4MKRA

Structure of the apo form of a zingiber officinale double bond reductase
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
343
structure length
328
Chain Sequence
VVVVNKQVLLKHFIPGAPKETDMELVTTGTIRLRVPEGSNAVLLKNLYLSCDPYMRMRMTKYVDDFVPGAPITGFGVGKVVDSSHPDFKTGDYVWGLIGWEEYSLITKPQGLFKIHHTEIPLSYYTGILGMVGLTAYVGFYDICSPKKGERVFVSAAAGAVGQIVGQFAKQFGCYVVGSAGSDEKVNLLKTKFGFDEAFNYKKEPDLTKALKRYFPEGIDIYFENVGGPMLEAVLHNMRIKGRIAACGMEGVHNLFLIVGKRIRLEGFLVFDHYGSYPEFEEKVVQLIKEEKIKYLEDIVEGLENAPAALIGLFEGRNVGKQVVVVSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Zingiber officinale double bond reductase
rcsb
source organism Zingiber officinale
molecule tags Plant protein
molecule keywords Zingiber officinale double bond reductase
total genus 109
structure length 328
sequence length 343
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF16884 ADH_N_2 N-terminal domain of oxidoreductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4mkrA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 4mkrA01
3F9IA 1R0SA 1WMBA 4EZBA 5I7FA 3IUSA 1U8FO 3TFOA 2OORA 5JE8A 2VNSA 4MIOA 1ZMTA 3Q2IA 1JKJA 1VL8A 1Y7TA 3O03A 2PTGA 1IL0A 1PU2A 2G5CA 1E7SA 3AUTA 5BSFA 1EEHA 2OGUA 2W98A 5DBIA 2VYNA 3U4HA 3T4EA 1V6AA 2JFFA 3OBBA 2V7PA 1C0IA 4KWIA 4KQXA 2JHFA 5B12A 4TMFA 5TF4A 1LRLA 5A3JA 4YJGA 2VOJA 2PD3A 4XR9A 4YR9A 2NV6A 1O8CA 2XXJA 3PJFA 4LMPA 5FI3A 1I3NA 4NFYA 3WYCA 4M55A 3MJTA 4GSKA 1JQBA 3GGPA 3ITDA 5IDYA 3PWKA 4RPLA 1YBVA 5T57A 3JQ6A 3H5RA 4J1QA 3TJRA 2YUTA 2V6BA 4OOEA 5LC1A 3GVCA 3WGYA 4EGFA 5CDYA 1PGPA 4MVJD 3CMCO 2IEDA 2NTVA 3KB6A 3GZNA 4IQGA 4E6PA 2Y93A 5L7TA 3JCZA 2EXXA 2POQX 1KS9A 1PEDA 1KVRA 3KO8A 2QHXA 2VZ0A 3IP1A 2RH4A 3VPHA 2HAEA 3BTVA 3EVTA 1YOVA 4BO1A 4TSKA 4U6QA 3KEOA 4XWYA 2YZ7A 3ANMA 4WNIA 1U5AA 3ZWPA 1C3VA 3UICA 1I5RA 3UHAA 4KWHA 4BIIA 4R1TA 2WMDA 4BB5A 3RFVA 1RM0A 4P4NA 4XRRA 2I6TA 5DP2A 1E1MA 1O95A 5I7VA 2C07A 3VPXA 4R01A 3GH3A 3GPDG 1UAYA 3S2EA 3RBXA 3D3EA 5F3RA 2OOSA 3ZWBA 2OP0A 3BA1A 4RLHA 1QYCA 1VE9A 4GAEA 1RYDA 3EZYA 1D1TA 1R16A 1VI2A 4YAJA 4K9DA 2ZIZA 3DEYX 1BXZA 3RUEA 3GAZA 4M1QA 5TJHA 4UEKA 4BOYA 2AW5A 1PJLA 4BNNA 2P5YA 1XQ6A 2VZ9A 4DPKA 2DTEA 1DEHA 3DBRA 3HDHA 2UV8A 2C7GA 1BG6A 3D5QA 1MGOA 4R1NA 4II3A 3ZNOA 3RC7A 2G1UA 4I9NA 2W2KB 3N7UA 4M8SA 4B3HA 2B35A 3IKTA 1E92A 1WDKA 5I8WA 4LCEA 4M49A 1MX3A 1KYQA 3WQQA 4CMIB 2C5EA 2J3KA 2PZJA 3LLSA 1QV7A 2CVZA 4WNCA 2Y66A 1UR5A 1Q1NA 1PJSA 4CR6A 1BW9B 5KNLA 3A9WA 4CLXA 1I3MA 3QWBA 4P22A 3H8VA 1OMOA 1P1RA 2GD1O 1B8PA 5T64A 1ZFNA 1ML3A 5K6AC 3TN7A 4ZQGA 1C1XA 2VRBA 3AU9A 1T2DA 1L1FA 3WTBA 3DBRB 2UAGA 1NM5A 2VHWA 5TQVA 1KEWA 5DBFA 2WYUA 1FJHA 5KVSA 5AXDA 4JBHA 4JCOA 4XB2A 4E5PA 1YQGA 2AG5A 1Q0QA 1ZMOA 4BMVA 3JTMA 2I3GA 4NJMA 3VKVA 4DLAA 1WMAA 2GCGA 1UH5A 1BMDA 5CDUA 1LUAA 5L7YA 3E5RA 1ADGA 4MVJF 5JC1A 3B20A 1ZZEA 2GYYA 1X0VA 2AEFA 3LT4A 5B37A 2Q2WA 2WYWA 2Z1MA 4CODB 1I3LA 1NAIA 4HKTA 5JO0A 1ZSYA 1B3BA 4NBVA 3E9MA 3JD3A 4L75A 4NFHA 1L7DA 3PQEA 5L45A 3B1JA 3QWFA 4CLOA 2YDXA 4UVDA 1DB3A 4LRTB 1B15A 4AFNA 3L07A 4CMEC 4NFSA 4DLLA 4EUEA 2BF7A 2NWQA 2UUPA 3RU7A 1LI4A 2DTDA 3E8XA 1K6JA 4BV8A 1EQUA 2CD9A 4OAQA 3PZBA 2H63A 5DN9A 3FBTA 3JQEA 2FPIA 2B4TO 2BKAA 3LF1A 1P0FA 1GL3A 4HFRA 3K92A 4ZJUA 1R6DA 4OQYA 2J8ZA 5DDIP 2QZZA 3VZQA 1ZXBA 3KYCB 3PYLA 4TQGA 1U7TA 1HZJA 1YB4A 4J49A 2BFOA 1P1KA 1NQTA 4B4VA 1S7CA 3AOEA 3GEMA 5JDCA 2NU7A 2VQ3A 3TSCA 2BHLA 4CMAA 3FD8A 5I8ZA 2GDZA 4XYBA 2HSDA 1P44A 3WWYA 3Q9NA 3TDKA 1OOEA 2OBYA 3KOUA 1JTVA 1NVMB 1SMKA 2EGGA 3DBVO 4O1MA 4L76A 1YBMA 5LDHA 2X5JO 3CEAA 3JQ7A 4E2ZA 3F1KA 1ENPA 3JQDA 4ND2A 3QVSA 5A05A 1C0PA 3D4PA 3OF2A 3OQ6A 2CVOA 1ZK2A 3H9EO 3U4IA 4DQUA 4Y6RA 1OC2A 1HLDA 2WD7B 3GPIA 4LMRA 1F0YA 4E2YA 6ADHA 2W4QA 3QVXA 1NASA 4RLSA 1R15A 1U5CA 3BHJA 1Q0LA 1PGJA 1B3RA 4I5EA 2C2YA 3HNPA 3TZ6A 3K5PA 2V6FA 2RBEA 4XIYA 3OJFA 3WICA 2EJVA 5L3ZA 4YT5A 4PLVA 3VZSA 3LK7A 3F5SA 4WCFB 3OH8A 4YTEA 2QYTA 5U9CA 3DHNA 1W8DA 4B7XA 1YDEA 3ZW8A 3S55A 4GPD1 1UXIA 4EYEA 3U3XA 4BO6A 1NHWA 3V5NA 3QSGA 1YOVB 4R9RA 2P9EA 4N7RA 2B4RO 3FR8A 1KVSA 1HF3A 5A3VA 1KVQA 2D8AA 4HY3A 1PZEA 1Y8RA 1XA0A 4GKVA 2Q1SA 4DWVA 3ZN2A 5JDIA 4IIVA 4Z0PA 3V1TC 4FCCA 4B8WA 2ZB4A 5FF9A 1I01A 1MC4A 3LC7O 3GMDA 1TEHA 4XA8A 4IGEA 4DPMA 2BFAA 2Y1OA 3BTUA 4H15A 1YL6A 4NK5A 5ILOA 2C7VA 3H6KA 4NBTA 3N58A 3U4DA 4XEHA 3WGGA 1DFIA 1EDOA 2IODA 4FFNA 2OO5A 4F46A 3KM0A 4MKXA 4QEDA 5F5NA 3QHAA 1XWFA 2AA3A 1GUYA 1TB4A 4Y6SA 2C0CA 3WYBA 5GY7A 1GY8A 4YJDA 1M76A 4BMNA 2UVDA 1LDEA 3OJEA 3ZHXA 4E32A 2PKQP 4BHTA 1EDZA 3CINA 4PVDA 3KEQA 1T25A 3V2UA 3RAJA 3UUWA 1YKFA 1GZ6A 3ZV4A 2EF1A 1DXYA 1PJCA 3EK2A 3SC4A 1LU9A 3GEDA 3ZHZA 5HWSA 1BW9A 1HDZA 4XQCA 1VJ1A 3AK4A 4UUPA 4K6CA 4KUEA 4NH4A 3MWDB 3JD4A 3P7MA 3E82A 2NM0A 1EUZA 1GQ2A 1ZKMA 1GADO 3IOYA 3PDUA 1ZIDA 4J9UE 4AJ4A 5JXWA 1LSSA 3SVTA 5I9NA 2NQ8A 1J4AA 3DC2A 1OBFO 1CQIA 2PKRA 1ZK3A 3GQVA 3HG7A 4IIUA 3PJEA 1V35A 4LVCA 4OSOA 4IDEA 1C1DA 3DFZA 1LDGA 1ISMA 4XGKA 1EE9A 1FK8A 3H5NA 4FFMA 1HXHA 3WFIA 1EBUA 3D4NA 4WJZA 4BNZA 1E7QA 3NT2A 4IINA 4RDIA 1U2GA 4GI2A 4CQMA 4GBJA 5CAEA 3ANNA 1RWBA 1NR1A 4IXTA 3PQFA 1HYHA 5GMOA 2VCYA 2ZYDA 5JAQA 4CM9A 5DT9A 2LDBA 3MJEA 4TRJA 2AE2A 3RROA 2WM3A 3U09A 1PWZA 4FJ0A 4IY1A 4YCAA 5KKAA 4YQYA 4E33A 1E3SA 1KERA 1YB1A 2H1SA 2OHXA 1B0AA 1A4UA 4C7JA 3X2EA 5G0WA 3WGZA 1JKFA 4D43A 2B4QA 3A4VA 1K89A 5JAZA 2Y1FA 1DSSG 4OXKA 5BNFA 1Q7CA 3K9QO 4NU5A 3DAGA 1NTOA 2TMDA 2D5CA 3WQSB 4WEQA 4PVCA 2GLXA 2OMEA 4QSMA 1JAYA 1HDOA 3JQCA 1G1AA 4NMHA 2NU9A 1ID1A 3VDQA 4HADA 2RIRA 2D3TA 1E5QA 1UP4A 3G3EA 3W4KA 3WXBA 2E49A 2GN9A 1R4NA 2HK9A 2HRZA 5L4NA 4ZQFA 2DVMA 4CPDA 2ZB8A 4J7XA 4Q3AA 4KOAA 3WSWA 3F6YA 3R1IA 1LTHR 4K1LA 3LT2A 1D4FA 4MVJM 4B79A 5U4QA 1E6UA 4HWKA 2E48A 3ZDFA 4DXHA 3QJ5A 4W6ZA 4IMRA 1I10A 4DRYA 1KEUA 3ENKA 1HLPA 5T8KA 3FTPA 3NGXA 1IYZA 3L9XA 3V8BA 3RBVA 4XYLA 4PLCA 5L95A 3CZRA 1KOLA 2JD2A 3B1KA 2DAPA 4PLYA 4R16A 4GGPA 4LRSB 4DLBA 1PS9A 3GAFA 3L6DA 4Q3NA 1ULUA 3LZ6A 2IXAA 4FS3A 2JCVA 4MKZA 4FFLA 1EUCA 4QFCA 1XG5A 4ZN6A 3DTYA 3C7AA 1U9JA 4DYVA 4XQGA 1XIVA 5AYVA 5DZSA 3JQ9A 3KYBA 1K3TA 5A4DA 1SAYA 3GEGA 1GCOA 2OFPA 3WQRA 2ZJ0A 3AI2A 5EMHA 2HJRA 4UUMA 2HQ1A 4G65A 3GA0A 3ROMA 1ISIA 3M2TA 1P0CA 4MO2A 5KOIA 2A9FA 5KTKA 5TX7A 1NFFA 1XYGA 1GZ3A 1X1TA 2DQ4A 4DIOA 4E31A 3LC1O 1XGKA 1UZMA 1PJ3A 1ONOA 1AXEA 4A2CA 1HDXA 5TNXA 3UXYA 4ESOA 3QQPA 1X1EA 3JYQA 1HETA 5BT9A 3TOZA 1CETA 3JD1A 1GEEA 4QO8A 4PG4A 3FWZA 3GRKA 3KVOA 2J5QA 1NXQA 5KVCA 2PH3A 2UYYA 2X8LA 1Y9EA 3OJLA 2GR9A 3D1LA 4YACA 4ALNA 1FDWA 3EGOA 3JQFC 3OJOA 4I5DA 3S2FA 4A73A 1MV8A 1U4SA 1H5QA 1V3UA 3H2SA 1ONPA 4CM4A 1MUUA 1QKIA 3DO5A 2J3IA 3WYEA 3HB5X 5IXYA 3AI1A 1T1RA 1QMGA 3GGOA 4NNJA 1W0CA 4TRNA 5A06A 1B8UA 1PWXA 2BI7A 5AQ1A 1A9ZA 1NAHA 1I2BA 1E1LA 2HDHA 4HXYA 4FIZA 4EUHA 4F3YA 4BQRA 3AI3A 1YVEI 3AJRA 4J91A 1A72A 2QYSA 5ENVA 3NUGA 3H9GA 3C7DB 2ZQYA 5T8KC 3OQ1A 3RUCA 1EK5A 2CF5A 4I5GA 2I66A 2W90A 3ZU3A 4FFRA 3NV9A 5EIOA 4D44A 1B7GO 1M6HA 1SPXA 1GV1A 4C4OA 4B4WA 2PFGA 1I2CA 2VOEA 4A26A 3SEFA 4X54A 1CRWG 3OP4A 3MCVA 4BNUA 1MB4A 1PQWA 4ND5A 3L0DA 5DCUA 3WS7A 3DMTA 1PJQA 1HTBA 3DZGA 3MJ4A 2GASA 3RI3A 4RPJA 1MLDA 1HDRA 4PIVA 3Q9UA 1E1NA 1MG0A 4ZQBA 2QIOA 5G0VA 1F06A 1GDHA 1SC6A 3P5SA 4F6LA 5JPIA 2J5KA 1NR7A 2GSDA 1VL6A 1YGYA 4XRGA 4WUVA 1Y8RB 3BAZA 2I65A 1TT7A 5A02A 2CFCA 3IAHA 3WGIA 2PZKA 1LC0A 1WAMA 2GN4A 4F6CA 3F47A 1V9LA 2JAHA 1HDCA 4N5LA 5I9MA 2O2YA 2JKVA 4Z0HO 4JJGA 2VRCA 2QRLA 3CXRA 3BMQB 4W99A 2QX7A 3AW9A 3BTSA 4QECA 3PXXA 2YHIA 1DJQA 5F21A 1VSUA 4BGEA 4IDCA 4QT0A 4E30A 3WIDA 4Z9FA 2VTDA 4YRAA 1UDCA 4ITUA 5A9SA 2C2XA 1U4OA 1WNTA 1PQUA 4YYZA 5B1YA 5B4UA 3S1LA 4KMSA 1DDOA 2FWMX 1H9BA 3GVIA 3IS3A 1LRJA 3RKUA 3PJDA 5BQFA 2JFHA 4ID9A 4Q9NA 4KQWA 4TZKA 2GPTA 1N1EA 1HKUA 2YHIB 3ETGA 1ZNQO 1VM6A 1YE3A 4FFOA 1LSJA 1UZNA 4MVJG 3I9NA 4ALLA 4PLPA 1LLUA 1YJ8A 3NT5A 2OZPA 5EINA 3WX0A 3K30A 1YO6A 2PH5A 3HSKA 3RFTA 4LK3A 3D7LA 5CDGA 3ONFA 3NTOA 1H6BA 1BXGB 2DBRA 2HK8A 3BZUA 2O7QA 1HDYA 3CUKA 1SOWA 4U8GA 5DOVA 3ZU5A 3DZKA 3W8DA 2PGJA 3JQAB 2PNFA 1F8FA 3PYMA 1BSVA 4WCDA 1YL5A 4BB6A 4ZICA 2E82A 4YWJA 3HFGA 3UFXA 4EUFA 2I76A 3DZJA 4JROA 4DYDA 2RCYA 1XLTA 4BVAA 2O7SA 3A28A 4F45A 4ZQHA 3GY0A 4PRLA 3DAPA 4R9SA 1P1JA 2OUIA 1GUZA 2ET6A 4FJ2A 3I9JA 3SLGA 2X86A 4EJ0A 5JW6A 2EKLA 2EP5A 3DONA 2VZ8A 3WDSA 1JAXA 5H81A 3SJ7A 1RJWA 1NQOA 3K2EA 3KYDA 4RZIA 3G1UA 4TVOA 2DPGA 2E4AA 3BMCA 5AOVA 1P45A 2JL1A 4JN6B 2GZ2A 3PLNA 3PVZA 1HDGO 5TS3A 1GFSA 2CSUA 2Q46A 1NVTA 1HT0A 1NWCA 2ZK7A 2O3JA 4BO7A 3JYOA 3TRIA 1H9AA 1TT5B 4S3MA 3GG2A 4MKRA 1CDOA 1UDAA 3GG9A 4OXNA 5BR7A 2XPCA 1Z45A 2IZ1A 2HMVA 2PLAA 5EL0A 3ZU2A 2VT2A 5CFZA 4YRDA 4Y9DA 1O89A 1SBYA 3GN1A 3SLKA 1FDSA 2C5AA 1Z73A 2HMUA 4ND1A 4YVFA 2B83A 2YJZA 2VWQA 3V2HA 1H2BA 3JQ7B 1MXHA 4Y98A 1BXKA 5CPFA 4Z9YA 1UXGA 4A7PA 5CDTA 1O9BA 2VHZA 1H6DA 3PHLA 4JGBA 2Q45A 2H9IA 1HZZA 1J0XO 1ZEJA 2AG8A 4W4TA 3WTCA 3ZV3A 1G0OA 2X22A 1NP3A 3HN2A 5F1OA 2O3UA 3ZNNA 4A0SA 1GEGA 4K26A 4OQZA 3G79A 4D3DA 3JD2A 3TQHA 4AJPA 4UUNA 1N92A 4RF3A 3ENNA 5HBRA 2YW9A 1IZ9A 4RO0A 4JP2A 3WGTA 3I4CA 1W6UA 1Z82A 1LDBA 3PHJA 3GNTA 4O0LA 4CMKA 3K31A 4Q39A 2H5LA 3BMOB 2FR8A 1NBOA 2DM6A 2DC1A 3O38A 4GX0A 4OOFA 3NDIA 4ALJA 2ZTMA 3OA0A 5DOZA 3KSUA 1AHIA 3JQFA 4IJKA 4LSMA 5H82A 4D46A 4IS2A 1Q7BA 5A04A 3KHUA 4NG5A 1B2LA 2O48X 3CIFA 1R4MB 2X9NA 4ZRMA 1UUFA 5U1PA 5ER6A 5LDGA 2FR0A 4XB1A 5JO9A 5IJZA 3BMCB 2VYVA 4CUJA 9LDBA 4FPXA 2JD1A 1KEPA 1GQQA 2C20A 4CL8A 1SB9A 3E9QA 2GF2A 1CYDA 3RJ9A 1EMDA 2FMUA 4UVGA 4R4JA 4YAGA 4KDEA 5BNTA 3HADA 1SOVA 4KTVE 1RPNA 4WLEA 3JYPA 1J5PA 4INAA 3JQ8B 2PZMA 3PFWO 1ZJZA 4L0QA 1CQJA 4WLNA 1WP4A 2Y68A 4AJ1A 4CLOB 1A71A 1LQUA 5F5LA 4FR5A 1VKOA 4WGGA 4D0SA 2O4UX 1E7RA 3COSA 4J1TA 3BXXA 4U5QA 4XDZA 1PL8A 2W2LD 1GPJA 3FCOA 2I5PO 1OI7A 3F4LA 1MC5A 2FOIA 2VHVA 1VL0A 4GX2A 3EAGA 3KYDB 1WW8A 2A35A 4GLLA 4OIMA 2QRKA 3U9LA 3NTQA 4RL6A 3TOXA 4IGFA 5A9RA 3OEYA 3CPSA 1I32A 5C37A 3PIIA 2P9CA 4BKPA 1F8GA 4ZRNA 3GFGA 2ZKLA 2EWMA 4B4UA 1YDWA 4U7WA 1ZXLA 2Q50A 4HNHA 2FRDA 4E5NA 4AJJA 4CMJA 5A5EA 1O94A 1DRUA 1UP7A 4RJTA 3AY6A 2HJSA 4IDFA 5BSHA 5L53A 3RUAA 1XKQA 3TPCA 2A4KA 1ADBA 3DXFA 1FDUA 4JJIA 4GWKA 5JC8A 1V3VA 4BNKA 4CL3A 3QP9A 3EY4A 3H9UA 3W6ZA 3CE6A 3HDJA 2J5RA 3FHLA 3GUCA 5I7SA 3ICPA 2F00A 3DOOA 2O2SA 5L9AA 1KVTA 1WDLA 3WLEA 2NQTA 1QLHA 1PS0A 9LDTA 1ZUD1 4M87A 3P2OA 1N9GB 1N7HA 1IZ0A 1FDVA 4D41A 4BGUA 1NYTA 3O4RA 4L73A 4RF2A 1DRWA 2AEJA 1SNYA 4NBWA 1DIRA 2C59A 1LC3A 4DBVO 4PLGA 5CPBA 4EITA 3JD0A 3VDRA 3W8EA 5IN4A 3DB2A 4J6FA 1PGOA 4TROA 4HFMA 5KJCA 1D3AA 1UJMA 1JWAB 1MFPA 4JJFA 3F46A 4JXKA 2CY0A 1BVRA 4MVJP 2WTBA 4D3SA 5C7LO 4PZEA 5EJ2A 4O63O 3ZCXA 1H0KA 2WE7A 3NJ4A 5COBA 3U49A 5EESA 1X7DA 4HFNA 1IHXA 3C1OA 2CDCA 1EK6A 2X0NA 3PWSA 1N7GA 4BNFA 5IDWA 3QVTA 3WGOA 4CLRB 4YXFA 3GNQA 4AJ2A 2JAPA 3RUIA 2AQ8A 4ND3A 3OJ0A 4PRKA 4AJNA 3ZNQA 2B5WA 5DCYA 2FPPA 2BELA 4N5NA 3I9LA 3RU9A 3ONDA 4AJLA 5CDSA 2NUAA 5G4LA 5A9SB 4HP8A 2GGSA 4RQUA 2IZ0A 2YQ5A 3ORFA 2NVWA 3QWHA 3W4IA 1Z6ZA 4A27A 1WLYA 1PZFA 1JWBB 4J4TA 2NSDA 4LN1A 1YONA 2X0JA 4WKGA 2HMWA 4MVJA 1VJTA 3GDGA 1TI7A 3RC2A 3GR6A 4GWGA 1QYWA 1PJBA 3GLQA 1A7KA 4YAEA 1LX6A 2D4AA 3LVFO 1QR6A 1E3IA 4D0RA 3ZWOA 2BI8A 1DOHA 3EUWA 3S2IA 1HSZA 4P4LA 4PG5A 2P5UA 5JDIC 2AQIA 4IBOA 1G6KA 5FYDA 4WLOA 3SJUA 5TRTA 1VKNA 3ANLA 2X0RA 4PZDA 4D3FA 5JFOA 2Y1EA 3WG9A 1EFLA 4XDYA 1EVYA 4S1VA 4Z6KA 5JY1A 4YT8A 3BIOA 1ONNA 3LC2O 2RAFA 4L4SA 1SB8A 3EMKA 4RF5A 4Q3CA 3ZWNA 3I52A 3IP3A 4CLDA 1LDMA 3L77A 2EP7A 4FOSA 5I7EA 2ZB7A 3G17A 3L9WA 2GN6A 1YL7A 2WD7A 4N54A 2EIHA 2UDPA 3ZWCA 2C54A 1M6WA 1DLJA 3BMOA 3I4FA 4WOKA 4H7PA 1CWUA 3W6UA 3IJRA 4HFJA 1VJ0A 3ZWMA 4N5MA 4WOJA 1A27A 2ZTUA 2BFPA 2VYND 4GMFA 1EVJA 4CMEA 4R5HA 2HMTA 2RH8A 4OJNA 4XR4A 3RASA 3JYNA 4XQ9A 1I24A 3T7CA 3V2GA 1N8KA 4CQMD 4IDDA 4FQ8A 4TKMA 3GVXA 3IJPA 1CIVA 1QSGA 4JBGA 4WECA 4BO3A 3PFFA 3SXPA 4OKIA 3WNQA 3DOJA 3PLRA 2OBNA 1MP0A 3RQSA 1GCUA 1NNUA 3M6IA 4CMHA 3PWZA 2PWZA 1T24A 4BNXA 4RVFA 4HUJA 4FOOA 5F1PA 1O6ZA 1GZ4A 2YHUA 3EYWA 2O50A 1ZK0A 4PFJA 4RPHA 3L4BC 5G0SA 2P91A 3KRTA 4H16A 4A10A 4BQPA 1D1SA 2OP1A 1QRRA 2X23A 4G81A 1ZEMA 1IHYA 1ZBQA 3M1LA 3OETA 3QA9A 4W7HA 3INTA 4IJVA 2IXBA 1A7AA 3KTDA 1DRVA 1LDNA 3AM4A 3FNEA 3HN7A 2AQKA 3Q3CA 2ZTVA 3ZWAA 1T2EA 2X58A 1YQXA 1LRKA 8ADHA 1WZIA 5G2OA 2VRCD 4GX5A 3ULKA 2LDXA 4IDGA 3QWAA 4MIYA 1C1XB 4YAKA 4UREA 2WD8A 3KSDO 4FC7A 1E77A 3RBZA 5JCXA 2BGLA 1NFQA 3CSDA 3L4BA 2FP4A 1YBAA 3K73O 5L4LA 4YT4A 2P68A 4XJTA 5JMWA 5JDCC 3GDFA 1P77A 2PKQO 7MDHA 1E0DA 3H65A 4IQ0A 1EFKA 2IDZA 3B70A 1UXHA 3FPLA 1BDMA 3G1TA 4U0JA 4XX0A 4BNJA 1Z7EA 3INRA 4DGSA 4RV9A 2DBQA 2W2LA 3RIHA 4XQEA 3C1AA 3F3SA 3ZV6A 5JYEA 2ZTLA 1Y9AA 4AJKA 2CMDA 3GVHA 2NACA 3IUPA 3A06A 2DFDA 5JCJA 3O9ZA 5AXCA 5KVQA 3DBLB 4NU6A 1LEHA 4NDNE 1ZO8A 4PLFA 1K6IA 1ZSNA 1WPQA 1KETA 2FN7A 5AVOA 1C1DB 5KVVA 5T5QA 5AXAA 2Y1DA 4KZPA 4Y8VA 3PRJA 2CZCA 1WZEA 4DPLA 1R37A 1PQPA 1XSEA 4IS3A 1N2SA 1K0UA 1H94A 3BTOA 3MZ0A 3UH1A 4YAIA 2EEZA 3WIEA 3I6IA 4RVUA 4WLFA 2PD4A 2IYOA 3E9NA 3OMLA 3W4JA 4BNVA 1Y81A 4MP6A 4Z9XA 4LW8A 1V0JA 4GKBA 1E3JA 1JW9B 1E7YA 4DVJA 4YBZA 4OKNA 2O4CA 4WLVA 4LGVA 2I3AA 3PP8A 3INGA 2Z5LA 3I9KA 3VAZA 4JNKA 3WJAA 2HMSA 1KVUA 1XU9A 3WB9A 3IL2A 3OIFA 5HA5A 5A1TA 2YV1A 5FI5A 3I9MA 1HYGA 2PR2A 2GUGA 5T6BA 4ZVVA 4IZIA 1FF9A 5MDHA 1KEVA 3NAQA 1DLIA 4AG3A 2PGLA 4PN3A 2Q2QA 3RKRA 5COAA 1UDBA 1EQ2A 2QZ9A 2VWHA 1ZW1A 2NADA 4QTZA 2FZWA 3SC6A 4UVHA 2NNLD 3QE3A 1DHRA 4NJOA 4R3NA 1E7WA 4PCVA 4BKQA 5IXSA 1Z75A 2EW8A 4GL4A 1YS4A 3WFJA 3RD5A 1OAAA 4EJ6A 2HUNA 1WVGA 4J2HA 3RWBA 5GZ1A 4NQZA 3FWNA 3DMTC 1EE2A 3H2ZA 3H3JA 3TZCA 2FZEA 2Y67A 1BXGA 2HU2A 4UVIA 2VWGA 1LXCA 1XQ1A 5CEJA 5K9ZA 5HRUA 1NPYA 1R4NB 3ETDA 2WEKA 2X9GA 3EW7A 3VPSA 2XF8A 2V6GA 3QVOA 2BRUA 4YJHB 2VYVD 3NTRA 4CV1A 4RVGA 1LSOA 1HE5A 5GZ3A 4QFDA 2WSBA 1ZK1A 3RCBA 1IUKA 1PZHA 1QP8A 1SEPA 2EHDA 4J4BA 3VZRA 1GYPA 3IKVA 1M75A 2PV7A 1VRWA 2HLPA 5TGDA 3PI7A 4D45A 2D2IA 1RM5A 3DZIA 3DMYA 2X1HA 2X4GA 2FSSA 3PGJA 2DBZA 4YJHA 4CM1A 2E6UX 5J23A 1J6UA 2NLOA 2P9GA 3LT0A 1V3TA 1NPDA 4ONEA 2Y99A 5DNAA 1F14A 2VN8A 4II2A 2UUOA 1C0LA 4KUGA 2VNAA 4WASA 4EJMA 4ROSA 5TT1A 3WMXA 1U3UA 1SZJG 3E1KA 5ADHA 3D64A 4GMGA 1MG5A 4MP3A 4E5YA 3TZHA 4TRRA 2Q49A 1ISGA 1GD1O 2Z95A 1GPDG 3JQAD 4L4RA 2XAAA 4FD3A 1E3WA 5TJ9A 1N5DA 2NVUB 1QORA 2YYYA 1IPFA 2YFHA 2TMGA 4I08A 4WCFC 4KUHA 2H6EA 3AM5A 5LCXA 1P31A 1Y5MA 3AFMA 3K6JA 3KSZO 5L7WA 3DDNA 3DBLA 3PK0A 3PPIA 3OEWA 4CM8A 3KZVA 2GRAA 2VUTA 3FNFA 2HK7A 3H9QA 5JAIA 3SX2A 2WE8A 1EZ4A 3PQDA 4DQXA 3U62A 2HRBA 2NU6A 4RPKA 4IPTA 3ZV5A 4E5KA 1DC4A 1DFHA 3R3JA 4Z3DA 1DC5A 1P1HA 5G0UA 3R6DA 3U0BA 4QXMA 3IC5A 4I5FA 4RGBA 4DQVA 4MINA 2DFVA 4XIJA 1U2DA 4CJXA 1QXSA 4OHUA 2FY8A 5C7IO 3OICA 3EHEA 4RPGA 1AN9A 1V8BA 3DHEA 3NX4A 1BDBA 4FSHA 5AXBA 3AWDA 5COQA 3O8QA 3HWRA 2AHRA 3MEQA 3D3WB 3ABIA 1HE3A 1EVZA 3AOEC 2DPHA 3DBHB 1M67A 3DFUA 3B6ZA 4IJWA 4BS9A 4Y6PA 1JU9A 5IZCC 1E5LA 1QYXA 4CR7A 3I23A 1YQDA 1PS8A 1NPTO 1NFRA 4MVJE 3WOHA 1DIAA 4FDAA 3VC7A 1T4BA 3R3SA 3AUUA 2GN8A 2Y1CA 1W73A 4R54A 4Z3KA 3OQBA 1MXFA 5TLSA 3NJ8A 2ZYGA 1HSOA 3FTNA 4W9NC 4J7UA 3WR5A 1R4MA 2IEBA 3LDHA 3HZZA 4J4HA 2V6MA 4TKLA 4URFA 4EBFA 4EW6A 3QWIA 4K6FA 3RUDA 3QVWA 3TZKA 3G0OA 5JNLA 1JDJA 1ORRA 1I3KA 5A03A 4E5MA 1LDYA 1AHHA 3FF4A 2Q4EA 3WNVA 1ISFA 3TL2A 3DTTA 1P1IA 1NVGA 1UXJA 1C14A 1P1FA 4NHEA 1XEAA 4HBGA 1TLTA 2GZ3A 5TC4A 4JK3A 1E6EA 4MOWA 5DP1A 4PG7A 1DHTA 5FEUA 1BHSA 2DBVO 5A9TA 4TZTA 4DL9A 4DIFA 5IF3A 1ADCA 1Q0HA 4DIBA 3ZGYA 1NHGA 3JQ8A 3X2FA 3K8ZA 1GU7A 4EDFA 5G4KB 4L9RA 4MJLA 4RORA 4N18A 4YPOA 2CVQA 4PZCA 1LQTA 3DL2A 3HDQA 3TNLA 3WSVA 2NTJA 4OMUA 5KWEA 2ZATA 1Y5RA 2XOXA 3H7AA 2Q3EA 4J1SA 4R51A 5C5IA 4BNMA 5JCJD 1B8VA 1JVBA 3NEPX 5CG1A 2NTNA 1ZH8A 3PTZA 3GN2A 5EN4A 2IRWA 3MJSA 1PZGA 5KJ6A 3UF0A 1XR3A 4BNIA 3VOSA 1Q7GA 4BMSA 3D5TA 3MOGA 3JQBC 2ZB3A 1IB6A 2VUSA 1XDWA 4GVXA 3V1YA 3WMWA 4CUZA 4QQRA 1YXMA 4O6VA 3G49A 1PR3A 3E18A 4CM7A 5TIIA 4IMPA 4E4YA 1BWSA 3AY7A 4M86A 4FBGA 1R12A 2NVUA 4PLZA 1T4DA 1GYQA 4FC6A 3STHA 4ALMA 5IZ4A 5JSFA 1QG6A 2R6JA 4NJMB 3EVNA 4IDBA 4YEDA 4CM8B 2Y1GA 3MTJA 5THKA 3TL3A 3ROKA 3PGXA 2P2SA 1GAEO 3K96A 1MA0A 1NWHA 3KUXA 4BO8A 4YT2A 2JCXA 2X6TA 3Q1LA 2G17A 4XCVA 4XGIA 3UCXA 1ENZA 4NZ9A 4YRBA 4CMIA 1YJQA 2Q4BA 2Y0DA 5C7OO 5FWNA 3VH3A 4B8ZA 3I1JA 3Q0EA 1T2CA 4ZD6A 1KIFA 4GQAA 3JV7A 3W8FA 3KV3O 4RF4A 4IM7A 2PGDA 1DPGA 1T26A 1RM3A 3PEFA 5JY6A 3O8QB 1IE3A 2B36A 4XYMA 1Y1PA 3GUYA 4D79A 3RC1A 1BVUA 1FDTA 2ZQZA 4L8VA 4W9NA 1TVEA 3R0IA 2QQ5A 3VH2A 4J3FA 4MP8A 4P38A 1TA4A 2X9VA 1LLDA 2CUKA 5EERA 1FXSA 3W1VA 4BGIA 1AE1A 4R69A 4CUKA 3JQGA 2IYPA 4CM5A 3GFBA 2YDYA 4YDRA 3ST7A 4CQLB 4Q3BA 2HO5A 2O23A 1P3DA 2FPGA 1N1GA 1P9LA 4O5OA 3AM3A 4R3WA 1HE4A 3HUDA 3E48A 4WEOA 5A5FA 1O5IA 3OFSA 3WJ7A 2DLDA 1GR0A 4JLWA 3D4OA 3NT4A 4CMGA 4LISA 2EG9A 3F1LA 3KETA 4GVLA 3QRWA 1I36A 4ILKA 3Q6IA 3BMNA 4GGOA 4A5OA 4OSPA 3BMQA 3NYWA 2ZJ1A 3PJGA 3AUAA 3JQAA 1U7HA 4EEXA 3EC7A 4IQ8A 4FGWA 1NX6A 3ZW9A 5EQDA 3LLVA 3JQGB 2SCUA 4JX8A 5HS4A 1AGNA 2DU8A 3PHGA 3P2YA 1OC4A 2J6IA 3ZH2A 4IDAA 5ITVA 1RYEA 4LCJA 4P8RA 2C29D 4Q3EA 3BMNB 1ADFA 1CJCA 3ON5A 1DC6A 4L74A 3VVBA 2QG4A 1J49A 3B1FA 5B4VA 2BGKA 2QRJA 2V65A 3OHSX 5ES3A 5IG2A 4WCFA 2AMFA 4XZ3A 4B7UA 1GTMA 3Q11A 3FI9A 4J43A 4ZGWA 1HYEA 4PGFA 4BNTA 2VUUA 1XCBA 4D42A 1DIBA 3DZHA 4HNGA 3I83A 3P19A 3RFXA 5HTOA 3IDSA 4QO7A 3A1NA 1Y8QB 5ITWA 4IZHA 5IAAA 1H2HA 2ZYAA 3NDJA 4R1SA 5HM8A 3C8MA 1PGQA 4MPDA 5ER9A 1OZAA 4XYEA 2X0IA 3LT1A 2GNAA 3VVCA 4ZHSA 1T2FA 2YY7A 3HHPA 4I1IA 2W2KA 3AU8A 5EQFA 3GZ4A 3LQFA 4LSWA 3VTZA 1PGNA 1F17A 3FR7A 4W7IA 1DFGA 1A5ZA 1LSUA 4AVYA 4CLEA 3D0OA 1CERA 2EV9A 3MJVA 5KJEA 3NGLA 4OM8A 4UEOA 4DC1A 2CDAA 4UEJA 5CEFA 4NR0A 3M1AA 3UVEA 4J90A 3JYLA 1R0KA 4CQLA 5BSEA 5IZCA 1E7MA 2B37A 2PY6A 4NK4A 1IY8A 3NDRA 4PLHA 4MDHA 5KIAA 3PIDA 3D3WA 1C0KA 1M66A 2BGMA 2FSVA 4IUYA 4R68A 2PZLA 3DHYA 4O59O 3RVDA 4CV0A 4MVJH 2EERA 3ADPA 3GNSA 4L4XA 2XXBA 4DUPA 4BUCA 1IULA 1U1IA 8LDHA 4BNWA 1JKIA 4AICA 2G76A 3KLMX 4GH5A 5ICSA 1U28A 3GK3A 3QY9A 1K6XA 4J1NA 3VTFA 3GF4A 4PLWA 2G0TA 2NU8A 3EZLA 4I8XA 1H6CA 5JMPA 3VKUA 3UAGA 2A92A 4B4OA 4R41A 1JN0A 2Q1WA 4J0EA 1EVIA 1KY5A 3UCEA 3ZHYA 3UW3A 1EUDA 1PL7A 5HS6A 1PL6A 1NQ5A 1B16A 2PD6A 2WYVA 2NVBA 4CM4B 5CG2A 4I9UA 5DF1A 3GVPA 3C24A 5CHEA 3PYXA 1SCUA 1LBEA 2B5VA 4R1UA 4NPCA 5DULA 3L4SO 4FJ1A 3FRJA 5CEEA 3DZBA 2X5KO 1PR9A 3ICCA 5BSGA 1B26A 1QLJA 4KP7A 5GZ6A 2I67A 1K2WA 4WK6A 3RJ5A 1VC2A 4TRMA 1PSDA 4AJEA 2AXQA 1LJ8A 3ASUA 3OM9A 4HX5A 3DBHA 3LYLA 3QIVA 3GMSA 5JLAA 1U3WA 4BO4A 1S6YA 4DREA 5JBIA 3FNGA 1GV0A 3ASVA 2GO1A 1X0XA 4Q3DA 2AQHA 3WWZA 1E6WA 4R5MA 3C3XA 3PZRA 2D1YA 4DTIA 2DTXA 2J3HA 4UVEA 1Z7BA 4E2XA 4BKRA 4YA6A 1WXDA 1ZJYA 1CEQA 3CMMA 5IDXA 1KBZA 3DR3A 1DIHA 1I8TA 4OYRA 4BNGA 3E6AA 4DMMA 4RVDA 3T4XA 3N74A 3ZHBA 1PJTA 4JBIA 1Z74A 3GC6A 1X14A 4NI5A 3H9JA 4JP3A 4KDFA 5C3MA 5KJ1A 1P74A 2YFQA 4AJHA 3GT0A 1M2WA 1R0LA 4KTTE 3JQ9C 1DO8A 3BYZA 2YV3A 1UAGA 3F5QA 3U5TA 1KC1A 3I9OA 4CV2A 4J16A 3RUFA 1QYDA 1TT5A 2CDBA 1E3LA 1GUFA 3L6OO 1H6AA 4BO9A 4TVBA 2IZZA 1RKXA 3TZQA 1P33A 1YB5A 4UULA 4GX1A 1H93A 1UXKA 3U4CA 1LA2A 3C85A 1ZSVA 1DC3A 1HE2A 2D0IA 1W4ZA 2O3TA 5KJFA 1BRMA 1UP6A 5TSDA 3ADOA 3F4BA 3FBGA 3GOHA 5K6AA 3ETEA 3VPFA 3DOCA 4XGNA 2CF6A 4AL4A 4CM6A 4RVSA 1BGVA 2GERA 4U6SA 2HCTA 1UZLA 1QV6A 2OL4A 2WWRA 3HJAA 3ZWXA 3ONEA 2YQ4A 1F12A 2D59A 4B3JA 1I33A 1EBFA 2EKQA 3M2PA 1E3WB 4B7CA 3LU1A 3ROPA 3IIEA 1JLLA 2G82A 1T1SA 3H5AA 1DAPA 3FSRA 3DAFA 4BNHA 5L51A 1NQAO 2HKIA 3FPCA 1BTOA 4C7KA 1JVSA 2RHRA 4M89A 4K28A 2DUWA 3LSYA 4BKUA 1AUPA 2Y05A 1X7GA 1XU7A 2PA3A 5CP8A 1ISHA 4YQZA 1SEVA 1ZCJA 5ENDA 2OXIA 1ULSA 4GLOA 4XJSA 5EPOA 5TT0A 3E5MA 3Q2KA 4FB5A 1HWYA 1A9YA 4QUKA 2DT5A 3AUSA 5H83A 1PTJA 3H3FA 3ZWWA 3RSHA 2O3SA 4OGWA 4I9HA 2Q2VA 3BHMA 4WLUA 4ZU3A 1YH3A 1D8AA 1IOLA 4UUOA 3C1TA 1PIWA 3OA2A 3L6EA 1GQYA 2B69A 3CTMA 4E13A 2B0JA 4CV3A 2EGHA 1ARZA 2JHGA 2PK3A 3T7EA 5IN5A 3ZNPA 1WDMA 4OL9A 3VH1A 1X15A 2WJPA 4IJUA 4DMLA 3CKYA 1IPEA 1I0ZA 3DZFA 3QV1A 4MIEA 4AJOA 2FHSA 3GZNB 3IMFA 5ILGA 5IDQA 3FN4A 2P4HX 4D7AA 4J7CA 3TWOA 2Q1UA 3WGHA 3JQBA 3LF2A 3DWFA 2JD0A 2Q99A 3VH4A 2R2GA 1DBVO 1U3TA 4CM3A 1MFZA 4CLRA 4J0FA 1QYVA 2X5OA 4WPGA 3S8MA 4YJFA 4FW8A 1DJNA 4EI2A 2DUUA 2JJYA 4M54A 4E21A 4OH1A 4ND4A 4MVJI 5DBGA 4OO3A 5JAMA 1PX0A 3O26A 3AOGA 4E2WA 2O3QA 3ZWYA 3A14A 1KY4A 4WE3A 2DKNA 3UOGA 1L7EA 3OIGA 3AY3A 1U8XX 5BNIA 2Z1NA 1GYRA 3UN1A 4PLTA 3HDYA 3WBFA 2VWPA 1WWKA 2BD0A 4ZQEA 4DA9A 1VPDA 1K5HA 2BFMA 4W82A 2E37A 3GDOA 2BMAA 3HE3A 4H3VA 2YV2A 2ZCVA 3OSUA 2I99A 3NKLA 3GHHA 4CQMB 1JA9A 4CR8A 4OXYA 4RQTA 3HFSA 3PHIA 1G0NA 1LNQA 5K1SA 4Y67A 4RCVA 3ZU4A 2O3RA 2EKPA 3AFNA 1Y6JA 3GRPA 2VHXA 3QW2A 5MGBA 1PJ2A 4U0KA 5L4SA 2ZCUA 5THQA 3I3OA 4YJGB 1X7HA 3FNHA 3WBBA 5G0TA 3VZPA 4ALIA 1A4IA 3ZI0A 4G5HA 3OECA 4BV9A 2R00A 3PHHA 4XYGA 4EEZA 4BKOA 1X13A 2Y0CA 1N9GA 2VTEA 3E03A 4A03A 4BNYA 1D7OA 4DBZA 4ALKA 5JYDA 4BO2A 3I5MA 5KCZA 2AEMA 5FFFA 4CLHA 1HL3A 2AE1A 2EJWA 4IXWA 4JQCA 3KXDA 2GZ1A 3MTGA 1VLLA 3CH6A 2RHCA 3CZMA 4RZHA 1HRDA 4J9VA 4GSLA 5L40A 4AJIA 2FR1A 3GGGA 4DC0A 4XKJA 4YJFB 1OFGA 1T2AA 1Q2XA 4FN4A 4NBUA 2A94A 1I2ZA 4JIGA 3SBOA 1B14A 2F1KA 2Y0EA 3MJCA 2EW2A 4FGSA 4E3ZA 3ROQA 2QW8A 4BO5A 2D5AA 5I9LA 5T67A 1ZK4A 2C82A 5IFLA 4BGVA 3ZZNA 5G4KA 4YB8A 2W8ZA 2X7HA 4RDHA 3DQPA 3EDMA 1DAOA 4NBRA 1YWGO 3QLJA 2I9PA 4J2OA 3KBOA 1ENYA 2P4QA 3UGKA 3JSAA 3RC9A 3NRCA 3VHRA 3RUHA 2J3JA 3UCFA 3WLFA 3TFQA 4BO0A 3ITKA 3TF5A 1ENOA 2BLLA 6LDHA 4ZA2A 4FFPA 5F1KA 1LLCA 1AXGA 2JFGA 3VPGA 3H4VA 4G2NA 3WGQA 1TXGA 4CM9D 2WDZA 3K2BA 4HV4A 1I30A 5DCWA 4P4GA 3I6QA 1R66A 2VHYA 1FMCA 3GHYA 1XHLA 4B3IA 1HEUA 4LVUA 1VSVA 4PG8A 3HQ4O 3HB4X 5JS6A 3IQDB 1ISJA 1SO8A 4Z0TA 2IE0A 4BNLA 4BL5A 5ICMA 1ZVMA 2ILTA 2JCYA 1LLQA 4PG6A 3ZWVA 3BHIA 5B4TA 5K0ZA 3V1UA 3MOIA 1O0SA 2CNBA 3KLPX 1E3EA 1XELA 3PDJA 4UAGA 4TWRA 1DIGA 7ADHA 4XD2A 4CMCA 2VT3A 1RM4A 3C7CB 2Q1TA 3S2GA 4QX6A 1U3VA 3KYCA 1PJ4A 4CMBA 1YRLA 3MWEB 2BH9A 4NIMA 3OIDA 1KC3A 2R00C 4E12A 1Y8QA 3UKOA 4RVHA 1CF2O 5KKCA 1E1KA 4E0BA
chains in the Genus database with same CATH superfamily
3F9IA 3LGXA 4H6VA 4QTXA 4MZXA 5A5VA 2O8CA 2HF9A 5I7FA 3IUSA 5JE8A 1VE6A 5DTEA 1ZJ4A 2VNSA 4R98A 4W8HA 5IW8A 1KZ9A 3Q2IA 1QHEA 2E89A 3JZIA 5LMCA 5E1OA 3FUVA 3EDQA 3S70A 2PTGA 2COEA 4KI7A 1PU2A 2G5CA 3ZZMA 4L16A 3EIHA 5BSFA 3I62A 2VYNA 1KMNA 3UT5B 1BCRA 1WUJS 5DFAA 1V47A 1GRVA 4D9JA 2XJ4A 1FU7A 4HLUA 1Q3TA 4KQXA 4MYUA 1LRLA 3V8PA 5A3JA 2ZCJA 2VOJA 3ZY4A 1CY4A 5JARA 4FNAA 3PJFA 4LMPA 5FI3A 2BE9A 1I1NA 1E3DA 4UDYX 1U7XA 2IBSA 3WYCA 3QFTA 4NS1A 1JQBA 2FPUA 2QQEA 1SXJC 3ITDA 3PWKA 4RPLA 2LIPA 5G41A 5IDYA 4O2BF 3H5RA 4URVR 4N03A 5AVJA 3K7EA 3TJRA 1THTA 2NAFA 4OOEA 2NN3C 3WGYA 4TMKA 2B3DA 4Q00A 3VDXA 3THWB 2R7AA 3LXXA 1FFXB 1M1NA 1YZYA 1KO7A 5C0OE 2Y93A 3BFPA 2XUPA 1N2HA 2PZAA 5FB3A 1N32B 2Q2OA 4Y9UA 4GHWA 1KS9A 1PEDA 2ZDQA 1SC4A 4OA5A 5ECDA 3F78A 3KO8A 5FWXA 2AOUB 2QHXA 3CLUD 1XLVA 2PL9A 3E81A 3G8AA 3IP1A 3NVMB 3LVBA 4YS6A 4NBLA 5DK4A 3EVTA 4TL9A 3CUUA 1C8VB 1JDBC 5CGZA 4AN1A 4TSKA 4BO1A 4YPVA 2R85A 1WKBA 4S1TA 4GICA 5IABA 2R1TB 1XNJA 4EG3A 3DQZA 5C4GB 3ZDQA 3OLQA 1DZ3A 2WHRA 1VPLA 4KWHA 4QBIA 4R1TA 2RC5A 2QDXA 3QH4A 5CVJA 4A4DA 4BB5A 4M98A 1GXSA 2HA2A 3BDAA 4LDPA 4XRRA 2I6TA 2C3PA 2Q5EA 4LSZA 5CJJA 2C07A 3VPXA 4AN4A 3GH3A 3GPDG 1UAYA 4V2IA 3L7IA 4B4DA 4FOLA 4BAUA 1QHGA 4W5TA 3ZWBA 2UYQA 4RLHA 4ZIRA 2C95A 3DWEX 1D1TA 1R16A 1A8PA 1VI2A 5CT9A 2MR5A 3RAPR 1SCAA 1MPXA 2HCBA 4MW1A 2IL1A 5BNZA 2QN6A 2ZIZA 3DEYX 4RSMA 3OSZA 1Y5NA 4I50B 4YRCA 5ALHA 4A23A 5GVSA 4XIGS 1OIWA 3FPEA 4R2XA 2AW5A 1MJ5A 4JUAA 1AK1A 2P5YA 1H8ED 1NC1A 2IXGA 4DPKA 3L6CA 2PFSA 1U2DC 1D07A 2JH3A 5E3IA 4K9PA 1BG6A 3D5QA 2V6JA 4CN8A 5AJHA 4H31A 2VTBB 2O8FA 2G1UA 1BVHA 2D1TA 1F8XA 2JC3A 3LLMA 3N7UA 4JMPA 2QTWB 5E7JA 3VYRB 3MNFA 1CVIA 3IKTA 1E92A 3ZHVA 4EY6A 2JJ2D 4M49A 5HTKA 3EGDA 1JJFA 2FK7A 3KFXA 1KYQA 5I4BA 2ZI7A 1AGYA 1GT6A 2Q6TA 3LLSA 2WBLC 4LDRA 2Y66A 3MVEA 1Q1NA 1THZA 4WY5A 3JXEA 4CBVA 5CCEA 1T0IA 2WG1A 3A9WA 4BCDA 1XF1A 2LCIA 3CB2A 1EFVA 1OMOA 3EISA 1PR1A 3NNDA 4UBLA 4RTSA 5T64A 1SBTA 3NW9A 3PL1A 3IBCA 5F7ZA 5E0OA 4ZTBA 5F5XA 3HFJA 4L5YA 4U7DA 2ZVQX 3A36A 4ZQGA 1C1XA 3TN7A 4DCSA 3DMFA 1OBHA 1JDPA 3IA7A 4QDUA 2CJWA 1XD9A 3UUEA 3HBJA 2EARA 4Q7QA 5EGNA 3PDIA 4ERXA 4MWBA 3WNCA 3RGGA 3B3JA 3NV7A 5CH5A 5AXDA 4UXIA 4CEHB 4K9LA 4FI3C 1L5MA 3L8ZA 4NYJQ 3JTMA 3OZCA 2H2GA 4XIIA 1IAVA 4LUCA 3PJRA 2GCGA 3PXBA 1W5TA 2R96A 2AN9A 1KL7A 2A57A 1BMDA 3LX4A 1UBCA 3R3WA 4H0CA 3C4JA 3AHGA 4MLZA 4OI4A 3ZD9A 3QPCA 4YMIA 2BDUA 4RY8A 4CT5A 5E6RB 1ADGA 1G8SA 4MVJF 3B20A 1X0VA 2AEFA 3BICA 2JS7A 2WYWA 2VP6A 1ZL2A 4IRMA 2HNBA 1I3LA 3USZA 4L9WA 1NAIA 1L5VA 4HKTA 4AKEA 4GMDA 1ZSYA 3FPHA 4BZXA 2QE7D 2X9LA 4OYYA 1EA5A 1N0HA 3OZSA 3DEFA 4L75A 5E38A 2P0YA 1ZCZA 3UT6A 4EIWA 3R2JA 1R3DA 1P9RA 2VAWA 3K4QA 5AKEA 4C4YA 1A4XA 3D4IA 2V9ZA 4DG5A 1QF7A 2QV7A 4PO8A 3KU1A 3CO0S 2VYCA 4UHCA 3PITA 1SHUX 3KFVA 5CYGA 4V2UA 4L8WB 5LLTA 3L07A 4HATA 1Z68A 1U9YA 4HDMB 3PQ3A 1RXUA 3EVCA 4NFSA 4DLLA 1COWD 4EUEA 3E4CA 4DC9A 2NWQA 5IJ9A 4CEJA 2C7OA 3IIJA 1QNLA 3PT9A 4HDQB 2ZIXB 4OAQA 4IIDA 2OYSA 1I13A 3A9CA 1UQUA 3FBTA 5CD1A 2W6MA 2FPIA 2I6GA 2OXEA 1KIAA 5JPDA 1BDHA 3KPJA 5DVZA 4HFRA 2PRSA 2V97A 3P0JA 4DUYB 1XPOA 2QN9A 4OQYA 1R18A 3O91A 2QZZA 3BF7A 4JB3A 3MWGA 5DDIP 3QKWA 3S3TA 4KLAA 3ONWA 2V58A 1T3LA 3NMUF 4QWWA 2BFOA 1JFTA 3ND6A 1FRFS 4G89A 3GLFE 2PQ0A 2V0CA 3GEMA 2NZXA 3HVHA 3UT5A 5JDCA 2QSJA 3KQHA 1Z2EA 5I8ZA 1N57A 5IARA 2GDZA 2CYCA 1P44A 1TO2E 4B09A 5FJIA 2CD7A 4XM0A 2MSKA 4A8JC 2HJVA 3EFEA 3TDKA 1RAIA 1WXIA 2OHOA 3NORA 3KOUA 1NVMB 4ZT2A 4EG0A 4W5QA 4EHHA 5F3WB 1P2VA 2DQYA 3VSDA 1WQ3A 5LDHA 2WT9A 3RADC 3JQ7A 5FP0A 3F1KA 2VDOB 3LDAA 2VJQA 2IUSA 2WU3A 3BPSA 3QVSA 3CVJA 5A05A 4JOBA 3D4PA 3OF2A 5ILQA 1Q3KA 3DLBA 3H9EO 4OLAA 3D8BA 1BWPA 4GUDA 3O73A 1L8LA 4RGVA 1Q6ZA 3OTQA 4GO1A 4Q21A 1ZS9A 5EIBD 3GPIA 1Z0SA 4LMRA 6ADHA 5B7PA 2ETXA 3HR8A 2AMVA 1TKCA 2JJQA 4QRIA 4BDSA 4BWGA 1VPTA 3IALA 1NASA 1Q7RA 4ZAFA 1BKDR 5KTSA 1Q0LA 3AL0C 1B3RA 1TGVA 1YD7A 2W00A 2V6FA 3W3AD 3QHPA 4ECAA 2JIDA 2BEUA 2EJVA 4WH0A 3NONA 4PLVA 4IEIA 1ODFA 2WSYB 4GYKA 2I9KA 1NJ2A 2QYTA 3AKCA 3FTDA 3AVWA 1RXSA 4B7XA 4GOLD 4UULA 4WZBE 3P0FA 3CS3A 3WLNA 2JLRA 3ZW8A 3AG6A 3E84A 3EXHC 1S2MA 2C5BA 4V3BA 2WT8A 2W2QA 5CH3A 4CTNA 2YBEA 4GF5A 1NHWA 3IT0A 4FE4A 1YOVB 5GVRA 4R9RA 2P9EA 1E59A 1W34A 1QE0A 1KVSA 3CX7A 3P97A 5AKXA 5A3VA 5JI2E 3WAJA 1KVQA 4HY3A 2OXFA 1PZEA 1FFDA 1Y8RA 4EKGA 1SCKA 3VYTB 3WL5A 1VLZA 3WAGA 3QU2A 5AW5A 1RWXA 4IIVA 3IMEA 3D7KA 1FMJA 4B8WA 1E79D 1RI4A 1TD9A 3FFAA 1I01A 4IWYA 4WUTA 2TMYA 4AMVA 3D6JA 3JWPA 2BFAA 2Y1OA 3BTUA 3EJWA 4H15A 1YL6A 4KAXA 5EKSA 3INNA 1JB1A 2QM3A 3OOJA 4NBTA 1UK6A 2FMKA 2JCSA 4XUDA 3N58A 4FCWA 3OKCA 3DBIA 4Y2VA 3RK4A 1WCIB 1IVNA 2HSGA 2CLLB 3CF0A 3N0VA 4FGJA 4O02B 5DASA 4FFNA 1TE2A 4RY9A 5D3MB 4F46A 1XK7A 8MHTA 2H11A 5EEHA 4QEDA 1FYFA 5CK5A 1G66A 4ENUA 1E2FA 1Z15A 3OCUA 2A1TR 2OWDA 4JX9A 2H4ZA 3TW0A 2WSSD 3HJTA 1ZMRA 3QLEA 5KYVA 2CMFA 4EYOA 3TXXA 4ND8B 3CLTC 5DW0A 2F8TA 1MAUA 2AOWA 3BK7A 1GY8A 2QLJA 2B98A 4YJDA 4DDKA 4BMNA 5ARBA 4Y6GB 1UJ5A 3KNZA 1XHFA 2ZRGA 4LYFA 3DKIA 1EDZA 1YULA 2FZVA 3RVBA 4A8JA 3UUWA 1GZ6A 3ZV4A 2OV2A 3GT4A 5IJXA 3PUKA 4H3HB 2XQIA 1DXYA 5LMNB 4P3YA 5C35A 1KO1A 1QGDA 1LU9A 2LXNA 4TS4A 3NALA 4K8RB 4EA7A 1NF9A 4EFKA 4F3NA 5LZ4A 3HPRA 2J45A 4XCQA 4BYGA 3IMCA 3IYLW 4NH4A 3DJYA 3P7MA 1DV1A 1TLFA 2Q5CA 1P5JA 4OP1A 5ALUA 2NM0A 3LXUX 4KHPB 1XA3A 3QI2A 2ZBQA 3R8XA 1Y80A 2VAMA 3KKMA 3L7BA 2IHNA 3O84A 1OBFO 1XCLA 1CQIA 4E46A 1AHPA 4ARZB 2B25A 5A5DA 2P6NA 3KKQA 3PHBE 4OSOA 1WEHA 5CXQA 3IP7A 5ES4B 1XT6A 1LDGA 4Q4AB 2E85A 3OQHA 4EY5A 2FZGA 2UZ4A 4HGZA 4O4JB 4K9QA 4MV4A 3N53A 1EBUA 1TVKB 2JVIA 4AKIA 2V45A 3VR1A 3HA2A 4L4ZA 2JATA 2IPMA 5CVUA 3HBLA 3QF4B 4PQGA 3SQLA 1PYOA 3UYKA 1LBHA 1R74A 2XADA 3JR7A 4UQLA 2C2WA 3GQBB 2HK6A 2YJ4A 4B85A 1HV8A 3AUYA 4NZNA 5CAEA 2XOKD 1GTVA 1XTJA 1KWGA 1NR1A 2RH5A 4B4KA 2Y1WA 2R44A 1WNFA 4ZOEA 1NUSA 2C4WA 5A6VA 2ZJOA 3C48A 5MF6A 3A10A 3U09A 2BKVA 3N6XA 1TCCA 4FJ0A 4OQ4A 1ZOSA 4YLGA 3UAOA 1E3SA 1KERA 3PQ5A 2XITA 2H1SA 3B2EA 4QUAA 4FHDA 2CXPA 3KHSA 4H60A 2CSXA 1PL0A 2CYBA 5EZQA 3X2EA 3D3JA 2BZSA 2PWPA 2VQFB 3V46A 4D43A 2GBFA 5HK9A 5CFPA 2WR8A 3F67A 1OB2A 3GV0A 5BNFA 2YKGA 1KFCB 3K9QO 3IQIX 1CDZA 1SD1A 2AC7A 3N6RA 3WC4A 3WDKA 2IVZA 4PVCA 2YN4A 4M83A 4C4ZA 4ZHQB 5BQ3A 3JQCA 4N3BA 3RS8A 1YE8A 1ID1A 2F1HA 4CTOA 1W85A 3VDQA 1IN8A 4HADA 1XQYA 2RC6A 2RIRA 3TTSA 2Z6AA 3W4KA 4P7KA 3SDZA 3L0BA 2AZ4A 1F6DA 1PQ4A 1R4NA 3CRMA 1S8OA 3HRKA 4FN5A 1J8YF 4PQEA 5MN5A 1USIA 2Q3MA 4TV9F 3U4GA 5L4NA 3I2IA 2XEDA 1WPXA 3BKWA 3L06A 1ADYA 4KOAA 4Q3AA 1V48A 1ISRA 1GKKA 4LY0A 4WNYA 4A6EA 4MVJM 1LTHR 3L18A 4XWKA 2KPOA 3CNOA 5U4QA 2AG6A 4OAOA 2YNMC 3FKQA 3KKNA 3AI7A 4L2IA 1WHSA 2OB1A 2E48A 4HWKA 3WLJA 4DXHA 3HCAA 1D1QA 4LEIA 2AVDA 4QQKA 1SOUA 2RGGA 3UAWA 4IMRA 3N86A 4FDLA 3IV9A 3PPVA 4DRYA 5T8KA 1EP1B 1P9WA 1KEEA 2P6MA 3NGXA 4HEJA 3QVGA 1IYZA 3V8BA 4RH1A 3NVAA 2C3OA 2ZFUA 4Q4JB 2J6HA 4XYLA 3T7DA 1BNCA 3IAS1 4JCCA 2OBXA 1KOLA 2JD2A 3B1KA 1UMCB 3I39X 3UJNA 1FFWA 1Z7WA 3A26A 3WGNA 1PS9A 3K2IA 3MYRA 3HLKA 1MCZA 4KX5A 5IK2A 4FS3A 1JLHA 4MKZA 2EW1A 2JLUA 3PKIA 1EUCA 4OP2A 4QFCA 1KK0A 3H1BA 1JA0A 2CHQA 1WZUA 3C7AA 1U9JA 3G8CA 3W5HA 4DYVA 3U31A 4ZN6A 3DNMA 2QR3A 2FEKA 4ZO6A 2LUOA 1CR2A 3R20A 4OATA 4A6PA 4BVHA 1ZU4A 3VU1A 4BJ3A 1U3DA 1QVZA 3R6WA 5A4DA 2ONYA 3GGSA 1HPLA 2Q3FA 1MN6A 1GCOA 4KW7A 2WWGA 3VPAA 1E4YA 1VBNA 1YA4A 1C4WA 3FNQA 1INLA 2HQ1A 4HB0A 3OPYI 3ROMA 4KSCA 3QHQA 3CJRA 3C3EA 3M2TA 1CK4A 3MHPA 2A9FA 2XOKA 5EPUA 4YUYA 4ZJPA 2WTMA 5FTKA 4DR7B 1GZ3A 1X1TA 5HFAA 1WVIA 1IHPA 4BUZA 4DIOA 1USVA 2O2GA 3ETLA 3PNBA 4QU0A 1G291 2WIAA 3WKEA 5FLEX 3RTAA 4A2CA 5HIKA 3KEFA 2W58A 3VSBA 4WT7A 3UXYA 5IPFA 1D4AA 2I2CA 3MD0A 1ZXXA 3QQPA 5FOXA 1BMQA 2AWOA 2FP4B 3RSFA 3TOZA 4DNOA 4PSUA 2GI4A 3JD1A 4QO8A 1M34B 1NV9A 2XB9A 2RHDA 3FWZA 2R7NA 4IQFA 4DCGA 5KVCA 3PC6A 1XTUA 4UE2A 2OO5C 4NCBA 1NSYA 5B1SA 1T5HX 1IG3A 3LOUA 4MUMA 4I5DA 1CEYA 2IU4A 4YJ2A 1SA0B 3DV0A 4J94A 3H13A 4A73A 1U4SA 2I2DA 1IOVA 1H5QA 1LBQA 1R6TA 1ONPA 1V3UA 3EF3A 4FYWA 3R0JA 3AEUA 1ZJWA 4Z9FA 2X4DA 3D6AA 5HGJA 2YIDA 1ZUWA 3HB5X 1RKBA 3MCZA 1CUCA 3TQSA 1YIOA 4AK9A 3W5CA 1W0CA 1BH2A 5F52A 1C8BA 1M34A 2Z6VA 3UWDA 5HX7A 2JFZA 1MAHA 3K5WA 5AQ1A 2WFAA 2B9VA 2HPAA 3M8KA 5ECWA 2HDHA 1AQUA 2OFOA 2EKZA 2VG8A 3GXBA 2DR0A 5AJZA 2R87A 2Y2VA 1DTSA 1GG8A 2WSIA 4F3YA 4MA4A 5CD9A 3U7RA 4QNMA 1GFZA 4JKIA 2HFKA 2V5VA 2OD9A 4ZO7A 4C03A 4QPPA 5ITSA 5ITZA 3C7DB 1WL8A 4ZT5A 4D98A 2VDPB 3GJYA 3IPXA 3ROFA 3RYFB 1KK2A 2CXXA 3HDTA 4TPKA 5C3UA 2V9CA 1NP6A 3DL7A 3H42B 4TTSA 1TRHA 4AKHA 2OOKA 4NX2A 5FQOA 1QFJA 3ZU3A 1W2GA 4MWTA 4UAUA 3NV9A 3R40A 4EF4A 1B7GO 4X1IB 5EGSA 2R65A 6CHYA 4G09A 3DE0X 4DDTA 1IN7A 2XEXA 5AICA 2Z6QA 2HADA 4B4WA 3M5WA 2VJCA 4BMCA 2MYUA 1XA4A 4MW7A 4P1ZA 1FFGA 4A8PA 2VDWB 4J0JA 1CRWG 2OLEA 2X42A 1Y4UA 2W8BB 3X1JA 2ADOA 1K8YB 1PQWA 1UKZA 5DRTA 1KDTA 5EKTA 3WS7A 2IYLD 1SCBA 1JEEA 2F1RA 3MJ4A 1CHNA 2Y6UA 3ZQKA 4P2GA 3M49A 3QBJA 1N2CB 2IC5A 1W94A 3GJ8A 4D8TA 4E5SA 4R8VA 1MG0A 1WXQA 1F2UB 2DULA 4D4JA 1J9GA 1SUSA 1EDDA 1GGHA 2ODQA 1AZWA 2QIOA 1GDHA 4GBMA 1E9FA 2VS1A 3KJNA 5BY2A 5JPIA 3QKSB 2UZIR 3AQ4A 1RMQA 1JIIA 1QE5A 4CIAA 2GSDA 4F9GA 2H9YA 3W7VA 2D7JA 5KZMB 4XRGA 3UFXB 1WF3A 1T4CB 2IF2A 3KXKA 4LNUB 4ZYVA 4XD7A 4LX0A 4QDZA 5A02A 1EBBA 3PEWA 1T34A 2G3YA 3E61A 3IAHA 5IULC 1TUGA 1I4LD 2WVAA 2GN4A 5KWJA 1CP2A 2C4MA 1D1PA 2JAHA 3MS7A 4HDRA 4RNDB 4NYIR 3ZOZA 4C05A 4EJFA 5KX5F 3DKRA 3KCNA 4DDVA 4YY3B 5EUBA 3PGA1 2E4YA 2J3LA 3DD1A 2VRCA 4NVRA 4LF9B 1TYZA 2PKCA 3FHJA 3FVQA 1U9IA 3V6LA 2Z4SA 2QX7A 4TX1A 4ATNA 3VM6A 1XTPA 5K5EA 5AJUA 2QX8A 2PFKA 5T4BA 2XUOA 1L7OA 2IHBA 4V1CI 4TYNA 2BUBA 2ZW9A 2X3FA 1E4EB 3FZQA 1WB5A 2AR7A 4ZREA 1K6EA 1JI0A 1UDCA 2VTDA 3A4YA 3C4VA 3CZ4A 4GOXA 4GQIA 4ITUA 4XCXA 3MS2A 3ZIAD 1N2ZA 1WNTA 1PQUA 2NZ8A 4ZVLA 4LYDA 2GRUA 1G7RA 2XCUA 2PLWA 3QTLA 3PFBA 3QW4B 4M6WB 1RABA 4YRTA 4HAZA 3RV3A 3C6ZA 1UFOA 4QICA 4A1FA 2WT4A 3LO5A 5AKJA 2F9MA 1LRJA 3VDNB 3LGAA 4OGFA 3BB4A 4GI3A 3BT7A 1NMEA 2REQB 2G5GX 2YICA 4ID9A 521PA 5BSWA 5ALVA 3A70A 2WF7A 4KQWA 4IG4A 4LBVA 4OMFG 4F4IA 3MRTA 5LJLA 2MINA 4LX8A 4OV6B 3B6KA 3ESBA 1YE3A 3ENWA 2QXYA 3MXOA 3CVXA 2FPMA 3I9NA 3SM3A 1LNZA 3H8WA 4XJXA 4H7FA 1LLUA 1YJ8A 2OE2A 3OO0A 1G3MA 1NLUA 2BE7A 2C4UA 2OZPA 3EE6A 3K30A 4UC0A 2OK7A 2A88A 3D7LA 4LK3A 4OHZA 5DX1A 1ZN9A 4MH0R 1KE2A 4U3JA 5FAKA 3NTOA 1JG4A 1LK5A 3S7TA 3B5IA 5J4HA 1P7WA 1YR8A 3AEUB 1HDYA 2FOLA 4P7BA 3HCWA 2PGJA 1YQ9A 3Q7SA 1GL7A 1F8FA 3MIZA 1TKBA 2FUNB 3BWYA 1JYSA 4L07A 1WRBA 3DG9A 1H05A 2JPDA 5H80A 1S2DA 5DHSA 3FCAA 2AMLA 1YUBA 2FSIA 2EDAA 3TLMA 4B2YA 7AT1A 3DZJA 2H17A 4P5DA 4QOSA 3HWWA 2I2XB 4XVQA 4ZQHA 2O2IA 2ZYTX 3EWAA 2E6KA 3K70D 1CQIB 1KA9H 1E9EA 1EFUA 4KZKA 4RHEA 4RZUA 2OUIA 2XYGA 3LY5A 3SLGA 2O0MA 3OC0A 3TIFA 3MJRA 3DONA 5GTDA 1K4KA 1YJAA 3WDSA 2VK1A 1KK3A 1HR0B 1KEZA 3K2EA 4TVOA 2E4AA 5EIEA 4JN6B 2QX4A 4YI5A 1GM5A 1R0XA 1TZ2A 2ZIUB 3HN6A 4YAWA 1HDGO 5BQXA 1DKOA 3KV1A 1GFSA 1FQJA 2IZ7A 1YHYA 1VMAA 1UKBA 1P5FA 3U3OA 8GPBA 3MHTA 2QORA 2I6UA 1EUQA 1TYEB 3DEKA 1DX9A 3THXB 1W1WA 1F20A 3BIJA 3TRIA 2NZUG 3FUCA 4EUSA 3DDUA 4MKRA 4TYMA 1UDAA 1X80A 1H8HA 1HDEA 3EGVA 1JDBB 2PLAA 1E6MA 3QKUA 3LFUA 2VT2A 5CFZA 3IO3A 4DRZA 3IPRA 3QLVC 3Q3HA 2A30A 1SBYA 4FEAA 1FDSA 2C5AA 1DAGA 3G2HA 4WOCA 1CD5A 1JTFA 2OZVA 2YJZA 5HKBA 1QHHB 2VWQA 3LQ4A 5K09A 4KI0A 1H2BA 1T5BA 2QP3A 1F38A 3CYFA 3I6MA 4MICA 5AKIA 4DLVA 3HM9A 4D0GA 2QJTA 1BXKA 2QPOA 2XDQA 4X91A 3VX3A 5I48A 2AJBA 2VHZA 1EXMA 1R6VA 2J9ZB 4M9CA 1KSGA 1NXSA 3KJFA 4CFZA 2WU8A 4F11A 3SSOA 3MMZA 4MGEA 3N2KA 1DADA 1HZZA 1MO6A 1XNGA 3R5HA 4G9EA 4IUCS 1GGKA 3G2MA 1ZEJA 3WTCA 1GKLA 3WGUA 3TK1A 1RBZA 2ASEA 4DWJA 1ZU5A 3EDCA 4M4SA 2O3UA 1M6YA 3M4XA 2X0DA 1J7KA 3IOBA 4DJDC 1K98A 2DQZA 2BBOA 3U60B 5TR9A 3D8NA 5IJ0B 1VB3A 5CT8A 4EP1A 2FJ0A 1Y6QA 2WY2D 1Y3HA 4UUNA 5LOVF 1BZYA 1EEXB 1LB1B 3IGFA 4QG7A 1K66A 3ENNA 3LKVA 2YW9A 4RO0A 1KR5A 2X41A 3LIPA 4OYLA 1KP9A 5AM1A 2CJWB 1Z82A 3DXYA 3VYVA 4O0LA 3GNTA 1TCAA 1I2MA 3I34X 4GBED 5HIIA 5TY0A 3CUSA 4CMKA 1XDSA 2CE2X 2CN1A 2K87A 2DM6A 1V1RB 2W83A 3W5VA 2HC9A 1V45E 5JS7A 3R3XA 3R8FA 2CMGA 4YRGA 3OA0A 5UKDA 2ZSUA 1FNCA 4WK4B 1OXBB 4C2TA 1N8TA 4DCTA 4IS2A 1Q7BA 5JCOA 1RJFA 4X3PA 4NG5A 4H6WA 2QD2A 3L0PA 3B13B 2AC2A 4OFWA 3CIFA 2IPOA 1QP7A 2C97A 4XM2A 2X9NA 2VEOA 1HQCA 1C3XA 2A9QA 4W1PA 1CQXA 3ECCA 3TXAA 5LDGA 2RKWA 3CGGA 4PFSA 3F4KA 4U3JB 1E9AA 1AUQA 4MQ6A 1CBUA 1EWVA 3OE1A 3TEMA 1L7NA 1SB9A 1PWEA 3E9QA 4G3XA 2GF2A 3TDMA 4YAGA 1OCEA 2G9QA 4GLFA 2JJ1A 4OPMA 1K88A 3SWWA 3HADA 2HHHB 2XUIA 4WLEA 1HO3A 3JQ8B 3U7EB 4ER0A 5CXSA 2VT6A 4L6AA 1CQJA 2NSHA 2NZVG 2IYWA 3H2GA 3QE2A 3DE4X 3HHEA 2Y68A 1OLSB 2XQVA 4KPFC 4KITB 1ECLA 1TIPA 4CLOB 4IKPA 4ZARA 1UBTS 3S40A 4HAUA 2QJFA 3RTCA 3CBGA 4OB7A 5DNEA 2WJWA 1ICIA 1SPBS 3VYSB 2FRDC 1UK9A 2PR7A 3K6RA 3FCOA 3A2KA 5K3CA 1IEQA 3BGOS 1T2UA 1VMDA 4UCQA 4F71A 1DDGA 4YDQA 1RYBA 2FX5A 2IDMA 5L8VA 2JFQA 1HC7A 3KYDB 2L0XA 3GA5A 4MS3A 4OK5A 4ZAYA 1WW8A 1CIPA 3OPQA 4GLLA 4OIMA 4RD1A 5CU7A 5DWVA 3SC3A 3SYRA 2J32A 3TOXA 5LXTB 5IAKA 5KS2A 3CPSA 1YZVA 1EWYA 1I32A 5C37A 4P32A 5DX8A 4H7DA 4EA8A 2ZREA 2OY0A 4ZRNA 4DMUB 1K06A 3SIPA 4JYMA 1KI8A 3S0JA 1X8JA 4B4UA 3DLHA 3B8EA 2B20A 5DKFA 3GPBA 4YUVA 2ACEA 2VJPA 3C7TA 3O75A 4IOKA 2FRDA 3FNBA 3LPDA 4RCZA 3VYWA 5EJ8A 1DEAA 4CMJA 2NU9B 4RJTA 2YCLA 1CB0A 1UP7A 3AY6A 2GN2A 1TIKA 3EVZA 5L53A 1ZX1A 3VZCA 1JQJC 3ZVRA 3C6MA 3BIWA 1FDUA 2C8LA 2Q3HA 1QYIA 1VQ1A 3UXEA 1QGYA 2RGWA 1GL9B 2PLNA 4CL3A 3W6ZA 1P3JA 1SZPA 1X74A 1XTKA 1Z06A 3R5TA 3K09A 1C3OA 3BZWA 1XMSA 2QBYB 1U0TA 5HCIA 3RRBA 1GRNA 4REQB 3SHVA 3QBEA 3DOOA 3P8ZA 2G77B 1WDLA 1QLHA 3T54A 4QPZA 4XWWA 4ZVUA 1JHDA 2IU6A 1M2HA 1ZUD1 2RK3A 1IZ0A 1JSXA 1R88A 1UF9A 5CM2Z 2QN7A 1GHTA 1NYTA 1L4UA 3ELDA 2BEVB 4RY2A 3RREA 5E3HA 2REXB 5IHXA 2C59A 2ZRAA 2VJOA 5REQB 3G8DA 3IE1A 4ZEVA 4OXIA 5CPBA 3IXMA 4RNCA 2RG7A 2XGMA 3ZGLA 4AMZA 4US2R 3TAHA 1E6CA 1QGAA 4J6FA 5SICE 4TROA 5KJCA 3B1YA 1L4GA 4JXKA 4JJFA 4FHFA 2GJ4A 1ZD3A 3P0HA 2ZYIA 4JAVC 4XXHA 1BVRA 4MB2A 2R66A 5KNBA 3KZMA 3OFJA 4QQ8A 3ZCXA 1O7JA 1K4YA 4HUQA 3VXKA 1H0KA 2CL7X 2GHQA 2WE7A 4UAVA 1NONA 4GOND 5CURA 5EESA 4E1AA 5JV5A 5KMGB 2OEPA 1N33B 1IHXA 3FLAA 2XVXA 1ZLXA 5DRYA 2NX2A 1CEEA 4N8DA 3IVMA 3PWSA 4FT2A 4DA8A 1NW5A 5TVGA 5IDWA 1E63A 1W1IA 4CCWA 1SKAA 4E03A 5FQNA 4KR0A 4CLRB 5ALNA 4M99A 3F5FA 4O25A 2AQ8A 4ND3A 4RLQA 4XSGA 4TMXA 3R7WA 5AH0A 3ZNQA 4CF6A 1FVHA 4DIKA 3AFGA 1A9XA 4F7WA 1G16A 1DINA 1YZNA 3V33A 5CDSA 2ZRIA 3D5EA 5E9WA 1L5YA 5A9SB 2H4HA 2HBRA 2QQGA 5LMUB 2QRQA 4I6GA 5FFMA 2YQ5A 3FWKA 3ORFA 4JI1B 2NVWA 2EVWX 1U8EA 3W4IA 2JI4A 4A27A 1F9AA 2P65A 1PZFA 1G8PA 1L9XA 4AULA 1QTIA 4E4RA 3ND8A 4O29A 1YONA 3ORSA 2ZJFA 2HMWA 1UM9A 2W6ZA 4LZZA 3ZXIA 1XMIA 2BM0A 3ZE7A 1TI7A 4C29A 2O8EB 3GR6A 1AUXA 4RK5A 3A1EA 3NU1A 1FSFA 4JC8A 3KQNA 1A7KA 3BD7A 1LX6A 1QR6A 1E3IA 3C14C 1OA1A 2VSQA 3HXKA 2BI8A 4PM4A 4XD7D 1DOHA 3UWPA 4DLXA 5CNIA 4P4LA 5GV7A 1OUMA 2P5UA 1DAMA 1G8AA 4WVLA 4IBOA 5IJAA 3MMSA 3ZCTA 4MQEB 4EARA 4F38A 3QVKA 1JMKC 2W5UA 4UBJA 1V96A 2X0RA 2H0QA 1QFXA 1BMFA 3WG9A 1EFLA 4XDYA 4IX1A 4BX2A 4S1VA 4A2WA 4HCJA 4BYMA 3AONB 5IVPA 1PE0A 3PC8A 4KV7A 1AUOA 3BIOA 2F43A 1VJCA 5P8WA 4AF7A 3LC2O 5I01A 1DAKA 1GPBA 1B6TA 1SB8A 2AN3A 1QIIA 5KDDA 4LGYA 3IP3A 2Y6VA 1LDMA 4KBGA 1X1DA 1DOAA 3EQ2A 2GN6A 2EKDA 1L5RA 4JNCA 4K46A 1U2EA 3LRTA 1JVNA 3VKGA 1CUWA 4V24A 3ZY3A 4DKXA 2OZLB 2J4CA 1DRJA 3BMOA 1HOTA 2TSYB 4IILA 4MYCA 4TTIA 1ZP6A 3GLUA 3IJRA 1VJ0A 2V8BA 3RVJA 3ZWMA 2I91A 4P7GA 4KK4A 3C3PA 2AUTA 3O82A 1A27A 3OFNA 4DEXA 1I9CA 2BFPA 1ND5A 1YZGA 3TLCA 5L6LB 1YCDA 2HMTA 3RM3A 2IYSA 1TQ2A 2Y1KA 1QHHA 4QGHA 3V2GA 3FDZA 3OT4A 1KS2A 1MA3A 4CQMD 1D2CA 2IHVA 1JNYA 2VH2A 2FEPA 3P52A 5TPWA 3ZG6A 4F93B 2BKUA 1U0FA 1AOXA 1V41E 2AKAB 1PBNA 3OWXA 3L01A 4EABA 4WECA 4DV0B 4CGZA 3PFFA 3T7TA 3WK8A 3Q7QA 1FNBA 1ES9A 3TI7A 2ZTHA 3NIBA 2GARA 4BNXA 1ND6A 3SVZA 1G63A 1R6UA 3ZJ4A 3DMHA 5F1PA 3L0CA 3EYWA 4H0NA 4GZ3A 5A7HA 4RPHA 1ZK0A 2C8KA 2IGTA 2ZYWX 5G0SA 4EW3A 1V25A 3AETA 3TR0A 1IJFA 1DKQA 5HKAA 2OP1A 3FCYA 2LCFA 5ALDA 2KWIA 3UWKA 1YC5A 5LOVA 4JVNA 3N76A 1NT4A 1ZEMA 1YS7A 1II0A 3M1LA 4BFUA 1XNHA 5DPMA 4HTFB 2R8YA 4UNIA 3FKSD 3KTDA 4MS1A 3DCYA 4M1MA 3Q98A 2ZTVA 3RNOA 4YDHB 1RU3A 4IZ6A 1WE2A 4U8HA 2GD6A 1JAIA 3LSTA 2R3SA 1YQXA 3OI7A 4RIHA 4U7TB 2NU8B 4A0HA 4C1BA 2ERYA 1H4QA 2ZBDA 4IDGA 2GLTA 1C1XB 3NAMA 4C0QC 4BLTA 5HZMA 1LV8A 2WD8A 2W11A 3KSDO 4O4HB 5JCXA 1DT5A 4DUZB 1NFQA 4YDSA 4OFXA 1G8KA 5BW8A 1PWHA 1E1CB 1YZTA 5C4MA 3K73O 1VIMA 4XJTA 5JMWA 1KAMA 5BVHB 4Z3OA 4HN9A 1F2TA 4EKYA 4RSHA 2XVYA 3GRCA 1CJBA 1G1MA 2PKQO 4PHCA 7MDHA 3GOQA 2P9TA 1EFKA 3SMVA 1IK4A 3B70A 2IU3A 3G1TA 5A0VA 4LF5B 1L1QA 2XUKA 3CX3A 4IIGA 3VJMA 4PX9A 3GRRA 2F62A 3KVYA 4XQEA 1U94A 2JI6A 4LKRA 3ZUPA 2HWYA 2ZVPX 3LQKA 3PC4A 3ZV6A 2XCTB 2ZTLA 1QZZA 3NOXA 3GVHA 2PMEA 2A9OA 3A06A 3BBLA 3CLRC 5AESA 1JMVA 3RFUA 1Y7HA 1ZR2A 3TBHA 3V4RA 1PTJC 1Y4SA 3BSYA 3O1LA 2YY5A 1N7IA 3U7FB 1LEHA 1NTRA 1Z0JA 1K6IA 3C2QA 3E2MA 3UB3A 5AVOA 2Q3BA 3E0XA 1H2YA 5T5QA 2VP4A 4KZPA 3T7JA 3PRJA 2CZCA 5KYGA 5IH7A 2Y8EA 1PQPA 1VBKA 3I1YA 1K0UA 2P6UA 3BTOA 3EZNA 4JB2A 3R6LA 4N8SA 4P4SA 5CLGA 4DRXB 3ZDDA 1U1EA 5AK0A 4I55B 4HLUC 3WIEA 4P3OA 1TJYA 3DUFB 1G5TA 3I6IA 4AG5A 4YP6A 2AF3C 3A1VA 2ZWAA 4Z7JA 3SZ3A 1SHLA 2YJ5A 4PYIA 3LW7A 4R83A 4LW8A 4Z9XA 4EGAA 1ORVA 4GKBA 1E3JA 1JW9B 2C94A 4M0CA 3R5SA 4ZOLB 4F97A 4E3ZA 4DVJA 2OILA 1VDMA 2NUPB 4G67A 3SOZA 3T0FA 6NULA 3K0SA 3W06A 4D9BA 3HKEB 1QVAA 1U9IC 4CHTA 4XARA 2DWQA 4KNYA 3G5AA 1MEJA 4KIUA 2VBFA 1F6BA 1WULS 2FWRA 3I9KA 3OZEA 4IR7A 4KHZA 4LXIA 4UBNA 4GD3Q 4JNKA 4G1FA 1QHFA 1VIVA 2JW5A 4FCVA 3WJAA 1QU3A 3JWJA 1VDZA 3JS5A 1D0VA 1C8LA 1I4EB 3GZJA 5ALXA 2CV1A 4HN4B 4KXVA 2YV1A 5A1TA 3I9MA 5AVVA 1Z39A 3HXOA 3N0RA 3EUAA 3FE2A 1X2EA 2LZ0A 3NAQA 4B32A 2QX9A 1GZSA 1RYFA 3S2ZA 2PGLA 5FWXB 1FYDA 1IOWA 3RKRA 1ZL0A 5LQJA 4NY1A 2VSXA 4QDJA 2NADA 2VUHB 1N6NA 1FRQA 1R6AA 2FZWA 2NNLD 2XCQA 3D1JA 4B87A 3ZXXA 1DHRA 3G7UA 1F2VA 1FFXA 1M1NB 4LYHA 1JH8A 4EO9A 4S35A 2A58A 3IUJA 4MNTA 5U9CA 5AOAA 3DLIA 4D2IA 5M5BA 4MQUA 1VOTA 5J1TB 5GZ1A 2WWFA 5JBQA 4P9NA 4WZBB 1XEFA 3FWNA 1EG2A 2L18A 3H2ZA 1E6KA 3T15A 3SK0A 1SCIA 2FZEA 2HIMA 2EFJA 1BXGA 1TW2A 5HDBB 5BN5A 2VWGA 5BXQC 3LQ2A 2IYRA 2Z0MA 4Q7KA 5AK4A 1KOGA 2V6GA 2F17A 1XMQB 3K15A 3NTRA 1NW6A 2WLSA 4FW9A 4CV1A 5SY9A 4R9UC 3U3DA 5K3SA 5ADUS 5LXTA 1N8NA 3W3AA 4QFDA 2EU8A 2IPAB 4KDRA 5GZ3A 3QUBA 2J67A 1LBSA 3REQB 1JU3A 3N8IA 1JFSA 1QP8A 1VMKA 4J0DA 5JNTA 5I7HA 1GYPA 1KJQA 2C1EA 1DGQA 4B31A 1M75A 2LRHA 2QNRA 2CLEB 4EM6A 5TGDA 4TT3A 1Z6YA 4YCDA 4C0WA 3ORHA 3VC3A 4GR9A 2CLDX 4V0MA 3ZH9B 1X7YA 1NYLA 2X1HA 3C8ZA 3DMYA 3KVRA 3PGJA 3PSHA 5AVKA 2BGGA 4RIFA 1XCGB 4RD0A 3GGDA 3IJEB 3KQTA 4CIVA 4KGDA 5ISMA 1P7VA 1J6UA 3LT0A 1N0IA 1DQRA 4PPYA 2JNWA 3SJZA 1KWKA 3FUUA 4JVMA 3SBXA 1ORTA 5BN5B 1F14A 1NVKA 1SH7A 2BV3A 4WOPA 5H59A 1AURA 4ICIA 3V00A 1IEXA 3HUTA 4MEJA 2YH2A 1UJ6A 4P35A 5TT1A 3DCJA 3JARA 4M60A 4YIKA 3WMXA 3I1FA 1SZJG 4CDGA 1X2BA 1MG5A 3BJRA 4MP3A 4TRRA 2Q49A 2XUHA 4UNSA 1Q7EA 4R8RA 1OI2A 3JQAD 4FD3A 3QY0A 4B84A 4OLFA 4TTPA 2JFXA 3RC8A 2NVUB 1KKMA 1QORA 5BVHA 3PD1A 4NJEB 1IPFA 2BFCA 4X7MA 1DKPA 2XWSA 3BGVA 5CCXA 3VSCA 3U44A 1MC8A 1WF6A 4GC9A 3OEHA 3VHQA 5EHZA 2AXNA 5JRDS 3HCFA 1H5UA 3DBLA 3PK0A 1T3HA 2RBKA 2UZAA 5A1JA 5FH9A 5J43A 2UZ1A 4F4CA 5JNVA 1X1AA 1N3BA 2D1RA 1VYVA 2OQ2A