4MKXA

Crystal structure of apo scyllo-inositol dehydrogenase from lactobacillus casei
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
343
structure length
338
Chain Sequence
MTQKTIKIGIVGLGRLGKIHATNIATKIQHAKLQAATSVVPAELDWAKKELGVEEVFEDFDDMVQHADIDAVFIVSPSGFHLQQIESALNAGKHVFSEKPIGLDIEAIEHTQQVIAQHANLKFQLGFMRRFDDSYRYAKQLVDQGKIGDITLIRSYSIDPAAGMASFVKFSGGLFLDMSIHDIDVIRWFTGKEIDKVWAIGLNRAYPVLDKAGELETGAALMQLEDKTMAILVAGRNAAHGYHVETEIIGTKGMLRIAQVPEKNLVTVMNEEGIIRPTSQNFPERFAQAFLSEEQAFVNSILNNQDVGITAEDGLQGTKAALALQEAFEKNDIVQVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of apo scyllo-inositol dehydrogenase from Lactobacillus casei
rcsb
source organism Lactobacillus casei
molecule tags Oxidoreductase
molecule keywords Inositol dehydrogenase
total genus 119
structure length 338
sequence length 343
ec nomenclature ec 1.1.1.-:
pdb deposition date 2013-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4mkxA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4mkxA01
5FWNA 3B6ZA 4A10A 1JKFA 1E6WA 1EEHA 1OMOA 3DZJA 4XRRA 5CEJA 3AM3A 1ZFNA 4O6VA 1SOWA 4UULA 1XEAA 4L73A 2Q1TA 1M75A 2WE8A 4IDEA 5A9SB 4IDAA 1PSDA 2DC1A 4MVJM 1UXGA 1QXSA 4BOYA 1IHXA 3OA0A 2QZZA 5B4TA 1K6JA 3GH3A 1W4ZA 4Y98A 5CHEA 4NI5A 3RQSA 4A03A 4BKRA 2BRUA 5LDGA 2Q2VA 3OJEA 3PHJA 5U1PA 2PH3A 4CQMA 1KEVA 1YQGA 1NHWA 2UUOA 2IYOA 3K2EA 2YW9A 2PFGA 5CEFA 3D64A 4R1NA 4WE3A 3VPHA 4OO3A 2GZ2A 4BGVA 2AMFA 2OOSA 2EP7A 4BQRA 1D4FA 1U7HA 2X8LA 5CEEA 4GPD1 4CUJA 1ISIA 1NR7A 1NPYA 3ZNNA 5AXDA 4YB8A 1DFHA 2OHXA 2X23A 2NU9A 3JQDA 2B35A 2BFAA 4DUPA 1GEEA 1AUPA 2J3IA 2LDBA 3PHLA 4RVSA 3UUWA 3ZH2A 3NX4A 3DHYA 4BO4A 1PQPA 3SC4A 2X9VA 4QQRA 1EVZA 4J16A 2VYVD 4RF5A 3AFNA 4DPKA 3BTSA 1UXHA 4GBJA 3MEQA 2BI8A 3EDMA 4YT2A 4F45A 4Q3AA 3KYCA 2QHXA 3SBOA 4XJTA 2AEMA 1X0VA 4IQGA 3DDNA 4YAGA 3K30A 1P1JA 4FOOA 4ZHSA 2ZYDA 3H9EO 2V6GA 3JD4A 5B1YA 5MDHA 4ZVVA 3ONEA 4FD3A 2Y99A 1YOVB 4AJ4A 4PFJA 2O23A 3L9XA 1E7RA 3V1TC 4CM8A 4D41A 4CV2A 2CDCA 4JBHA 2BFOA 4E32A 4WUVA 4BNKA 1XKQA 2QW8A 4H7PA 4J1NA 4J1TA 1NHGA 1UP6A 4WASA 3JCZA 4IINA 1ML3A 3ENNA 4M55A 4WEOA 3HDYA 2PD6A 2GSDA 3LC2O 2P9CA 1T2EA 5JY6A 3WQSB 2AEFA 3WYBA 4FSHA 5GZ3A 3LDHA 5IN5A 3JYQA 4I5FA 1E3LA 3ENKA 3FPCA 1E7SA 4YJHA 1PGPA 4B7CA 1C1XA 5TQVA 1IYZA 3F1LA 3R6DA 1TA4A 5EIOA 5CG1A 3ZWCA 1GQ2A 2X5KO 4BMSA 1K2WA 4YT8A 3FTPA 1ISJA 2O7SA 1Z7BA 3H4VA 1U5CA 2EWMA 5AQ1A 2HO5A 4H16A 4Q3BA 4AG3A 5KVQA 1NM5A 3LT2A 4ZICA 3DTYA 2WMDA 4L0QA 2YHIA 1ZSYA 3GC6A 4IMPA 3CH6A 2UYYA 5KJFA 1B7GO 2C29D 4II2A 2QYSA 5L7WA 1C3VA 3CZRA 4BL5A 3O8QA 2Y1GA 1HDYA 2IRWA 4U7WA 1PZFA 4PZEA 4D43A 4BO5A 1ZZEA 1OI7A 2ET6A 5JNLA 1WMBA 3JQCA 4I5GA 2AA3A 3EGOA 4YPOA 2JHGA 2AEJA 3KVOA 4NPCA 3WIDA 3GVHA 3K6JA 4NJOA 3QQPA 3QVWA 4WOJA 3HQ4O 3DAGA 4PVDA 1ULUA 5HA5A 3KV3O 1C14A 1MFPA 4IXTA 4D3FA 4NR0A 2VRCA 4IZHA 1ARZA 5B4UA 2Y1EA 1NR1A 2C59A 2V6MA 3EY4A 4J1SA 3KOUA 2VYNA 3UF0A 3PGXA 3OICA 1NAHA 1JW9B 1UDAA 4OH1A 5BSHA 4BNYA 3HDHA 4BV9A 3HJAA 3QV1A 1XIVA 2YFHA 3O4RA 3X2FA 2WWRA 3DFUA 5ICMA 4G2NA 2FMUA 3H3FA 1M6HA 3TL2A 2FOIA 3L6DA 4K9DA 4CR6A 1F06A 5BSFA 1PS0A 4DIBA 5J9GA 1K0UA 2EEZA 4M54A 4WLUA 4ALJA 2DFVA 1YXMA 4BKOA 1ZSVA 3VPSA 1X7GA 3DBHA 4KOAA 2V6FA 4CM8B 1WAMA 3AK4A 1LC3A 1T4DA 1PJCA 1BDMA 2HDHA 2NSDA 2C7VA 4LMRA 1VSUA 3BMQB 5KVCA 4PCVA 3EHEA 4GKVA 4ND5A 4RVUA 1ZJZA 3PI7A 4YAIA 2NV6A 3IIEA 3JD0A 5HRUA 1YDEA 3QRWA 1WP4A 4MP3A 4XGIA 3RFVA 4NFYA 4BO1A 5TGDA 3GRKA 3NUGA 3NT2A 4J6FA 2EGHA 2HCTA 3OM9A 3RUAA 3WJAA 4DQUA 4Q3DA 3N7UA 1E3JA 3OSUA 4XDYA 3MWEB 3WGHA 3FRJA 4UUNA 3L4BC 2VRBA 3R3JA 4CLEA 1YQXA 4JN6B 2HJRA 2O2SA 2C2YA 2EERA 2DPGA 1PS9A 1H6BA 2PZMA 2WYWA 4J90A 4TKLA 4R9RA 1C1XB 1ZVMA 1DC3A 5CDYA 4OKNA 2YJZA 2ZQZA 4EDFA 4BB5A 2EKQA 3AY3A 5L51A 4BS9A 3FCOA 4AJPA 3RBVA 2ZQYA 1O5IA 2Q4BA 3E5MA 2D3TA 4HNGA 3VZRA 4CM9D 4M1QA 4OGWA 5FI5A 1NXQA 1LJ8A 2Q2WA 1I3KA 3GY0A 1JU9A 4ALIA 1SZJG 4MKZA 2HMVA 3LK7A 1VKNA 2X6TA 5A06A 2YZ7A 3HUDA 4UVDA 3QVSA 1NTOA 2QRLA 3L9WA 3QVOA 3RUHA 2W2LD 5BNFA 4D0RA 2FR8A 2O50A 2PZLA 3WMWA 1PQUA 3PJDA 3RC2A 4NIMA 2PKRA 4RVDA 3RD5A 3GGGA 3DFZA 1N8KA 3MTJA 4PRLA 1Q0LA 2BGMA 3ZNPA 3QVXA 3FWNA 4RQTA 2GF2A 4E21A 1DHTA 1U3TA 1DIGA 1YB1A 2EXXA 1QYVA 3WG9A 5IZCA 1LRJA 1A7KA 3WB9A 5B12A 4D3DA 5EESA 2VHYA 1I24A 1RWBA 1BDBA 1SAYA 5KCZA 1ADFA 1M76A 2HRBA 3O8QB 3MCVA 1O95A 4B4VA 3RC7A 1T2AA 2UDPA 3L4BA 1DFIA 5JBIA 2W8ZA 3NDIA 3DMTA 5A5FA 1FDSA 1EE2A 2QYTA 3NRCA 4D46A 2O4UX 4WNCA 4OM8A 3H6KA 3RJ5A 3PQDA 1DC4A 5A9RA 2XOXA 1KOLA 4W7HA 2W98A 3ANMA 4DQVA 2BLLA 3EZLA 4GKBA 4RPJA 4GGOA 4WCFB 1JAXA 2PA3A 1YQDA 4WLNA 3C85A 3JQ7B 5TC4A 1XELA 1DIBA 2WJPA 4UREA 2I99A 1AXEA 4DTIA 2WTBA 4L74A 1PZGA 4KMSA 3U9LA 5IDQA 1KS9A 3TZQA 1E7WA 4WOKA 2CDAA 2JJYA 5ER6A 3IJRA 1CRWG 3KRTA 1SOVA 4M87A 1WZEA 3QWFA 3DZGA 1TXGA 1DAPA 3H9JA 4FR5A 5T64A 3RC9A 3HDJA 2AQIA 5DP1A 3RUIA 2Y66A 1V0JA 1YBVA 3WFIA 3KETA 4KUHA 3JQ9A 3ULKA 1YDWA 2DBZA 2PGLA 4JP2A 2B4RO 5A9SA 1DJQA 4QXMA 1X14A 4DYDA 1LU9A 2ZCVA 4IBOA 1GD1O 4GSKA 4BNGA 3ITKA 4JBIA 4E5KA 3DZIA 1PZEA 2BGKA 3GPIA 2OP0A 4TVOA 5KVVA 5T73A 1BVRA 3Q1LA 2FZWA 2G76A 3BMCA 2J3KA 4IS3A 4E2WA 5I9MA 5G0UA 3HSKA 3WGTA 4IJWA 2E6UX 4GMFA 1NQTA 3C1TA 4CMJA 3PDUA 1F17A 1V35A 2WM3A 4Q3CA 4WLVA 4R4JA 1MUUA 3K5PA 1C1DA 7ADHA 3ST7A 2IXAA 1ZCJA 3PEFA 2B0JA 5A1TA 1M2WA 3L4SO 3I3OA 2EF1A 3IL2A 1B8PA 1KYQA 2P5UA 2Q99A 1IUKA 4M89A 3GT0A 3Q0EA 3G17A 2PK3A 3VZSA 1CERA 1HXHA 3VVBA 1N9GB 2YV2A 3STHA 3ETGA 4NQZA 3TSCA 3NT5A 4RPLA 7MDHA 3PTZA 5IAAA 4XA8A 1T4BA 1UZLA 4NU5A 4U6QA 5AXBA 3ETEA 1DDOA 3H5RA 1RJWA 2GASA 4GX5A 1HEUA 4J9UE 2EW8A 4B4OA 1QMGA 4O5OA 5DCUA 1F8GA 5JCJD 4YAKA 1A9ZA 4J7UA 3F4LA 1ZMOA 3HFGA 4XQGA 3ZN2A 3PYMA 3C8MA 2PWZA 4XR4A 3E48A 1GQYA 4L9RA 1NVGA 3G0OA 1E7MA 4EW6A 1T25A 2UAGA 4NBUA 4HNHA 4B4WA 2X0RA 5ICSA 1P0CA 3ON5A 1ID1A 1QYWA 3U4HA 4R1TA 2BFPA 2AE2A 1S6YA 4OXNA 4B8ZA 1IOLA 2A4KA 4FFOA 4IDCA 5AXCA 4JLWA 4WCDA 5L45A 4J9VA 1B8UA 3HDQA 3OJ0A 3UKOA 3I9JA 3WGZA 4CLHA 3EYWA 5THKA 4IMRA 1JTVA 2VUUA 3PK0A 1PIWA 1U9JA 3AM4A 3LQFA 5ENVA 1WVGA 1Y9EA 1EUCA 3UVEA 4W7IA 4M49A 2W90A 3VDQA 5G0WA 3ZNOA 2ZKLA 1CQJA 3H9UA 3GMDA 4HADA 1GUFA 4E0BA 1IULA 4GVLA 1Y8RA 5JDIA 5CDGA 4LMPA 3FTNA 4EI2A 1HE2A 4JJIA 4ALKA 1B15A 3KSUA 3LF2A 4CLXA 1DIHA 1E5QA 2VHZA 1LDBA 3JQ8A 1LLDA 1P45A 1RKXA 1N7GA 4OOFA 4BNZA 4RVFA 4BNWA 1VKOA 3AY7A 3ZU2A 4GQAA 2H9IA 1B14A 1PJ4A 4LK3A 4HKTA 1GZ3A 4CQMD 3M6IA 1U7TA 2B4TO 1D3AA 5L3ZA 4B8WA 1H0KA 4MVJI 2GERA 2VHVA 4XIJA 3T7EA 1DBVO 3L6EA 3QA9A 4K28A 1I10A 3INRA 5H82A 3MJCA 1YL6A 3ZHXA 3IC5A 1O0SA 4ITUA 4YRAA 5TIIA 1EK6A 3NV9A 4U5QA 4A0SA 4EGFA 4R1UA 1HYEA 3ZCXA 3DWFA 2JAHA 5COQA 4LSWA 5G4LA 2FPIA 2DUWA 5KWEA 3WGQA 1I3MA 2FR0A 2XPCA 3L07A 2OP1A 4BNMA 4FGSA 4K6CA 2OMEA 3WQQA 2D4AA 4FCCA 4Z9FA 2VZ9A 5JDIC 1HE5A 2ZTLA 3JQGA 2NVUA 2R6JA 2HLPA 3WGIA 3DBRA 2IZ1A 2HMSA 2AXQA 1LSOA 3QSGA 1H2BA 3TZ6A 1O6ZA 4TSKA 4YJGA 5HS4A 3ANLA 3KXDA 4CODB 2VTEA 5C5IA 1HYHA 1LBEA 4XRGA 4A5OA 3KM0A 4FJ2A 4BGUA 1MC5A 4FFPA 1R0SA 2C5AA 3GEMA 1RYDA 4S3MA 1I3LA 1PR9A 1SPXA 4Z6KA 2EKPA 2NU8A 1HZZA 4XB1A 3SJ7A 2X0NA 1PL8A 4CMHA 4F3YA 1I32A 5ENDA 4PLPA 3U4CA 3L6OO 3KYDB 5F5LA 4QO8A 5KJCA 3OQBA 1GR0A 2PR2A 4JJGA 4N5NA 1VJ1A 3VTZA 3F6YA 5L53A 2HQ1A 3U49A 3TZHA 3IJPA 4BNVA 4FJ1A 5G4KA 3W4KA 5JDCC 1PL7A 1DJNA 2OBNA 2Y67A 3AUSA 5TJ9A 3UAGA 1TLTA 1P0FA 3DAFA 3KEOA 4AJKA 2NU6A 3R1IA 4BHTA 5TRTA 1NBOA 4IM7A 5I8WA 4HFMA 1J4AA 3V5NA 2IYPA 2NVWA 3CKYA 4FPXA 1HDCA 3BZUA 3WTCA 4WECA 4Z0HO 3GNTA 4IJUA 4GSLA 3GNQA 4OAQA 1CETA 3G1TA 2J3HA 1G0NA 4PG5A 2TMDA 4IS2A 1JAYA 4MIEA 1UDBA 3QJ5A 4PVCA 5CG2A 3ADPA 3S55A 3ZV5A 1JVBA 3AFMA 4J0FA 3OQ1A 1F8FA 4KQWA 3ZV4A 4CV1A 4C7JA 3VC7A 1XDWA 4IY1A 1YVEI 2Q1WA 2C54A 4AJEA 1YONA 2J5QA 6LDHA 3E1KA 2X5OA 4YRDA 4J49A 2G82A 1DEHA 3AOGA 2AG5A 3Q2KA 3CXRA 4HUJA 4TZKA 2GZ1A 4FC6A 3VOSA 4EEXA 3E9QA 5KJ6A 4O63O 3KYDA 1GY8A 1E7YA 1DRWA 5JXWA 2WD7A 3GNSA 2B36A 2PY6A 2NTVA 4FDAA 3MJSA 4PG7A 1Q7CA 1ZEJA 4FQ8A 1DHRA 3D5TA 4W9NC 2X0IA 5L7TA 1X7DA 1SNYA 4ZU3A 3WTBA 1H94A 2I65A 3DC2A 1B0AA 1CJCA 2X58A 4ND2A 1NASA 4PLYA 4WGGA 4B7XA 4MPDA 3Q2IA 2EG9A 2ZB8A 1W73A 3O38A 4PLHA 3IUSA 4LCJA 5I7VA 4IQ8A 2ZIZA 5T67A 1LDNA 1SEPA 4H3VA 4MDHA 4C7KA 1JLLA 2Y0DA 1QKIA 1GYRA 3I9KA 4I5DA 4XYEA 3RI3A 3IKTA 2Y0CA 1P44A 3DEYX 3JQBA 1EDZA 1ZW1A 2ZB3A 1U1IA 1PJSA 4JXKA 3QLJA 4FFRA 2HKIA 4LRSB 4IQ0A 2RHCA 3CMMA 4ALMA 2VNSA 2NTJA 4DLLA 5EQFA 4PLCA 2O3TA 4O1MA 1PJTA 3G3EA 1YS4A 4GGPA 3PJGA 3ZWPA 2DFDA 4UEJA 3DZBA 1LUAA 4DPMA 1EBUA 1YE3A 2Y1FA 4ZQBA 3E03A 1HF3A 1ZXBA 3UCFA 2AHRA 2B37A 3JQFA 4DRYA 1R37A 2ZTUA 1QG6A 3PQEA 5H81A 3K9QO 2GRAA 1IHYA 3GFGA 2B83A 4OQZA 3GUCA 2QZ9A 1HT0A 4BUCA 4CJXA 5KJ1A 1PGNA 2J6IA 4CQLA 4BQPA 5DDIP 1EK5A 2NUAA 3GOHA 2RHRA 1EUZA 1Y1PA 1L7DA 4AJOA 2QQ5A 4N18A 4BNJA 1QV7A 1T2CA 3U09A 2DU8A 5DULA 1E3EA 4KUGA 4CM9A 1FDVA 2ZATA 5IJZA 4QFCA 5IDXA 1EQ2A 3AUAA 3DMTC 2UV8A 3LT1A 4RDHA 1MG0A 3GAFA 3B1JA 4Y6SA 1O94A 1N9GA 1PS8A 3IOYA 1IY8A 3NKLA 2W2LA 4GLOA 4AVYA 1YL5A 3ZWOA 2NQ8A 3NT4A 4XIYA 2DM6A 4FOSA 3SEFA 1TI7A 3VTFA 1DAOA 3AOEC 3CTMA 3PDJA 1CDOA 1EQUA 4HFRA 1ADCA 1GYPA 1ENOA 2YDXA 4P4GA 4PLFA 3G1UA 2Q4EA 4NFSA 4AJIA 3GRPA 3S2EA 1NVMB 3CE6A 3KO8A 1WLYA 3H5NA 4JNKA 2RBEA 3WOHA 2TMGA 1GEGA 2ZK7A 2CD9A 5ADHA 2WYUA 3HWRA 1LC0A 2VCYA 1D1SA 1Z75A 2GR9A 1XSEA 1AHIA 1I01A 3VPGA 4E5NA 2EV9A 4XYLA 1DLJA 4DQXA 2GN4A 2I76A 4L4XA 3JQ6A 3PFWO 4TRNA 4D0SA 1H6AA 4OYRA 3WS7A 2P68A 1RM0A 3QVTA 2DKNA 1E1LA 3KB6A 1AGNA 3V1YA 4P22A 4F6CA 2DT5A 4HX5A 3TFQA 3Q3CA 4WCFC 3MTGA 4R51A 1FMCA 1NVTA 1UXIA 3I4CA 3UICA 1NAIA 2HRZA 2D2IA 3BMCB 1HL3A 3ONDA 3PHIA 4RZIA 1N1GA 1U3UA 5JS6A 3ASVA 4S1VA 2XAAA 2D5AA 4WCFA 4JK3A 1KERA 3D4PA 1C1DB 3OIDA 3ORFA 4GVXA 4RZHA 1YBMA 1U8FO 3EK2A 2CF6A 4AJJA 4NBTA 1UR5A 2VTDA 2WYVA 2YQ4A 3JQBC 2VT3A 4EJMA 4RDIA 5AYVA 1QP8A 4JP3A 5HBRA 1HSOA 2D8AA 3ZHZA 1MX3A 2C2XA 3PWSA 4U8GA 3RFTA 4WK6A 1S7CA 4KQXA 3LC1O 3N58A 1G6KA 4B4UA 2FPPA 3GUYA 4E4YA 1ZH8A 1O89A 3D3WA 3P2YA 5ITWA 1UAYA 4QSMA 2H5LA 4TVBA 3K2BA 2CY0A 3E9MA 1CF2O 1BXKA 3PXXA 5IF3A 3TL3A 4CMEC 4CLOB 2DBVO 1X13A 1XHLA 3OECA 3AOEA 1FDTA 3RROA 1QV6A 4GX2A 1H93A 2GUGA 4A2CA 5H83A 1CIVA 3H7AA 3JYLA 4Y6PA 3HE3A 1PWZA 3TJRA 3NEPX 3Q11A 5JYFA 4G81A 4QTZA 1KVUA 4J4BA 4CM7A 1UZMA 2JFFA 1ZIDA 1LRKA 4H15A 3E8XA 1RM4A 4A27A 4G65A 4G5HA 5G2OA 1Y5MA 1I3NA 4MVJD 3IS3A 3VHRA 4CLRA 4RPGA 1ZSNA 3F47A 3BTUA 2X4GA 3EVNA 3GHHA 1MC4A 5DCWA 3TOZA 4YWJA 4LVCA 4XYGA 1B26A 4DWVA 3K92A 4FC7A 1LSUA 1T2FA 3FNFA 3I6QA 3PRJA 3WX0A 3D5QA 4MVJH 1WMAA 2PV7A 4JX8A 3FNHA 5MGBA 2I9PA 2YV3A 1Q2XA 1ZK0A 3ZWBA 1XCBA 2HK8A 4O59O 4AJNA 4YRBA 2BELA 5BSGA 3D1LA 2FY8A 4DLAA 4CV3A 4MP8A 3DOJA 1UDCA 3NDJA 3OBBA 1NPTO 1GPJA 3QWHA 2VNAA 3VH2A 2PLAA 1WNTA 4CV0A 1ONPA 2P91A 3GVPA 4IDBA 5JFOA 1BSVA 3WGYA 1AN9A 2CNBA 4YJGB 2JD1A 3BHIA 2VUTA 2BF7A 4RJTA 2BFMA 3GGPA 4ONEA 4PLGA 4I9UA 2C7GA 4ZQHA 5EJ2A 5DT9A 1E0DA 3I4FA 3RASA 3CIFA 2RCYA 3AW9A 4BNLA 3GZNB 5GZ1A 5KKCA 1UUFA 4NK4A 1U3WA 3FBGA 1K6XA 3H3JA 1LQTA 3VDRA 1C0IA 1LX6A 5HTOA 1EVIA 1CWUA 1GPDG 5JO9A 3EUWA 4OXKA 2EHDA 2Y1DA 3OEWA 4YYZA 2IZ0A 4IIVA 4XEHA 4YXFA 3E18A 1VJ0A 3W8EA 3W8DA 1YGYA 1HTBA 3I52A 3TDKA 5DCYA 1DPGA 3WGOA 3WLFA 5DP2A 3WSVA 4J1QA 2GN6A 3D3EA 5IXSA 3D0OA 4R3WA 1I8TA 1V6AA 3GVXA 1Z73A 3BMQA 5JW6A 3WLEA 3FNEA 1X0XA 4MVJF 3DBVO 3DBHB 4XYMA 3ZWVA 2E37A 4HY3A 4BKPA 4CM4A 1HWYA 1BWSA 3G79A 4Q3NA 5TT0A 2DTDA 4RORA 4JBGA 4IZIA 1T1RA 2O3JA 5FEUA 2OZPA 5BNTA 1YJQA 3ZWNA 1JVSA 2YDYA 3ETDA 4D45A 3GF4A 3OJOA 3T4EA 5JCXA 3MOIA 1B2LA 3DBLB 3M2PA 2JCXA 3RFXA 3NJ4A 3AU9A 4NH4A 2PZKA 1E3WB 5C7IO 4J0EA 4J2OA 4OL9A 2YV1A 2CZCA 1A9YA 2PD4A 4YJFB 3M1AA 4ND1A 2CVOA 1V3UA 4OJNA 1A4IA 3JYNA 3ROKA 3GAZA 4IDDA 1NPDA 1Y6JA 5G0TA 1FDUA 3WBFA 3QWAA 4GX0A 4QFDA 3ASUA 3WMXA 1E77A 5A03A 1ISHA 1E7QA 2Q2QA 3BMOA 3I23A 4P4NA 1Q1NA 2VWHA 1MA0A 1DLIA 3IQDB 3TQHA 5COBA 1Z7EA 1KEWA 1C0KA 2W2KB 3IKVA 2V6BA 4DXHA 4BIIA 3RWBA 3SVTA 4FN4A 2Q49A 1UH5A 1PR3A 1V8BA 2DPHA 4JROA 4CPDA 4WJZA 1AHHA 2FPGA 3W8FA 3MZ0A 4BNIA 1I2CA 1TEHA 3MOGA 3SX2A 3UCXA 3FR8A 1PGOA 5F3RA 1DFGA 1GV0A 3VKVA 3ZV6A 1EFKA 3OMLA 4YEDA 4W82A 2POQX 1KIFA 3IAHA 3V1UA 3OIGA 2HMUA 3ZU5A 3F5QA 4GL4A 4FFNA 4R9SA 4RLSA 5IDYA 3TF5A 3DL2A 4IDGA 1BG6A 1ZUD1 3LC7O 1DO8A 2YHIB 1Z82A 4IPTA 1DSSG 4XQEA 5TF4A 4B3IA 4ZGWA 5HS6A 4BGIA 5HM8A 3RC1A 1ZXLA 4YQZA 5IXYA 1XQ6A 1F0YA 1P74A 5THQA 1EDOA 4P4LA 4BV8A 1FXSA 3PYLA 2Q1UA 1QR6A 3DOCA 3VKUA 1PZHA 2EIHA 2IDZA 1U3VA 5C3MA 1ZK1A 1J49A 3GN1A 3RUEA 3SXPA 1SB9A 1PL6A 4F6LA 1Y5RA 1C0PA 3OH8A 3TZKA 1KVTA 5JSFA 4GAEA 1B8VA 3GN2A 5BR7A 1JDJA 1HDZA 3H9GA 3B70A 1H5QA 3AUUA 4FFMA 4KDEA 3PJFA 3NDRA 3PJEA 3PQFA 2VRCD 2O48X 5I7FA 4K26A 4PG6A 3PLRA 4PIVA 3WFJA 4YT4A 1AE1A 2B69A 3AI2A 3FHLA 3FN4A 2DTXA 1FJHA 2WSBA 4WKGA 1EUDA 4B3HA 4CQMB 3BYZA 3GDOA 3U3XA 1E3IA 1IL0A 2QRJA 1VL6A 3NAQA 1MXFA 3RUCA 3JD3A 2C0CA 3PIDA 5TS3A 4BKUA 2A35A 2BI7A 3WR5A 1MP0A 1K5HA 1D1TA 1N5DA 2RH8A 2UVDA 3QWBA 4NU6A 1QLHA 4YA6A 2WEKA 1Y81A 1QYCA 1BW9A 2JL1A 4L4RA 2GPTA 1PTJA 4E5YA 2AG8A 2Y93A 1TT5A 4TWRA 3KLMX 1LQUA 2C82A 5JAQA 3KLPX 3W6UA 3R3SA 5TNXA 5JC8A 2JCVA 3I1JA 3LLSA 3E9NA 1P1IA 4NJMA 4E6PA 3RJ9A 4DA9A 4E2YA 4EZBA 3C7AA 5KNLA 2FWMX 3H65A 3JQ9C 1ADGA 3C7DB 3GPDG 2IODA 3BAZA 2AE1A 2SCUA 2X86A 2Y1CA 5CFZA 4BB6A 4MKRA 4OMUA 1DXYA 3JQEA 2BH9A 5T57A 1R16A 3EMKA 1PWXA 3CEAA 4ID9A 2GYYA 1LLCA 3UGKA 4E31A 2J3JA 5BT9A 4XGKA 1VC2A 4WLEA 1HDOA 5EMHA 3GA0A 1E92A 3PPIA 4EJ0A 5LC1A 3RUDA 1RYEA 2VN8A 2G0TA 2VYVA 5K0ZA 3WQRA 2O3RA 3PGJA 3BMOB 4RVGA 4PLWA 3BTOA 1ZO8A 2GCGA 5A02A 2O3SA 1VI2A 2DBQA 3PFFA 4CUKA 3GVCA 2IEBA 2C07A 4R5MA 1E6EA 4R68A 5EL0A 3PZBA 3NYWA 1GAEO 2VWPA 3B1KA 2G1UA 4ILKA 3AY6A 3FF4A 1VL0A 5KVSA 2CSUA 5I9NA 1YL7A 4FFLA 5F5NA 2W2KA 1I2BA 5ES3A 4K6FA 1UP7A 3TZCA 2NQTA 2GGSA 3GEDA 4LSMA 1XWFA 4BNXA 4CM6A 3GG9A 3X2EA 3COSA 2X9NA 4NJMB 3S8MA 2NLOA 4HBGA 5FF9A 2NNLD 3KYCB 5IN4A 4Q3EA 5JCJA 3K73O 2DLDA 2DQ4A 3CINA 1CQIA 4Z9XA 8ADHA 2DAPA 4J7CA 4F46A 5C7LO 5T6BA 3PWKA 2GDZA 1ORRA 4PZDA 4WLOA 4ZRNA 2C20A 4DLBA 4W4TA 1BW9B 3K96A 1LTHR 2OO5A 5G0SA 1U2GA 4E3ZA 4URFA 3GZNA 2I3GA 1HLDA 4AJLA 3F1KA 4BO9A 1PU2A 3E6AA 2ILTA 2ZYAA 4GX1A 1SC6A 4KDFA 3A9WA 2A94A 3RAJA 3TN7A 1E6UA 2F00A 2FP4A 4CMEA 4ESOA 4M8SA 4AICA 2NACA 3C1AA 2Q3EA 5TJHA 5AXAA 3F9IA 4A7PA 1K6IA 2P4QA 4TROA 4YVFA 4OHUA 1T1SA 4R5HA 4NMHA 1XU9A 1VL8A 1HKUA 2Q50A 1L7EA 3W1VA 3ABIA 5C7OO 4AJ2A 2CF5A 5JE8A 3E5RA 4ALNA 6ADHA 3OFSA 1ZK3A 1QRRA 5TT1A 1TB4A 3QW2A 5JO0A 3UFXA 5A04A 3ZU3A 2D0IA 2B5WA 4DPLA 3LSYA 3JYOA 3JSAA 2RH4A 4NG5A 3BIOA 1KC1A 2EJVA 5EPOA 3W4JA 3NTQA 5JYDA 3I9NA 3ZU4A 5EERA 3M2TA 4HP8A 2JD0A 2R00A 4MIOA 2JD2A 4Q9NA 1WDMA 4BVAA 3R0IA 3RU9A 5BQFA 3ONFA 1PQWA 3QP9A 3QWIA 2J5KA 4Z0TA 1NQAO 3ZGYA 3I5MA 1SBYA 4QX6A 4UVGA 2VWQA 4NK5A 4YJHB 1Y8QB 2ZTVA 4CUZA 1RM5A 4BO2A 1XGKA 3WNQA 1KVRA 4J2HA 5M6DA 4CM4B 3P7MA 2I66A 2HMTA 3QE3A 2O3QA 4RF4A 4GH5A 3OP4A 4LVUA 5DBGA 3GR6A 1Q7BA 4R41A 3V2UA 2F1KA 3PHGA 1R12A 3ZW8A 3KSZO 1GQQA 2AQHA 2P9GA 1NFFA 1H9AA 1G1AA 1K89A 1U4OA 2PZJA 3GK3A 1OC4A 1ZMTA 1CEQA 1O9BA 1WDLA 2Z95A 3O26A 4AJHA 4GI2A 4LISA 1WPQA 2GNAA 1AXGA 3DHNA 3DZKA 4PRKA 5ER9A 3RSHA 1F14A 1GTMA 3VAZA 3BHMA 4OXYA 1Z74A 5J23A 3KTDA 3PZRA 4LRTB 1XYGA 1B3RA 1XG5A 2XF8A 2GD1O 4L8VA 2BKAA 1MFZA 1OAAA 5FFFA 1NQ5A 1LRLA 2Q45A 3JD1A 3RKUA 1JWBB 3VH4A 5JAZA 1U8XX 5T8KC 4FB5A 1ONOA 4HFJA 5IZCC 1LSSA 4XKJA 2O3UA 4PZCA 2PNFA 4L76A 3U4DA 1SB8A 3AJRA 3JYPA 5B37A 2HUNA 5KKAA 3IDSA 1UXKA 3DBLA 2QG4A 3T7CA 3JQ7A 5F21A 3VH3A 5L7YA 4CMIA 3WYCA 1QSGA 4CL8A 2G17A 3KZVA 3GLQA 1DIRA 3OF2A 1R66A 2X0JA 5BSEA 1YKFA 4OSPA 2GZ3A 1GV1A 3WWYA 2I6TA 1UJMA 5T5QA 2J5RA 5JAIA 2D5CA 3PYXA 4TMFA 1JKJA 1ENZA 5I7SA 1BRMA 1LLQA 1D7OA 1BXZA 3UN1A 3H9QA 4BNTA 4HWKA 1LA2A 5A9TA 1I36A 4MOWA 4BO8A 4BMNA 3OETA 1XLTA 1LDMA 2GN9A 1PJBA 4BNNA 4D42A 3EVTA 5CPBA 2GLXA 2PD3A 4J7XA 5A5EA 1M6WA 4L75A 1R4NA 3JQFC 1DRUA 3Q6IA 2A9FA 2PH5A 4PLVA 1ULSA 3LU1A 3LLVA 4MVJP 2X7HA 1UP4A 1NFQA 3D3WB 5TSDA 4RPHA 4BNHA 1UXJA 3AI3A 3TRIA 1Q0QA 1XU7A 3GG2A 4CL3A 4I8XA 1Y9AA 3QY9A 3INTA 4FIZA 1MB4A 4QO7A 2PKQP 4CLOA 3S2GA 1T24A 1EMDA 4KWHA 4K1LA 4D79A 9LDTA 5FYDA 2X9GA 5JYAA 2HJSA 3DTTA 1D8AA 2ZTMA 4Z3DA 3ZI0A 3UH1A 4EJ6A 2B4QA 3AI1A 1HRDA 2NM0A 4KTTE 3FD8A 2JFGA 5K9ZA 4Y9DA 2E4AA 4JJFA 4YACA 1ZK4A 3WJ7A 1Y7TA 4OIMA 3Q9UA 1R6DA 4Z9YA 2YUTA 2P2SA 4YCAA 3SLGA 4NBWA 1ISMA 2NTNA 2YY7A 2D59A 1ISGA 2FZEA 3EAGA 3H2ZA 4LCEA 5JMPA 4EUHA 2JAPA 4EUFA 1NFRA 4PLTA 4TRRA 2CVZA 3DO5A 2CUKA 1GUZA 1XQ1A 4DVJA 3A14A 1SCUA 3D4OA 3W6ZA 5JMWA 5CDTA 1A7AA 1OZAA 2OORA 4MIYA 4RL6A 3DZFA 3C7CB 1Q7GA 4BGEA 5ILOA 4ROSA 5JLAA 3VPFA 1E3WA 3C24A 5DBIA 5KIAA 4YAEA 1NP3A 1LDYA 1Z45A 2BHLA 4N5MA 4OOEA 3WSWA 1BMDA 4IJVA 3QHAA 1KY4A 2AQKA 3FPLA 4KTVE 1T26A 3AU8A 1FK8A 4L4SA 1O8CA 4DBVO 3ZNQA 4WLFA 2C5EA 3JV7A 5KJEA 1PJQA 4IXWA 4U6SA 3GVIA 1DB3A 4W99A 3FI9A 4E2ZA 4CR8A 1HDRA 2EGGA 2I67A 3TPCA 4A26A 4MINA 2QX7A 2JHFA 5EN4A 2YFQA 2X1HA 1VE9A 4P8RA 4RCVA 3KEQA 4LW8A 1NQOA 4MJLA 3V2GA 2FSSA 5I7EA 5F1KA 1P1FA 3BXXA 4IGEA 3JQAD 4J4TA 4R3NA 8LDHA 1YB5A 3GHYA 3OJLA 3ROMA 1SO8A 3DXFA 1IPFA 1MGOA 2VZ8A 3RIHA 2HK7A 1R4NB 3ZHYA 1NWHA 1WZIA 3DMYA 5B4VA 4BO7A 1XR3A 5JDCA 2OL4A 1I30A 1A4UA 3UOGA 4X54A 3RCBA 2RIRA 4R1SA 2RAFA 3A4VA 1JN0A 2P4HX 4CMAA 4EYEA 1PJ3A 4R69A 3D7LA 4AFNA 1WW8A 3KUXA 1ZK2A 1NWCA 1GDHA 1YRLA 1YBAA 4KP7A 5AVOA 4CQLB 4ZJUA 3I6IA 2JKVA 3PIIA 1ZBQA 2DUUA 4R54A 2OGUA 3B20A 2VZ0A 3CZMA 1BXGB 4YTEA 5L95A 1BVUA 1DC6A 4ZQGA 2IXBA 3ZDFA 2Q46A 3ZW9A 4ZD6A 3DZHA 1IB6A 2CFCA 4QECA 4PN3A 2Y0EA 1T2DA 3HNPA 1A5ZA 4LN1A 4RO0A 1E3SA 4I1IA 1KVQA 2E49A 1V3TA 2V7PA 3I9LA 1OFGA 2PKQO 5KTKA 1P3DA 4NZ9A 2VOEA 3LVFO 1H6DA 2Z1MA 1B16A 3G49A 4E12A 1KEPA 4WPGA 4BKQA 3AWDA 2DVMA 4PG4A 3O9ZA 3LZ6A 2ZJ0A 3T4XA 1YWGO 3FR7A 1BGVA 4JIGA 3ZWXA 3ANNA 1H9BA 2VOJA 2ZYGA 4FW8A 4XWYA 4PLZA 1HDXA 2OXIA 1E1NA 4RQUA 3WXBA 1MV8A 4DMMA 3TWOA 3WWZA 4Y67A 2OBYA 2QIOA 1P33A 4JQCA 1LI4A 2WE7A 4XX0A 1V3VA 4YJFA 4A73A 5DF1A 4DIFA 5TLSA 1EFLA 3SLKA 3BMNB 1CYDA 4DMLA 5ITVA 4MVJG 4RV9A 1GFSA 1YOVA 2VT2A 2HMWA 3RVDA 1R0KA 4M86A 4II3A 1R0LA 1ONNA 3CUKA 1J5PA 4IGFA 5DNAA 4GWGA 4CLRB 3RKRA 2NU7A 3D4NA 1LSJA 1WXDA 5A4DA 1H6CA 3I9OA 4D3SA 4YDRA 4O0LA 4UVEA 5ILGA 5K6AA 1DRVA 1I0ZA 1P31A 3KYBA 4UAGA 3KBOA 4P38A 4ZQFA 5CP8A 1N1EA 3EZYA 5JYEA 1R15A 2NVUB 4BO6A 4E2XA 3HZZA 5L4LA 1B3BA 3DAPA 2WD7B 1I5RA 1KEUA 3S2IA 1MLDA 1MXHA 3BMNA 5I9LA 1ZEMA 1EVJA 1G0OA 4NHEA 2ZJ1A 3FWZA 1A72A 4MVJA 2O2YA 5A3JA 5GZ6A 1XA0A 1OBFO 2XXJA 4CMBA 3RBZA 4EEZA 4XQCA 2D1YA 1X1EA 4CMKA 1PGJA 2YHUA 2Z5LA 3IP1A 1FDWA 2NADA 2R2GA 3K8ZA 5JC1A 2B5VA 1LLUA 4DBZA 3GEGA 4RPKA 1BTOA 3GMSA 1RM3A 4TZTA 3Q9NA 4MVJE 4RF2A 4XZ3A 3LF1A 4JCOA 1HYGA 1GCUA 1UAGA 1GYQA 3GZ4A 1OOEA 5DN9A 5LCXA 4B3JA 5T8KA 1P1KA 2CVQA 3P5SA 2CDBA 1U2DA 3JQAB 3INGA 3OA2A 1VJTA 2HAEA 4UUOA 2VUSA 1DC5A 4QUKA 5G0VA 3W4IA 4CMGA 1BHSA 3HN2A 3L0DA 1VSVA 2X5JO 1YJ8A 2W4QA 4MP6A 4XYBA 1ZKMA 3ZHBA 2VHXA 4TRMA 5F1PA 2E48A 1A27A 2NWQA 4NDNE 1J6UA 3JD2A 4OQYA 3UHAA 3DB2A 1LDEA 2GN8A 1I2ZA 3MJVA 1IZ0A 2BMAA 5L4NA 4MO2A 4BO0A 1NX6A 2PTGA 4KZPA 3KHUA 1L1FA 5IDWA 2BD0A 5U9CA 4ND4A 3DOOA 1PEDA 4RVHA 1R4MB 5KOIA 5G4KB 4UVHA 3SC6A 1E5LA 1JQBA 1P1RA 1WDKA 2QRKA 4KWIA 4N54A 3RBXA 4OSOA 1SMKA 3BHJA 3OQ6A 1LNQA 2HSDA 1GZ4A 1SEVA 4CLDA 1JKIA 3WBBA 3DR3A 2V65A 3CMCO 1NYTA 5AOVA 1K3TA 4J91A 3HG7A 2EP5A 1HSZA 1M66A 4DC0A 5CPFA 4D7AA 3P19A 4DIOA 3FSRA 1EZ4A 3H8VA 2UUPA 4TQGA 3F4BA 4E5PA 3H2SA 3RU7A 4UVIA 2YYYA 1KY5A 3AUTA 3V8BA 4I9NA 4CM1A 3F46A 1P9LA 4PGFA 5A3VA 2EKLA 5GMOA 4DC1A 2X22A 4EUEA 1J0XO 1Q0HA 3GFBA 2G5CA 4BNUA 5CDUA 4C4OA 1X7HA 3PHHA 1PJ2A 4I5EA 3PP8A 4XJSA 3LT4A 1E1MA 2Z1NA 4KUEA 4I9HA 2VHWA 1ISFA 1QYDA 4J4HA 4PG8A 4BNFA 4U0JA 3U4IA 1IPEA 4IJKA 4FGWA 4D44A 1KBZA 3S1LA 4HFNA 1U5AA 5IG2A 1GZ6A 3MJEA 4MKXA 4FBGA 1HETA 1NNUA 3H5AA 3VZQA 4XD2A 3IMFA 3ADOA 3UCEA 4LGVA 3I9MA 3V2HA 3HFSA 4BO3A 1EVYA 2FSVA 3PWZA 3CPSA 3S2FA 2VWGA 2JCYA 2J8ZA 4NNJA 1ZNQO 3K31A 3U0BA 1M67A 1R4MA 4IIUA 4FJ0A 1HZJA 3MWDB 1P1HA 1GU7A 2OFPA 3HN7A 2FN7A 4B7UA 2O7QA 4QT0A 3VPXA 1PX0A 3L77A 4YAJA 2E82A 3HB5X 3IP3A 3NJ8A 4FS3A 2Y1OA 1TT5B 1LDGA 1LXCA 2BGLA 3IUPA 1TVEA 4YQYA 3OEYA 3ZZNA 3WNVA 1QYXA 4ND3A 3EW7A 4CM3A 3KSDO 2O4CA 1I33A 2FR1A 3TNLA 2I5PO 5IFLA 4EITA 3OIFA 2H63A 4Y8VA 3OJFA 2IE0A 1E1KA 2DTEA 4CMCA 1EE9A 1QORA 3JQAA 2I3AA 3LYLA 3AM5A 5FI3A 3I83A 3GDGA 2Y05A 1F12A 1U4SA 1JWAB 3MJ4A 5DZSA 3WDSA 1X1TA 2NVBA 4CR7A 5JY1A 2AW5A 1VPDA 3B1FA 4I08A 4DL9A 1VM6A 4CM5A 3ZWAA 4Z3KA 4AL4A 5L4SA 1IE3A 2WDZA 3GDFA 4J43A 1ADBA 3HB4X 4YR9A 5K6AC 5CAEA 4WNIA 3NGXA 1EBFA 4GMGA 1QLJA 4W6ZA 4RF3A 4E5MA 2R00C 1W6UA 3ITDA 2PGDA 1YB4A 4ZRMA 1IZ9A 4J3FA 1HLPA 3NTOA 1X15A 4UUMA 5F1OA 3U62A 1C0LA 4R16A 1DIAA 3OHSX 3GGOA 3QIVA 4NBVA 4QEDA 3ZWYA 1N2SA 3CSDA 4XGNA 3RUFA 3C1OA 5EINA 1HE4A 4DYVA 4OKIA 1OC2A 1HE3A 1GUYA 1PGQA 2PGJA 3FNGA 4UEKA 5EQDA 2LDXA 2VQ3A 3VH1A 3ZWWA 5A05A 1RPNA 2OUIA 3F5SA 1Y8QA 4YBZA 4CMIB 2H1SA 3TFOA 3WIEA 3DQPA 1A71A 4TKMA 2FRDA 1HDGO 3NGLA 1Y8RB 5GY7A 3SJUA 4DGSA 3PVZA 2XXBA 1U28A 5DOZA 3N74A 3UXYA 1GL3A 3EC7A 4ZN6A 3BA1A 4W9NA 4NBRA 5COAA 4GLLA 2IZZA 1YH3A 3GQVA 2GO1A 4RGBA 3VVCA 4JGBA 3DONA 3HADA 2ZB4A 1ENYA 3DHEA 1V9LA 4YJDA 2HK9A 4AJ1A 5DOVA 2WD8A 4XB2A 5CDSA 1WWKA 2FHSA 1GCOA 4ZQEA 3ICPA 4NFHA 4XR9A 5IZ4A 2AQ8A 1MG5A 4WEQA 5U4QA 2IEDA 1ENPA 3JTMA 1GADO 4UUPA 5TX7A 3WICA 1VLLA 4ZA2A 3FBTA 2Y68A 4GWKA 4XQ9A 9LDBA 2DBRA 4B79A 3O03A 4Z0PA 4XCVA 4E33A 5L9AA 4IUYA 3M1LA 2ZB7A 3F3SA 3ROQA 2HU2A 4YT5A 5HWSA 3P2OA 3E82A 1KC3A 5LDHA 3U5TA 3BTVA 4HV4A 5I8ZA 1DOHA 1JA9A 4N5LA 4BMVA 1N92A 4INAA 3A28A 4Y6RA 5BNIA 1KETA 3NTRA 2A92A 2P5YA 4U0KA 1FF9A 5DBFA 2Q22A 3JQGB 3ZV3A 4E13A 2EW2A 1N7HA 4Q39A 1BXGA 4XDZA 5JPIA 5L40A 2EJWA 3ROPA 4RLHA 1W0CA 4N7RA 1PJLA 2ZCUA 3VZPA 4HXYA 3A1NA 1H2HA 1YO6A 2JFHA 3ZWMA 5C37A 3JQ8B 1UZNA 2YQ5A 3WGGA 1LEHA 4ALLA 3C3XA 2Q1SA 3WYEA 4DREA 5JAMA 3UW3A 3MJTA 1TT7A 3TOXA 4IDFA 1Z6ZA 1VRWA 1W8DA 1KVSA 1ZJYA 2P9EA 3LT0A 4E30A 3PLNA 4R01A 4TRJA 2H6EA 3DBRB 1P77A 4UEOA 2VYND 3HHPA 4EBFA 2CMDA 3A06A 3ICCA
chains in the Genus database with same CATH superfamily
3ZCQA 5FWNA 2ZJ6A 2B1JA 3II6X 1TYAE 1GUBA 2R60A 2SECE 3B6ZA 4A10A 1O97D 1OA0A 4DCCA 5KMGB 4G56A 1U8EA 2VDNB 4DJDC 2CLDX 3D02A 2X3FA 2B98A 3K15A 1JXOA 1QFYA 4UU8A 5IP5A 3TEFA 3WIBA 1XEAA 3R5TA 2Q1TA 5A9SB 2W37A 2QE7A 3ETJA 1PSDA 4IDAA 4KO4S 1UFOA 2O1XA 4MVJM 3CZ5A 1UXGA 2P8SA 4EHBA 5LWQA 4X65B 4BOYA 3QBJA 3I1FA 1A82A 1RI4A 3MVEA 1IHXA 3FLMA 4MVWA 4GLBA 3ETHA 3F7NA 3G1WA 4QTXA 4XFJA 4XD7D 1EWVA 2K5UA 3RQSA 3AZQA 4DLRA 2YXBA 3AP3A 1GNPA 3WHKA 3DCYA 1V8DA 4ETNA 3PHJA 4R6WA 4F97A 2VAWA 4BNDB 4COKA 1EUDB 1AO3A 1DX4A 1GA1A 1U1EA 1VCIA 1NNLA 1WCIB 2ONKA 2UUOA 1KEEB 2IPXA 1V7ZA 2UYQA 4RH0A 4RMNA 5H70A 1VXOA 5CEFA 3TIVA 1QH9A 1ZCBA 3CT6A 4N40A 3VPHA 3WDMA 3IWDB 3WWEA 4OO3A 2AMFA 4MUAA 3T1YB 3AF4A 4BBPA 4BQRA 5CEEA 4NSNA 1FP6A 4P2BA 5DM60 3OLZA 1NMZA 2MSWA 1CE8B 4RSRA 2EBHX 3UAXA 1DFHA 1FU4A 3Q85A 4XLTA 2PIDA 4NE7A 2NU9A 1ECLA 2QAJA 3JQDA 4DUPA 2NV2B 4DILA 1F4VA 4B47A 1GAJA 3UENA 4KQIA 1AUPA 1JMKC 2HFKA 1NW7A 3WI7A 2HC9A 4BO4A 1D03A 3SC4A 3PQ7A 4Q1DA 1XL1A 4CLQA 4M60A 2VYVD 2J4DA 3IRVA 4U2CA 5BWBA 2YJGA 1JDBC 4YIHA 4FKMA 5ALMA 1M6VA 1SUSA 1UXHA 1ZGJA 2VZEA 1QE0A 2IELA 3ZQ6A 2XNDD 3AILA 5T4FA 4F45A 2XDYA 4KH0A 3ELWA 3BCRA 4XJTA 4POOA 4INOA 4FBLA 1X0VA 4H4EA 1DTEA 2PYIA 4C76A 3VX3A 3ESBA 4YCBA 1PT7A 1HQDA 3H9EO 4ZZ0A 2XX3A 2C97A 4ZVVA 3ONEA 2EFEB 3MBOA 4FD3A 4CTNA 5BW5A 1E5DA 5IVHA 3DG9A 1YOVB 4AJ4A 1QHEA 4MVYA 2ZAIA 1E7RA 5AJHA 5A6SA 3AEQB 4D41A 3ITEA 3T5BA 4L5BA 1S2DA 1ZD1A 2BFOA 4JBHA 3REOA 5FOXA 4UTXA 1S01A 2WAYA 1UOQA 4BNKA 1JQ3A 5DISB 1DKPA 3CLVA 3KQUA 4X7BA 2CN1A 3P52A 4S2EA 5EY5B 5TDHA 4B31A 4CEIA 5B6JA 2VQSA 5DEOA 4BJ3A 1ML3A 3G0CA 2JI8A 3I37X 4Z2YA 4B6OA 4GYYA 4MQFB 3LC2O 2NSJA 3B6IA 5JY6A 3E53A 1Q0UA 3QPUA 4JDUA 5DX0A 3WQSB 2GH1A 3PU6A 4J3NA 3O7WA 3LDHA 3PQ6A 4LZLA 5IN5A 1FEZA 1JLKA 2ECQA 3JYQA 3QYAA 3R6WA 4MLDA 3V1KA 3PTAA 2NW6A 2NT3A 2ZLBA 4U39A 3SGLA 3ZY3A 3FZQA 2RI0A 5E6SA 2E4WA 2J45A 4DDHA 3NBZC 5BN3A 3F1LA 5DI9A 1IWOA 1X8XA 3I5UA 4O4LB 3NETA 5DT2A 1HG0A 4MV6A 3ZWCA 2JH8A 3SQWA 4X94A 4FYMA 4WV3A 5BV8A 2RCNA 3OCVA 2HCBA 3GBPA 5JWOA 2UXDB 1T4CA 4YT8A 2OWDA 3O92A 1Z7BA 1U5CA 4FZ5A 3VOBA 3KIPA 4PQYA 3L82B 4QQNA 4AG3A 2HRCA 2FPXA 3LT2A 4QBTA 1C8BA 4ZCMA 4F72A 5AUPB 4IMPA 3IKMB 5LQAA 1PDOA 1B7GO 1XZEA 8GPBA 2OLEA 3OZIA 4NU8X 4UDYX 4KK3A 5EKSA 2QYSA 5B3KA 1CR2A 2VJBA 3SQLA 4MRAA 4BL5A 3ECAA 4UFOA 2Y1GA 3HXTA 1MU0A 1J1ZA 1OLUA 3OQPA 3AWIA 2QVYX 4X61A 5JNLA 2DECA 5JHGB 3AXSA 5J43A 2AA3A 3EGOA 2PMDA 1L4BA 3QEBZ 4NPCA 1JHXA 3WIDA 1OPRA 3GVHA 4NJOA 1T15A 3ACDA 3JXEA 4QNNA 3QVWA 4WOJA 1E20A 2MJLA 4CFYA 3U4QA 1PNVA 1H5UA 3OWOA 3PDHA 4UE6A 5BQOA 1RCUA 3UWDA 3NONA 4UEWA 2Y1EA 5BUZA 3DUWA 4URHA 5AM3A 5IK2D 1H4QA 1UT8A 3RU3A 1BU5A 4UHDA 5EKDA 4G8JA 1SXJC 5HJ7A 1RNLA 1XJWA 2FH5B 3HL4A 1IN1A 2W6ZA 3UF0A 2I7CA 1SIBE 3IOMA 2UKDA 3PGXA 4X91A 4HL6A 7AT1A 3SKVA 3K0FB 3UGJA 2JJQA 3K0FA 1JHDA 1JW9B 1UDAA 4BNYA 1JFSA 3HDHA 1EAYA 3KTFA 2PLRA 5CGQB 1XIVA 4ABTA 4DLKA 1BMTA 2PU7A 2DE0X 4BE4A 2WWRA 1YJXA 1NBHA 1GL6A 2FMUA 3H3FA 3OPYA 1GGVA 2AN5A 4K9DA 3L6DA 4KMRA 5EJ8A 4IKPA 3B1VA 4DIBA 5J9GA 1Q20A 4WN9B 2GZMA 5FI0B 1HNWB 5KMGA 1GLNA 4GBMA 3PEEA 3PI6A 2EFJA 1ZSVA 2WB4A 5D01A 2V6FA 2VDWA 1FNSA 1LC3A 1T4DA 5JISA 1M2KA 2GA8A 4Q1VA 3ZHSA 2ZT6A 2PQMA 3LDAA 3LKZA 4LMRA 5K4HA 2FMTA 3NTVA 3SX4A 5FNZA 3EQ2A 1C9JA 3IT3A 4RHTA 5BY2A 1NXPA 3WIUA 3AHGA 3OM1A 3UMJA 3IIEA 4LDPA 1TIBA 4I19A 5JVDA 5F76A 4AY2A 1YDEA 2WHXA 3O1JC 1RAHA 1AY0A 2B4AA 4EDHA 3GELA 4ND8A 4YCMA 2LIVA 3SICE 3AV0B 5TGDA 3QSYA 4ZAGA 3NT2A 2PUFA 1OI4A 2HCTA 3OM9A 2ECPA 4HWPA 1JQAA 3FB4A 4B3FX 4E08A 2L17A 2PUAA 4Q3DA 1ZNWA 4WNAA 2YYSA 4WNAB 1LB1B 4XDYA 3ZXSA 3MWEB 4UUNA 3W9SA 3S81A 4X6XA 1D4AA 2DJIA 1GQFA 1CUWA 4N6OA 3S1AB 4CLEA 1QPBA 1YQXA 1YFLA 2NTYC 4YCNA 3IODA 1E61A 2DPGA 2GPYA 4QHSA 5JD4A 4JDPA 4TKLA 4KLZA 4R9RA 3RPEA 1M2JA 3AT1A 4HYEA 2TMYA 3FCXA 2BJWA 3KD3A 1MT3A 4Z8XA 1Q7RA 3DL4A 2ZQZA 2Q6KA 1JAZA 2L42A 3I12A 2PEYA 2KSQA 4AJPA 1B6GA 1ZWKA 2VHCA 3ONWA 4Q5IA 3RBVA 2NZYA 3CX8A 2ZTSA 3R77A 5CVVA 1QHHB 4O25A 1O5IA 2VSXA 1LD3A 3UC9A 4KOEC 2AW3A 2Q2WA 4XOUA 4ISCA 5F64A 3FCSB 4ZYZA 1JU9A 1Z6PA 3QPAA 2CMGA 5CITA 4F4HA 5JZBA 3LK7A 4O4JB 2ZYUX 3R7LA 2WOJA 2X6TA 3HUDA 1RJDA 2C77A 2GHIA 4HC4A 1NTOA 3JVEA 1NOJA 5MGNA 4QGSA 2BJHA 3L9WA 1AQIA 1KH3A 4UTRA 5C53B 2X0KA 2BDTA 2ZRQA 4JMPA 5BNFA 5C18A 2VTVA 1P81A 1RLUA 2O50A 3QPDA 2O20A 1PQUA 5CIYA 4RSGA 2XB6A 4XWGA 2QQFA 4NIMA 2PKRA 1YA4A 1KNXA 3DE4X 3GGGA 3PQ4A 1CUHA 1RJGA 5H3HA 4A2QA 5EC8A 2OCYC 2XD4A 4MR7B 5F7ZA 3DFZA 3T1NA 3V4VB 5HRCA 4I14A 1IN4A 1XTSA 1CUSA 1V9SA 2G70A 2I2XB 3ZPXA 4LQCA 1T5SA 2W4MA 1PNOA 2GF2A 4E21A 3LA8A 3NHFA 3P1JA 3JYHA 1V5FA 1BHJA 3L43A 4X95A 3RYHA 1I94B 1G8PA 2QTAA 4D3DA 5EESA 1BDBA 5INTA 3TCXB 1QVZA 1Y6GA 4OHBA 1FRZA 2WJZB 3VISA 3S6JA 5IABA 2HRBA 3O8QB 4MA5A 1T2AA 4W7SA 2O2HA 3EGXB 1DFIA 2IDMA 4KE6A 2IZOA 3RIMA 3DMTA 1ZRHA 4FD2A 5KQGA 3PHCA 3TRHA 2QQ0A 1SGWA 4D46A 2O4UX 4WNCA 3MCTA 3H6KA 2XQVA 2OHVA 3RJ5A 4DUGA 4UBLA 1QIEA 4EM6A 1P3JA 3HKBA 1KOLA 4W7HA 4ZT4A 1U0SY 2V98A 2IHVA 2BLLA 2DRIA 3DOUA 4ENPA 4GGOA 2EQBA 4RZ2A 1W52X 3DHWC 1Q0RA 4MYDA 4WLNA 5J4VA 1T4CB 2WIBA 3IULA 3G9TA 1O96B 4NY1A 1SQGA 4FUTA 2I99A 1AXEA 5LN1A 4YRSA 4L74A 4P35A 5J63A 2Z8YA 3ZJTA 4D99A 3TZQA 2IITA 3FWHA 3ESXA 1N1DA 1IM8A 2CXPA 1YS7A 2JJYA 3PPVA 2IWRA 5B1HA 1CRWG 1HFKA 1BFUA 1SOVA 1WZEA 1XDDA 2G9RA 2Z2KA 4FYPA 3H9JA 4LQLA 1JECA 2IEZA 3RC9A 1ZINA 2AQIA 3UHPA 4FI3F 4GC5A 4IEEA 2Y66A 4A6EA 4P5PA 5EWMB 1E4EB 1AS3A 4BC1A 1UBJS 2O05A 2YV4A 3ULKA 4CG1A 1BXRB 3OSZA 4F60A 2CL6X 3TM4A 2XMGA 5A9SA 1PFQA 1WXGA 1C7FA 4JB3A 4A9AA 4LXTA 2V5AA 2VXBA 1KQGA 2FYTA 3A9UA 4K9QA 2BEUA 2OXRA 4GT1A 2AYXA 3DFMA 1LU9A 4KH1A 4LHVA 5C3UA 1N9KA 3IBCA 2W11A 3I5YA 1QKKA 1FTWA 4F4CA 1SHZA 4FHZA 4W8HA 5ES4B 3GPIA 1QTQA 1WQ4A 3GYGA 4TVOA 2VH1A 5EG5A 1XD2B 2WHEA 8OHMA 2FZWA 2HX1A 1SXJA 2C8LA 3BMCA 2J3KA 1CJMA 3KXLA 4E2WA 1E0SA 2H1VA 1MEOA 1QVRA 2QXTA 2XRFA 1I6MA 3QPCA 3UH0A 1E2IA 1C30A 1MAAA 3OE5A 3OFVA 5K3FB 5DE3A 1LPNA 1NQUA 3E7XA 4DZRA 1X9IA 1PAUA 3GA5A 3I6MA 4EWLA 2WM3A 1GG9A 2WMOB 3QHQA 4CKBB 5C51B 1K0FA 2SKEA 4G89A 3ST7A 5EJGA 3CW2A 2EF1A 1DAFA 1ULTA 3EB9A 1BWQA 1B8PA 2GTPA 2PKCA 5TPZA 1SVNA 3OZFA 4DQLA 1Z5OA 3G17A 2WIFA 2PK3A 1E2DA 1NY6A 3U0VA 1CERA 1HC7A 1HXHA 4QUGA 3RSLA 1M34A 2C9YA 4LJ4A 3PQ5A 2NAFA 2W2NA 3OLCX 4IMJB 1FUEA 4Q7EA 1P6XA 1Q17A 2K87A 4L9AA 5IAAA 2LIPA 3WK4A 5LB4A 4C7OA 4D26A 4ITVA 2IPOA 5GP1A 4RELA 1D2CA 3E81A 4O2RA 5KPDA 5FUBA 5A0VA 1HX7A 2F4NA 2IKSA 1F8GA 2CLEB 3A0UA 1A9ZA 3W6OA 3HDTA 4WD3A 3S8YA 3HFGA 3X44A 3NHWA 1N8TA 2UXBB 2QUIA 3L02A 3OLYA 3C8MA 3BXZA 3E48A 1QHXA 1WQ1R 2OO5C 4L9RA 1P19A 2VTBB 3B3JA 1O97C 3G0OA 4QVGA 2WG2A 4EW6A 3HCWA 3GP8A 1XB2A 3QOYA 5A2GA 3VNAA 4NBUA 2H5JA 1XZDA 1NJSA 1PI3A 4HNHA 4KIFA 4B4WA 3ZDRA 3LTNC 2GRJA 5HR5A 2OUKA 1I2MA 4R9VA 3AVVA 3ZD7A 1EP3B 4H77A 1JEAA 4I4TF 4U6NA 2IBTA 1R6BX 3U4HA 3IIJA 4GI5A 4OXNA 4MPPA 1SKMA 2WJYA 4C4PA 2CXUA 4GMDA 3V8EA 4GZ3A 3AB7A 5TE9A 3I9JA 4J75A 4DKXA 1CFJA 4DA7A 2PDAA 4MV5A 1OWMA 3OZTA 1N2ZA 1CZUA 1RXYA 1RWXA 1YQWA 3QVLA 5THKA 4ZYXA 4A1FA 4HDNA 2VQFB 4CI0B 4E11A 1EH5A 3UMRA 3IUQA 2UYCA 2ZJAA 2WWHA 4JC8A 3AM4A 1LKZA 5ENVA 3U16A 4NXMB 1WVGA 3P97A 3RF7A 1K08A 3BZBA 1VL1A 3K0KA 4KO3S 3OTOB 1KSHA 3UJ8A 3IESA 4MARA 3GMDA 4HADA 3T5MA 3T7IA 3BHNA 3W5HA 5KC9A 5FORA 5JDIA 3ZZMA 1QK5A 1QQ6A 3FTNA 4KG7A 3ZLTA 4JEUA 1HE2A 1E8MA 1M2FA 4JJIA 3KSUA 3FW1A 2ZZKA 4CLXA 3FZYA 4BZZA 1E5QA 2VHZA 1W34A 2YWJA 2O8EA 1LDBA 4X7PA 3HEBA 4WZ6A 5EFZA 3TXYA 1P45A 1N7GA 4OOFA 2OV8A 1S3SA 1VKOA 3AY7A 4JITA 4GQAA 1K6EA 3NZEA 2H9IA 1B14A 5HOEA 4V1CA 3GI1A 4EL5A 2WU0A 5K45A 1NXVA 4AUMA 3R9XA 2EATA 4G9GA 4OX9B 1BDIA 3T7EA 1A5BB 1SUBA 1ZIXA 2I1QA 2XGOA 3CKMA 1TPYA 1V5IA 3INRA 3CLSD 3WNBA 5KNCH 3LQQA 2J6HA 3IQXA 5J2UB 2YY5A 4MW9A 4D98A 4ITUA 1O0SA 4PSAA 4KXNA 4CKYA 3IB3A 2C03A 1ZMRA 1SQSA 5J3JA 4EGFA 2R6ZA 3O3CA 1UMBB 4QDOA 2JAHA 4LSWA 3W05A 3CVOA 1Y89A 5HW0A 5I9IA 4P53A 2XPCA 3PNYA 3CB4A 4RD2A 3VZDA 4LE2A 1OYOA 1SXJD 4ZT5A 3V7NA 1FZTA 2JIOA 4HEQA 1USIA 3WQQA 4ZAWA 2Z5GA 3CFYA 4XGQA 3C70A 1ML4A 1XE3A 2J07A 5HYVA 1MW9X 1R88A 2VZ9A 2RB5A 3UBMA 1HE5A 2BONA 1IN8A 2R6JA 3WGIA 3Q8KA 5GJBA 5AMXA 2AH5A 1RACA 4KDCA 2AXQA 4Q4LA 3VHXB 2HYIC 1AH2A 1SBNE 1NU8A 4YJGA 5HS4A 3KXDA 4CODB 5JXGA 1QZZA 5C5IA 2HJ9A 4RK6A 5ITZB 4G3XA 4EO4A 4W9MC 1JKXA 2ZRHA 2A57A 2HEGA 1AZLA 3KM0A 4FJ2A 5E2AA 4AXXA 4FBMA 1G7CA 1Y4UA 3C3AA 3FYUB 5HFNA 1S96A 5F23A 1TX4B 1R0SA 3HBFA 1SUAA 4TXNA 4M36A 4DLTA 3NOVA 1X7YB 2J0UB 4FMDB 1XRSB 4LNUA 1W1IA 1S8OA 4NYMR 4UNIA 1S02A 3X1XA 1NQXA 3HR4A 4FIDA 4Y1RB 1P4SA 4CMHA 4F3YA 1KI6A 2H00A 4FN5A 3QEKA 3P9IA 4LX8A 4NJEA 4Z9AA 3NBUA 4DSNA 3KYDB 3IA2A 4QO8A 3OQBA 7ABPA 1XZMA 5KJCA 4JJGA 5P21A 2VLBA 2HQ1A 4BRZA 3MS7A 1PCXA 1U9YA 1A7UA 3H2YA 4QJBA 2GZAA 1T9DA 3CH7A 4Q4AB 4P9NA 3LS2A 5G4KA 5JRDS 4FDUA 1ZAYA 5JDCC 4BFTA 1DELA 1PL7A 1X8KA 2IYSA 5K8JB 4ZZ2A 1MAUA 1FQWA 2GFQA 4DMFA 3QHPA 5TJ9A 4D6YA 1SG9A 3EQ9A 2QS9A 5HFAA 3AJDA 5LQNA 3UAGA 7YASA 3LH5A 3JWGA 2QRMA 1NF3A 3BRQA 3KEOA 1KKUA 4WXYB 3G2HA 1H4TA 1SVLA 2O0LA 3OZCA 2PXXA 2HZBA 1X42A 1W5FA 3FMVA 5I8WA 3OT1B 4NLLA 1J4AA 3BRCA 1WP9A 1ZQ1A 1J8DA 2IHTA 2IUEA 2R8PA 3WTCA 2Z9CA 4WECA 2ECKA 5IRCD 3BB1A 4H6WA 3B8EA 1N1MA 2Q5HA 2YWFA 1SOAA 3H86A 3OOWA 4U7HA 3FPBA 3JVVA 4OAQA 2WQZA 3W77A 4CNQA 4O8JA 2WJVA 4K6GA 4S12A 1KHTA 3AO0B 3AR8A 1MRSA 1Z0AA 1X2BA 1Z6QA 4DRXA 3AL3A 1JAYA 4F1KA 5IX8A 4MIEA 1KAQA 4PVCA 5ADWA 3ADPA 1DE0A 4L16A 3SEZA 4B43A 3WRXC 3W78A 1ELOA 3DM5A 3ZV4A 4KQWA 1T6XA 4CV1A 3D9QX 1MTOA 3O3MB 2AG6A 1EFDN 2I0FA 1YVPA 2Y1KA 1K6MA 1YONA 2YVQA 4TQAA 2DPYA 3VYVA 5DNCA 1JX6A 4W5JA 5KO2A 3M6WA 4WZBA 4CTKA 3U60B 3EVZA 1KK1A 2X76A 3GJXC 1FFYA 2P9QA 3ABOB 2BP7B 4BUZA 2DJ5A 2EFDB 2AG5A 3G2IA 4L8WB 4E4TA 4HUJA 1ATIA 3MTAA 1HKHA 2GZ1A 3MELA 5FQNA 3OESA 5K01A 1NG9A 2UUBB 1J39A 4I5IA 1Q1ZA 4L5IA 3OCJA 4QUEA 3VOSA 3KSRA 5LBUA 4ZDJA 5KJ6A 3N5CA 2MMCA 1GY8A 2WICA 1J20A 2COKA 2JNWA 1EGMB 1WTCA 2C2HA 1T4MA 2HXSA 3GNSA 2C5FA 3GB9A 1FJ2A 3L18A 5CCDA 3SZ3A 1K5GA 1XTRA 2B6HA 2FLKA 3NNSA 6GPBA 2X0IA 3NBKA 4MGHA 4L5YA 4FHDA 5GJCA 1DU4A 4XFKA 5EZYB 3DC2A 4W1RA 2VDUE 1YQQA 4MQMA 1ATZA 1E5TA 2FJ0A 4ND2A 1NASA 1VE6A 4PLYA 2G1JA 2WA2A 4B7XA 4DADA 4ZCRA 2AJTA 5AFSA 4PHTA 4P0QB 3S44A 1UOOA 3QLUA 3Q2IA 1JQDA 5JQWA 2P77A 4C3OB 1W73A 3O38A 5CFPA 2ZPUA 3TFWA 5EXTA 2BP7A 4ZCTA 1AO0A 3QFFA 3QFCA 3A11A 2BKUA 1YRBA 2QP9X 5ALQA 3A6JA 4MROA 2GEDA 4KEAA 4MDHA 2VTKA 3HB0A 4IXMA 4QOEA 3I9KA 4Y2VA 2NUAB 1S8FA 3NHSA 1BRTA 3BSSA 4Y6QA 3SDSA 3SYRA 3JQBA 1P44A 1VYTA 1EDZA 1ZW1A 3DH0A 3LWZA 2Q3LA 5IYZB 2O8NA 2ZR7A 5AICA 5AK0A 3CVYA 1ZUHA 3JRWA 3ILVA 5BVHA 5AHWA 1NXWA 3IX7A 4QDZA 3ER8A 2R3SA 4O1MA 4MKGA 3G3EA 1U31A 3DLIA 4E5UA 3DD5A 1YS4A 3KR0A 3JAKB 4GGPA 3PJGA 4TS1A 1K68A 3ZWPA 5ALFA 4EQZA 4PS1A 5JTUA 3DZBA 3OKAA 4DV1B 4DPMA 1C2YA 1YE3A 2Y1FA 2NP7A 2VNJA 3N2KB 3DF7A 5C5EA 3UCFA 1YQEA 2ZYTX 4KFRA 2AN9A 3E8MA 3RRXA 4DRYA 2QY9A 2IW3A 3PA8A 4AMUA 1EUQA 3K9QO 3O4JA 5GVSA 4YV1A 1SXQA 2GRAA 4Z4FA 1H2EA 2J9FA 3TSWA 5HQ3B 2PUEA 3GFGA 1WUKS 2JFVA 2XT6A 2B83A 5KJ1A 4UMDA 5FUVA 1YIAA 5E6UA 4L0CA 3AERA 2IP4A 4JI8B 4PPFA 1T9BA 1K06A 4PSDA 3FROA 3F7OA 3CWZA 4PGAA 3K72B 4EAQA 4ZDIA 1FTGA 2YJTD 1Y1PA 5AVTA 1WMEA 4FOPA 1M1UA 4WAUA 1QV7A 4C03A 2FMIA 1ORHA 2ZRDA 1E3EA 4ZV7A 3DVQX 2BVNA 1COWD 4ZEMA 1RPZA 1QRUA 5IDXA 1EQ2A 2DFNA 5C8ZA 3N2KA 2UV8A 2EGUA 3LT1A 2WKWA 1T6YA 1VLQA 1SN7A 3TJMA 2YYZA 1A8IA 4CDRA 2X1VA 3L8DA 1N9GA 1PS8A 3TR5A 2ZAMA 5GTDA 4KPYA 4GF5A 1JKJB 1YA8A 5K20A 1YL5A 2G72A 4DN6A 5B55A 4BXOA 4ID3A 3TX6A 2YZNA 3WO0A 2B2NA 3BGVA 1IBSA 5K6TA 5E6UB 2YXPX 3SEFA 5I4KA 4RTMA 4R6XA 2X9QA 3ZY6A 3UJBA 3W9YA 4HFRA 3DEAA 1ENOA 4EHIA 1GZDA 3G9UA 4HGOA 1I6LA 3HCEA 3MXTA 4AJIA 3GRPA 5JANA 4BX2A 2Q4OA 4WRRA 1NVMB 3NEAA 2ZGVA 1E2FA 1E63A 3AI7A 5CYFA 3WOHA 3PRHA 1VFPA 1FMTA 3EP4B 2Q3JA 1ESNA 3HB7A 4JVMA 4NENB 1EA7A 1WKVA 4GMHA 1L4YA 2JI9A 2J9ZB 1Z75A 1CJUC 1M5UA 4GE3A 4RSHA 5ELMA 2QV0A 1JRLA 4TXHA 4RW0A 4F7WA 1M3SA 5AR1A 5FPKA 1UPXA 2EV9A 3SM9A 1M7BA 4YCJA 2NU6B 4XYLA 4LOKA 1DLJA 1YMVA 2N47A 3C3WA 2VRNA 3C43A 3LG2A 4RM2A 3ZHUA 4BP8A 3FLBA 3PFWO 1SHUX 2GPNA 1PT9A 4EOGA 2IEAA 2OECA 3RQIA 1KR5A 1EHCA 2BCEA 2P68A 3BIXA 3CEJA 5HIIA 1P72A 5HUJA 1DCKA 1AGNA 1YQTA 1S8NA 1TC2A 4AF7A 1R4AA 4P22A 3SC2B 2DT5A 4IX1A 5F2NA 3MTGA 4HZUB 4R51A 5KYVA 4IH1A 4I6GA 1J23A 3TIIA 3UICA 3I4CA 1NAIA 2G1PA 4GOND 1Z0KA 2XNCA 3K35A 5HIKA 1U3UA 1OI2A 1MB3A 3KSAC 4YMSA 2LP4Y 2FUG6 4M22A 4QUDA 4YP1A 1Z3IX 3SEAA 2AWOA 1EJ0A 5IJXA 3FTDA 1V1MA 4QA9A 2HSWA 2MOKA 2Z4SA 2IV3A 2JGEA 3F5DA 1S2GA 4JJ8A 2Z6UA 4ZCLA 3AW8A 2P5SA 4P3PA 4NBTA 3KX2A 3DT6A 4A91A 4OHOA 4AYXA 3JQBC 2EWVA 2VT3A 2AMLA 2F17A 1XRMA 2OC4A 3C3KA 2WHRA 2P4UA 3EZ2A 2WPNA 3GD5A 1QP8A 3PXDA 4UU0A 2BYTA 4PX3A 1ZIOA 3QEAZ 1HSOA 2CFRA 2CWDA 3L1VA 5BORA 2D8AA 4R1QA 3ZBUA 2VH2A 3D0QA 4JL6A 4R31A 5AWFC 4M76B 4DARA 1WBDA 1MX3A 2HIHA 3LPDA 3H4TA 4KQXA 3LC1O 3FG9A 1SUFA 3MSCA 3QPWA 1G6KA 1UPBA 1GKUB 1CZNA 2Q27A 5JCOA 1I5EA 3T4PA 1DVRA 4B4UA 5IMSA 1T5OA 2FN9A 3UJ3X 1S4QA 5CLHA 1J2RA 3OWHA 3DPIA 2YC2C 4QHTA 5LOVA 3DZ5B 2P2DA 3K2BA 3QKRA 2A88A 3KEMA 1IJKA 1D2GA 1JR3D 2CY0A 4XVUA 5CFQA 5GIPE 3DZDA 2WG1A 1ZN7A 2OZVA 4RD1A 1BDJA 4X20B 5KQSA 4UTOA 5IT4A 2QL9A 3IUEA 3UO8B 3TL3A 5IF3A 1W36C 3JS5A 2DBVO 3AEQA 1CJVC 1XHLA 1Y4ZA 3CLTC 1FDTA 4UHEA 1QV6A 5DHAA 3GRVA 2BZ0A 1A8SA 2GUGA 4MRRA 3IXQA 4ECEA 1Z2OX 1BJTA 3HM2A 4IOKA 5CB0A 1WB9A 2Q9CA 1DEOA 3MJDA 1ZRSA 1WCWA 3KS9A 4FHGA 4GYWA 4JFAA 4BCDA 4D9KA 3TJRA 4C0HA 1P5ZB 1IN5A 5JYFA 4G81A 5JCPA 3CCFA 4PW0A 1W36D 3I45A 2Z5FA 1QHYA 4AUKA 4C6SA 4B7AA 5E0OA 3A70A 3LXXA 5BQXA 2GCEA 5I7AA 1RM4A 2B99A 4PO9A 2JLYA 4G5HA 5CM2Z 2NXCA 3WRXA 1JZSA 1CF9A 2VNIA 3IS3A 5HX7A 5EIWA 4EW1A 3ITNA 3KOXA 5DGCA 3WA6A 1ZSNA 3ZCPA 2X4GA 1TAHA 2PU5A 3EVNA 2YVUA 4MEJA 4PHGA 5TV2A 5FRDA 3QU5A 3AR7A 1RZRA 1FB5A 2XZDA 4LVCA 1OFUA 2XKAA 5KSPA 1TQ8A 4GEKA 4Y2UA 3T3HA 3WHIA 4EABA 2OK8A 1RRKA 1I2DA 3BH7A 1WMAA 1U7OA 3IBFA 3WX0A 4C07A 4J0HA 3RS7A 3DSRA 1GPLA 1ZGHA 1ZK0A 3ZWBA 5JAUA 3OE4A 4AJNA 4HQKA 2BELA 5BSGA 3D1LA 1M2NA 3D8TA 4IOLA 4DDWA 2WYOA 3JZAA 3FMIA 3OBBA 1GPJA 4GPTA 4J0GA 5BSKA 2EBUA 2PLAA 1NI4A 1JENB 3QUBA 1JHMA 4UJ3A 3GVPA 5AO9A 2ID8A 1FPMA 1QAMA 3NOOA 1BSVA 3WGYA 1AN9A 1CNEA 2X4LA 3T7RA 4BZXA 4FDMA 4YJGB 5BV7A 1Y0BA 3AIOA 2JK1A 3F71A 5LIRA 4KGZA 4Y9RA 1DI0A 2VDQB 4LPSA 3ONVA 3BWMA 4OHRA 2I4TA 3TLYA 2Y1WA 3NC1C 3KSBC 4I9UA 5EJ2A 4K9RA 4A8PA 4HYTA 3JRNA 4WUTA 3RF6A 2Y1LA 4JKOA 3RASA 1LNZA 1ZM4A 1XCLA 3AW9A 3O1HB 3WXMA 3B3QA 2ZUSA 3LOUA 5FUXA 3ZTWA 4BNLA 2XE8A 3DA8A 4MJXA 4NK4A 2ZQ5A 4Y18A 3H3JA 2VDPB 2CXOA 3E4DA 4NOLA 5IK2A 1C0IA 1LX6A 2AC4A 4BATA 5HTOA 2M6LA 2H2IA 1YZYA 3EUWA 2JFXA 3T6KA 2EHDA 2ORWA 4G2TA 1NVWQ 5KYTA 4DMCA 4IIVA 3KJNA 3A1VA 1RFGE 1JA0A 1YGYA 2A9KA 2Q8NA 5JZSA 1P75A 3BS4A 2HHAA 1X3SA 2ODWA 2QLJA 3TDKA 1ADJA 2IYTA 3WGOA 2OHOA 1G8AA 1C7JA 1ID8A 2D54A 1GAQA 3KZNA 2M6KA 2IHNA 3QBVA 3IP6A 1YFKA 2X1MA 3D3EA 1ZY2A 4AULA 5EEHA 4QXPA 4OCZA 1V5WA 1JBEA 1RPAA 3T06B 4ZO6A 3GMTA 4L5AA 4MVJF 1I1QB 1U8UA 2VNKA 3DBHB 4HY3A 4R0VA 3ZWVA 4CM4A 1C9KA 1T0IA 1UQTA 2FN3A 4MJ7A 5JWRA 1Z2PX 1JI3A 3G79A 4RTSA 5TT0A 2UU9B 4F2HA 2IYNA 3BSFA 2DTDA 2W70A 4EY8A 4JBGA 1DCTA 3R44A 3H99A 5ICFA 1YJQA 2XMQA 5JQGA 1UPCA 2YDYA 2YWGA 3GF4A 3R24A 4QFMA 1MO2A 1LK7A 3RABA 4OI1A 3L8MA 2CMKA 2UZ1A 3CF4A 4MKHA 4YX9A 1B2LA 3E2IA 3M2PA 3O3OB 1MIOB 2CLMB 2RFLA 4NAVA 3AU9A 4NH4A 4URUR 2VUHB 5IAEA 3TRFA 1RQNA 2QQEA 4Y3UA 5GVRA 4EYKA 1S2NA 3MINB 5C7IO 3TOSA 1CK4A 1Z35A 1U6IA 1A9YA 3K1JA 1P2GA 3V4FA 3L7BA 2PRZA 1VP3A 2ZVDA 3EVGA 3LC0A 3U13A 3W2HA 1V3UA 3ROKA 1Q6ZA 1CX9B 2FPIB 3GAZA 2XDQA 4TLAA 4KX3A 3QK7A 3RV4A 5K3DA 3W5UA 4IDDA 4NCBA 3RHTA 4CEJB 2BT4A 2L19A 2VDRB 3KWMA 3NIDB 4BZPA 3OTIA 2G9NA 5DGXA 5FHRA 2F3QA 1EXNA 3ASUA 3R7SA 5A03A 1ISHA 4HATA 1E7QA 3KBBA 3IILA 1AUOA 2EP8A 3L84A 2UVPA 1N2XA 2PSSA 2Q2QA 3M5WA 3AONB 4P4NA 2VWHA 4BQIA 1NMQA 3AIKA 3K4PA 1VLZA 3W3AD 4MSUA 1KEWA 1C0KA 4EPRA 1X8JA 3DE0X 3KB1A 1Y3BE 3AHFA 1KIMA 4I46A 3DLHA 1WW3A 1WXEA 3DUFB 3AJEA 4ETIA 3EXHB 3GQBA 1Z83A 5LOVF 3LQKA 3UT0A 2DPHA 1NJ1A 1A9XB 2PANA 2V74B 3K7EA 3A9CA 5GOTA 3D7MA 4F9GA 1F0KA 1BQ3A 2PXHA 3UHFA 4AWAA 5L3VA 1B43A 4MTCA 5J5AA 1I2CA 2EVWX 5F7JA 3UCXA 3VJKA 2QD1A 1DBQA 3E8SA 4FYIA 4Q19A 5KDLA 3RK1A 4CZ2A 4PIPA 1LS6A 3VKVA 4ZGBA 1EFKA 2Z2IA 2JIDA 3ANTA 4BX3A 2POQX 1A9PA 3DP7A 5JR3A 3L8CA 1KIFA 2E3JA 3IAHA 4RK1A 4P7FA 3OZ7A 5EIEA 3ZU5A 1ZN2A 4GL4A 4B1FA 4MWSA 4M38A 4RLSA 5IDYA 3KR9A 4ZQCB 3X1MA 1ZUD1 2JRLA 1DO8A 1G4UR 3B7GA 1C4XA 2BUBA 3QX3A 1DSSG 4XQEA 2FX3A 4B3IA 1QRAA 4M87A 5F7OA 2F8TA 1FDOA 1ESDA 4ILEA 3A6EA 5ESRA 5NULA 4AO6A 2OZEA 1ZXLA 4LX0A 4YQZA 1XQ6A 1MHTA 1F0YA 1TL7C 1UKBA 3WC4A 1QGED 3SU8A 4C4XA 5THQA 2NZVG 1BDHA 4P4LA 1DKNA 4BV8A 3DQQA 2O8DA 1UDRA 2Q1UA 3DOCA 3VKUA 3KJZA 4HLNA 1NSTA 4KQ2A 1U3VA 1U81A 2CBGA 3IB6A 4GM0A 4JLMA 3SJAA 2WAAA 4FLFA 4XFDA 1DAKA 1LVHA 4M53A 5A71A 4QDKA 2WU4A 2GVZC 3DWGA 1YC5A 2NG1A 2R6HA 2PFKA 4FFMA 2CV1A 3U3KA 2L2QA 3K1YA 4K8RB 1NW9B 3PJFA 3LIIA 2J1LA 4G84A 1MH9A 1C80A 3HDGA 3T1TA 1PBNA 1IBCA 1YF3A 2O48X 1JLSA 5BR4A 2ZJOA 4TMYA 2PT7A 1UBNA 5LPNA 4X0EA 4PG6A 2OR3A 5KVAA 1HZZC 4DIMA 4RY9A 4JI1B 3EARA 4AECA 3WDKA 3FPKA 2QT9A 4WKGA 4WXMA 3PCTA 3BF8A 2ZRBA 3RVSA 4BVKA 4CTMA 2QRJA 5FTMA 3FUWA 4Z3OA 3I9FA 5FNVF 1XTPA 1I4TD 2C0CA 2GD2A 3MQ4A 3PIDA 4U2GA 3VR2A 3LJKA 3H5IA 4A36A 1M34B 1X19A 3FKSD 3ETNA 2R8EA 1D1TA 4M1MA 3QPBA 4YA6A 5ESXA 1YB7A 4R7GA 1P2DA 1G6HA 1QYCA 4R7TA 4L4RA 2GPTA 1PTJA 2XT0A 2AG8A 2GZRA 1SFRA 3IOEA 3L01A 3VKFA 1RAAA 2QJFA 4PICA 1GTSA 3JAWA 1EQAA 1R8JA 2ZDQA 3CR8A 4HB2A 3W6UA 3R3SA 1K9SA 1LY1A 3LLSA 3E9NA 4INJA 1E62A 5AI8A 2E2WA 4YUXA 4V03A 2JLSA 3DFKA 5KNLA 1WV0A 5BXQC 3H65A 3V34A 2AFVA 2G4VA 4Z0NA 3G02A 2AE1A 4XWTA 3FXAA 2X86A 2Y1CA 3DKPA 4UJ5A 2P9FA 1EX7A 4K8OA 4MKRA 1FJGB 3UNXA 2P9HA 4Y2PA 3NHRA 3L4EA 1P0PA 3EUAA 3OJWA 4QOGA 2V96A 3OZUA 2Q8PA 2YINC 3ASZA 2GYYA 3OFJA 3UGKA 5I47A 4ARSA 4B6FA 4LMAA 4DG5A 3D6TB 1P6QA 3VR1A 4UDOA 2KX7A 1EK0A 1SHJA 4C3UA 5JD6A 5K8TA 1CUXA 1OXVA 1Y9DA 1Z29A 1E92A 1QM5A 3NAZA 3RG8A 2WZQA 2H1LA 3K6RA 4IOJA 2LKDA 5HE8A 4AKEA 1GNSA 4P3OA 4AF6A 4D8WA 1RYEA 2G0TA 4TLMB 4QBFA 1UJCA 3TSYA 1W9MA 1ZOPA 5CFRA 1KH2A 2VRWA 3WQRA 1Z25A 3BK2A 4GZ5A 2P6UA 5CIQA 4PLWA 4CXMA 4P0PB 3PDIA 4D9CA 2CNDA 2O3SA 4AZ0B 1IJFA 1F5SA 2FPNA 3GVCA 3KUCA 3C5EA 4GC9A 3VJRA 5AW3A 5BOSA 2UYHA 3I3SR 3KDPA 5EL0A 4L2IA 1PNRA 1JHPA 3MWEA 3I6YA 2PPLA 1KZHA 4PTLA 1XKLA 3DOHA 5BQPA 3B1KA 1ZI6A 2C88A 1MORA 4P1ZA 4DUGD 5BN1A 1PR5A 1VYHA 3G2MA 2CSUA 5I9NA 3EJ6A 1K86A 2IV2X 4CFSA 4Z4GA 2WSIA 1RHMA 2QLNA 2XBLA 1R00A 1I2BA 2QUJA 1TRHA 2JIMA 1QPGA 4Q66C 5ES3A 5FFNA 3EPAB 4EHNA 1C7EA 3WLPA 1LV7A 2JI6A 2Y2UA 3M3DA 3O2JA 1AHPA 5B3AA 5K6RA 4URWR 4CIVA 1CY4A 2DB3A 2CEKA 2H52A 3C97A 5FL3A 1I3CA 5EHXA 5KYYB 1FXWA 2CCKA 2G0NA 4UARA 3URKA 2VJDA 3S5UA 2ZUVA 1VSTA 4WX2B 4YQEA 4B33A 1IB0A 4DNFA 2JGMA 1M9NA 2PQ6A 3PNVA 4IZ6A 1TUIA 5CM9C 1J56A 2NYAA 2NNLD 3EGVA 2PUCA 3D6MA 4QUBA 1Y7IA 1XF1A 4LIPD 4U2FA 3K73O 1U04A 2GCIA 5ARCA 4Z4EA 2ZTHA 5BYKA 2WQ6A 1LBQA 1CQIA 1V6SA 4J7CA 1Q57A 5C7LO 3FFTA 2YMMA 2ZIVB 4WLOA 5T6BA 4DLBA 1Z0IA 3LX8A 1BW9B 1XRLA 4Q9JA 5K3OA 4N7MA 2FSPA 3DM9B 2J7KA 1UPUA 4NWIA 3FJ1A 1BYUA 3FMGA 3HUFA 5FLEX 4DR6B 4D4JA 3HKDB 2VBIA 4ASUA 1N6KA 4BO9A 3GLUA 2XI4A 2ILTA 4H08A 2LR0A 1CYEA 3PD0A