 2CIMA 1TL7B 4DHVA 3TVYA 2L41A 3KLEA 2WB1D 4PPDA 4DR7F 1SH0A 3HLUA 4NLQA 4P2FA 3SCLE 3R1LA 2VF3A 2W25A 3TAMA 5A8WB 2Y1IA 4RWWA 3MUTP 3FQLA 1VQOS 1T03B 3KG4A 2R9LA 1RT1B 1H73A 1OMSA 3HHDA 4I4BA 4WP8A 3DGVA 4Z7YA 3CJKB 1UVNA 2KYZA 1H0HB 4ZS6A 5IM0B 4X4PA 2GQ2A 2KJVA 3K5NA 2HVIA 5CZVA 2IBOA 2GQQA 3QGPA 4EYIB 4ID8A 3OJUA 4DG1B 1FEHA 2PIIA 3CDEA 5HP1A 1D9AA 4KAIA 5F3ZA 2FY8A 1RYSA 3N4WA 3U1MA 2KH9A 4C8LA 4U67Q 4ZLNA 3DLKA 3NAHA 3RUBL 1VRTA 3K58A 1KTVA 2ZUGA 5KFFA 1VQ6S 1Z2ZA 2VOPA 3M6WA 3V4IB 1BQMA 4NI2B 5DZ6A 4QIVA 4ZP7A 1T05A 1I5OB 4FZVA 1SC1B 4QR0A 1R31A 3B54A 4URQU 3ZC4A 1UZDA 3D1HA 3G2XA 4ZJLA 3M9OB 4OIXA 1S1XB 2YX7A 5IWAF 1R27B 2E7XA 2ADBA 4USWA 2C3MA 4QOTA 1R43A 2EBEA 2YKMB 2FVSA 1UVLA 2BJ1A 2YQ0A 2HZVA 1XQIA 1KQFB 2ZH4A 4O4RA 1C4AA 1HBUA 4O44A 4TXSA 2CJKA 2WSFC 4B3TF 4ED4A 1HBMB 1MMLA 4DPWA 4KR0B 3KLHB 2A3JA 3BGFA 2W9BA 4CLKA 5KAKA 4DSFA 4JI5J 3M6XA 3G86A 4ZPBA 3DC2A 2JFKA 4TU8A 4PG8A 2GAGC 2PFDA 3VZIA 1GMWD 1U2FA 4QWBA 5KT7A 1PGZA 2QT7A 3FZBA 2RQCA 1ZZNA 2I38A 3CMQA 1OQ6A 1S1TB 2KG1A 2FLNA 4NEYA 1RT2B 1NSPA 3ILOA 4W92B 2EBGA 2RKIB 2EVZA 4N8OA 1L5UA 2IMWP 2ZEJA 3UDLA 3FCHA 1XC9A 2E5JA 3MMCB 1TL3A 2G2ZA 4D3GA 2UP1A 1T11A 4IFYB 2YKQA 2BJEA 1SKRA 4ED6A 1BHNA 4X66J 4PKDB 1Q95G 1J5OA 1M5SA 1OO0B 2B4UA 2MSSA 4GO5X 2RB7A 2FB0A 1X4CA 3FEXB 4L74A 4OV1A 1XEZA 4J9KA 4CP5A 3T5KA 2M70A 1XK8A 3PIPQ 2O3DA 3FZ2A 2J8AA 5GMDA 3CPWR 2IA6A 3CJ8A 4K0KF 3EVMA 1H3DA 3QT6A 3O1LA 3EYZA 4PUOB 1NSKL 2DD8S 3BH7B 5KG7A 1WKLA 1ZA1B 2PMWA 4TY8B 4Q44A 4TU7A 1N36J 1WELA 4ZJQA 2ZH3A 4B3MF 3UR3C 2AJ1A 2BXJA 1NB2A 3MM7B 3DOLA 1IBLF 1UEVA 1EB0A 2GA7A 3IAM9 3EZ5A 3HHKA 3QMQA 4HTIA 3ZFVA 4DN9A 2EC2A 3VAKA 4A47A 2I0XA 1S59A 3HVRA 3TEGA 1N33J 1JLGA 3BB5A 4IH5A 1GX6A 2YX4A 4YB6A 1IKXB 3MMAB 4NXMF 2MGZA 2ZWPA 3IM8A 4NLRA 2UVRA 6AT1B 3QJLA 2YQ3A 3OL9A 1HR0F 4ZP9A 3PX4A 3A3NB 4BBYA 4AXJA 3CJ3A 1VLOA 5I3QA 2HRYA 2YTCA 3QZ8A 2NREA 2BKNA 4MYTA 4LF9F 5I42B 1WDTA 2RHQB 1N0UA 2MQOA 2K3IA 2ASYA 2B9XA 2LYVA 1NK0A 1IBLJ 3GIJA 1KD1T 4QZVB 5KFKA 3GIRA 2MKYA 2CPYA 4A4JA 4J7CA 3EUNA 5HATA 5DG7A 4IO9Q 4LVNP 3SCIE 4ALZA 4JOUA 2D69A 2XCAA 2MQNA 2VG7B 1QLNA 1ROFA 4C6AA 4G1PA 3T1HF 1QSSA 4PXEA 1FJEB 2VKZG 3JTOA 4X2BA 3LWMA 2HMIA 4Y34A 3KMQA 3RR8A 3MMBA 2B5JA 4CWBA 3BDPA 3IBWA 4GVBB 4QW8A 3I5BA 3HO1A 1EQ0A 1M1KT 1SJ4P 5A8RA 5GAEI 2ZWOA 3N6LA 1HBOB 4PWUA 5LSLA 2CDRB 2RT3A 3S1TA 3SI8A 3DHWC 2EG2A 1X7VA 2A6MA 2D74B 2DR6A 1IKXA 2OHDA 3DM2B 3MMAA 3CCMS 1S76D 4O0NA 5CYQB 1HKAA 4WFXA 3J7YU 4NLOA 5C25A 1LOUA 4U8YA 4KT0C 2LQJA 1TL1B 2CPEA 1UA0A 1U1LA 2VG7A 3K17A 5KFAA 2IRUA 2R7UA 3OHAA 5HVFA 3R9LA 3JS9A 3A3OB 4RW8A 1UETA 3K89A 4QIFA 1UPMB 2EXUA 4ZVFA 3RAMA 4X65F 4IKAA 3MXHP 1Q8IA 2W2QP 2G0JA 5B0EA 4JV5F 2FJAB 3PTWA 5H9EJ 4G3IA 2CZ9A 2HHQA 2EI5A 4AL7A 4K5SA 4O3SA 3NKYA 2J8SA 4RBVA 4UTGA 3SFGA 1R0CB 2QE5A 3TZWA 3GIKA 4LF6F 4LFCF 1VK3A 2F8HA 4FS1A 4LF5F 3HHNB 4P2SA 3QRPA 4C8YA 2KFZA 1HIYA 1RA7A 2DGQA 2WVFA 1LQ9A 1VCTA 2JLFA 5JVGQ 3ZO7A 1N32J 1WC5A 3G6YA 5IM0A 3PJ9A 2E5LJ 1S57A 2BA9A 1S6QA 2H5JB 2F40A 2J7WA 3TX8A 2OAUA 3KK3B 3PM9A 3D68A 2FVPA 2BOAA 2HWHA 3VVTA 2OMLA 4CYUA 3MM9B 1LNQA 3CCUS 3PW0A 1TK8A 3AFGA 2RKIA 3DLLQ 3WC2A 1PAEX 4EZ9A 4DS4A 2EFPA 2OPRB 5DGAA 2DIUA 4NLSA 3ITHA 2QZ8A 3CDBA 4ECXA 2HQDA 3TA1A 1N5TA 1N6QB 3L9ZA 1FXDA 5AE3A 2W01A 3N5BA 1DTQA 1DTTA 2ZHOA 1RT5A 2MXYA 3OLBA 4N76A 5K5MA 4M5IA 1S77D 2X1BA 5A6WA 4YP3A 1YIJS 3HULA 3PRVA 3UO0A 4DEZA 1U2RA 2JZ5A 3R5GA 2WSCC 1YJTA 1GT8A 3J7AN 1NK5A 2CQPA 4HACB 3THPA 5D3GB 1U6FA 3NBPA 3KLGA 4URSA 3WZ0A 1PCAA 3V81B 3SEOA 4DWIA 2ATCB 5DG8A 3FFIB 4DUYF 5HJXA 1I6JA 4M5DA 1N5YA 2CPHA 3P5TL 4MKAA 2V2ZA 1S49A 1FRLA 2L9DA 1N5SA 1CC8A 2YXLA 1WI6A 1Y3JA 4NLVA 4NWBA 5AJ3F 1FKAF 2AYGA 2RUSA 3G8QA 4MMOA 2GGPB 1X31C 2KO1A 2NUUG 1ZM9A 3KG0A 2VZ9A 3OQ2A 2IIHA 3NOCA 4ZPTR 1N8RT 1WNEA 2CQIA 2VBZA 3LPYA 1BUXA 1FXLA 4Y28C 1N36F 3CDUA 1VGYA 4NA2A 3NMAA 1RT4B 1RE1B 3OXGA 2ZVIA 1IKYA 1DAXA 3CB4A 5L38A 1YBUA 4K0KJ 2COLA 2VBWA 1WC3A 3VZHA 1RXOB 5KT4A 5DDRC 3KMSA 4N47A 1SL2A 1L3SA 2BEFA 1OY9A 2ZDPA 4OFZA 4OLPA 4HHHA 4DQPA 3R6LB 3FJ2A 1U1RA 2AJ4A 1HQUA 2XO6A 1TKXA 1X5PA 2AEFA 1X4AA 1FJGJ 1SI9A 2YKPA 4UY8T 4OZ5A 4WJBA 2YY3A 3M6VA 5DDOC 1VISA 2P5VA 1BQMB 4NI2A 5KG3A 3AT1B 4ZLLA 2YH1A 2XS5A 2AJQA 1PJ5A 1SB6A 2DBBA 4NXMJ 2VA2A 4TQSA 1YJUA 2POKA 3I96A 5D0EA 2NR0A 3LA0A 2MYFA 3K5PA 3U02A 4DV1J 1ZAVA 1LW0A 2CQBA 3AXKA 4JI6J 4CIOA 2KM8C 5D4NA 2LEBA 1EIYB 3FBBA 1N5QA 2BE9B 4C3MA 1ZYQA 2UU9J 4DL2A 2ZNZA 3JYTA 2OJ3A 4WYWA 2EC0A 5IFMA 5D0GA 4N8NA 3ZZZA 1VFJA 1S1WA 1UWBA 2CKWA 2WZ1A 3C6TA 3H98A 2H4WB 4PEOA 1VIOA 3Q24A 1VRQC 2PT0A 3OV7A 2VV5A 4P6QA 3PG9A 4CDIA 4NCBA 1NZ8A 2P9EA 2B7BB 2RILA 2QLJB 4LF6J 4F4XA 3DOMA 1MU2B 2PSZA 3PJWA 3CT9A 3I9V9 3MMJA 5D15A 2CNOB 3LTOA 4OHXA 4EFAC 3PJXA 4NXNJ 3LP2B 2BV3A 1RWUA 2VL1A 2RUGA 4K5RA 4UF4A 2A0FB 4JI3F 2OEJA 3G82A 4XAKA 3EDRB 1CPZA 1UL3A 1HW9A 5A76A 3I5CA 1IKWA 4F8RA 3FBEA 3PW5A 1XIQA 5GAEU 5F8GA 1NDPA 4R8UB 3QLHA 1MNEA 1G7CB 4NYZA 4QW9A 1QUPA 1T9XA 1NXIA 3GFYA 3FSXA 4XDDA 2YWKA 3I56S 4IOAQ 4JI3J 4ZPVR 1HI0P 1X8DA 3LH2S 2FQQB 1WHXA 1ZPWX 3V6KA 5B0GA 2XNQA 2PN6A 2OP5A 1PC4A 5LXYA 4J9NA 4NLDA 4YY3F 2V94A 2QYCA 4Q5VA 3OSPA 2LEAA 2KT5A 2BRLA 1HFEL 1Z1ZA 3UI3A 2M0GB 5LXRA 4CT8A 1VQYA 4DR7J 2ZC4A 3MEGB 3DOKB 5KFHA 3L7OA 4P74A 1XMBA 2I6WA 4FYYB 1LK7A 3AODA 2DGWA 3KJQB 3OTEA 3E8OA 3HVTB 3MM5B 5A0YA 4ZCIA 1ZAWA 4DV7J 1FEEA 4M94A 4CNYA 2NCKL 2CZVC 2V63A 1JKHB 2ZD1B 3BGRA 4ICLA 1VQ4S 1T0TV 5EUHA 1JLQA 3PYEA 2D3OR 2XGQA 1H74A 1KLNA 2J6TA 1G2EA 2HS0A 3MPYA 3UD5A 3AJ1A 1B0TA 5B0FA 4LFCJ 1MN7A 3D3CJ 3WQPA 1DQ8A 3C66A 2P9CA 3PYFA 3KK3A 2E5GA 4QIEA 2ROPA 1VK8A 3PDNA 2VOOA 1EHWA 4B9TA 3BKUA 1EETB 4HHJA 5CZXA 4DQSA 4ELVA 2VBYA 3N79A 3I0SB 1TZ0A 4UT4A 2AYMA 4KHMA 3UFCX 1RB0A 2VPZB 2GC8A 1APSA 2QN6B 4NEZA 1PYSB 4LR7A 3J7Z5 3LGNA 2MKKA 2HFOA 1FD2A 1FWLA 4JI4F 3PHEA 3D66A 1CQNA 5HQLA 2DXFA 4P2XA 3OW2R 4FXDA 1RAJA 1CS4B 1YHQS 2YNIB 4WE1A 3LPEA 5ETNA 2R8HA 4H4KC 2VC0A 4YB1P 4EK2A 4JI1F 4DV7F 4RW7A 2FZKB 4HEA9 1T9UA 4OYMA 4IYQA 2RU3A 4E98A 3BBCA 1FWKA 4FXWA 3NGTA 4NRTA 5SZTA 3NBPB 3Q22A 3MTKA 1DFDA 2B8PA 2NXCA 2R3VA 1FFSB 2IVYA 1C1CA 4DBQA 3JAMY 4X4OA 4YDDB 2E1AA 2IBKA 1NPRA 2MZTA 2OO4A 4DV3F 3FMWA 4MKBA 1R0BG 3L7PA 3IR5B 4EO8A 4DJBA 1TV6A 1VC5A 1EZZB 3UVJB 2JHEA 1RKJA 2FC8A 3AXMA 2D3O1 4GRSA 4ZIVA 1WSVA 1C0TA 2XMJA 3R8YA 4ATNA 4UQGA 2F8MA 4DU8A 4B9SA 3MECA 1SBRA 2HVZA 4USMA 4IQMA 4G1IA 1TL1A 1UJ5A 2MZQA 3CCZA 3GJQB 3M2VB 5T7LB 2CUYA 3WX8A 4XDCA 3ILJA 3LP1A 1F60B 2CFXA 2MKHA 3FCWA 2KHCA 4MK9A 5BXIA 4QYZK 2WVBA 2H5EA 1TL5A 4JV2A 4H4MB 1C4CA 1UEKA 2HBZB 4ZMMA 4WU3A 1SJ1A 5SUHA 4B9NA 2M3DA 4LR8A 1TL7A 3CXCR 2N3OA 4DV4F 1JXEA 4B9UA 4PUOA 4J9UE 4RW9B 2YPZA 2YNIA 2Q43A 1KKHA 3M30A 4KKOA 4WE1B 4CM0A 1OPZA 5A8KB 3GR1A 2KXNB 1FFWB 3C3LA 1VDHA 2IAJA 2RRNA 4FPIA 5L39A 4JYAJ 2E7VA 2LKZA 3IM9A 2GMJA 1RU2A 1Z4UA 2Z2YB 5GAHI 4DSEA 4DR1F 1FRJA 2IRYA 3T1HJ 5L9XA 1U6ZA 3DLEB 1VHFA 4NYOA 2ILZA 3GSIA 2JEJA 4OV6A 5KFPA 4CT9A 1PJ6A 2FJEB 1TAQA 2BE2A 3MMCA 2JJ4D 4ID5A 3A8KA 2XG8A 1U8WA 1PYTA 1YJ7A 1NDKA 2F3JA 3M2VA 1PKUA 7FD1A 2E29A 1IKVB 4DFPA 4NYPA 4ANCA 2JRSA 3MPWA 1FKOB 1UCNA 4KH0B 4MIBA 2MZ1A 1YK9A 4PQAA 2I9SA 1C0TB 5KFBA 1F6TA 1LWEA 2WVCA 4M5KA 2OFHX 2OFGX 2PEHA 1D3WA 1IR1A 1FO1A 2XMTA 3BKTA 2RHSB 4A8YA 1DLOA 2PMHA 1RTJB 2BANB 1YKWA 2KZMA 3GQCA 1WF0A 4RX6A 1WJ9A 3DRYA 4RW4A 3EX7B 2CXEA 3EICA 1UJ4A 2KRRA 2QFJA 1R0AB 4JI0J 1JLBB 2IC3A 3QIPA 3PVXA 3K7RA 4GKJJ 1CEZA 4X64J 1LWXA 1TP7A 4IOBA 1RWVB 2Y3YA 2WONB 3R5JB 2HFUA 4L76A 4JBCA 3M1VB 3TYTA 5KFLA 3WX4A 1SKWA 3GILA 1V3ZA 3R5AA 2DY1A 3DRSB 4GC6A 2HMIB 2AWZA 2CNNB 4B3RF 5J2NB 1JJ4A 1FDAA 3CTRA 1EJ7L 1Q53A 4WFZA 5L9NA 1XMQF 4ZPWR 4F3OA 4JI2J 1VC6A 4HH1A 3JQKA 1EKSA 2YNFB 4TY8A 2C3YA 3FDSA 3HHLC 4ED7A 2H3EB 3A8JA 3GV5B 1EX8A 1RT3B 2J5AA 2JFDA 1NSQA 3AD7C 2CWKA 3BO4A 1MROB 1B70B 1TKZB 3C16A 4I1TA 2EK1A 2CRLA 5L1JA 3CWJA 3KJVB 2C2KB 1U0HA 1Y7PA 1O8BA 5B0AA 2ZH6A 2NQPA 2EKYA 2Z57B 4NA3A 1QSLA 5EX0A 4YB5A 4OMFG 2MJNA 4F36A 1U45A 3FK4A 3OR2B 5KFJA 2L08A 4DS5A 4UOHA 4DCPB 1P1LA 4JI1J 5J2MA 3HKZD 1DLOB 1OY6A 3CE8A 5B0CA 4MTPA 4ZP8A 2G4BA 3UQSA 4B3RJ 2Y0SD 2UVWA 1B64A 2GHVC 4DR4J 2CJ9A 2DGSA 2HBQB 5E7OB 3J7ZT 2UXDF 2XS7A 2LP4A 2CJAA 2Q1LA 2QX0A 3M8QA 2QSFA 2IDLA 3HZGA 1KWMA 3FGVA 2BM0A 4OZ0A 5D77A 3PW4A 2X3GA 3A8EA 4LSNB 3PKYA 3HJFA 3QO9B 4OZ2A 3F41A 5AE1A 1HBOA 2E7WA 2NSCA 3ZXWA 2B4PA 3MUVP 3E2EA 1HD1A 1RBLA 1HBNB 2CPXA 5KT2A 1FRIA 2LQBA 4OYOA 1JX4A 2Q79A 1T7PA 4MK8A 2Z0GA 1FA0A 3HHLD 3M9MB 2XY7A 2F4VJ 1ULRA 4CRJA 1GMUA 4DFKA 4DZDA 1YDLA 5B0BA 5HO4A 4NCGB 3D0HE 4ED8A 4DR3F 3ET6B 2CPDA 4QPTA 1LXJA 1X4DA 1RADB 2WOMB 2EFQA 2V8GA 2DISA 5K8NA 5LJ3Y 4OI4A 4DSLA 3Q23A 1S9GA 3AHPA 2AGQA 2Z8QA 3EXYA 1A6LA 3QSIA 4ILRA 4LRBA 4B17A 1TR0A 3RB0A 3K5MA 1Q5VA 2DNQA 5FDLB 3JAMU 3W3SA 5LT5A 3QZ7A 4DV6F 1RCOB 4HT5A 1XNRF 4A8SA 2DNOA 1TK0A 2BMBA 2OGUA 4KV8A 1OS5A 2YWGA 4F4ZA 4PYAA 5K9FA 3UCGA 3NMRA 3CJKA 3NL0A 3QO9A 5KFEA 1VLYA 2OLWA 1C0UA 3MF5A 1C2PA 1ICEB 1U7LA 4TLQA 1LXNA 2C3OA 2V9KA 3KLIB 2ZJQQ 4M5LA 2UUCF 3HFKA 4DR5F 1HWIA 4CLFA 3DMJB 2C22A 4OI6A 5K14B 3FUYA 4HL9A 2GO9A 4PG6A 3CJRA 3ELHA 4H54A 2LU1A 2F1FA 2E9TA 1H72C 2DNNA 2E5IA 3VAIA 4C8ZA 1L3UA 4PWDB 4MH8A 2IPOB 2HHXA 4QYZJ 3RBEA 2ZOFA 1TKDA 4X4QA 1HNXF 2ADCA 2IY5B 4I67A 4RNHA 1YI2S 2UUBF 1QE1A 3DGPA 3DI6B 3H5SA 3DXBA 4HDGA 5ETTA 3RTVA 2W7OA 2FIUA 1JLEB 5HN0A 3OL6A 4ED5A 1AZSA 5L8RC 1BMQB 3GCXP 2ZE2B 2XLIA 4LF8F 1VQ9S 2AD9A 3A8IA 3DMJA 4JI7J 1IM6A 3IWNC 5IQ6A 3SSQA 2F8EX 3K57A 2I1RA 3Q8VA 4GMKA 2A1BA 2BM1A 1B4SA 2ZE2A 3KOAA 2ERRA 3OSNA 2HRTA 1F5CA 1B7YB 3BO2A 2CPZA 2LMIA 3ETMA 5D0RA 1BXNA 2WCXA 3BPSP 3BYPA 2QGFB 3N28A 4FP9A 2IVFB 3E01B 3A4TA 3PHTA 3EDQB 2N4CA 4G1QB 4HVZA 1W2BR 4M1KA 4ZLPA 3AA8A 1KLMB 1YLXA 1YRTA 1HQEB 1QAJA 1IBMF 4V19J 2BACA 3O6QA 5BR8J 2Q6CA 4NLUA 3IRXB 3NXZA 2ZBPA 4PWDA 4ZIWA 1RQ0A 4LF8J 1WC6A 3OTOJ 4DL6A 4QBUA 4DR6J 1WEZA 3GG0A 1VJWA 3CCVS 5THWA 1WKJA 2ZKUA 1NMEB 4ILMA 3K5LA 4ID5B 2GCFA 1VC0A 4NLPA 2BDPA 3GCWP 1VRUB 3OFHA 3F56A 3HP6A 3G6VA 5F8LA 2V2KA 4HACA 3QBCA 5KG4A 4BLGA 1RAEB 1KOOA 1RWWB 3H42A 2ZH1A 4M5NA 5CYMB 4X4RA 2IMOA 3HXMA 3OFFA 1K0TA 1N34J 3MEEA 3CEDA 4WKRA 1K1QA 2ROGA 1S9FA 2MB0B 1P9QC 3NS6A 1NJZA 2DH8A 4ELTA 2FGOA 2HS4A 3JQMA 3KFWX 1BQNB 4NZ6A 1HBNA 2QSWA 1XR6A 2GMHA 4YUDA 2HHWA 2FHMA 2JC1A 5IT9Y 1KVIA 3QWUA 3V6DB 3MOJB 2UVVA 3ZTRA 2B56A 2YKMA 1R0AA 3IWXA 3I0RB 3LUYA 1GXUA 1HBUB 1N0VC 2VPXB 1LWEB 4HLBA 2MGZB 1HNIA 2WSEC 4YDXA 3PFEA 1AYEA 2JWNA 3FNNA 5CQGA 4C3KA 2HFZA 3D4JA 4Q8EA 3SV3A 2NZCA 4F4AA 3MM7A 1S97A 4LR9A 2ZZMA 4JI5F 2GIQA 2IJFA 3OL8A 4JP8A 4PG7A 1WOPA 3TVKA 3W1YC 2R4FA 3CC2S 1JLAB 2CQ4A 3RB4A 2CWXA 5ETMA 2DNZA 1BLUA 1RZMA 4DPOA 2ZJRQ 4FBUA 3C6UB 3H5XA 3DLKB 2CVEA 2HGMA 1CJTA 1D1UA 4QYRA 4ANEA 1SQEA 4C0OC 2DHHA 2BJ3A 3QGGA 3Q8UA 1S0NA 2HQGA 2W24A 2JL9A 2YKAA 2WW8A 1CJKB 3C15A 1BE4A 1D8ZA 2QLXA 2M7SA 1FHTA 1WOOA 5HMWA 5HL7Q 2NXEA 4J9VA 3GYGA 2SXLA 2QA4G 3NLCA 1JNZB 2BKPA 1U8SA 2OMOA 4WTYA 1FI4A 4IH7A 2CQ1A 2EW9A 1TVRB 1RAGB 3DYAB 4ZVOB 3UNYA 3AOBA 3TWZA 4Q45A 2OPQB 3G4SS 2L48A 2YWFA 3MD1A 5CYQA 3LGHA 1HNIB 4MIAA 1ZM3A 3W66A 2J0XA 2HZAA 2BW7A 3OD2A 1W2IA 3UWTA 3DOKA 1VQ5S 1KHVA 2NLWA 2VQFJ 1ZTWA 1IJEB 1FERA 2DH9A 3HPOA 4FYDA 4I2PA 2KTQA 1JJ2R 3DLJA 3NGUA 5G0RB 5LMUF 2CG8A 2VUGA 2HBRB 4GVBA 4WIIA 3N9UC 3UDEA 3BV8A 3BN4A 3TI0A 4NPOA 2P6SA 5HVGA 1TAUA 5FDLA 1TUVA 1X0PA 1RI7A 2HVDA 3PY8A 4XK8C 4IO1A 3QT7A 4YR0A 3KDOA 2IA0A 5HJYA 4TYBA 4ED1A 1Q81T 1K73T 2BE7D 2KXFA 1H7XA 1S9EB 3MM8B 2DNMA 2HHPA 5DJBA 5DO2A 3DKDA 2E1RA 2C2OB 1U47A 1HYSA 5A0YB 2WOMA 4AT1B 3UPFA 2HWTA 3T19A 3TAPA 3JSMA 2CZ4A 4AL6A 5D3GA 2KYXA 1OIAA 2M4MA 3ISND 3QLHB 4Y6IA 2E1CA 1XTZA 1R6VA 1FDDA 1I94J 2KU7A 2QLFB 2YWHA 5A2QU 1F3VA 1GX5A 2G0CA 3B78A 3WIVA 1FCAA 4UW2A 2ZHAA 5F9NA 3A3PB 3ZZOA 4ZN3A 2ZM6J 4G1QA 4PR6A 1V5VA 3R27A 4TN2A 4KV8B 1ZM2A 2VB6A 4CQ1A 1FRMA 1J5EJ 2XBPA 4F25A 3CD7A 3RR7A 1YRUA 2FJXA 3LALA 4ZCLA 2X1FA 3TANA 4C3LA 4WU2A 1E6YB 1F5BA 1KNZA 3CCSS 5BJRA 4ECRA 4YY3J 2UXCJ 1RHQB 1R8CA 2OD6A 2DRDA 1NO8A 1DARA 1RK8A 2WRMA 2ZZTA 4KGZB 4DUTA 3M9NB 3R7BB 1U1KA 2BQ3A 1L3TA 1PJ7A 3DRPB 3OTDA 5K20B 4ERDA 1XMQJ 1HARA 1VBZA 2CQHA 1S48A 2YKNB 1FKPB 1WHYA 2XSJA 1FNMA 5AXLA 2HFNA 2VKRA 5F41A 1XNQJ 1C1CB 4U96A 2V4RA 3KDNA 4WYLA 3AD9C 3VF0B 3IAS9 1HHSA 1N48A 2YKNA 2L9NA 3BSAA 2GX8A 4FNHA 4S0MA 3D7SB 2W8LA 1X9SA 3LOUA 4ZVGA 1RABB 1BQXA 2CYYA 4C8NA 2WBMA 2KM8B 4C8OA 1RISA 1M5KC 3CVKA 5DS7A 3UDCA 3I87A 4MYUA 3EVOA 3R7NB 1JXLA 1KQSR 2E9ZA 4CLZA 2DGUA 1RA6A 1Q16B 1SCJB 2PC6A 1UTAA 2QG9B 2VICA 2U2FA 1SJ3P 1AZSB 3MCSA 4JV5J 2LDIA 1NJIT 2AKWB 2YWWA 3QT5A 3THTA 4YQWA 3GTYX 3FSYA 1X60A 1S7IA 1NLKL 2ZBCA 3UVJA 3TW0A 4ED0A 3GP9A 3ZTOA 1N32F 2APOA 3H59A 2W9AA 1FWPA 3MEEB 3VAHA 3QJPA 4K4XA 1GAOA 2KHDA 3TQEA 2CJYB 1SL1A 1KFDA 3MM9A 5HMYA 2JNJA 2NXJA 4F3QA 4FN5A 4OX7A 4CO4A 2HHHJ 2OIHA 2QLBB 4IG3B 3MUMP 4E2FB 1SV5A 2DHXA 3JYTB 1P8GA 1RT4A 2XMKA 3BEGB 3AOAA 3BREA 2R7WA 4N56A 2DEJA 2W7AA 1RHJB 5I3PA 1Q78A 1RTDA 4GKKF 3GG1A 4QIGA 2MKJA 2RQ4A 1Y11A 5IWAJ 2LXUA 4USUA 4DZ6A 2NYHA 2DNLA 1VS3A 4YFUA 1UP1A 1SJQA 2OEKA 1T3OA 3A1YG 1R8PA 5CA5A 4FVMA 4UUXA 4X62J 4CTAA 1P1TA 4F4YA 4LF4F 4LSNA 1MG7A 4EBDA 4RUCA 2F9DA 1C1BB 1REGX 2QTWA 4LBPA 4P71A 2ZITA 5AXNA 4W4MA 2ZVSA 3D5MA 4K59A 4K8RA 4N77A 2F65A 1RTIB 5F8IA 1VQMS 4CH7A 4FF4A 3ICLA 1M5HA 4L3NA 2DB1A 2PEBA 2OPSB 3JXOA 5A8WA 4I68A 4QPXA 4DL5A 1RAOA 2FJWA 1X4EA 3GYNA 5T7LA 1XR7A 4L73A 2HW3A 4WZMA 1Y9OA 2Y1JA 3ETOA 1RTIA 2BJ9A 2AQ4A 1LK5A 5C5JA 3QRQA 5D8HB 1URRA 2VC1A 4Z37A 4K4VA 3TR5A 4NLTA 3IMQJ 3M2RB 4PXDA 2PE8A 3TJAA 3BR8A 2E1MC 2HSEB 1ELOA 3TZXA 3NNAA 1WG4A 3CJTA 4IDKB 3K8WA 3T5LA 3IFEA 2J76E 4I69A 5A2QY 3SZ2A 3MWBA 1GEHA 1UW9A 4G65A 4MK7A 4ZVHA 2JSXA 1KC8T 4LSLA 3EJMA 1DHMA 1ZA2B 2ATLA 2N3LA 2OD4A 4C0HA 4LRDA 1R8AA 4JV0A 5J2NA 1K47A 2H5IB 2P9GA 1VQ7S 1YJWS 4JB8B 4M63A 1SVDA 4WP9A 3CUNA 2DYAA 4DX6A 1N54B 4DF4A 1B0PA 4HKQA 4HR2A 4WIQA 1R6YA 3NNHA 5CD4H 2ZC3A 4KPCA 4YN3B 5LSOA 2ASLA 1FXRA 2KDOA 1AFJA 4OX8A 4CH1A 1HLWA 2QIFA 4KGVB 4BC9A 2LECA 1S10A 3C2PA 4DL0C 2Z2MA 2MDAA 5AJ3J 4B3MJ 1ITPA 3CGIA 3PW7A 2CQ3A 4PG5A 2WVDA 3AJDA 1RACB 4OYWA 2DRAA 2IRXA 1MU2A 4I2PB 1KFSA 1KBRA 5EDWA 2V4JA 1Y5IB 3O8WA 1M1GA 2DPIA 4X4VA 3KUGA 2R8KA 2MQMA 4P9SA 5E0OA 3AOCA 3SQOP 2R2TA 1BWEA 1WG1A 2DRBA 1WC1A 2CQGA 2WTFA 5KFTA 1Z2LA 1TELA 2VU5A 4HYKA 3SFUA 1O5JA 2J9DE 2QMXA 1JLQB 2MY7A 3OXLA 5IC6B 5DQIA 2VA3A 2D1CA 1T9TA 4KB7A 2AF6A 3FQKA 2VQFF 2MZSA 1A7GE 1JLEA 3B8HA 3GFHA 2DK2A 3IGNA 1T3NA 4RO0A 4IQXA 2V34A 4ES1A 2E66A 4F4WA 3THVA 3ADAC 4RUHA 1WACA 1VQLS 2B5JB 1K9MT 3UDVA 1ZZFA 4CO3A 2L3MA 4IR1A 1L3KA 1WSRA 3KJVA 2CPIA 3TRGA 1IWGA 3H5YA 3W5XA 3TUJC 3M8PA 2FHJD 2MHNA 2KN4A 1FDBA 2BBEA 3AD8C 3E3XA 2FHKA 3TP2A 4Q0BB 2BQRA 1P9YA 4YMEA 1S1UA 3HMJG 4AYBD 2OSRA 1TKXB 2PA3A 4F3MA 3Q8PB 4MKYA 2Y8YA 4K7QA 5KFMA 2J9DA 3KHLA 2ZKTA 2VFSA 3KLIA 2HQ3A 2PA8D 3MZIA 2QA4S 4ECSA 3TARA 2V0NA 5KG5A 3KJNB 2R7VA 1YQHA 4OYBA 3MECB 4ICLB 5K8PA 1TFYA 1HWKA 3RBXA 3CO9A 2UV8A 5B08A 2PI4A 1GXLA 4RBUA 4WBFA 5DGBA 3OJSA 2EFVA 4DR3J 1FT8A 2DO4A 1KSPA 1SIZA 3MPVA 3NS5A 4PYDA 4BWMA 3K8VA 4NOHA 1F2HA 2RAQA 2WK4A 3DHXA 4O3RA 3GMGA 3RG6A 4RNFA 5L46A 4IG0B 3CJ4A 1IBMJ 2NPFA 4USTA 1CBKA 5A8KA 3NWRA 2VHGA 2D3UA 2ILYA 1Q86T 2ZNYA 1GXTA 5HLFB 4M5GA 4RWXA 3JSBA 2RS8A 2CQCA 1SPBP 2RQKA 3MR6A 2D9PA 3W63A 1YITS 3LP1B 4WTOB 4YR2A 3HM9A 4EZ6A 5KFGA 4Q2LA 3KLFB 2GVDB 4Y65A 1WD6A 1TL4A 3NG8A 3VAMA 1NK6A 2HHTA 1N34F 3M2UB 4DR4F 3IRXA 4FVCA 1CJVB 3MGJA 3H20A 5BYRA 3UR0A 5AE2A 4ZITA 2DITA 4MT1A 5KFWA 4WK3A 3LQVA 5GAGI 3NGSA 2FLPA 3ISNC 4B3OA 3CCJS 1F9HA 3CIZA 4X62F 1TK5A 1RAIB 5CXTA 5F8MA 4QU6A 1IWAA 2HGLA 4ZPAA 3IR7B 2CQ0A 3NGRA 2XWYA 4DOZA 5E33A 2RE1A 3QT8A 1HNXJ 1KVJA 3V5RA 2D7SA 3ITHB 1RKIA 2E44A 4BCAA 4E8UA 1DQAA 2YX1A 2Z56B 4ZPCA 1FE4A 3DRRB 1YJ9S 1VYAA 4FDFA 2BJ7A 3NOGA 3P8BB 4DX8H 3GJTB 1O51A 2CNLB 4WXWA 1Y3KA 1CJKA 3C15B 4NZ0A 5DRKA 4C97A 4WFAQ 1QTNB 4ETZA 4PG4A 2V68A 2FVQA 3BYRA 4QJVA 3AAWB 4ZKAA 1MMNA 1W7WA 1K0VA 2PD1A 2C3PA 2AMCB 1CJVA 3SCJE 4BC7A 3W9JA 2H1YA 2JLEA 4PXCA 3OLAA 3TZYA 5GMEA 1FTRA 2JLGA 1U6BA 3M8SA 2R7QA 4DQIA 7AT1B 4OL8A 3KLFA 1SUQB 2ALYB 3HK2A 4IH6A 1O0PA 2MEWA 1N5YB 2I2YA 1RT1A 1HWUA 1QVFR 2ZOMA 2M88A 3MFIA 3H7HB 1WOSA 1KP6A 1H7WA 1FRHA 2LU2A 3GJRB 4I7FA 2NUHA 3RYLA 3V4IA 3MEDA 5B7WA 1Q79A 3KUHA 4OI0A 3SXLA 2ZH9A 2XULA 4UOFA 3ENAA 4J9PA 1T94A 1RT2A 4LFBJ 2GNKA 3P6YC 3HFVA 1D8YA 2F63A 3H90A 3PR4A 2VIHA 1Q82T 1C1BA 2R7OA 1IKWB 3IG1A 3LF0A 4NL5A 5KFNA 2P2CB 1RT6B 3BKFA 3EGNA 1FTCA 4ES2A 2XLJA 1DZ5A 2D9OA 1XWLA 1BQNA 2W2PP 1VI7A 4LBHA 4ECTA 3HI9A 1NK7A 1XMOF 1RTJA 2BANA 2RJZA 1S6PB 4CLLA 1RT6A 2LCWA 2AYBA 4RR5A 4H4OB 3EPGA 1G6BA 3C16B 4M5JA 1W26A 1RP5A 4M8LA 4L3KA 2ZHBA 1KONA 5G4DA 4FYVB 4ECUA 1TFWA 4ZVSB 1WI8A 1NPKA 3FBFA 2LLZA 3BJYA 1KTQA 3GIMA 2M8HA 2CG4A 4RU9A 3HSZA 2DNKA 3KK2B 1I3OB 5F0UA 2VPYB 2LFVA 2RNEA 4QWCA 5HANA 3W8PA 3W2WB 1S6OA 5EGYA 4HHUA 1PG5B 2A10A 2RMLA 4RZRA 1J5OB 2VJVA 2AEMA 2HNDB 5D4PA 3GFZA 2VASA 3H0PA 1CG2A 2M5YA 8AT1B 3Q2TC 3RRKA 3M8RA 3SDEB 1HL6A 5KG1A 2F4FA 1S5ZA 3Q8SB 2DVIA 4V1Ak 5IQQA 1JLAA 1YZ7A 4LQ3A 3P96A 3PIOQ 5CHCB 1SKUB 3JSRA 2MLZA 3U7JA 4U7UK 1VQ8S 3L3CA 3TUPA 4DR6F 1N88A 2B9EA 3BR9A 4MKVA 1VOMA 1HQUB 2HHVA 3KYLA 2NXUA 3T41A 9RUBA 3GIIA 2DXDA 5EX3A 4YEAA 3NGKA 3NS7B 4EWTA 3JTNA 4CO0A 2HAFA 3HVWA 3QAEA 4PQUA 5D6GA 3KLHA 4AFFA 1JLFA 1AFIA 4J37A 5C24A 1H38A 3FVYA 1IQZA 2BABA 4K4TA 4ECZA 2M2BA 3U27A 3G6XA 3CCRS 4EGLA 3I55S 2DNGA 2J7UA 2I8EA 1R8HA 2V2QA 2NS1B 3IWLA 5EN1A 4Y2MA 5HROA 1GMWA 3OUYA 3U1NA 1IM4A 5D4OA 3D0GE 4C7QA 2VPWB 2Z4PA 2EFNA 2R2RA 1B7FA 2ZBQA 2FVRA 4ENOA 2AEJA 5LM7E 1ZM4A 4KIAA 3BBFA 2AIRB 2VFRA 1KQKA 2PMZD 4LF4J 3C14B 3IS9A 3ZTSA 3L4BC 3J81Y 2UUBJ 5E3CA 4Q7AA 5K14A 1Q0NA 3VHQA 3LANA 4PABA 1SKSA 2F9JA 4P72A 4FF2A 5I42A 1NHUA 2XC9A 2A2DA 5KFVA 5M2RA 4LF2A 2HFSA 4OZ3A 1UVMA 3A12A 3HZEA 3T1AA 1UJ6A 1PSDA 2ZH5A 2C2NA 1F9FA 4EBEA 2AT1B 2WONA 1QSYA 1U1MA 1DTQB 1FDNA 4OX9F 4ZOSA 5GMKa 3CD6S 2R42A 3EMTA 2DGOA 3R1HA 1BGXT 2Z2LA 1NJXA 2ROEA 4LFAF 3CSKA 4L6V3 2DHSA 3R5BA 3Q8RB 5KFCA 1X0FA 2OH2A 3HHLA 1REVA 2VQEJ 5ETOA 1NAQA 3PCOB 4DV2F 4G6VB 4Y2IA 2H51B 4U9RA 5KG6A 2XI2A 3K59A 1Q7LB 3L95X 3DN9A 5KT3A 3PO4A 3MEDB 1T9WA 2D41A 1S1UB 5H1SV 1X4BA 4DN0A 1S9EA 5E2QA 2N7CA 4WKYA 2QA1A 3J7YI 3DI6A 3FMBA 2GQCA 5ETKA 3VALA 4J9QA 1IBKF 4LT6A 1S1VA 5EWGA 1AB8A 4WFNQ 2BQUA 1H98A 4OHZA 4DV6J 2GZOA 1JIHA 2LQ8A 1L3VA 4DV2J 1UVIA 4GO7X 3ULHA 5CCMA 1WC0A 3HX9A 4I0WA 1HMVA 2B0GA 2GS8A 4OI1A 3PEJA 3MAHA 1WUUA 2ZH2A 5J2QB 1QVGR 5KFRA 4AQYF 2CQ2A 2NXNA 1OWXA 3H25A 2LQ5A 2MLYA 3B82A 4KQZA 4LQ9A 2FJVA 5T41A 1U1OA 3CCES 1LWCA 2XHCA 3D6HB 3EZOA 2HIYA 5L1KA 3D1QA 3MFHA 1A9NB 1VMBA 2VBXA 2BJDA 4NLWA 4ANDA 4C48A 2G0IA 3QIDA 1CS4A 4HI1A 4KGMA 3VV2B 2UVUA 2XMAA 2DGVA 2B8QA 2XS2A 2GJFA 2HVEA 3I0RA
chains in the Genus database with same CATH topology
3T6JA 2FVCA 2EG1A 1LFPA 5J2MB 2ABYA 3H4BA 4Z2XA 1ZTTA 3K5OA 4ZA1A 4WXOA 4CTAB 3DDNA 4DSIA 2V5HG 2V4QA 3WC0A 4ZCKA 1HWLA 2FUG9 4NZ7A 3OR1A 2LQ9A 4KBIA 2XO7A 1V3RA 1X5TA 3VCDA 2B51A 1RTDB 2RRBA 4KC5A 2CQDA 2CVIA 1GQEA 2ZH8A 1CSJA 2C3UA 1MROA 1TKZA 1S9GB 2DH7A 2NSBA 4OZLA 4RW7B 3MR3A 2MZJA 4P7VA 3I9ZA 4KHPF 2MQLA 4LIRA 4RUAA 5DDQC 5K8OA 3KG1A 4ZDNA 1KRPA 2HWIA 4ILLA 1Y0HA 2GO8A 1SL0A 1SJFA 2R8GA 3VWSA 3WBZA 4DG1A 5HP1B 1UMJA 2IM2A 1J5EF 4BHQA 4E0DA 2KI2A 3EGWB 4NLXA 1HBMA 1T02A 2RRAA 2MSTA 3M2RA 4C98A 4NA1A 4QR1A 4CO5A 5M2UA 4LVOP 3CCTA 2MQPA 2GJ2A 5DQGA 3GZ7A 1K1SA 4FBTA 4FF1A 3S8SA 4ZCMA 2JH3A 1U24A 2DNYA 4ED2A 3DLGA 1RTHB 1N52B 2GFFA 3NCPA 5A6PA 3G6ES 3PV8A 1CLFA 4O0IA 2UUAF 1AXQA 3MI7X 1OSCA 1AUDA 3M6UA 2HAIA 4FS2A 3VQSA 3CCQS 1U4BA 1PO6A 2KG0A 4UY85 2KXHA 3I31A 2HNDA 3S6EA 4RW6A 3BQ2A 2JX2A 1HW8A 4V19X 4JI7F 3CCLS 1JLFB 2XMMA 2PGCA 3CIMA 2QO3A 3WDOA 3DU5A 2DGXA 4Y3CA 3IXQA 3POTA 3CF5Q 3DOLB 1XR5A 4OJGA 2V8DA 4A48A 4RNNA 2VFTA 1LW0B 4CNZA 5HMXA 5D4LA 4EO6A 2K7KA 4XIUA 4F02A 5HBMA 4DF8A 4AL5A 1U26A 4MFBA 2FLOA 3PACA 3LP2A 2M8DB 3AQOA 1OSDA 4MIWA 3LP0A 2MQQA 3CMAS 4F4WA 1HPZB 2LA4A 4X84A 2GJIA 3N6NA 4X4NA 5F8JA 3DDKA 3TVZA 3X1LB 3GSDA 3ENQA 1JJHA 4TNOA 3T1HF 1S4FA 3HHEA 1S7HA 2OPPA 3GB0A 5KFUA 1P27B 4LUBA 2MY8A 3FEZA 2FY1A 4DQQA 5AXKA 2AJFE 2B4VA 4RU2A 1VRUA 5D78A 3TO8A 2HGNA 2MZRA 4AXIA 3G8SA 3UD4P 3HVTA 3MM5A 3I5AA 5JVHQ 5HQ8A 4BWJA 2LVWA 4R25A 1N4LA 1FJGF 5HROB 3HF5A 1JB0C 2IHR1 4NLYA 2F7VA 3T5HA 1UVKA 3N6MA 4EYHB 3MDFA 1NK9A 3KHGA 1LKZA 1H6KX 4ECWA 1SXLA 5AXMA 4O4GB 2VG6B 3FSIA 1VBYA 2FC9A 5DLGA 2UU9F 3KNGA 1EP4B 1VBXA 4C11A 4KFBA 4DV1F 3KLEB 1ZPVA 1F5AA 2DNHA 5EWEA 2CJBA 4A8FA 3OVBA 3NCQA 4F4KA 4TLRA 1E6YA 3NNCA 1G3OA 4WFBQ 3G71S 5FJ4A 4Y00A 3HT3A 3UE2A 2YNHA 3SYZA 4B3OB 1R8BA 4KE5A 2K3KA 5F3TA 5A8RB 5J2PB 4I6AA 3KK1A 3RB3A 2B4OA 3QGHA 3RRGA 4DL3A 2MPUA 3SV4A 2UXCF 1LFWA 5EWFA 4ELUA 2XGPA 2K7JA 1V6HA 4F67A 2IFXA 5I4MA 3R5CA 4KTQA 2FJBB 1LWCB 2NYIA 3NAIA 4BS2A 4LIWA 1VRTB 3AH6A 1VQSA 1IJFB 1IQTA 3J80Y 2CPFA 1DRZA 1XN9A 1U1PA 2CDQA 3I6PA 3HKWA 2CJQA 3MR5A 2DJWA 2CPJA 3ZZ0A 3KNAA 3IA0A 4USHA 1RT5B 6FDRA 3MR2A 4IRDA 1D0EA 3IC1A 2R7SA 3PNIA 2DR8A 1URNA 5KFOA 1JLGB 4C0BA 5E5NA 2K1RA 4A46A 3UCUP 2R7XA 4USJC 4A8OA 3H5UA 2KVIA 3MAQA 5DM6Q 4QR2A 4KJIA 3CJ0A 1HNVA 1JMTA 1FK9B 1UEUA 4LSLB 5KG2A 5GAHU 3DLHA 1NKCA 4YOEA 1AW0A 4IRKA 2J0QD 5B0DA 1HQEA 5B09A 4DUZF 1PC5A 3N5FA 3OPKA 4OZNA 5KFDA 3MTJA 3R5DA 3G96A 4KGKA 2R2UA 1JLCA 2W9CA 3W7BA 1Y4ZB 4EU0A 1MW7A 1H2VZ 3FEYB 2V9WA 3F73A 4RW4B 1OPIA 2DO0A 2RF2B 2LA6A 4AE5A 3SQGB 2E5LF 5IXUA 1QY7A 5LMNF 2KFNA 2FDNA 1IKVA 2V4JB 2BUNA 1Q1KA 3OTCA 4ETXA 3D0IE 1Q8LA 3V6DA 4K4SA 3GR0A 5KFQA 1V3SA 2YNGA 2R8JA 4MAKA 4DFJA 2J6SA 3ZZRA 3IN5A 4HH0A 2Q66A 3PO5A 2ZBIA 2F4VF 4A8KA 1S0OA 2PFFB 1XNQF 5DQHA 2RS2A 5CCLA 2J6UA 3CC7S 3DLBA 1YJRA 2IVMA 4IFYA 1YBAA 5IZHA 2YNFA 4RNMA 1HA1A 4PRFA 3T3FA 2VD3A 3BGUA 3C6TB 3JTPA 4K4WA 1NJYA 3AB4B 4RW6B 3QYYA 3ZZUA 2XY5A 4WCEQ 2AGOA 3UD3P 2XHWA 1KS2A 3D1OA 3M1VA 4HDHA 4Q43A 4JUZA 2YVSA 1Y5NB 2HG4A 5C42A 5MLCV 2N4DA 4I64A 3TA0A 4CCHA 1IXKA 1H2TZ 4FXVA 3RW7A 1WTFA 1NH7A 4MFBB 2BOPA 4B9VA 3JSMB 5E3QA 1VQPS 4HI2A 2VG5B 3I32A 1NU4A 4HT7A 1JK9B 5KFSA 4X4TA 2R7RA 2HNYB 3M05A 5BYQA 5J1PA 5GADI 3M8QB 4J9SA 2QLWA 2E9RX 2OPQA 3CDAA 3VR1A 4X66F 2H9ZA 2VG5A 2O67A 3V2UC 3H4DA 1V9OA 3RB6A 1ZOTA 1FVQA 2O1PA 1M5PC 2VG6A 3V4MA 4OI2A 3N01A 3VAJA 4Q0BA 1WF2A 1HNWF 4DSJA 2UUWA 3L09A 3FRZA 3MMBB 1DURA 1QUVA 3MURP 4K4UA 3G8TA 1SJRA 5J1NA 2Y1RI 1QAXA 1E6VB 3OVAA 1MSWD 3TOQA 3LO3A 3TQ1A 2FGCA 2YNHB 2MMYA 5U47A 5KFZA 4YR3A 5KFIA 2XNRA 5L1IA 4W90B 2EFGA 4NX9A 2N82B 3IRWP 4QWDA 1NKBA 1S0VA 3BQ1A 5HLFA 1WWHA 3FFIA 1REVB 1EP4A 4OJ3A 3I4PA 2ZH7A 2Q6BA 4ECVA 3Q0AA 4IG0A 4IR9A 2R7TA 2OKQA 2RH3A 3DM2A 4YB7A 1U25A 1QTMA 3OR2A 2IM3A 3LP0B 4OJHA 2R2SA 5F8NA 2HHHF 1EETA 1TQLA 1N6QA 3N0VA 4IUFA 2YWEA 5M2PA 2VONA 1DTTB 3CD0A 1RJJA 3TAMB 3C8YA 3GWCA 3BZQA 3BSNA 3QPIA 4ZP6A 4IOCQ 2GIRA 3DRXA 2X1AA 1U48A 4K4YA 4KSEB 1YRXA 2NZ4A 4QIWD 1KQGB 2ZJPQ 4B02A 2VFUA 4I56A 3D2WA 5F0WA 2G1DA 2HRUA 3H8YA 4DLEA 2VH7A 2J0SD 3J7A1 3M32B 1LW2B 1ZBTA 1FNXH 1DJ0A 1N5VA 5HI7A 2IAJB 4R5PB 3TA2A 2HS3A 4FNIA 1FKPA 2XSJB 4WZQA 1RTHA 1S6UA 3E01A 1S1VB 2O01C 3BS9A 1SIWB 3S7RA 2AGPA 4LMZA 2ZM6F 4OQJA 2B9YA 5DDPC 3BF4A 5K8MA 1LV5A 3OTOF 2LEPA 4DR2F 1YWXA 4C11B 1R89A 3HHLB 2AX1A 3SSSA 2K1RB 1T03A 5J1EB 3CULA 1IKYB 2DR7A 1S79A 2ZD1A 5L1LA 2RU9A 2KKHA 2RF2A 2AV5A 5GAGU 2JC0A 3AA9A 4J9LA 2XMVA 2C2EA 3T6BA 3T1YF 4O23A 5DLFA 4CZCA 5C42B 2PDAA 1Q4RA 1Y5LB 2WHOA 1HD0A 3R3TA 1S1XA 1SC6A 4RLEA 3EPIA 2ASJA 5KT5A 1JWWA 2DR5A 2WBRA 2N7YA 3ZZTA 3OTBA 3CJ5A 3IO1A 2HLTA 1T05B 1TKTA 4ITSA 3TNVA 1X4HA 1OQ3A 1NK4A 1UKUA 2BE2B 4C4WA 2R8IA 2XI3A 1GH8A 1WG5A 3VAFA 1H2UX 2JDJA 3M8PB 2HNZA 3NGDA 2YH0A 5CYJA 3DU6A 2W9CB 1U1QA 4CI0B 4WFYA 3E51A 3BN7A 4H4OA 2U1AA 3Q8QB 4ZPDA 2AW0A 6FD1A 3CC4S 2BZ2A 2ACYA 1VQKS 2QRRA 2B43A 2G13A 4R0JA 1FK9A 2D3ZA 3PR5B 3RRHA 5KTQA 4LF7F 2YNGB 4TQRA 2ZOGA 2OSQA 4DQRA 1S72S 4PQUB 1SH2A 1IUJA 2DT9A 1T95A 5CYMA 4X4UA 1QM9A 2I5JB 1RYRA 1GTHA 1ZETA 1FKOA 3BGRB 2PI5A 5IS2A 5GADU 1FNOA 2GW8A 3UCZP 2BYCA 3GV7B 3AY0A 1RT7A 3SDEA 1YVFA 4O4GA 1X9MA 1HNZF 2BRKA 3JB9k 1UVJA 1IN0A 3PEHA 2ZZNA 2DCUB 3PZPA 1FJCA 3OFGA 3C6UA 1Y00A 1JLCB 2XEXA 4QQBA 3I0SA 3MM6B 3B4MA 2LXFA 1VIXA 2X1GA 3ENWA 1DBDA 4A8MP 4D3HA 2XY6A 1J5OA 2HZCA 1Q7YT 3LAMA 4C8MA 1MMDA 3KTQA 2O5DA 1PILA 2HNYA 3H2VE 2GHWA 4C9DA 5DM7Q 3O5TB 1MWZA 2XZWA 2QA2A 1WEYA 3V6HA 2JEIA 3X3UA 3P3DA 3PFOA 3S01A 1R7IA 4XO0A 2O66A 3NRBA 2HIQA 3EZUA 2K2PA 2RDJA 2XWXA 4JI8F 5BYSA 1QJHA 4JI6F 4ES3A 2DHGA 2MKSA 3I82A 3PRBA 4Y2AA 1AROP 4IFVB 4KFBB 2VQEF 2C42A 3RZAA 3FRYA 3RW6A 4KO0A 1I1GA 1YJVA 3W2WA 2XLKA 4J5OA 2HHQA 4NMLA 5GVQA 5H9FJ 1JKHA 1KR4A 3KKFA 1HYSB 4NCGA 1M5OC 2HVHA 2C2RA 3MD3A 1LWFA 3DRSA 2JVOA 3HDSA 2FD2A 3US5A 5LJ5Y 3O2IA 2MKKA 3D54A 3MHYA 1UFLA 2MHEA 1E6VA 4ED3A 1S0MA 2IM1A 2UXBF 1KHWA 1S1TA 1U09A 1X4GA 2WB4A 2XCPA 2QEXS 3RAQA 1WTBA 1W25A 4ECYA 5KFYA 3O44A 1U1NA 2VFVA 4I2QB 5ITHA 2RVJA 2RD5C 3PXGa 3SCKE 1NB7A 5HBMB 4DMZA 4MJKA 4OZ1A 2OTLS 5DG9A 2W4PA 3DRRA 5ADZA 1P6TA 4F26A 2UZAA 4OJ1A 4N5SA 2ALZA 1YSJA 2OPRA 4TYAA 1U49A 4PXBA 2DIVA 2UUTA 5JJBA 2B3TB 2K8GA 2M9KA 1FD8A 2EK6A 4TY9A 3Q2SC 5F9LA 1YTYA 1NKEA 1RDRA 4N41A 2FLLA 3DFEA 3SSRA 3T5JA 1QE1B 1SUQA 3UNGC 4A8WA 2GHPA 2V8VA 1G1XA 2XMUA 4I2QA 4B08A 4JV1A 1FVSA 1F0XA 2XMWA 4QWEA 4DV0F 4F2SA 3CMES 4JI0F 4GKJF 4NRUA 2IYGA 3BSOA 5KG0A 1HNVB 3UW1A 3KHRA 3CJ2A 3IGVA 4ECQA 3I4HX 3V6JA 2DNPA 2DGTA 3T9NA 1KEKA 1YGYA 1HI8A 2LXIA 4J9OA 4UUWA 2FHJA 3MEKA 2A18A 1KN6A 4U6PA 1KLMA 1S6PA 2HPUA 3CD5A 1QAYA 4TKTA 5IT4A 2LDYA 1R3NA 2JEGA 4O44B 3BM7A 3W2VA 3OVSA 5E3AA 1SH3A 4O3QA 1D9FA 2HQIA 3CDWA 5JXSA 1RGVA 2BW2A 4OHVA 1HI1A 4Y2KA 4U7CA 3M32A 4EUVA 2GGPA 5LSRA 1UAWA 4K2XA 5FD1A 3IS9B 4I6WA 1N56A 2FPHX 4FPRA 4B9LA 1NNDA 1TKTB 4FF3A 1S6QB 2UV8G 1B0VA 4Q8FA 2RDIA 1HWJA 3DNCA 3OUYB 3EXCX 4Y0FA 3LGMA 4CO2A 3IR6B 4DSKA 5F8HA 3TUIC 4R5PA 4PPZA 5FIIA 2BR0A 4OI3A 4A8XA 1CQMA 1T8EA 1QAIA 2DR9A 1BY9A 1J2VA 1X5SA 1UFWA 4LJMA 4QCLA 4RW8B 3ONQA 3M30B 4KKOB 2J9EA 2W8KA 3ISZA 3OBIA 4IG3A 3H40A 2BVZA 1U1OA 1CC7A 1TL3B 4R0EA 3TUZC 3GE9A 3PW2A 3ENVA 3BO3A 3PX6A 2W4CA 2OPSA 4H4MA 1HHTP 5DETA 4ZK7M 1NJWA 4NCAA 1ZH5A 4K50A 3KHHA 5MAOA 2ZDOA 3GV8B 3KLGB 3V81A 3AB2B 1K8AT 4C8KA 4I7FB 2ZFHA 1C0UB 3DXSX 1NHVA 3QJJA 3H2LA 1WHVA 2HYIB 3SQGA 1CVJA 3OFEA 5T14A 4XPEA 1S99A 3RU0A 2W9BB 4JI2F 4DL7A 3K2YA 4B9MA 1ZAXA 5KOXA 2IYIA 1FRXA 3DLEA 3C46A 3MOZA 2AP6A 2PO4A 3HVAA 4UQTA 3NP5A 1M5VC 1N33F 1KOHA 3IG1B 2XSFA 3G9CA 4H4KA 4BDPA 2L9WA 3P49B 1FF2A 4F2RA 2RQMA 2DGVA 1RT7B 3NWGA 2KFYA 2A2CA 4RW9A 2JVRA 4XPCA 3KK2A 4KRWA 5HMZA 1SV5B 3MM8A 5CH7B 4I6YA 4HTJA 3SMZA 4NLGA 2GV1A 4C2MA 1GTEA 3DCAA 2QMWA 4USIA 1X5OA 4IDKA 4KO0B 2FHOB 1FRKA 1XBWA 1NRKA 1JLBA 2IC3B 2OPPB 1M0SA 3QIPB 5G0RA 3OR1B 4YHHF 4ZHRA 5KFXA 5E3RA 2DHAA 3VQTA 3LAKA 3QGIA 4DLGA 1M90T 4KPYA 4WK1A 1UW4A 3B4DA 5E41A 3KWMA 4CO1A 2JOQA 2EPIA 4ZHRB 2QV6A 3OL7A 1WF1A 1YG0A 4O3PA 4EBCA 2Q3PA 1YJNS 2I5JA 2RSQA 2AX0A 3OXFA 5I3UB 5C25B 1RT3A 2J0WA 2B6AB 2KT3A 2HLUA 1FESA 2KB2A 3POTB 1TVRA 3DYAA 4X64F 3EGZA 2HHUA 3PRDA 3U1LA 4Y2CA 1WEXA 3RAXA 3M4XA 2J7KA 3MEGA 4URGA 1S1WB 2MKCA 1UWBB 2GMLA 2KRBA 3TAQA 2AJ0A 2IJNA 4ZVEA 2EFOA 5J2QA 2YKOA 2KT2A 5E3PA 3RBDA 3BSCA 4QWAA 2DPJA 2EWHA 4P7TA 1NZAA 3BDEA 2IM0A 3GFXA 2X51A 3MM6A 4J9RA 2XB2D 5C24B 3LWLA 5J2PA 2KZZA 1XERA 2P6TA 2W4DA 4OZJA 4TU9A 2WAQD 2G9OA 3BGLA 3D28A 1UA1A 4PCQA 3NCRA 2FJDB 4A8QA 4NXNF 2DTJA 3DRPA 4UOCA 1Q8BA 3DLGB 1X4FA 2RIJA 2B6AA 4OX6A 2MKIA 2VODA 4R8UA 1BC6A 1NH8A 3QAUA 4IFVA 1F2GA 2W7PA 3ZZYA 4EEYA 4JYAF 4WF9Q 2AU0A 3AJ2A 4DDFA 1HPZA 3T9ZA