4MIWA

High-resolution structure of the n-terminal endonuclease domain of the lassa virus l polymerase
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
170
structure length
170
Chain Sequence
MEEDIACVKDLVSKYLVDNERLSRQKLAFLVQTEPRMLLMEGLKLLSLCIEVDSCNANGCEHNSEDKSVERILHDHGILTPSLCFVVPDGYKLTGNVLILLECFVRSSPANFEQKYIEDFKKLEQLKEDLKSVDINLIPLIDGRTSFYNEQIPDWVNDKLRDTLFSLLKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution structure of the N-terminal endonuclease domain of the lassa virus L polymerase in complex with magnesium ions.
pubmed doi rcsb
source organism Lassa virus
molecule tags Viral protein, transferase
molecule keywords RNA-directed RNA polymerase L
total genus 61
structure length 170
sequence length 170
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4miwA02
4MIWA 5J1PA 5J1NA 3JSBA 5IZHA 4I1TA
chains in the Genus database with same CATH superfamily
2JLGA 5H9EK 3DLEB 4FXDA 3BKFA 2EPIA 2AJ0A 2BX6A 1A6LA 3A13A 4L75A 4CM0A 2AGOA 1QVGR 3VF0B 1QTMA 2XMAA 4KHMA 1V3ZA 2WZ1A 1QE1B 3G96A 2J7KA 5HJXA 4X64F 5CYQB 2R7VA 1VHIA 8ATCB 4ECSA 3X3UA 1YRUA 1FWPA 2QA4S 1QSSA 4JV2A 5B0AA 2FHOB 1FDBA 3OLAA 2VA2A 4BS2A 1RWNB 4A8YA 1TKXB 4WFBQ 2JEJA 4JV5J 4IDKB 1FESA 2J8SA 2V6AA 1H38A 3GR1A 2OELA 1RT7A 3QFWA 2OH2A 4A8QA 1FNMA 1X7VA 3TJ9A 1U2CA 1YRTA 2XWYA 4WFZA 1WG5A 3DLKA 4EI2A 4X65J 2Z2ZA 1VQMS 4NMLA 3A3PB 4EMDA 4ED4A 2PDAA 3FCVA 2XY5A 1UVNA 1K9MT 4IH5A 4OHYA 5ETLA 1SB6A 4ZVGA 3UO0A 7AT1B 4PABA 3DI6B 2FJVA 2VA3A 1KN6A 5IC4B 2M9KA 3MMJA 1T9TA 4FF2A 2DNRA 2HBYB 1VC6A 5K9FA 1FX4A 2YVSA 3D66A 1NMEB 4USKA 2KH9A 1RA7A 4Y0FA 1S4EA 2ZVSA 3TI0A 3H42A 1GFWB 3Q89A 1X9SA 4JI4J 1CJTA 5FLXY 1WNEA 5THWA 4NLPA 3MM9A 4OI6A 2CQ3A 4BC7A 3KLHB 1MN7A 4RW7B 5ETNA 1WEXA 4OHXA 5KFIA 1YGYA 5CZXA 5D8HB 4OZJA 5F8HA 3DLBA 1N8RT 1NSKL 2XI2A 2RUSA 3K89A 3ONQA 2QX0A 5CA5A 4DUTA 3A12A 1C0UB 2F9JA 3CCTA 1R6VA 1RTDB 3C6TB 1TZ0A 3D0IE 1HNIB 4NCBA 2N3LA 1ZS6A 1FRHA 2QGFB 2XWXA 2HAIA 4RW9B 5KG3A 2IA0A 4QBUA 2ASLA 2BKPA 4FYXB 1NEEA 3CCSS 4DV6F 4LR9A 2WVDA 1QAYA 1S1XA 2QE5A 2MZ1A 2IPOB 1HA1A 4AL5A 2HHTA 1N33J 2POKA 3OQ2A 3ENAA 2BXJA 4KQZA 3BGRB 2E1AA 3A8KA 3RBXA 4X4NA 4HEA9 3CJ4A 2LXUA 1F9FA 2AGQA 4Q2LA 1V5VA 4HACB 2C42A 3OR1B 1ZETA 2XCAA 4N8OA 2ZZNA 1N36J 3HJVA 2IM3A 4KT0C 4PRFA 1GH8A 3H4DA 1YTYA 4QZVB 2MHNA 1KOHA 5D0EA 1SV5B 1UTAA 2RAQA 1NK0A 4ILLA 1KRPA 1ZM2A 3BH6B 3H2VE 1PJ5A 1SXLA 3A8IA 3PYEA 3PYFA 3NBPA 5K5MA 1U1MA 1FKAF 2PN6A 3ILJA 4F25A 1GMWD 1WC0A 2EFOA 2NXNA 2QSFA 2CQBA 3ISND 3T6BA 3WHIA 1HWIA 3WDOA 4A46A 3CMQA 1SC1B 1S1TB 1WC5A 2JFKA 4ZVRB 4F2SA 1SVDA 3GILA 3NY0A 4CLSA 4EBDA 1T9VA 3I6PA 2ILZA 3PM9A 2E5GA 2YWWA 4LSNA 5HI7A 5B7WA 5A2QU 2L3MA 2YKMA 2V8VA 3DM2A 5EWEA 3CJTA 4ECWA 1WEZA 1NXIA 1X4FA 3VZIA 5IT0A 1RTHA 4DL6A 2P9CA 2VDHA 5ETPA 2WONA 2UZAA 1RTIA 3W9HA 1LK7A 1UWAA 2QLXA 2VV5A 2XQCA 3KLFB 3M8SA 1K44A 2B5JA 4FS2A 5HROA 4ZVTB 3RR7A 4B3RF 1VRTA 1FT8A 2ADCA 4NXNJ 1FFWB 3US5A 1EZZB 2BJ1A 5B09A 3L3CA 1HBNA 5ADZA 5LOQA 2L9DA 3D68A 3W60A 1VCTA 4J9OA 3A8EA 1C1CA 4I2PA 2BJ9A 1BE4A 2DO4A 3FMBA 2NCKL 1NSQA 2BYCA 1JX4A 3AQPA 5KG7A 5D0GA 4USWA 1T9UA 4C11B 1HWLA 3NS5A 3QLHA 3CUNA 3O2IA 3NGRA 4OX8A 2I1RA 5DLGA 4A8XA 2R8IA 1GEHA 3I4HX 4OJ3A 5JVHQ 4ED1A 4KTQA 4MKAA 3M32A 4EGLA 4OYZA 1IBLJ 1C0TB 3M2VA 3H8YA 1V9OA 3Q8YA 5KFLA 2GVZB 1MN9A 2MQ8A 1VC5A 1TL3A 5H9FJ 4OYWA 4DR5F 4ED7A 4IFVB 1PO6A 4EEYA 3DLGA 4IG3B 2V0NA 5EDWA 2QA4G 8RUCA 3PX4A 2LYVA 2XMMA 2BJ3A 3P96A 2FJDB 2QC3A 3BYPA 3E01B 3IBCB 5EX0A 2F9DA 5HATA 1AROP 2CDQA 5KFNA 5JVGQ 2V63A 5B0EA 1N6QA 1JLQB 2XZTB 4AQYF 2HRUA 2BQUA 3ULHA 3NAHA 1RT1A 4X66J 3VAKA 4LF5F 3O5TB 3B6BA 5KFDA 1HMVA 2BANB 3L7UA 4MYUA 4ZPBA 5HAOA 2IRXA 4HT7A 5A6PA 1P9QC 2Q3PA 3DRPA 4K0KJ 4M5MA 4DV6J 2H1YA 2W4PA 3FVYA 3MPDA 5KFBA 5GAHI 5HMXA 3OUYA 2XLKA 3DMJB 5I3UA 2F4VF 1FNOA 4NZ7A 4EFAC 3DRXA 2AD9A 1XTZA 3ZZRA 3DFEA 2Z2MA 2OP5A 1RTJA 1UFKA 5L1KA 4UOGA 4JI6J 4C4WA 1S12A 3ZZZA 4DCPB 3ZTSA 1HW8A 3TEHB 2B6AA 4XIUA 4JI0F 1NDLA 3N0VA 4WP9A 4ZP8A 4NYZA 5E33A 1DQ8A 4ZJLA 3KXDA 1FJGF 3FBCA 3NG8A 4OMFG 4HTJA 2NZ4A 7FD1A 1FO1A 1JK9B 3UDEA 1LFWA 3OHAA 4H54A 1FDAA 2GNKA 2EG2A 1N32F 3TA2A 3FZBA 1VQ8S 1V6HA 2J8AA 2FJXA 2QEXS 2JH3A 2WBRA 4I6AA 1JLCB 3DOLA 4OZ1A 4IFYA 5J2QA 4M5IA 3ENQA 1WWHA 3LQVA 4KIAA 4U8YA 2UV8G 4DQRA 4C8YA 1VQ5S 4KPCA 1VQKS 2RILA 3HX9A 1IKXA 3OTDA 4RNMA 2VKRA 3UN3A 3BQ1A 1IKVA 1RA6A 1JKHA 4NOHA 3SDEA 3TAMA 5DDRC 3D6FB 3F56A 2Z56B 2ZC4A 3IRXB 4I2QA 3VTIA 2DTJA 2KHDA 1S0OA 4KFBB 4TY9A 3SEOA 1P6TA 4Y28C 2EXUA 4QU6A 1W25A 3IG1A 1NBEB 1EX8A 2Q1LA 2V34A 4ES3A 1N4LA 2HMIB 1XWLA 2IJNA 3MR6A 2FY8A 1MWZA 1YX2A 4ZDNA 3O44A 3AD9C 3MHYA 1RWPB 3LW5C 4DX6A 2CNOB 1XMBA 2UP1A 1VQSA 1WHWA 2QLFB 3U1NA 4AFFA 2ZJQQ 3TQ1A 2FHJA 1HPZA 5D77A 3V6HA 5HL7Q 2XMJA 4F0MA 1QSLA 3CDBA 3W5ZA 2ACMA 4O44B 4CDIA 4F36A 5J1EB 4U6PA 3TARA 3RB4A 4F4XA 3EJMA 1YQHA 2W9BB 1SJFA 1D1UA 4NXMJ 1TAQA 1TKZA 1SH2A 1TQLA 2AJ4A 4I68A 4DCOB 1UVLA 3MI7X 2Y8WA 3K5OA 5KFJA 2GS8A 2Z30B 4WZMA 2RS8A 2LQJA 4O0IA 1N52B 2GMJA 2X1AA 3AY0A 3PHTA 2EFVA 2EVZA 4NZ6A 1IVZA 1VQNS 3P8BB 4AD6A 2DNKA 3OFFA 1HNWJ 1TVRB 2CJXB 2W2PP 3E8OA 3H59A 2CXEA 3FSIA 3RBZA 4DR6F 2G2ZA 2MJNA 3HVTA 3IBWA 1GAOA 2M8DB 4PWDA 4ITSA 3JSMB 3VGTA 3TAQA 3R5DA 1RBOB 4ICLA 5M2PA 2VBXA 3ZZOA 4HR2A 4JV1A 1YBAA 4M1KA 2ZKUA 2VQFF 2RMLA 4ELUA 2W7AA 3MM5A 4WFXA 1CJKB 1Y00A 3KK2B 2PMWA 4F4YA 2HFSA 2CYYA 2VD3A 4WWSA 3QZ8A 4ETXA 2DRAA 4K5RA 1RU2A 4B9TA 3N79A 5CCLA 4K0KF 3M05A 2EKNA 4AL7A 1FRIA 1QSYA 1TL7B 2A3JA 3UNYA 5A0YB 3SBMA 1TKDA 1V3RA 3TVKA 1O0PA 4NLTA 4G3IA 3G82A 3NGTA 2KXHA 4M63A 4TNOA 3ZZTA 4M5NA 4K2XA 1AW0A 1D8ZA 1TL4A 2Y1RI 4JBCA 5DZ6A 1L3TA 4IRDA 1HNWF 1KS2A 4FYYB 2MKCA 4P7TA 1TK8A 3W9JA 1OQ3A 2JEFA 3W2VB 3G6ES 5B0FA 2QMXA 3Q2SC 1LFPA 1S1XB 1XN9A 1YJRA 4MKVA 3NKYA 5ETKA 2DR8A 2R2RA 3CE8A 1DFDA 2UXDJ 2G2YA 3TEGA 4BLGA 2PI4A 4UOFA 1WG4A 2AYMA 2HSEB 3FRYA 3I9V9 3TW0A 1QJHA 2XLJA 3I56S 3D2WA 3DGVA 4CO5A 4OZ5A 1X0PA 1OJ4A 3QT8A 1EIYB 1BC6A 1KWMA 1YIJS 5I42A 4PPDA 1FKPA 3V5RA 1BMQB 2QYGA 2IJRA 2J76E 3LH2S 4O0NA 3J81j 3SZ2A 1RAGB 1YJ9S 2MLXA 3HJFA 4USMA 1RISA 3L7OA 2V4JB 3SSSA 2WB1D 4JI1J 4EBEA 3LP0A 1F9EB 2F8HA 1UVJA 2VOOA 4RNNA 1AFIA 1PILA 1X60A 3I0SB 1CPZA 2DGQA 1EARA 4P73A 2YNIA 1S6OA 2DBBA 2KJWA 4P75A 2VIHA 1X8DA 2PI5A 4FP9A 4DLEA 2XNRA 1UCNA 2XULA 1T7PA 2B7CB 2QMWA 1ZYQA 3HXMA 1D9FA 3R1HA 1XC9A 1Q82T 1L3UA 2F1FA 3G6XA 2Z57B 2COLA 1TAUA 4P72A 3MAQA 2APOA 5HQ8A 2RUGA 4DX8H 4ED6A 2J7WA 2WOMA 2LQ5A 2VG7B 1C1BB 3IAS9 1YBTA 2IVFB 1VQPS 1RWVB 3QT6A 4Y2AA 1HW9A 4R5PB 2AV5A 3TWZA 9RUBA 4F3QA 4OJHA 5KFOA 3WQPA 4H4OA 3SMZA 4U7CA 3GIJA 4CLUA 4MT1A 4C8MA 2RHQB 5A8WA 1IQTA 1NPRA 3M30B 5G0RB 3U1LA 1VC0A 2IM1A 3EWGA 5KFQA 1S72S 1WELA 3BS9A 2W2MP 3CJ5A 1X4BA 2CQIA 3M1VB 2BA9A 3M8WA 3R3TA 3DNCA 2RQCA 2C3MA 4M8LA 2AQ4A 5D6GA 5M2RA 4C3LA 4ENOA 5LMUJ 1LWEA 2BR0A 3POTA 1OY6A 1E6VA 2AIRB 2FC9A 3IWXA 4M5KA 2C2RA 4DG1A 2BE9B 3GFXA 5F9LA 1OS5A 5KT3A 3ZTPA 2VICA 3MD1A 5SZTA 3FEZA 3G8TA 3QATA 1IR1A 4ZJOA 4FXWA 1S59A 4LFCJ 1T05A 4P2XA 2P6TA 1UZDA 5L39A 2R7OA 2NREA 2ZH2A 3EZOA 3KHGA 2YQ3A 4UW2A 4FPRA 3TP2A 3THVA 3OTCA 2UVUA 3TANA 1TUWA 3HHLD 2A0FB 3TZXA 2NXUA 3MEDA 4OI1A 5HMYA 3E3XA 4ELVA 4H4KC 1X9MA 1JMTA 4Y6IA 3EXCX 3MPYA 4P71A 2WRMA 1FRXA 3KLIA 3MD3A 3D7SB 4WFNQ 4OX9J 4DOZA 5KT2A 3DGPB 3QJJA 3CCWA 1TK0A 1B4SA 4DHVA 1VK3A 2VQEJ 3PDNA 4QIGA 4XPCA 3CJ2A 3G6VA 2XEXA 2KT2A 4TYAA 2YWEA 2J9DA 3IM9A 4LBIA 2OD6A 5LM7E 5CH7B 4KH0B 3CCUS 3X1LB 4ES1A 1D9DA 4MK7A 2UUAJ 2AEFA 1EHWA 2CNKB 2VFTA 3M6VA 5JUMA 1BQNA 2RU3A 2MTLA 3OUYB 4ECYA 4F50A 4DL4A 2EC2A 2C28A 2WBMA 1L5UA 4QU7A 2QG9B 3LAKA 2QIFA 2ZH9A 4CO0A 3PR4A 4DL7A 1BXNA 3M7VA 3QGGA 4MIAA 3DDNA 4B3RJ 3BGOP 4Q0BA 3MM7A 3Q8RB 4R0JA 1OWXA 2YNGA 1FRJA 3GJSB 2WHOA 3KUHA 4I56A 4ZCLA 4CLWA 3W61A 5KFPA 1X4HA 5LJ5Y 3QYYA 3HO1A 4C9DA 1XIQA 4OZNA 5EWFA 4QIWD 1F60B 3MCSA 1S99A 2BDPA 3GMGA 3Q23A 3V4IA 3Q8VA 4F3MA 1TKXA 1A9NB 4MFBB 1OMSA 1DHMA 4CI0B 4LSLA 4Q7AA 5HP1A 1RT5A 3BF4A 4R8UA 3ZZYA 1YJTA 1PG5B 5F41A 3W5XA 2Z8QA 2WCXA 4QYZK 3KJQB 1FA0A 3I9ZA 3R7BB 4ZLNA 2FVQA 2ACYA 2FHKA 4OQJA 1IKXB 2LFVA 2MSSA 4UTGA 3V6DB 1UW4A 1Y5NB 2D3ZA 5CZVA 2YKQA 3MMCB 1FTRA 3IR7B 3OV7A 3U02A 2YNFB 3MMBB 3NGUA 4TY8A 5E3QA 5DGBA 4W98A 3OVSA 4X62F 4LF6J 2DXFA 2HURA 4WKRA 4NRTA 4IUFA 2DK2A 2BOPA 3BH7B 4A4JA 3CF5Q 1UL3A 4OV6A 2Q66A 1T8EA 2QL7B 2G13A 4HKQA 4PQUA 2MZJA 2RH3A 2BRLA 1REVB 4YR2A 4RW6B 3QAUA 4TU7A 1C4AA 1S10A 1N5TA 1WC6A 3CVKA 4EU0A 4CIOA 3C15A 4XAKA 4LFAJ 3UNGC 3VVTA 5KFAA 6FDRA 2ZH5A 3CMES 4QR2A 5HVHA 1HWJA 3HCXA 5IWAJ 2MKSA 4DF4A 1QAIA 4FYDA 2GJIA 2HHWA 3CCZA 2E5HA 1RTDA 4DPUA 4DQPA 1K0VA 1RT3A 3UDLA 4NYOA 4UY8T 5AXKA 4LJMA 2I6WA 1QE1A 2HFZA 1WEYA 2FZKB 2BJ8A 3C6UB 3RU0A 1J5EJ 4F8RA 1LOUA 1F2GA 3MWBA 4EO8A 4DSFA 3W7BA 1ZZNA 2F3JA 2O3DA 1D0EA 2HK3A 1U47A 1VLOA 1FJGJ 1NJYA 5FDLA 1TVRA 4ZLPA 4CNZA 3D28A 4V19X 3CO0P 3EDQB 1FE4A 1NCLA 2QLJB 1RADB 2J0XA 3QWPA 1N0UA 2VUGA 1R31A 3M6XA 2OSRA 2E7XA 1NSAA 2XYPB 2KN4A 2ZH4A 1RUSA 3QRPA 4YUDA 4F0KA 1VLYA 3MR3A 2MPUA 2XMKA 1H74A 2VJVA 2R7QA 1TUGB 2DY9A 1U25A 1FXDA 2EI5A 2ROGA 3UW1A 2R8KA 1JIHA 3HSJA 4KGVB 4IRKA 3TOQA 3HHNB 3IR6B 1FE0A 2W2QP 2MDAA 5KFVA 3M2RB 2CJ9A 1NK8A 1H98A 1PYTA 4DBQA 2BVZA 1O8BA 4Q8EA 5FJ4A 1XNQF 1EETB 3MXHP 2OIHA 4JYAJ 2MY8A 1HKAA 3CGIA 3MR5A 1T3NA 2RD5C 3IFEA 3M9NB 1NJZA 4P2FA 3TZWA 1UVMA 3BGUA 3N6MA 2GHWA 4YFUA 4LSNB 2VPZB 3RBDA 1KOOA 1REGX 3LALA 4EZ6A 1M0SA 1SQGA 3FBBA 5GMKa 5E2QA 2ZC3A 4X64J 2B4UA 2NYHA 2DHSA 1RWMB 1S7HA 2HQCA 3DRYA 1PC5A 3GG0A 3W9IA 3VGVA 2A1BA 1WKLA 3CXCR 1M1KT 3VAFA 2X51A 1T02A 2OGUA 2B51A 4ZOSA 1S0NA 4DQIA 3OW2R 2KTQA 2YQ1A 3VGUA 3ENVA 5C42B 2ALZA 2MB0B 4CO1A 2W4CA 3GV8B 1HBOA 2ZNZA 3EGZA 1Q53A 4DS5A 3J7ZT 2YWKA 3OR2B 2RDIA 2NZCA 4B08A 2MKIA 4J9VA 4DSIA 1Q5YA 2GGPB 2CZVC 5BYRA 3DC2A 3A1YG 1VQ6S 1IKWA 2H5IB 1GXTA 2RDDA 2XYGB 3PW4A 2ZFHA 3D3CJ 4NE9C 2OTLS 2GAHC 1OYDA 5SUHA 4CZCA 1HI1A 3M8PB 3NOCA 4QWDA 3GV7B 4A8FA 3LWMA 2W9CA 3EPGA 1SL1A 1LEOA 2D1CA 2AGPA 4I67A 1DY3A 5LL6d 4YMEA 4USVA 1UA1A 3LOUA 1U45A 5ETSA 3HD2A 1R0AB 2W01A 1T11A 3HVWA 5IXUA 4O44A 1G4CA 2J0QD 2RNEA 3VR1A 4OZLA 5B0GA 2CKWA 1GT8A 1RWUA 1C0UA 2VPXB 4IG0A 1WI8A 2XSFA 2D3OR 3FC9A 4Q5VA 3R2CJ 1TL3B 1UPMB 2LECA 4DR6J 2DR6A 2HHUA 3D1HA 3NNHA 2J0WA 3TVYA 1JLEA 3B4DA 4J9KA 3IBFB 2W2NP 1Q95G 2HNDA 4DR4J 4WP8A 3W64A 4DU7A 3ETOA 3RTVA 4OX6A 4RW8A 3ZFVA 1ULRA 2CQCA 2D3UA 1PAEX 2IBOA 3BGRA 2P5VA 4IKAA 4ZVEA 3W8GA 2Y0SD 2YKMB 5AE3A 5B0BA 3C14B 1OIAA 5AXLA 4I1TA 3QGPA 1Y7PA 3FKBA 1NKBA 1U6BA 4EO6A 4ZHRA 2ZJRQ 5LMNF 2HHQA 2FB0A 4Z7CA 3CD7A 1X0FA 2RF2B 2DGVA 3DLKB 3KLFA 3WX8A 2BQRA 3POTB 2H54B 2I8EA 3K8WA 4D3HA 4I7FB 2B4OA 4CH1A 1KFDA 2DKOB 2OFGX 2OPSA 4P6QA 3NBPB 4ZPWR 1NO8A 3ELHA 1XQIA 3MGJA 5J2MA 5KG6A 3T3FA 1DLOB 4RL1A 4WF9Q 2J9DE 5CYMA 4ZIVA 5HLFA 2KFYA 3S6EA 3SV4A 4DQQA 2HK2A 5L46A 4NLDA 3KLGA 3CC7S 4TQRA 2DR7A 3EGWB 3R5JB 4PPZA 4NLYA 3J81Y 1NZ8A 4O4GA 1RHQB 2NUUG 3TUJC 2KFZA 2QA2A 4DX7A 1WF2A 2LU2A 3EGNA 3C19A 3CB4A 2KO1A 2ZNYA 4DZDA 1RTIB 2U2FA 4BBYA 2VU5A 2XB2D 4Y2IA 2CG8A 2DEIA 1SC3B 2QRRA 3GPAA 4OIXA 2CJKA 3EMTA 3M2VB 4KC5A 2XGQA 3VQTA 2FLOA 2V2QA 3AXKA 1U49A 3PJWA 5DRKA 1MROB 5KFKA 2AJQA 4I2PB 1CVJA 2OPQB 2H65B 3AXMA 5HBMA 1NDCA 1WI6A 1S48A 2L48A 2XI3A 3MM8B 4IO1A 1YI2S 1AUDA 4BC9A 1XNRF 1F3FA 5G4DA 3W5YA 2FUG9 4YDXA 3FK4A 3NWRA 1H73A 2EKYA 1CC7A 1FVQA 2DRBA 2JHEA 4P9SA 2D7SA 4ZVHA 2MGZB 2YQ0A 2JLEA 2RS2A 1P8GA 5KFYA 2DH7A 2GC8A 3ILOA 3H90A 6FD1A 3W1YC 3T5LA 3RAMA 4B3TF 4PUOB 2YKPA 3T9ZA 3EGVA 5AJ3F 5IV4A 3QT5A 4DJBA 1HQEB 2YKOA 1ROFA 3DLEA 1FK9B 4P74A 1ZA2B 2D9PA 2JZ5A 4LVOP 1FRLA 3H5SA 2IRUA 4NI2B 3HHEA 1L3SA 3OL8A 3E2EA 1EKRA 1UEKA 4UF4A 4DV5J 2LEBA 2C3UA 2B6AB 1C1BA 2B43A 3PO5A 4KYZA 1QUVA 3EYZA 2FIUA 2XS7A 2BQ3A 4ID8A 3BGFA 1KLMA 4HYKA 1KEKA 2VL1A 4W90B 2ZUAA 3AODA 3GFYA 3MMCA 4PG6A 4UQGA 3CC2S 3HSZA 2FVRA 2YX4A 4RKUC 5LSLA 1TMJA 2JSXA 3U1MA 4U67Q 1JXVA 4RPFA 3KMQA 2R4FA 2ZUGA 4OHVA 3D9BA 3AHPA 1UPPA 2OSQA 1FI4A 2XM3A 2HBQB 1A7GE 1X5SA 3PW0A 4R0EA 1ZTWA 2GQCA 3HT3A 3MM5B 3ZNUA 4RU9A 1CJKA 1FXLA 3JS9A 2MHEA 2F7VA 4DR7J 4ZPTR 2IDEA 4CO3A 3TX0A 1WKKA 2AJ1A 2XYHB 3CEDA 3Q22A 4MAKA 4YB6A 1NH7A 4QIFA 4JI0J 2DEJA 3T9NA 2JL9A 4G6VB 2GA7A 4PXDA 3PKMA 3KJVB 3GQCA 2DNMA 3N6LA 2KYZA 3DN9A 4TXSA 1KHVA 3GU0A 1U48A 3EVWA 2HRTA 3DLJA 3AB4B 1F0XA 2OMOA 3WBZA 4ZPCA 5F8JA 2V5HG 2K3KA 4KB7A 2RHSB 1CJUA 5DQGA 3T5KA 4CLYA 4TLQA 3HI9A 3J7YI 2HLUA 2VF3A 3DU6A 3M2UA 4WTOB 2FJWA 2E9ZA 1B7FA 1WG1A 2JVRA 3K5LA 1R0CB 1S1WA 2KJVA 3BM7A 3JQMA 4P2MA 4DR2F 4RUHA 3FGVA 5GADU 4OYIA 1DURA 1TKZB 2QL5B 5L8RC 5IT9Y 2QLBB 3C6TA 4W92B 4NWBA 3PCOB 3H25A 1RAEB 2HVEA 2VFVA 3LPYA 3MM6B 2JOQA 2XS2A 5KTQA 2CG4A 2JLFA 5T41A 4WZQA 4IG3A 1I1GA 2CQDA 2VFRA 3GLJA 1Q86T 3KHLA 2A6MA 5B0CA 4ETZA 2IMOA 3UCGA 4ZCKA 4L3KA 3EXYA 1FD2A 2FLLA 1X31C 1HBMA 4KO0B 5HSPA 2QFIA 5F8IA 4YDDB 2RT3A 3DHXA 1KP6A 4TKTA 4DFMA 4XK8C 1HFEL 4HACA 5AE2A 4Q0BB 4LFBJ 1GX5A 1NH8A 3G2XA 3QWUA 4OV1A 2QT7A 4ZP7A 4DFKA 4C8ZA 1U8SA 2JC0A 3U7JA 2UXCJ 2M4MA 2C2ZB 3DRPB 4WIQA 5A76A 4GC6A 3MTJA 1ZPVA 1IJEB 4KSEB 2UU9F 2E66A 1VBXA 4J9LA 2CQ0A 4X4VA 5IT9U 4OYBA 5IM0A 1DBDA 2LEPA 4WCEQ 1PKUA 1X4GA 2F8MA 2G0CA 4I6WA 4NL5A 4DPXA 2JX2A 4R8UB 4RUCA 3GIMA 3FDSA 1T9XA 5L1JA 4OL8A 1ITPA 1TL7A 2B9EA 3D5MA 4DCJB 3FEYB 3ICLA 4FNHA 2B56A 2OKQA 1RU1A 5HANA 4ZN3A 4FN5A 4NLWA 1RAFB 3MAAA 4K2JA 4WK1A 2HEKA 3O3LA 4WFYA 4YB5A 1N36F 4K4SA 2DNNA 2OD4A 4IDKA 4DV5F 2DGWA 4LR7A 4HDHA 5DM6Q 2CPZA 4Y3CA 1RTHB 2AF6A 1VIOA 3RRHA 1HI8A 3RR8A 4DL2A 2WSCC 2NXEA 1PSDA 2WONB 3KMSA 1SC6A 2HNZB 3LAMA 3QQCD 2BACA 3CJKA 3Q8SB 5GADI 1S49A 1RXOB 1TUVA 3FUYA 2ZJPQ 1OPIA 2F63A 1WOPA 2CPEA 3BR8A 3P5BP 5H1SV 1R43A 2N4CA 3CDAA 3BN7A 3WC0A 3NGSA 5KFRA 3JYTB 4DV2J 1N48A 3EICA 1C1CB 3KK3A 1C2PA 4KFBA 2R2TA 1UFWA 3NGDA 2AX1A 3RBEA 2B0GA 4QWEA 1JJ2R 4DPTA 3I0RA 3S01A 1GTHA 2XGPA 1PBUA 3KLEB 1YJWS 3ISZA 1KQGB 3UPFA 2AW0A 4FF3A 3K5MA 4NX9A 3MEDB 1RAJA 3SCJE 4RW7A 2HG4A 4WE1A 3DLHA 2EBGA 4M5HA 4A8SA 2E9RX 4PKDB 1OY8A 1CLFA 1RKIA 4TN2A 1XBWA 5IT4A 1XNQJ 2BM0A 4FS1A 2BW2A 5ETRA 3CD5A 2MMYA 3TUIC 4DV3F 2HHHF 1Q81T 5LMUF 1C0TA 1WJ9A 3IXQA 4KHRA 2DNGA 5IWAF 2R7TA 2QYCA 2PA3A 1OYEA 3A4TA 4CH7A 4GO5X 4KHPF 2CAJA 3KDNA 1IKYB 2YNHA 4IH6A 4L6V3 5DO2A 3W3SA 1JWWA 1LWFB 3D6MB 4FYWB 1IBKJ 4F26A 3HFZB 2ZH1A 5IZHA 1U1KA 2CQGA 1FTCA 4NLSA 3BQ0A 4YHHJ 2R9LA 4I4BA 1HNXJ 4DR5J 1BD6A 1OPZA 2IFXA 3IS9A 5KT7A 2V4QA 1N6QB 2J6SA 3BR9A 3N5BA 3CD0A 1W2BR 1ZAWA 2BABA 3R6LB 4OLPA 4A47A 3MAHA 4ECXA 1S4FA 2GAGC 5K8NA 3TQEA 3P4UB 4X4QA 1N0VC 2F4VJ 1SCJB 3UR0A 3LP2B 1U4BA 1LWEB 4NLQA 2MKKA 3UR3C 2NUHA 3UVJB 1I51B 4IYQA 3JAMY 1R89A 3KLGB 3TRGA 3T1HF 3D67A 2CWKA 2FPHX 5LMNJ 3Q2TC 2PMHA 2Z58B 5CD4H 2UUWA 3I87A 2HQGA 2R2UA 1ZZFA 2EG1A 4OYOA 4WU3A 2UUCF 1LWXA 1GXUA 5JMNA 1N54B 3JSYA 1RHRB 2C2MB 2DGOA 4HT5A 4DMZA 1YZ6A 4MH8A 2VHGA 4IR1A 2L9WA 1ELOA 2LDYA 2G2OA 5ETVA 3WIUA 5KFZA 4U7UD 3KK1A 1AZSA 4DSLA 2NQPA 1SBRA 2CQPA 3FSYA 5F8GA 5DLFA 1KFSA 1P27B 1XR5A 4RBVA 4TLRA 3KHHA 1SPBP 4J9PA 3DLLQ 4LF8J 2AHOB 1HL6A 3M1VA 3M8YA 4LF2A 2LA4A 1FDNA 4P10A 3T19A 3A8JA 2LEAA 2WW8A 3BJYA 2HHHJ 2CPXA 2B9YA 4PQUB 1NUEA 1HBUB 1OSDA 1JLFA 1IBCB 2WSEC 4PR6A 1U1QA 2HWHA 4DR1F 1HLWA 2GVDA 4PAAA 4EYIB 1U1LA 4E8UA 2AZ3A 4WXWA 2VBZA 3F41A 3JTPA 4CO2A 5I42B 4LT6A 4AYBD 4TYBA 3R6GB 3UD4P 2FVPA 1K73T 3UN5A 1T05B 1JLGB 5J2NA 5MLCV 4YP3A 3GJTB 4DV0J 2DNHA 1S1UA 2ZBQA 5JXSA 1UFLA 3PTWA 4HL9A 4IG0B 5E3AA 3VV2B 5J1PA 2XCPA 1RT3B 1XR6A 1Y0HA 2WSFC 3MM7B 2QL9B 4O3PA 2XO7A 1YJNS 2IM0A 2KG1A 4GO7X 3KUGA 2BUNA 3EUNA 4QIEA 3TJAA 2GO8A 5KT4A 1CBKA 2IDLA 5BYQA 3ZTQA 2FHMA 4NMXA 3HT0A 5L9XA 3K0JA 1VYAA 5E3PA 2PSZA 2AKWB 3UCZP 4L72B 1JJCB 2MQMA 5C24A 4KKOB 4O3QA 3AT1B 3K7RA 4LFCF 3CJ3A 2I5JB 2E7WA 2OFHX 2PO4A 3BKTA 3ENWA 3H98A 3KUEA 8AT1B 3GIIA 1N5YB 2CIMA 1RT4A 3L7PA 3J7Z5 1PCAA 1YZ7A 2BE7D 4RNFA 1ZOTA 1VHFA 3I31A 4B9UA 4C0BA 4ANCA 2AZ1A 2NSCA 4PG4A 1Q7YT 1FDDA 3ETMA 2RRAA 4FF4A 1VDHA 3VAMA 2WW4A 2E44A 3EM1A 4DWIA 3HHKA 5J2MB 3W63A 3JSMA 5D0RA 2ASYA 1KD1T 2Q6CA 2QZ8A 1RE1B 3BSNA 1ZPWX 3HKWA 4QW8A 1UWBB 1LKZA 4GVBB 4ILRA 4L76A 4QJVA 4KRWA 4AT1B 2EBEA 1VQOS 2MLZA 4FYVB 3DMJA 1E6VB 1FHTA 4CH0S 2CDRB 4AE5A 2VJUA 1RYSA 2LQ8A 2MQQA 2V9WA 1H2TZ 3IR5B 2J0SD 3M8QA 1WSVA 3T1YJ 2DHXA 4LQ9A 4JI6F 2XC9A 5C25B 4FZVA 2QO3A 1VBYA 2HFNA 1KTVA 2UXBF 1GQEA 5LT5A 1TU0B 2RRNA 4CYUB 4QOTA 4UT4A 1N33F 1Q8BA 4YR0A 4J37A 2MQPA 1FF2A 3UN2A 4LF9J 1H3DA 1S9EB 1E6YA 2UV8A 3J7A1 1RAHB 3ILIA 3MM6A 2HGMA 4O23A 4IOCQ 3ITHA 3BREA 3GP9A 1NKEA 1KQFB 4MIWA 1VISA 3D54A 2IMWP 4B9MA 2AEMA 2J7UA 1VGYA 2AYBA 1SI9A 3LP1A 2IAJB 2HFOA 5KT5A 4LFAF 2PFFB 3R2DJ 3H40A 3KTQA 2VBYA 2W9CB 1IKVB 2BRKA 3L9ZA 2MGZA 1FFGB 1XMOJ 2BJEA 3GG1A 3SDEB 3TAMB 1CULA 1EJ7L 4GVLA 3TNVA 5C5JA 3OJSA 4WU2A 3Q0AA 1KDNA 1J5OA 4OHWA 1W2IA 3K5PA 1NHVA 5BJRA 3H2LA 3HSDA 5KFUA 4I6YA 2HZVA 4U8VA 1HQEA 4CLPA 1UETA 4EWTA 4Y2MA 4ZVFA 3MFHA 2F4FA 4J9MA 2IYIA 4J9NA 2LMIA 2MQOA 3U27A 4NI2A 3CPWR 2FLNA 2R3VA 2OEMA 3B82A 3KG1A 1KQKA 3KG4A 1SKSA 4LQ3A 1VBKA 1H72C 1S6QA 3OTEA 3QSIA 1DTQB 4NEZA 2KT5A 4LVNP 3NMAA 1VR6A 1WC4A 2YKNB 3FFIB 2HGNA 2HHPA 5J1NA 4QW9A 3D0GE 4LF1A 3P45B 1UEUA 3PJXA 3QIPB 4K7QA 1Y11A 4JB8B 4X66F 1TFYA 2ABYA 2VG7A 2Z2LA 2R7WA 4NA1A 4A8OA 2K2PA 1VFJA 4HHHA 2H5EA 4ID5B 1CC8A 1MNEA 2P9EA 2XMWA 3FQLA 4PYAA 5GAGU 4DV7J 1KKHA 2HW3A 4EZ9A 4MKBA 3FJ2A 2G0JA 1QLNA 3V6DA 4OI0A 3PV8A 4ED3A 1RSCA 2CVEA 1QY7A 3DXSX 3GYXB 2FDNA 2HNYB 3I96A 3PJ9A 3QMQA 4FVCA 2WTFA 1PGZA 5KFWA 3PG9A 4RBTA 2MZRA 2QTWA 4ZVUB 2BJDA 1OQ6A 2V50A 4ZLLA 1FJEB 4ZPDA 1JLAB 2N7YA 3AQOA 2R8HA 1M5VC 5F0UA 2A2CA 1IKWB 2D74B 1S79A 4DUYF 1ZA1B 2BZ2A 1S6UA 2EWHA 4FXVA 4ZVQB 3M8PA 5E7OB 4CM2A 3ZTOA 4D3GA 5A2QY 1WC1A 1NZAA 3R5CA 1YLXA 2OAUA 4RW6A 3VHQA 5KFMA 2GV1A 2Q6BA 2AP6A 2RJZA 3LUYA 1UVKA 4CLKA 3G71S 4ECQA 3J7AN 1Q78A 3DRRB 4WK3A 2EW9A 2BJ7A 2OUGA 3OSPA 1N5SA 4NPOA 4DV0F 2M5YA 4JI2J 4RU2A 2KRRA 2FZCB 2OPPB 2RQ4A 2ZHAA 3RRGA 2B8PA 3WIVA 2Q43A 2RSQA 4C97A 2EC0A 4NLRA 1U26A 3ZZPA 3AOCA 1IKYA 2YNHB 2E1MC 3W2VA 1J27A 1OSCA 2Y3YA 5I3QA 4UQTA 2CVIA 2C3OA 2QLWA 3D6TB 4LIWA 4CTAA 1HBMB 4X4UA 3KFWX 2FGCA 2OMLA 3CWJA 3DGPA 3G6YA 4KV8A 3H5YA 3C14A 3AD7C 3DOMA 2CJQA 1YSJA 1SJ1A 3V2UC 2O01C 4RNOA 3FSXA 1FKPB 5ETTA 2HYIB 4URSA 2RU9A 1HD0A 2AJFE 1KLNA 1O6XA 2SXLA 3F0NA 4V1Ak 3SI8A 5ITHA 3VAGA 3IM8A 4DR7F 1OY9A 3L4BC 4YN3B 1CQNA 2XMUA 1VQYA 1XJWB 1G2EA 1DLOA 3EDRB 4HHUA 3C46A 3MUTP 1S1VA 1IM6A 4XTTA 1EETA 2HQIA 4LRCA 2DH9A 2NR0A 1JB0C 2D69A 3MCMA 3JTOA 3UQSA 1NHUA 2HIQA 2KXNB 1KLMB 3OXGA 5CXTA 1D9AA 2IBKA 1WKJA 4LF7F 1T3OA 5FLXU 2FZGB 2RVJA 1DJ0A 4MFBA 5I3PA 1RABB 3AA8A 3Q24A 4Y00A 1RT5B 2FVCA 2BBEA 3M6UA 3N9UC 4ED5A 1FCAA 2HFVA 3KYLA 1U1PA 1M90T 2J5AA 1U6FA 1BGXT 3VVUA 5F3ZA 4ZJQA 1K8AT 5J2PB 4UZBA 4QR0A 1EP4B 4YHHF 4B3MJ 4ECVA 3JB9k 1JNRB 3EPIA 3K58A 1HR0J 4IR9A 2HRYA 5CQGA 1WF0A 3I55S 3UCUP 1KSPA 4NYPA 5D3GA 2GVDB 1VOMA 2JVOA 2ZWPA 3MEGB 1VMBA 1DAXA 2H9ZA 5LSOA 3OR2A 1TTHB 4YB1P 3IP0A 4GC7A 1L3KA 4K8RA 1RBLA 1VQ4S 3PYDA 4B9LA 3MOJB 3D3BJ 3FQKA 4LF5J 5HBMB 3W65A 2AMCB 5KG1A 5F8NA 3N5FA 2DGUA 4K4WA 2VC0A 3SYZA 1R8CA 3FBEA 4PWWA 3KLEA 1UJ6A 5LJ3Y 3I5AA 2VASA 4DFPA 3C16B 1UW9A 3ISNC 3QFHA 4X4PA 1DRZA 1JJHA 3R5AA 5D78A 4DV2F 3QRRA 4QYZJ 3FEXB 3OD2A 1TKTA 2HWIA 3R5GA 4CRJA 3BO2A 2M88A 3C15B 5M2UA 1QD1A 1FK9A 3T1YF 4NA2A 1M5SA 3G9CA 2Z2YB 2F8EX 4JI3F 3PVXA 4WBFA 2B3TB 4LF6F 1RCXB 3H20A 1RWWB 4CLZA 2F5GA 4HH0A 3V81B 1JLEB 4WPAA 3CCRS 3QIDA 1N5YA 1Y5IB 4ZVPB 4JI7J 1FVSA 2CRLA 2DD8S 1AB8A 1AUSL 4P52A 3BPDA 2C2KB 3IN5A 2X1BA 1TK5A 3ET6B 2VQFJ 3AJ1A 3HD1A 4DS4A 3HSGA 3TVZA 4LSZB 3VCDA 5E5NA 1O5JA 2K7KA 2XMVA 2N7CA 3I82A 2J6UA 4C8KA 1IXKA 1WACA 1AA1B 2QV6A 1NB7A 1WDDA 2IHR1 1F2HA 3KJVA 5ETMA 2OJ3A 1RDRA 3PFEA 4KBIA 3GIKA 4K4ZA 5EWGA 3EVOA 5F9NA 4F4WA 4CLLA 2FLPA 3FNNA 1FEEA 4OYPA 4DSKA 2ZHOA 4J91A 4I0WA 1U09A 3PFOA 3BV8A 4Y34A 2HS0A 1Y9OA 2DPJA 2RRBA 2R7XA 2AEJA 2GW8A 4FVMA 1FFSB 1EKSA 2H48B 1WTFA 4BDPA 1BWVA 1G6BA 3B78A 4NCGA 1RBAA 4C8NA 4DUZF 2C22A 2RKIA 3SFGA 1OO0B 2KVQE 1KBRA 2XZDB 2ZBCA 3MAAB 3W2WB 3EVMA 4Q43A 3QSYB 3V4IB 5DM7Q 1PAUB 1YBUA 3QZ7A 5HP1B 1NNDA 2A18A 3QO9B 1YG0A 4N77A 2DHHA 2LDIA 3ITHB 3BDEA 2P9GA 3N01A 1AT1B 5DGAA 2DCLA 5DJBA 2ZM6J 1RYRA 1UJ5A 1U0HA 2MY7A 4RUBA 5HVGA 3CC4S 1AXQA 2PIIA 3S7RA 1JLBA 4PG8A 1HBUA 2AYEA 3VZHA 3M8ZA 3FMWA 3F73A 2FD2A 3MMBA 2DNOA 2ATCB 4TY8B 4ZCIA 4G1IA 4OYMA 1VQ9S 4IOAQ 1CULB 2PEHA 2VDIA 2OPQA 1DTTB 2VBWA 2WK4A 3MM8A 4C3MA 1UZHA 4QYRA 3NP5A 2ZBRA 1FD8A 3TZYA 4DX5A 2IIHA 1WTBA 1RT2B 3PRBA 4PEOA 2VG5B 3UWTA 3NS6A 4PUOA 3GONA 2KT3A 3PNIA 4JI5F 1S1WB 1NDKA 1LXJA 2CADA 3GJQB 4USIA 4EYHB 1S6QB 2MKYA 2ZWOA 2YWGA 1SIZA 3QGIA 2W1BA 5A8KA 2JWNA 1WUUA 5ETOA 3BBFA 3CW2C 2X3GA 2JFDA 4I69A 1HHTP 5C24B 3J7YU 4Y65A 3JQJA 2O66A 4CP5A 2KFNA 5B08A 3QPIA 4YR3A 1YJVA 4NA3A 1HNZJ 1N88A 2ZH8A 5HQMA 1ZAXA 1H7WA 2VFSA 2K3IA 1RZMA 1X4EA 1LWCB 2IRYA 1IWAA 3SIPB 3J80U 3VAHA 4KHPJ 4MKYA 3IS9B 1XMOF 1JNZB 3CTRA 4MIBA 1RB0A 1LW0B 1PJ6A 1CJVB 2KKHA 3SFUA 3BEGB 1RK8A 2MZTA 3NCRA 2KM8B 1Y3JA 2NYIA 1UWBA 3GB0A 1BQMA 3V6KA 5DG7A 4N56A 2V8DA 1UEVA 3VQSA 3EZ5A 2A6OA 3E51A 4PXEA 2B9WA 3LGHA 3M2RA 4UOHA 3EX7B 2DB1A 5KG0A 1NK6A 3SQOP 2BKOA 3H0PA 1B7YB 4XPEA 3OSNA 1FKOA 5DETA 1B0VA 4LUBA 3KK3B 1ZM4A 4L3NA 2V8PA 4ECTA 4CO4A 5HLFB 5A6WA 2XSJA 3RB6A 4GKJJ 2VB6A 3I5BA 2LCWA 3KG0A 1HYSA 1N5QA 1LNQA 1W7WA 3KK1B 2IA6A 3KJFB 1GX6A 4RW4B 2DXEA 2EFQA 3GSIA 3HVAA 3CCJS 1MSWD 3M2UB 4KPYA 3AH6A 1YWXA 3CSKA 1RACB 3PR5B 1S9GA 3RB3A 2C3YA 3BPSP 3NEKA 3PX6A 4Z7YA 2AYGA 1R7IA 1XNRJ 2WB4A 3SQGB 3I5CA 4Y2KA 2NPFA 3NOGA 4J9UE 4BWMA 5KFTA 2IAJA 1X4AA 2R7SA 2IM2A 3UDVA 3KHRA 2Y1IA 1JLFB 3T41A 5CD4A 2DXDA 4DL3A 3K57A 1EQMA 1KTQA 2PA8D 4G1QB 2UVRA 5E3CA 4IQXA 3CNQP 3OBIA 4X2BA 2GIQA 1Z2ZA 2GGPA 1FJCA 4DUYJ 1MU2B 1CS4B 2B8QA 4WP3A 2MJUA 4OI3A 3R9LA 5E3RA 2G1HA 2LKZA 3TYTA 5GAEI 4F4ZA 2DIUA 2W8KA 5HMWA 2QJ3A 1U0SA 1TV6A 2K8GA 4K4YA 4M5DB 2LXFA 4ED2A 2UU9J 4NRUA 1CQMA 1UAWA 3I32A 5CYQA 4DSJA 3C3LA 1KVIA 3NCQA 1RWKB 1S1VB 1B99A 1I94F 2V69A 4DN9A 3FRZA 2XNQA 2CPDA 4OZ3A 2XY7A 1YKWA 3PW5A 2VKZG 2J9CA 2BV3A 1RQ0A 4XDDA 5DS7A 4RX6A 2OHDA 3QRQA 1NSPA 2ALYB 2DH8A 2G1DA 2H4YB 2KL8A 4PG7A 3WC2A 3NNAA 3N6NA 2GFFA 3AJ2A 3CDUA 4NLOA 4NLUA 4X62J 3DYAB 1LK5A 2JC1A 3PX0A 1EP4A 4PZVA 2HNDB 2EK6A 4ZMMA 2V9KA 4HVZA 2VH7A 4RW8B 5B0DA 5HJYA 4Q8FA 3AA9A 4RR5A 2U1AA 1WC3A 3GSDA 2CWXA 2K1RA 3DKDA 5D3GB 1IR0A 2CQ4A 1HNVA 5EN1A 2P2CB 3B54A 4C48A 2BW7A 4KAIA 3GR0A 3IC1A 4WIIA 3UDCA 3ZZUA 3QJPA 3NWGA 2DISA 2MQLA 2IC3A 3S1TA 2KXFA 3NXZA 1GMVA 3OFHA 4I7FA 3CJKB 1RP5A 1UP1A 2DGSA 4JI8F 4CWBA 4Z2XA 3BSOA 3UFCX 1FX2A 3EE3A 4KY3A 5HN0A 1S57A 2VONA 3ZNJ1 2UUTA 4C11A 4YOEA 3KLHA 1HQUA 3KJNB 2YWFA 4DU8A 3VGSA 3JYTA 2XO6A 1P9YA 2CPYA 5AT1B 3SV3A 3ADAC 2X3DA 3OFEA 1Q5VA 4LMZA 1TL5A 1BLUA 4M94A 3T1AA 2KDOA 5C2CA 2RQMA 1S1UB 2E1RA 2ZITA 4DV4J 5HQLA 4OJGA 3GTYX 2ZDPA 4DV1J 1U7LA 4O4GB 1SUQB 1NKCA 4IFVA 1M5OC 4WE1B 3DLGB 4MJKA 1IM4A 3MZIA 4EUVA 4YQWA 2RDJA 1S0MA 4QCLA 2Y1JA 1NK4A 5DQIA 2V68A 4RJVA 2C2DA 3HHDA 2AX0A 4F0HA 2CUYA 3C8YA 4IOBA 5HK4A 3PY8A 1F9HA 1RAAB 2W4DA 1AYEA 3DOKA 4WYWA 3V4MA 4KV8B 7FDRA 1W26A 2IYGA 4R25A 3W8PA 4ED0A 3DCAA 1U1NA 3NL0A 1ICEB 1MROA 2DGXA 2VZ9A 4RLEA 3O1LA 4H4MA 4RUAA 2DY1A 1S6PA 3HDSA 2RE1A 3TX8A 2UXDF 1X5PA 4AUKA 2CQ1A 3Q8PB 4KO0A 3CCES 1FWKA 2Z0GA 1TR0A 4U7UK 1UKUA 3MECA 1NB2A 1SH3A 4QIVA 3KOAA 2GHVC 2JEIA 3DRSA 3OPKA 1V5IB 3WX4A 4B9VA 1HWKA 3PIOQ 3G87A 3MMAB 3SCLE 6AT1B 2PEBA 3L95X 4GVBA 4HI1A 1RHMB 2IJFA 3BBBA 3HHLA 1LW2A 3LP2A 2DNZA 2BM1A 3R1LA 3A3OB 2RKIB 4JYAF 3Q83A 5IM0B 5F8MA 1VRUB 3RW7A 5IOLA 3GJRB 4KKOA 3CJ0A 3D4JA 3LWLA 4GKKF 1P1TA 4WJBA 1FJ7A 2M7SA 2RB7A 3AOAA 2FQQB 2NSBA 4J9QA 1QTNB 3AAWB 3JSBA 3H5UA 1Q8IA 1TMMA 3GYGA 3OT9A 4OHZA 4PQAA 4OJ1A 3RJMB 3HFVA 1AZSB 4LF7J 1R27B 1K0TA 4C3KA 1CG2A 3HK2A 2HNYA 3VAJA 1HIYA 1JKHB 1YJ7A 1HWUA 2CPHA 1HBNB 1JXEA 2HQFA 2E7VA 2K06A 1TL1B 1UJ4A 3IRXA 3PXGa 2ASJA 1S77D 2PE8A 4QR1A 4ES2A 2J6TA 1B3TA 5FD1A 5FIIA 4O3SA 3CD6S 3H5XA 2HKEA 1IN0A 2HNZA 2OPRA 3PW7A 1BUXA 2KVIA 3CDEA 4C6AA 4C2MA 3CMAS 1VIXA 1NRKA 2KM8C 2GJFA 1S5ZA 1GNKA 2XTJP 2CQHA 1CJTB 1RT6A 2L08A 3D0HE 3DDIA 5T14A 4KGXB 1CSJA 4OLOA 3T5HA 1YITS 2D9OA 2HZCA 3CJRA 1HR0F 2B7BB 4DV1F 3CDWA 3RGIA 3K17A 3BB5A 4BCAA 3PIPQ 3MOZA 1UVIA 4CLTA 1GTEA 4RZRA 1LQ9A 3I0RB 3PW2A 2ZM6F 2VPWB 4F02A 1Q7LB 2MLYA 4TU8A 1T03A 2C2NA 4AXIA 2UUAF 1TFWA 1WHVA 2ZDOA 4RW9A 1MW7A 3JAMU 3H7HB 3QJLA 5JJBA 3KLVA 3M4XA 5ETQA 1KHWA 1Q79A 3N28A 5CCMA 3MFIA 1VQLS 4QWBA 3SCIE 5LXRA 2HQ3A 2HWTA 3NRBA 3OJUA 3NCPA 4ZP6A 2GQQA 2UXCF 3LP1B 3PYGA 4ATNA 4DUZJ 1U1RA 2PD1A 5RUBA 1MMLA 3W62A 2G4BA 3PEJA 4P2SA 4K4TA 1D3WA 3OLBA 2R7RA 5I4MA 2DNLA 2W7PA 1PC4A 2LVWA 2HVIA 4FF1A 3LPEA 2HAFA 1JQGA 3QIPA 1Y10A 2I5JA 5A8RB 5LXYA 2UVVA 3CCQS 3RRKA 2N3OA 5KFXA 3H4BA 1WSRA 1XEZA 1ZM3A 1VBZA 3T1HJ 1F5BA 1RT4B 3BGLA 3LGMA 2ZVIA 2DR9A 1S0VA 2WVFA 1MMNA 4PG5A 5KG5A 4ZP9A 3KK2A 5KG4A 5HMZA 5I3UB 3OL7A 1T9YA 4JI1F 4CLFA 4UY85 1DZ5A 4DLGA 4B02A 3GV5B 1FEHA 4B9NA 2CPFA 1GXLA 4A8MP 3CJQA 2FC8A 5H9EJ 1YK9A 3MPUB 2FYXA 1KONA 4C8LA 2ZE2B 3K8VA 4KE5A 2PC6A 5MAOA 5BR8J 2R8GA 3P3DA 2HVHA 2XSJB 4YEAA 3CIZA 1BHNA 5K14A 2E1CA 4OZ0A 4JI8J 1IBKF 5DQHA 4LBHA 4CNYA 1Q8KA 3IAM9 2VFUA 3MEEB 4ANEA 2XMTA 1RT7B 2YH0A 4J7CA 3BO4A 2YX7A 5D15A 2HBRB 1JLCA 1YRXA 3DOLB 4N5SA 4JI3J 2JJ4D 3UI3A 5J2QB 4KGZB 2LQBA 4ID5A 2LQ9A 4C0OC 4CT8A 4CCHA 5GAGI 2Y9HA 4UZCA 5HROB 1QAJA 2OPPA 1U0HB 1R8BA 4K4UA 1WHYA 4LR8A 4DPWA 2N82B 1V3SA 1Z4UA 5KFEA 1U1OA 4JI7F 3RAXA 4ECUA 2HBZB 2AJ2A 3JTNA 4QWAA 1E6YB 2NXJA 1U2FA 1G3OA 2ROEA 4G1QA 4NLXA 2DHGA 3ZO7A 2VQEF 3VALA 2HHXA 3P5TL 1RCOB 1JLAA 2E5JA 4PCQA 2RIJA 4H4KA 1WORA 1HHSA 1XR7A 4LRDA 3BSCA 4EK2A 4WFAQ 1KNZA 3IG1B 3TA1A 4ED8A 1RHUB 4CTAB 4AXJA 3UD3P 2VODA 1YDLA 3R27A 4NXMF 4DDFA 1K47A 2B4VA 2KB2A 5KFSA 4ZPAA 2V2ZA 3QLHB 2BE2A 1M5PC 3NMRA 3JXOA 2OI2A 2M70A 4USUA 4KR0B 4ZIWA 1J5OB 2VC1A 2CJAA 2B9XA 1IJFB 2DNYA 2JNJA 2MQNA 3EZUA 3ILLA 3JQKA 1ACMB 1SL0A 2AT1B 3KNAA 3UD5A 2ERRA 4B3MF 4B3OA 2ZEJA 4QPTA 2M2BA 1XMQF 1XERA 3BO3A 1NJWA 1FXRA 1HNIA 1VJWA 3LA0A 1EB0A 3CJ8A 2WOMB 3PHEA 5GAEU 2J9EA 3V81A 4N76A 1Q1KA 2KI2A 3HF5A 4ER8A 1SJ4P 3MF5A 3UE2A 3JSRA 1X9WA 4USHA 4LF9F 1S97A 1RLCL 1DTQA 3G4SS 3BZQA 1Y5LB 1HARA 4ZKAA 5D4PA 5HO4A 2PT0A 2ADBA 5KFCA 2K1RB 2QA1A 1LW0A 2ZKTA 3R7SB 4GKKJ 3DM2B 1CJVA 3K2YA 5T7LB 4MK9A 2N4DA 1LWFA 4AL6A 3OL9A 4C8OA 5GVQA 5J2PA 1M1HA 3MCOA 4O3OA 1RHKB 3OL6A 2O1PA 1SQEA 3OXFA 1MMDA 3TA0A 3RW6A 2HQDA 2HVZA 2A2DA 2E5IA 2KHCA 4PYDA 2R8JA 2ZOMA 5A0YA 2C2OB 3AD8C 2DRDA 4NCGB 4FBUA 3BDPA 2ZD1A 4DEZA 1FERA 2BOAA 3UVJA 4MK8A 4PXCA 3IWNC 1UMJA 4JI5J 5KG2A 1K1QA 1F5AA 5E41A 1RJJA 3MDFA 1QAXA 2XBPA 3MCNA 4ZPVR 5AE1A 2GIFA 3S8SA 3MUMP 3HZGA 5HVFA 1T95A 2NPIA 1URRA 2W25A 5BR8F 4KJIA 1PIEA 2H51B 1S9GB 3GCXP 4O3RA 3MEKA 4LF4F 1HHQA 4IQMA 5C25A 3SQGA 1IQZA 3PZPA 3ZTRA 4LIRA 4CYUA 1G1XA 1A0OB 4DR2J 4AQYJ 4B3SF 1TELA 5DDOC 3V6JA 1NJXA 1SKRA 5EGYA 2AWZA 3QT7A 2VPYB 3PEHA 1Q0NA 2BEFA 2IVMA 5D4LA 3W66A 4E98A 2YKAA 2H4WB 2GIRA 1JJ4A 1QM9A 1WDTA 2GMLA 3IGVA 4PWUA 1S6PB 4YB7A 4YY3F 3TO8A 1NK7A 2KU7A 2BKNA 4K4XA 1N32J 4C7QA 3RAQA 4EBCA 1N34J 2V4JA 3Q8UA 2D3O1 3KDOA 3D6HB 1I5OB 2DHAA 2I0XA 1PJ7A 2OEKA 2VG6A 3I0SA 4NZ0A 1VQ7S 2QSWA 1YHQS 1P1LA 1IBMJ 2VG5A 1HMVB 2BANA 3L09A 1M5KC 1ZTTA 1R6YA 2E1PA 3T6JA 4Z37A 4Q44A 1JLGA 5J2NB 1BWEA 1NAQA 5J1EA 1Z1ZA 3HHLB 3M32B 4G1PA 2W9BA 1KR4A 3TUZC 3BN4A 2I9SA 3H2UB 1R8PA 3LGNA 4X4TA 2L41A 3HVRA 1J2VA 5IQ6A 2DIVA 3C66A 4LRFA 4S0MA 5DDPC 2AU0A 1KC8T 1WD6A 4LF4J 1WOSA 2LA6A 4N7TA 1T94A 4MYTA 5GMDA 4J9RA 4C0HA 4NLGA 2X1FA 2FY1A 3TUPA 4FDFA 4XO0A 1FRMA 2GCFA 2KYXA 3IWLA 3KKFA 4BWJA 1QVFR 1XK8A 2P8IA 4DV7F 3C2PA 5KOWA 1UA0A 3ZZ0A 1F3VA 2YKNA 3FFIA 3MTKA 1Q4RA 2I38A 4HH1A 3TAPA 1VS3A 2YNFA 4Y2CA 2F40A 5G0RA 1HNVB 3QO9A 2Y0BB 2CPJA 2QFJA 2ATLA 3BYRA 4RO0A 4KH1B 1PBAA 5DDQC 2R2SA 4DR3F 2KRBA 1HNXF 2UVWA 1BQMB 5BXIA 1ZBTA 4NCAA 4DR4F 1VRTB 1KQSR 1B70B 4OYXA 1RT6B 4DQSA 3WZ0A 4HHJA 2EFPA 3OHBA 1RTJB 2CPIA 1RAIB 2WVBA 3MEGA 1HQUB 4DPOA 4RWXA 1H0HB 5L9NA 1T9WA 2NS1B 2Z4PA 2CA9A 3LTOA 3Q86A 2V2KA 5L1IA 4OX9F 2FJEB 5U47A 2C1EB 4ILMA 2XG8A 5BYSA 1EAYC 4NASA 1GMWA 1U24A 2R42A 4FNIA 4DV3J 3R8YA 1SQFA 5F8LA 1R8HA 1NDPA 3NGKA 3K5NA 4RW4A 5D4NA 2JDJA 3R7NB 1RI7A 3N4WA 1T03B 1WF1A 3FCWA 3O6QA 2VOPA 2FJAB 1EQ0A 3C6UA 4B9SA 1TKTB 2Y1LB 3F44A 3M8QB 3DRRA 3FCHA 4WYLA 3I4PA 2HGLA 4F4AA 1S7IA 4UUXA 2ZOFA 4JV0A 1D09B 3HKZD 2MXYA 5A8KB 2EFGA 2EK1A 1VJQA 4TQSA 1C4CA 2UXBJ 2LXIA 2MSTA 3HLUA 4J9SA 1U02A 3AFGA 2GVZA 2QN6B 1S9EA 2MZQA 2P6SA 1X5OA 4RNHA 2DNQA 3G8QA 1H2VZ 5AJ3J 2YH1A 4JV5F 2MKHA 1NM2A 2CNLB 2ZZTA 4DXLA 3BQ2A 4B3TJ 2YPZA 3PRVA 4FKYA 3LF0A 4ZLJA 5K8PA 3LANA 3GCWP 4HDGA 2B4PA 4JI4F 4X4RA 2W2OP 4A8WA 1MU2A 1BQNB 3IO1A 3E01A 1LWCA 2CNNB 4IO9Q 2HPUA 3CCMS 1NPKA 2E29A 1RKJA 4GKJF 2V2VA 4LRBA 2ZOGA 3HVTB 3MECB 2YTCA 4M95A 5F0WA 4PWDB 5EHHA 3DOMB 1RT2A 1SJQA 2X1GA 4M5DA 4A48A 2OLWA 3CCVS 3OTBA 1NK5A 2ZE2A 1WHXA 2YNIB 3HM9A 5IV3A 4DFJA 4F3OA 2EFNA 2PMZD 1B0PA 2V94A 3FBFA 2YY3A 1B0TA 3IA0A 5K14B 2CJYB 1F6TA 2FHJD 4M5LA 4CT9A 3HP6A 1GMUA 1U8WA 4IRCA 3BSAA 3AJDA 5D4OA 4V19J 1RLDA 4N47A 5D0HA 1RHJB 4ZITA 3CO9A 2CFXA 1NHKL 1S1TA 3O8WA 1Z2LA 2MYFA 3MUVP 1CEZA 3GFZA 3CULA 4BHQA 2DYAA 2IY5B 4LBPA 3W2WA 1Y4ZB 5C42A 5K20B 1BQXA 1NPPA 2ROPA 5DG9A 2DT9A 2ZBPA 4RWWA 5DZ7A 2YX1A 5A8WB 4K4VA 2HHVA 4B3SJ 3NLCA 4RBUA 3BBCA 4LFBF 4ICLB 3CIMA 4DZ6A 1U6ZA 2ZH3A 1DARA 1PYSB 4JI2F 5KFGA 2K7JA 5IQQA 1X4DA 2B5JB 2R7UA 2V67A 4YY3J 1JLBB 4U96A 4K5SA 2E9TA 4DG1B 3CJSA 3M6WA 3T5JA 2HS4A 1J5EF 2UUBJ 1NLKL 4DN0A 1YJUA 2BE2B 4I2QB 3DI6A 3QAEA 3P6YC 5CABA 1IWGA 1DTTA 4ZVOB 2XLIA 1HYSB 4MTPA 4O3NA 3G82B 3HULA 3THPA 2GZOA 4USJC 4XDCA 4F04B 1NJIT 3HFKA 4ANDA 4J5OA 1X5TA 1M1GA 2XZWA 5L1LA 3MM9B 1SH0A 3RUBL 1SUQA 1TP7A 2KG0A 3HHLC 2M3DA 2PGCA 3AOBA 5EUHA 5CYJA 1HPZB 1I3OB 1HD1A 4NXNF 3ZXWA 3DHWC 2E5LJ 1SIWB 1RGVA 2GO9A 2DPIA 1NU4A 2D41A 2GX8A 3M8RA 5FDLB 4YS2A 2A10A 2WVCA 4DL5A 2ZH7A 3VWSA 4QQBA 2WVEA 4ECRA 1NK9A 4WTYA 2UUCJ 1RWXB 4X4OA 5T7LA 5KFHA 1SKUB 1R0BG 5A8RA 4ZHRB 3SSRA 4E0DA 1ZH5A 3OTOJ 3G86A 4L74A 2ZH6A 3P49B 2RF2A 1H6KX 2W7OA 1B64A 3SXLA 1HI0P 2O67A 4IH7A 4UUWA 2HHSA 4ZVSB 4ELTA 3D1OA 3LP0B 1Y3KA 2L9NA 1FWLA 2OPSB 4ZA1A 4OX7A 3KNGA 1RT1B 1TV6B 3OR1A 4NEYA 1H2UX 2YNGB 3DDKA 3RB0A 2DJWA 4GMKA 4C98A 3Q8QB 1URNA 3HMJG 4KGKA 2DR5A 1LW2B 2YXLA 5EX3A 1F5CA 1SV5A 3RG6A 9ATCB 4DSEA 2M0GB 5H9FK 3M9MB 1H7XA 3OVAA 1DQ9A 1VRUA 4UOCA 3B8HA 4DPYA 2V4RA 3OFGA 2JEGA 3MPVA 4M5GA 1SJ3P 3MPWA 1ZAVA 3SCKE 2CZ9A 4P7VA 2YBVA 4R5PA 2IVYA 2YPYA 2XY6A 3J81U 5KAKA 2EEYA 1I94J 1YVFA 3OXLA 3QBCA 2WAQD 5KFFA 4ERDA 4WKYA 2HVDA 3M30A 2LLZA 1ZM9A 4JOUA 1AFJA 4HI2A 1Q16B 2G9OA 1TL1A 1HQ2A 1RAOA 5IS2A 1XMQJ 1QDUB 1MG7A 4JP8A 3MR2A 4IFYB 4W4MA 2I2YA 4F2RA 4O4RA 4FKXA 3QNWB 1RWOB 3MR7A 2HLTA 4N8NA 4DI6A 4NLVA 1I6JA 1K1SA 3KLIB 2OTJS 4ZCMA 2NLWA 4I64A 3GYNA 4F67A 1T0TV 2XHWA 3TZZA 2ZHBA 1REVA 3GIRA 1S9FA 1SC4B 3R97A 4Q45A 3J80Y 2CJBA 5KOXA 3BKUA 3G8SA 1R0AA 4ALZA 2DCUB 1Q8LA 1CS4A 3PACA 3R5BA 2GMHA 4J90A 2HMIA 4B3OB 1M5HA 3NNCA 2MKJA 2QMUB 4K59A 4Q2MA 1WOOA 4WXOA 3GWCA 1N5VA 3C16A 4LREA 4B17A 4E2FB 1F1BB 2DNPA 4JUZA 1DQAA 2NXCA 2ZBIA 3DRSB 3FZ2A 2YWHA 2W24A 3THTA 3PKYA 1LXNA 3GE9A 4X84A 2LU1A 4GRSA 4K50A 4OFZA 3OTOF 3B4MA 3IMQJ 2DITA 4FBTA 1S76D 2M52A 4DV4F 4X65F 2F65A 1SJRA 2O5DA 4HTIA 1R3NA 1G7CB 1N56A 2KZZA 3AB2B 3TR5A 4OZ2A 3RYLA 4ECZA 2M8HA 4QWCA 3IGNA 1IUJA 5AXNA 1KVKA 3GFHA 4N41A 3LO3A 3DYAA 2ASDA 3IRWP 5AXMA 3TJ8A 4URQU 2GQ2A 4U95A 4X4SA 2FJBB 3OVBA 1VK8A 4A8KA 5E0OA 4H4OB 3ET6A 4U9RA 4ZN1A 3D1QA 3MURP 1X4CA 1JLQA 2LP4A 4ZK7M 2KZMA 5L38A 1HNZF 1SL2A 3PRDA 2ZZMA 3NAIA 4MMOA 4CQ1A 5GMEA 4TU9A 2G0IA 3DU5A 1QUPA 2DGTA 5IC6B 2FVSA 5CYMB 2FGOA 5DG8A 2C2EA 1LV5A 3MMAA 4FPIA 5IFMA 2GHPA 1L3VA 4KGMA 2HZAA 2OPRB 2ZD1B 4URGA 3PO4A 2IC3B 2W9AA 2OO4A 1FRKA 2DO0A 3CT9A 2MEWA 4M5JA 5F3TA 5K8OA 1APSA 3MEEA 2UUBF 1MWQA 1CJUB 3DXBA 4DF8A 4USTA 4QPXA 4LSLB 4DR3J 4LRAA 1R8AA 2FTRA 1FNXH 4TVAB 2HFUA 3ZC4A 4OI4A 1FKOB 2C3PA 4OYAA 2V8GA 1VRQC 5CHCB 4G65A 1N34F 1IBLF 1KVJA 2CZ4A 4ZS6A 3HPOA 1BY9A 2HS3A 2MZSA 2E5LF 1O51A 4F7VA 4PXBA 2XS5A 1GK8A 4DL0C 1SKWA 1HBOB 1MWYA 5CAAA 2H5JB 1U2RA 5LSRA 5KT6A 2JRSA 3NS7B 4DR1J 3RZAA 4F4KA 1D8YA 2CQ2A 2GJ2A 1PYOB 3SSQA 3M9OB 1RTZA 4OI2A 1IR2A 2V8HA 4HLBA 1JXLA 2OEJA 3GZ7A 2DVIA 3HZEA 5C7PA 5K8MA 2PFDA 2XHCA 3DOKB 4LF8F 2HIYA 2VG6B 3CCLS 1MLAA 2RQKA 3VAIA 3KWMA 2W8LA 2H3EB 2Y8YA 3K59A 4H4MB 2BMBA 1VI7A 3A3NB 2ILYA 4L73A 2Q79A 1IBMF 2X7IA 5GAHU 5C2GA 3QGHA
chains in the Genus database with same CATH topology
2JLGA 3DLEB 4FXDA 2EPIA 2AJ0A 1A6LA 1QVGR 2AGOA 3VF0B 1QTMA 4KHMA 1V3ZA 1QE1B 3G96A 2J7KA 4X64F 5CYQB 2R7VA 1QSSA 4JV2A 4ECSA 3X3UA 1YRUA 2QA4S 5B0AA 2FHOB 1FDBA 3OLAA 2VA2A 4BS2A 4A8YA 1TKXB 4WFBQ 2JEJA 4IDKB 1FESA 1H38A 3GR1A 1RT7A 2OH2A 4A8QA 1FNMA 1X7VA 2XWYA 1YRTA 4WFZA 1WG5A 3DLKA 1VQMS 4NMLA 2PDAA 2XY5A 1UVNA 1K9MT 4IH5A 4OHYA 1SB6A 4ZVGA 2VA3A 2FJVA 3DI6B 1KN6A 2M9KA 3MMJA 4FF2A 2DNRA 1VC6A 5K9FA 2YVSA 2KH9A 1RA7A 4Y0FA 2ZVSA 3TI0A 1X9SA 5FLXY 1WNEA 5THWA 4NLPA 3MM9A 4OI6A 2CQ3A 4BC7A 3KLHB 4RW7B 1WEXA 4OHXA 5KFIA 1YGYA 5CZXA 5D8HB 4OZJA 5F8HA 3DLBA 1N8RT 3ONQA 2XI2A 5CA5A 1C0UB 2F9JA 3CCTA 1RTDB 3C6TB 1TZ0A 3D0IE 1HNIB 4NCBA 2N3LA 1FRHA 2XWXA 4RW9B 2HAIA 5KG3A 2ASLA 2IA0A 4QBUA 1NEEA 3CCSS 4DV6F 1QAYA 1S1XA 2QE5A 2MZ1A 1HA1A 4AL5A 2HHTA 2POKA 3OQ2A 2BXJA 4KQZA 3BGRB 2E1AA 4X4NA 4HEA9 3CJ4A 2LXUA 1F9FA 2AGQA 4Q2LA 2C42A 3OR1B 1ZETA 2XCAA 4N8OA 2ZZNA 2IM3A 4KT0C 4PRFA 1GH8A 3H4DA 1YTYA 4QZVB 2MHNA 1KOHA 4ILLA 1SV5B 1TAUA 1NK0A 1KRPA 1ZM2A 3H2VE 1SXLA 1FKAF 5K5MA 1U1MA 3NBPA 2PN6A 4F25A 2EFOA 2QSFA 3ISND 2CQBA 3T6BA 4A46A 1HWIA 3WDOA 1S1TB 2JFKA 4F2SA 3GILA 4EBDA 3I6PA 2ILZA 3PM9A 2E5GA 5HI7A 4LSNA 5B7WA 2L3MA 2YKMA 2V8VA 3DM2A 5EWEA 4ECWA 1WEZA 1X4FA 3VZIA 5IT0A 1RTHA 4DL6A 2P9CA 2WONA 2UZAA 1RTIA 1LK7A 2QLXA 2VV5A 3KLFB 3M8SA 4FS2A 5HROA 2B5JA 1D0EA 4B3RF 3RR7A 1VRTA 1FT8A 2ADCA 3US5A 5B09A 3L3CA 1HBNA 5ADZA 2L9DA 4J9OA 3A8EA 1C1CA 4I2PA 2DO4A 3FMBA 2BYCA 1JX4A 3AQPA 5KG7A 4C11B 1HWLA 3NS5A 3QLHA 3CUNA 3O2IA 4OX8A 2I1RA 5DLGA 4A8XA 2R8IA 4ED1A 3I4HX 4OJ3A 5JVHQ 4KTQA 4MKAA 3M32A 4EGLA 1C0TB 3M2VA 3H8YA 1V9OA 5KFLA 1VC5A 1TL3A 5H9FJ 4DR5F 4ED7A 4IFVB 1PO6A 4EEYA 3DLGA 4IG3B 2V0NA 5EDWA 2QA4G 3PX4A 2LYVA 2XMMA 3P96A 2FJDB 5KFEA 3E01B 5EX0A 5KFNA 2F9DA 1AROP 2CDQA 5B0EA 1N6QA 1JLQB 4AQYF 2BQUA 2HRUA 3ULHA 3NAHA 1RT1A 3VAKA 4LF5F 3O5TB 5KFDA 1HMVA 2BANB 4MYUA 4ZPBA 2IRXA 4HT7A 5A6PA 1P9QC 2Q3PA 3DRPA 2W4PA 3FVYA 5KFBA 5GAHI 5HMXA 3OUYA 2XLKA 3DMJB 5I3UA 2F4VF 1FNOA 4NZ7A 4EFAC 3DRXA 2AD9A 1XTZA 3ZZRA 3DFEA 2Z2MA 2OP5A 1RTJA 5L1KA 4C4WA 3ZZZA 1HW8A 2B6AA 4XIUA 4JI0F 3N0VA 4ZP8A 4NYZA 5E33A 1DQ8A 1FJGF 3NG8A 4OMFG 4HTJA 2NZ4A 7FD1A 1FO1A 1JK9B 3OHAA 1LFWA 4H54A 1FDAA 2GNKA 2EG2A 1N32F 3TA2A 3FZBA 1VQ8S 1V6HA 2J8AA 2FJXA 2QEXS 2JH3A 2WBRA 4I6AA 1JLCB 3DOLA 4OZ1A 4IFYA 5J2QA 4DQRA 3ENQA 1WWHA 3LQVA 4KIAA 4C8YA 2UV8G 1VQ5S 1VQKS 2RILA 3HX9A 1IKXA 3OTDA 4RNMA 2VKRA 3BQ1A 1IKVA 1RA6A 1JKHA 4NOHA 3SDEA 3TAMA 5DDRC 3F56A 3IRXB 2ZC4A 4I2QA 3VTIA 2DTJA 2KHDA 1S0OA 4KFBB 4TY9A 3SEOA 1P6TA 4Y28C 4QU6A 1W25A 3IG1A 2Q1LA 4ES3A 1N4LA 2HMIB 1XWLA 2IJNA 3MR6A 1MWZA 4ZDNA 3O44A 3MHYA 3LW5C 1XMBA 2UP1A 1VQSA 1WHWA 3U1NA 4AFFA 2ZJQQ 3TQ1A 2FHJA 1HPZA 5D77A 3V6HA 5HL7Q 2XMJA 1QSLA 3CDBA 4U6PA 4O44B 3TARA 5J1EB 1SJFA 3RB4A 4F4XA 1YQHA 2W9BB 1D1UA 1TAQA 1TKZA 1SH2A 1TQLA 2AJ4A 4I68A 1UVLA 3MI7X 3K5OA 5KFJA 4WZMA 2RS8A 2LQJA 4O0IA 1N52B 2GMJA 2X1AA 3AY0A 2EFVA 2EVZA 4NZ6A 1VQNS 2DNKA 3OFFA 1TVRB 3E8OA 3H59A 4DR6F 3FSIA 3HVTA 2MJNA 3IBWA 1GAOA 2M8DB 4PWDA 4ITSA 3JSMB 3TAQA 3R5DA 5M2PA 4ICLA 2VBXA 3ZZOA 4JV1A 1YBAA 4M1KA 2ZKUA 2VQFF 2RMLA 4ELUA 2W7AA 3MM5A 4WFXA 1Y00A 3KK2B 4F4YA 2CYYA 2VD3A 3QZ8A 2DRAA 4ETXA 4K5RA 4B9TA 3N79A 5CCLA 4K0KF 3M05A 4AL7A 1FRIA 1QSYA 2A3JA 5A0YB 1TKDA 1V3RA 3TVKA 1O0PA 4NLTA 4G3IA 4M63A 2KXHA 4TNOA 3ZZTA 4K2XA 1AW0A 1D8ZA 1TL4A 2Y1RI 4JBCA 1L3TA 1HNWF 4IRDA 1KS2A 2MKCA 4P7TA 1TK8A 1OQ3A 2JEFA 3W2VB 3G6ES 5B0FA 2QMXA 3Q2SC 1LFPA 1S1XB 1XN9A 1YJRA 3NKYA 2DR8A 2R2RA 3CE8A 1DFDA 2PI4A 1WG4A 2AYMA 3FRYA 3I9V9 3TW0A 1QJHA 2XLJA 3I56S 3D2WA 4CO5A 4OZ5A 1X0PA 1BC6A 1YIJS 5I42A 4PPDA 1FKPA 3V5RA 4NLGA 3LH2S 3SZ2A 2J76E 1YJ9S 3HJFA 1RISA 3L7OA 2V4JB 3SSSA 2WB1D 4EBEA 3LP0A 1UVJA 2F8HA 1AFIA 2VOOA 4RNNA 1PILA 3I0SB 1CPZA 2DGQA 2YNIA 1S6OA 2DBBA 2KJWA 2PI5A 1X8DA 4FP9A 4DLEA 2XNRA 2XULA 1T7PA 2B7CB 2QMWA 1ZYQA 3HXMA 1D9FA 3R1HA 1XC9A 1Q82T 1L3UA 2F1FA 3G6XA 2COLA 3MAQA 2APOA 5HQ8A 2RUGA 4DX8H 4ED6A 2J7WA 2WOMA 2LQ5A 2VG7B 1C1BB 3IAS9 1VQPS 2IVFB 4Y2AA 1HW9A 4R5PB 2AV5A 4F3QA 4OJHA 5KFOA 4H4OA 3SMZA 4U7CA 3GIJA 4C8MA 5A8WA 1IQTA 3M30B 1VC0A 5G0RB 3U1LA 2IM1A 5KFQA 1S72S 1WELA 3BS9A 3M1VB 3CJ5A 1X4BA 2CQIA 3R3TA 2BA9A 3HMJG 2RQCA 3DNCA 5JVGQ 2C3MA 4M8LA 2AQ4A 5D6GA 5M2RA 4C3LA 2BR0A 1LWEA 3POTA 1E6VA 2FC9A 3IWXA 2C2RA 4DG1A 3GFXA 5F9LA 1OS5A 5KT3A 3MD1A 5SZTA 3FEZA 3G8TA 4FXWA 1T05A 2P6TA 5L39A 2R7OA 2NREA 2ZH2A 3KHGA 2YQ3A 4UW2A 4FPRA 3TP2A 3THVA 3OTCA 2UVUA 3TANA 3HHLD 2NXUA 3MEDA 4OI1A 5HMYA 3E3XA 4ELVA 4H4KC 1X9MA 1JMTA 4Y6IA 3EXCX 3MPYA 2WRMA 1FRXA 3KLIA 3MD3A 4WFNQ 4DOZA 5KT2A 3QJJA 3CCWA 1TK0A 4DHVA 1VK3A 3PDNA 4QIGA 4XPCA 3CJ2A 3G6VA 2XEXA 2KT2A 4TYAA 2YWEA 2J9DA 3CCUS 1CEZA 2OD6A 5CH7B 3X1LB 4ES1A 1D9DA 4MK7A 2VFTA 3M6VA 5JUMA 3RW6A 2RU3A 1BQNA 4DL4A 3OUYB 4ECYA 4F50A 2C28A 1L5UA 4QU7A 2WBMA 3LAKA 2QIFA 2ZH9A 4CO0A 3PR4A 4DL7A 3QGGA 4MIAA 3DDNA 4Q0BA 3MM7A 3Q8RB 4R0JA 1OWXA 2YNGA 1FRJA 4I56A 2WHOA 4ZCLA 5KFPA 4DQIA 5LJ5Y 1X4HA 3HO1A 3QYYA 4C9DA 4OZNA 5EWFA 4QIWD 1F60B 3MCSA 1S99A 2BDPA 3GMGA 3Q23A 3V4IA 1A9NB 4F3MA 1TKXA 4MFBB 4CI0B 1DHMA 5HP1A 4LSLA 4Q7AA 1RT5A 3BF4A 4R8UA 3ZZYA 1YJTA 5F41A 2Z8QA 2WCXA 1FA0A 3I9ZA 2ACYA 2FHKA 4OQJA 1IKXB 2MSSA 3V6DB 1UW4A 1Y5NB 2D3ZA 5CZVA 2YKQA 3MMCB 1FTRA 3IR7B 3OV7A 3U02A 2YNFB 3MMBB 4TY8A 5E3QA 5DGBA 3OVSA 4X62F 4WKRA 4NRTA 4IUFA 2DK2A 2BOPA 4A4JA 3CF5Q 1UL3A 2Q66A 1T8EA 2G13A 4HKQA 4PQUA 2MZJA 2RH3A 2BRLA 1REVB 4YR2A 4RW6B 3QAUA 4TU7A 1C4AA 1S10A 1N5TA 3CVKA 4EU0A 4CIOA 3CMES 4XAKA 3UNGC 2ZH5A 5KFAA 6FDRA 4QR2A 1HWJA 4DF4A 1QAIA 2MKSA 4FYDA 2GJIA 2HHWA 3CCZA 2E5HA 1RTDA 4DQPA 1K0VA 1RT3A 3UDLA 4NYOA 4UY8T 5AXKA 4LJMA 1QE1A 2HFZA 1WEYA 3C6UB 3RU0A 1F2GA 4F8RA 1LOUA 3MWBA 4EO8A 4DSFA 3W7BA 1ZZNA 2O3DA 2F3JA 1U47A 1NJYA 5FDLA 1TVRA 4ZLPA 4CNZA 3D28A 4V19X 1FE4A 2J0XA 3QWPA 1N0UA 2VUGA 1R31A 3M6XA 2OSRA 2E7XA 2KN4A 2ZH4A 4YUDA 1VLYA 3MR3A 2MPUA 2XMKA 2R7QA 1U25A 1FXDA 2EI5A 2ROGA 3UW1A 2R8KA 1JIHA 4IRKA 3HHNB 3TOQA 3IR6B 1FE0A 5KFVA 2MDAA 3M2RB 2CJ9A 1NK8A 1H98A 4DBQA 2BVZA 1O8BA 4Q8EA 5FJ4A 1XNQF 1EETB 3MXHP 2OIHA 2MY8A 3CGIA 3MR5A 1T3NA 2RD5C 3IFEA 3M9NB 1NJZA 1UVMA 3BGUA 3N6MA 2GHWA 4YFUA 4LSNB 2VPZB 3RBDA 1KOOA 4EZ6A 3LALA 1M0SA 5GMKa 5E2QA 2ZC3A 2B4UA 2DHSA 3DRYA 1S7HA 3GG0A 1PC5A 3CXCR 2A1BA 1M1KT 3VAFA 2X51A 1T02A 2B51A 4ZOSA 1S0NA 3OW2R 2KTQA 3ENVA 5C42B 2ALZA 2MB0B 4CO1A 2W4CA 3GV8B 1HBOA 2ZNZA 3EGZA 1Q53A 4DS5A 3J7ZT 2YWKA 3OR2B 2RDIA 4B08A 2MKIA 4DSIA 2GGPB 2CZVC 5BYRA 3DC2A 3A1YG 1VQ6S 1IKWA 1GXTA 3PW4A 2ZFHA 2OTLS 5SUHA 3GV7B 4CZCA 1HI1A 3M8PB 4QWDA 4A8FA 3LWMA 2W9CA 3EPGA 1SL1A 2D1CA 2AGPA 4I67A 5LL6d 4YMEA 3LOUA 1U45A 1R0AB 5IXUA 3HVWA 4O44A 2J0QD 2RNEA 3VR1A 4OZLA 5B0GA 2CKWA 1GT8A 1RWUA 1C0UA 2VPXB 4IG0A 1WI8A 2XSFA 2D3OR 4Q5VA 1TL3B 2LECA 2HHUA 3D1HA 3NNHA 2J0WA 3TVYA 1JLEA 3B4DA 4J9KA 2HNDA 3RTVA 3ETOA 4OX6A 4RW8A 3ZFVA 1ULRA 2CQCA 2D3UA 2IBOA 3BGRA 4IKAA 2P5VA 4ZVEA 4FBUA 2Y0SD 2YKMB 5AE3A 5B0BA 1NKBA 1OIAA 5AXLA 4I1TA 3QGPA 1Y7PA 1U6BA 4EO6A 4ZHRA 2ZJRQ 5LMNF 2HHQA 2FB0A 3CD7A 1X0FA 2RF2B 2DGVA 3DLKB 3KLFA 2BQRA 3POTB 2I8EA 3K8WA 4D3HA 4I7FB 2B4OA 4CH1A 1KFDA 2OFGX 2OPSA 4P6QA 3NBPB 4ZPWR 1NO8A 3MGJA 5J2MA 5KG6A 3T3FA 1DLOB 4WF9Q 2J9DE 5CYMA 5HLFA 2KFYA 3S6EA 3SV4A 4DQQA 4NLDA 3KLGA 3CC7S 4TQRA 2DR7A 3EGWB 4PPZA 4NLYA 3J81Y 4O4GA 2NUUG 3TUJC 2KFZA 2QA2A 1WF2A 2LU2A 3EGNA 3CB4A 2KO1A 2ZNYA 1RTIB 2U2FA 4BBYA 2XB2D 4Y2IA 2QRRA 4OIXA 2CJKA 3M2VB 4KC5A 2XGQA 3VQTA 2FLOA 1U49A 3PJWA 5DRKA 1MROB 5KFKA 2AJQA 4I2PB 1CVJA 2OPQB 5HBMA 1WI6A 2L48A 1S48A 3MM8B 2XI3A 4IO1A 1YI2S 1AUDA 4BC9A 1XNRF 5G4DA 2FUG9 4YDXA 2EKYA 1CC7A 1FVQA 2DRBA 2JHEA 4ZVHA 2D7SA 2MGZB 2RS2A 2JLEA 1P8GA 5KFYA 2DH7A 2GC8A 6FD1A 3T5LA 4PUOB 3RAMA 4B3TF 2YKPA 3T9ZA 5AJ3F 4DJBA 1HQEB 2YKOA 1ROFA 3DLEA 1FK9B 2D9PA 2JZ5A 4LVOP 1FRLA 3H5SA 2IRUA 3HHEA 1L3SA 3OL8A 3E2EA 2LEBA 2C3UA 2B6AB 1C1BA 2B43A 3PO5A 1QUVA 3EYZA 2FIUA 2XS7A 2BQ3A 4ID8A 3BGFA 1KLMA 4HYKA 1KEKA 2VL1A 4W90B 3GFYA 3CC2S 3MMCA 4PG6A 4UQGA 2FVRA 2YX4A 4RKUC 5LSLA 2JSXA 3U1MA 4U67Q 3KMQA 2R4FA 2ZUGA 4OHVA 3AHPA 2OSQA 3PW0A 1A7GE 1X5SA 4R0EA 1ZTWA 2GQCA 3HT3A 3MM5B 4RU9A 1FXLA 2MHEA 2F7VA 4ZPTR 4CO3A 2AJ1A 3CEDA 3Q22A 4MAKA 4YB6A 1NH7A 4QIFA 3T9NA 2JL9A 4G6VB 2GA7A 4PXDA 3PKMA 3GQCA 2DNMA 3N6LA 2KYZA 3DN9A 4TXSA 1KHVA 1U48A 3DLJA 3AB4B 1F0XA 2OMOA 3WBZA 4ZPCA 5F8JA 2V5HG 2K3KA 4KB7A 5DQGA 3T5KA 4TLQA 3HI9A 3J7YI 2HLUA 3DU6A 2FJWA 3M2UA 2E9ZA 1B7FA 1WG1A 2JVRA 3K5LA 1S1WA 2KJVA 3BM7A 4DR2F 4RUHA 3FGVA 5GADU 1DURA 1TKZB 5L8RC 5IT9Y 3C6TA 4W92B 4NWBA 3H25A 2VFVA 3LPYA 3MM6B 2JOQA 2XS2A 5KTQA 2CG4A 2JLFA 5T41A 4WZQA 4IG3A 1I1GA 2CQDA 2VFRA 1Q86T 3KHLA 5B0CA 4ETZA 2IMOA 3UCGA 4ZCKA 3EXYA 1FD2A 2FLLA 4KO0B 1HBMA