4MKZA

Crystal structure of apo scyllo-inositol dehydrogenase from lactobacillus casei at 77k
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
343
structure length
336
Chain Sequence
MTQKTIKIGIVGLGRLGKIHATNIATKIQHAKLQAATSVVPAELDWAKKELGVEEVFEDFDDMVQHADIDAVFIVSPSGFHLQQIESALNAGKHVFSEKPIGLDIEAIEHTQQVIAQHANLKFQLGFMRRFDDSYRYAKQLVDQGKIGDITLIRSYSIDPAAGMASFVSGGLFLDMSIHDIDVIRWFTGKEIDKVWAIGLNRAYPVLDKAGELETGAALMQLEDKTMAILVAGRNAAHGYHVETEIIGTKGMLRIAQVPEKNLVTVMNEEGIIRPTSQNFPERFAQAFLSEEQAFVNSILNNQDVGITAEDGLQGTKAALALQEAFEKNDIVQVAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of apo scyllo-inositol dehydrogenase from Lactobacillus casei at 77K
rcsb
source organism Lactobacillus casei
molecule tags Oxidoreductase
molecule keywords Inositol dehydrogenase
total genus 115
structure length 336
sequence length 343
ec nomenclature ec 1.1.1.-:
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold
A PF02894 GFO_IDH_MocA_C Oxidoreductase family, C-terminal alpha/beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.10 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 Dihydrodipicolinate Reductase; domain 2 4mkzA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4mkzA01
3GR6A 4BNHA 1U2GA 2A4KA 1ZEMA 2X0JA 2JCYA 5JAQA 1Z82A 1H6CA 3AW9A 3K2EA 3MOIA 1R0LA 2OFPA 4YRAA 2B4QA 1ISFA 1LC0A 1YL7A 2DUUA 3PGXA 5CPFA 3D4NA 5EN4A 2Q1SA 3EMKA 1V3TA 2EG9A 2CVOA 2QIOA 3PQFA 4F6CA 2C20A 1MG0A 2W90A 3LLVA 1QYVA 3JD3A 1GUFA 2NUAA 3JQGA 3DAGA 1DLJA 1FDUA 1V3VA 2O3TA 1HLPA 3Q0EA 1WMBA 3ZWCA 1ISMA 1XYGA 3F6YA 3GH3A 4CQMB 1E3SA 4ZN6A 3PJFA 4INAA 1DOHA 3DHEA 2J3IA 3L0DA 1XIVA 4YEDA 1GD1O 1NFQA 1N2SA 2PY6A 4NR0A 2J5RA 4MP8A 4E12A 4DPKA 3VPFA 2IODA 2PR2A 3QP9A 1E1MA 3MEQA 4CLRA 1AHIA 3H2ZA 4BL5A 1N5DA 4EZBA 2CSUA 3CUKA 4PGFA 4AG3A 3BMQB 4Y98A 3B1JA 1MGOA 4IQ8A 4MP6A 2EF1A 4IDDA 2GCGA 4PCVA 1P1IA 5JSFA 5M6DA 5G0WA 1H93A 4NJOA 1C1DA 1PWZA 3JCZA 2GYYA 1ADBA 4E3ZA 1N7GA 4BS9A 4CMGA 4F6LA 1EUZA 1AN9A 1Y6JA 1YWGO 1I24A 2O3JA 3N58A 3RJ9A 1ZNQO 1W6UA 3C3XA 4J91A 2BRUA 3JQAD 1Y8QA 4DMMA 3KYCA 1TVEA 2HKIA 2Z1MA 1EUCA 2PGDA 3DZFA 2B5VA 4XR9A 4A27A 1R6DA 2EJWA 1BXGB 1PR9A 4MJLA 2OL4A 3MJ4A 3WGHA 2CVQA 4U6QA 3QVXA 5CFZA 3EDMA 3RUEA 3MJVA 3F46A 5L7YA 5JLAA 5JPIA 1I3KA 4RDIA 4CPDA 4PRKA 3SXPA 5A03A 3DL2A 1F8GA 4DC0A 4IGEA 4R9SA 4LVCA 5T8KA 2HDHA 1E7YA 2AXQA 2EW2A 4YACA 4BO8A 4YPOA 4OOEA 3F47A 4DRYA 4AJKA 4M1QA 1KC1A 3DR3A 3L4SO 4CV1A 3SBOA 4KOAA 2YFQA 4XX0A 4CLHA 3KB6A 4FSHA 4J7CA 2ZQZA 2CDCA 2FSVA 3BMCB 4IDAA 5G0UA 5T67A 4BNIA 4PLCA 3FI9A 3K2BA 1LQUA 4XQ9A 5ES3A 3HSKA 4D43A 1ZVMA 2J8ZA 4M8SA 3TN7A 4GX5A 4WASA 1BXKA 3TL2A 5TJHA 2YJZA 3OP4A 2ZB8A 2C7GA 4Z6KA 2OHXA 5DN9A 3TWOA 5DDIP 3LT1A 1P3DA 1QXSA 3GNTA 5EJ2A 5BSGA 1Q7GA 2QRKA 1NWHA 5LC1A 2D1YA 5A3VA 4E5YA 3PRJA 2ZYGA 3D5QA 3AI2A 4E5KA 2VRCD 4DIFA 1HE3A 1VRWA 4Z0TA 3RUDA 4Z0HO 4PRLA 2GN4A 1MXHA 4NJMB 1Q0LA 4BKPA 2JHGA 1DDOA 1E7SA 1ONOA 4WLEA 5GZ1A 4DQUA 1CETA 3A4VA 4CUKA 2G17A 2PLAA 3ZNPA 4MVJH 4JK3A 5KJ6A 3HDJA 4N18A 1QYCA 5B37A 4XYBA 1T2DA 4S1VA 2DFDA 1LDBA 2O2YA 3GG2A 4ND4A 1B14A 3S2GA 4J9UE 2DBQA 3VVCA 4Z9FA 2JJYA 1E3WA 1HSOA 3A1NA 1VPDA 5GMOA 1KEUA 3RC2A 1Q0QA 4BO1A 5COQA 3U0BA 4IDGA 1IPEA 2OZPA 2BI8A 4GL4A 3JQBC 3WGTA 1YBMA 5IDYA 1SAYA 3HN7A 3L6DA 4XDYA 3RUCA 4YAKA 1ISJA 5EPOA 5TS3A 1JLLA 2GERA 5I8WA 5JDCA 5L7WA 3O4RA 4MP3A 2OXIA 1PGJA 1EE9A 2ZB4A 3FPCA 2DU8A 2VOEA 3CEAA 5ICMA 4N5NA 3AK4A 1RYDA 1E7WA 3BTUA 3UW3A 4D42A 3ANMA 3UF0A 3H9EO 2ZTLA 1YKFA 3V1YA 2YUTA 3DZJA 2WYVA 3O26A 2R00A 3OJOA 4AJOA 1I32A 4IZIA 4CMJA 4Z9XA 4YAGA 5FYDA 2B4RO 4UUNA 4A2CA 5LCXA 1SB8A 3PQDA 5J23A 4AJ4A 4MKZA 3GGOA 3DOOA 4TRMA 4GKVA 3IJRA 3ADOA 3OETA 3FSRA 4KTVE 3NT5A 3SC6A 2UV8A 4BHTA 4CV2A 3GGPA 3INGA 2HMVA 1JWBB 3U4CA 2FR0A 1PGPA 4GQAA 1E7RA 4RO0A 3F1KA 4TQGA 3Q9UA 2VWHA 1A27A 3WIEA 4AJJA 4K28A 4R9RA 2DQ4A 1YRLA 3PVZA 1C0IA 4XYMA 1ISHA 5ITWA 4CM1A 2EIHA 1O8CA 3WLFA 4HFJA 3JQ7A 5K6AA 3SJUA 4EUEA 3ZHZA 1QSGA 2X4GA 3JQFA 4NBTA 1BVRA 3GEGA 3OECA 3NT2A 3M2PA 4JJGA 4NFHA 1KEPA 4CM4A 5IDQA 2XXBA 4YAEA 1Y5RA 4I8XA 1UXJA 3HJAA 4PG4A 3W8EA 4FJ1A 2LDXA 4IJKA 1Y1PA 4WLOA 4PZEA 5L3ZA 2OOSA 3V5NA 2BH9A 2AEFA 3LC1O 1T2AA 1WWKA 1V35A 4IM7A 5HBRA 5I7EA 2O7SA 3IAHA 6LDHA 1P0CA 4UREA 3JQAB 4DIOA 1DPGA 2ZKLA 4GX2A 1YDWA 4OKNA 1CEQA 3U4DA 1NHWA 4UVHA 2JAPA 3GY0A 1F12A 3WS7A 4Y6RA 4NIMA 2BFPA 1TI7A 4MVJF 3N7UA 1B2LA 4TZTA 1QORA 3QVTA 1HDXA 1LSUA 4R1NA 3ZV4A 3KZVA 1NFRA 2ZJ0A 4B4VA 5I7SA 4DGSA 3WOHA 1DJQA 2GNAA 4EYEA 5ITVA 4RPGA 1PS0A 1DB3A 4O63O 3T4EA 2NTVA 1O5IA 3D4OA 1XSEA 2X9NA 1GPDG 3OEWA 2V6BA 5T57A 4IDCA 3Q6IA 1KVRA 2O23A 3C7CB 3NT4A 1UUFA 4IZHA 1I36A 2I67A 5B4TA 4DLAA 3KEQA 2AMFA 2IYOA 5JC1A 3VPHA 3U4HA 3BA1A 2BI7A 3DQPA 5G4LA 3RKRA 1FMCA 3GMSA 5ENVA 3HG7A 4CV3A 2W2LD 5JO9A 3UN1A 5AVOA 5JAZA 4FB5A 3PLRA 1ENOA 3FR7A 4PIVA 5TX7A 2VTDA 1NM5A 1AHHA 3CZRA 4LK3A 1EK6A 3L77A 5JYAA 4W9NA 1MFZA 1NVGA 3PHLA 2I76A 1GUZA 1X14A 4IS3A 1CDOA 4IUYA 3AU8A 1W73A 5CEJA 2G5CA 1T2CA 1E7MA 3UOGA 1FXSA 4YXFA 4C7JA 1UZMA 5L4SA 3I9JA 2I3AA 4JQCA 3NGXA 3WLEA 4FFLA 1I33A 4J2OA 2E6UX 3CXRA 4JP2A 5L7TA 4JIGA 4JCOA 4E5NA 1E92A 1MA0A 2VUTA 1DHTA 1N8KA 1X0XA 3IP1A 5A5EA 4IS2A 2C2XA 3KM0A 3ZCXA 1HDZA 4WK6A 1KEVA 3ZNQA 4MIYA 3RROA 2GLXA 4MPDA 4P4GA 4BNNA 1T1SA 1U3WA 1DLIA 2BLLA 4PZCA 4DQVA 1RM5A 2O3RA 1ZK2A 4U8GA 4ZU3A 3GDOA 2HK8A 2DPHA 5TT1A 1A9ZA 4DPLA 2O3QA 3PFFA 2NSDA 2YY7A 3AUUA 4AJNA 5BSEA 5BSHA 3PPIA 3R3JA 4RPKA 2GGSA 4Z9YA 4BKUA 3AM4A 4I08A 4XYLA 4TZKA 1E1KA 1BW9A 1D3AA 4TRNA 4UVGA 1TXGA 1OFGA 1ML3A 4CQMD 4CLEA 4RZIA 2RH4A 3AUTA 4PLTA 3TFOA 3OICA 1VI2A 4A03A 3ONDA 4J7XA 1UP4A 1UXKA 1TB4A 1EFLA 3QIVA 1A9YA 1ZK3A 3ZWXA 1VL6A 3DAFA 3H5RA 3TPCA 4E13A 3QVOA 4A26A 2WYUA 5CDSA 2EKLA 2WWRA 3VKUA 4HNHA 5DZSA 3GDFA 3EVTA 4GI2A 4CQLA 3P7MA 5DT9A 5BNFA 6ADHA 4PLHA 3WNVA 3ZU4A 4LVUA 1PU2A 1FDTA 2NV6A 2VUSA 1D1SA 5JYEA 4LSWA 4WCFA 1EE2A 3WGZA 3EGOA 3FNGA 3KYDB 3ZWWA 4JBHA 3PFWO 4AJLA 2Q50A 2Q46A 4RCVA 1PL7A 3O8QA 4BMVA 3S8MA 1LDEA 2EJVA 2O3SA 1GQ2A 7MDHA 1HDGO 4J1QA 1KETA 4N54A 4BO5A 4MOWA 5JY6A 3LT0A 4E5PA 1P1RA 5G2OA 1LBEA 4BIIA 5B4UA 4EJMA 3I52A 4LISA 3C85A 4YB8A 3ONFA 1C14A 3WGOA 4MVJG 1GU7A 5JS6A 3TDKA 2CVZA 4XWYA 4IY1A 3PJGA 3T7CA 3SVTA 2GSDA 2O4UX 3VZSA 1J0XO 1N1EA 2H6EA 1LLCA 3IL2A 1DAOA 2Y1FA 4ONEA 1Z45A 2LDBA 3OQ1A 3WR5A 1Z7EA 3JYQA 4OYRA 3GHYA 4LRSB 4D45A 2B35A 4EW6A 4J0EA 3P2OA 3WIDA 3BHMA 1GYQA 2G82A 5EERA 1SO8A 4D3FA 1P9LA 5K6AC 4RVUA 2JHFA 1HEUA 4OXKA 3W8FA 4MINA 2GO1A 1QV6A 3PZBA 2BD0A 2FRDA 4FBGA 3I9NA 4ZGWA 3GK3A 1LNQA 1RWBA 2JCVA 2HQ1A 3WBFA 1D7OA 3KVOA 4C4OA 1EVZA 3A28A 4K6CA 5JYFA 2OGUA 3ROKA 1DC6A 5AXAA 3QJ5A 3BHIA 3DMTA 4ZICA 4LMRA 4DIBA 2F1KA 2EEZA 2DAPA 3JQ8B 4GPD1 3OF2A 3GPDG 3OQBA 3BMNB 7ADHA 4OSOA 4YJDA 5L4NA 2FN7A 1TT5A 4GGPA 3F4LA 3ST7A 2UUOA 3WTCA 4A7PA 1YQXA 4ALIA 1NPDA 1PQWA 2GDZA 3DBVO 4D3DA 1SPXA 4BMSA 1EBUA 4ZA2A 1XU7A 5CDUA 4PLYA 2GN9A 3W4KA 3RD5A 4CUJA 4P4LA 1PR3A 4FOSA 1TT7A 4AVYA 2EHDA 2AE2A 1R16A 1UZLA 1OMOA 4K9DA 1T2EA 4Q3AA 3DEYX 4CM8B 2DTEA 1ISGA 1ENPA 3EK2A 4L4SA 3OJEA 3OIGA 5IZCC 2NVUB 4FDAA 3GPIA 4D44A 1JVSA 3PIIA 3LT2A 1UR5A 4WJZA 4O5OA 3E48A 3K30A 3KOUA 1ZZEA 4Z0PA 3HFGA 3ZGYA 3H9GA 3TZ6A 3LT4A 4UEJA 4BV9A 1GQQA 1BSVA 3GVPA 4P8RA 3GFBA 4WLUA 3PDJA 4HX5A 4CODB 1BXZA 3C8MA 2EWMA 1RM0A 1A7AA 1NASA 4W9NC 3IMFA 3ZV6A 1EDOA 1M66A 3H5NA 3HUDA 3LU1A 4XDZA 4XJTA 4E33A 2ZATA 5AXCA 3AM3A 1R0SA 1DJNA 2GN8A 4H7PA 4AJHA 4ND5A 1GFSA 4BOYA 1B0AA 4NPCA 4CM8A 4M54A 4FD3A 3GUYA 5BNIA 1KEWA 1GY8A 4B7CA 1MUUA 1YQGA 5IFLA 4KUGA 3ROQA 2QG4A 4KQXA 3RQSA 5JCXA 2AG8A 5KVCA 3GMDA 1K2WA 3VZPA 3FN4A 4TKLA 4AFNA 1MXFA 3RU7A 5KOIA 1PJCA 5C3MA 1KVSA 3MZ0A 1LXCA 1GCOA 4HADA 1QV7A 5FFFA 3BHJA 3VH1A 4B8WA 3WJAA 2FZEA 4CMIB 4NK5A 3UCEA 3DFZA 1A5ZA 5K9ZA 3OA0A 4NBVA 1TT5B 3IOYA 3AFNA 3BMNA 1HE5A 1LQTA 2AQHA 5H81A 4Y6SA 1E77A 3JQ8A 4ALLA 2ZIZA 1XHLA 2X23A 2NM0A 1BHSA 2AW5A 5JYDA 4UUPA 4GWKA 4YQZA 2NTNA 3DFUA 2TMDA 3LF2A 3TOXA 4YBZA 4R41A 3TL3A 4GGOA 5HS6A 5CDYA 4RVFA 3KBOA 1G1AA 3FBTA 5ER6A 3WQQA 2EXXA 2O4CA 3AI3A 2B36A 5F1PA 1H2BA 5EQFA 1I2ZA 1C1XB 4ALJA 3PJEA 3WWZA 1ENYA 2G76A 2WDZA 1A71A 5JC8A 5CPBA 1FF9A 1VJTA 1BRMA 5HA5A 1CRWG 2DBVO 5A9RA 1JWAB 3D7LA 4BQRA 3RUAA 2HUNA 2JD0A 3RBZA 1LRKA 3DTTA 2IYPA 3RASA 3E03A 3B20A 2NACA 4OJNA 5JAMA 1P1FA 2ZTMA 1MX3A 3UCXA 1N7HA 4BGIA 2YW9A 4IJWA 5U9CA 1I30A 4WLVA 2PH3A 1LA2A 5LDGA 5LDHA 2I99A 3L07A 1DRVA 1XGKA 1YB5A 2HMWA 3U4IA 3DBHB 2HLPA 4OSPA 4NG5A 1DIRA 3ZWMA 3ZWBA 4H3VA 1H5QA 3LK7A 1VM6A 2WTBA 4J2HA 4PG5A 1E3EA 1J5PA 3O8QB 2EGGA 4WE3A 5ICSA 2JFFA 2NU9A 5KJCA 4K26A 3KYDA 2Q4EA 4WCFB 4WLFA 2X9VA 5DOZA 2FOIA 2VN8A 4UUMA 5JCJA 4BKQA 4EEXA 3GGGA 3O9ZA 2Y1OA 4FGWA 4UAGA 5CDTA 2JAHA 5KJ1A 1XG5A 1O95A 4CMEC 1CWUA 1O94A 3VPSA 2X0RA 2A35A 5A9SA 5F3RA 3O03A 1ZIDA 2CY0A 4RQUA 1KVQA 1Y5MA 3ZN2A 3HQ4O 2WMDA 1VJ0A 4QX6A 5KVVA 3KLPX 1OOEA 1X15A 4L73A 3F5SA 2GR9A 3E82A 3VH4A 1HZZA 4U5QA 4W82A 4Z3DA 5L95A 4R4JA 3M1AA 5JY1A 1U5AA 4HKTA 1ZXLA 2ZCUA 4FCCA 2Y67A 2PKQP 4R01A 4QEDA 1PL6A 1LDNA 4K1LA 4MVJE 1NR7A 4CLOB 3JYLA 2GD1O 4F3YA 2EW8A 2JD1A 1N9GA 2ZQYA 3NUGA 1E6UA 3ZV5A 4BB6A 3BXXA 3GHHA 1IL0A 4DREA 2GN6A 5ILGA 2VUUA 4ND2A 4XQGA 1LDYA 1LEHA 4H15A 4OOFA 3D3WA 3WYCA 1M75A 1WAMA 2J3HA 2VWGA 1QYDA 1Y9AA 3D3WB 2AHRA 4EGFA 4U7WA 3KSDO 3C1TA 3L9XA 4GBJA 3CIFA 1Q1NA 3GAZA 3IP3A 2UUPA 4TMFA 5KVQA 1XWFA 1DC4A 2O3UA 2Y93A 2I65A 1HRDA 5G0VA 2DT5A 4CV0A 4EJ0A 5L51A 2JFGA 1NBOA 1N9GB 2FSSA 1S6YA 1PWXA 1OZAA 5JDIC 3Q2KA 5TSDA 3WGGA 1Y9EA 4EI2A 5CAEA 1DFGA 1XLTA 3NAQA 5A3JA 5I9MA 3FD8A 1AXGA 4OAQA 2BKAA 1LSSA 3R3SA 1PJ3A 2AQ8A 4YAIA 2IZ1A 3ETDA 3EZYA 1YVEI 3FCOA 3CKYA 4HXYA 1EQ2A 3ZNOA 4XYEA 3WQSB 2A9FA 4XD2A 3UFXA 1BWSA 2OBNA 4HUJA 2HSDA 1J6UA 2CMDA 4O0LA 2DKNA 2CFCA 1NQOA 1PJBA 4C7KA 1ZSNA 3V1UA 5A9SB 2D0IA 1DSSG 1C0KA 1DC5A 1LDGA 3Q1LA 2POQX 2QRLA 4UEOA 1H94A 3JQDA 2J6IA 4YDRA 1FDVA 2C59A 2RBEA 4RVGA 1C3VA 4R3NA 1ENZA 1E3JA 1ULSA 1ZJYA 3GVCA 2QQ5A 3HADA 3X2FA 3H9UA 1I2CA 3NTOA 4GX1A 4L76A 1VSUA 3GFGA 4ID9A 3PGJA 2GZ2A 2Y66A 4DLBA 4OKIA 2RCYA 1CQJA 4LN1A 5BR7A 5L45A 1PTJA 2F00A 3SLKA 1L7DA 4RJTA 1I01A 4TROA 1PGNA 1YL6A 2P5YA 4MVJI 3DBHA 1NFFA 3DAPA 1U8FO 3IUSA 3F4BA 4DTIA 1LSJA 4E2WA 1NWCA 3COSA 4RF4A 5HWSA 1UP7A 4BNFA 2V7PA 3CZMA 2QZZA 4FJ2A 4PVCA 4RPHA 4FJ0A 4RDHA 3BTOA 1HZJA 3P19A 4QQRA 1VSVA 1NX6A 2X58A 2UAGA 2I66A 4NU5A 1UDAA 2B4TO 5FI3A 4YVFA 5IN4A 2QYTA 3AOGA 5C37A 4R5MA 4MIEA 5B1YA 5TNXA 3H9QA 4XYGA 1UJMA 3KTDA 1KVUA 1P1HA 3DOCA 4IQGA 4XQEA 4EDFA 3RAJA 2QRJA 3V2GA 1C1XA 5I9NA 4ROSA 1I3LA 4IMRA 4B7XA 4CM4B 1ZK0A 3HDHA 1SEVA 4BGEA 4WEQA 1YBVA 3RUIA 3VAZA 3ANNA 1B8VA 2BF7A 4GX0A 3ZH2A 1B16A 1BMDA 4II2A 4O1MA 3RUHA 1LRLA 3RBVA 4JP3A 3MOGA 4FIZA 3ORFA 5DP1A 1CERA 1Z7BA 4ZQHA 1V0JA 2Q2WA 3ZHYA 5L9AA 5C7LO 3EYWA 2VZ0A 1H9AA 2I9PA 3OHSX 4CMIA 1YL5A 1YB4A 4RPLA 2JL1A 1B26A 2CF6A 1YH3A 2DM6A 4UVDA 2NU8A 3FTNA 4RL6A 1LUAA 3KXDA 1I3NA 1XQ1A 5F1KA 1X7DA 4QO7A 3RFTA 9LDBA 4PZDA 4ZQEA 4OM8A 4PG8A 4E2YA 4YT4A 3K96A 4NFYA 1GDHA 3W4IA 1Y81A 4ALNA 1LLDA 2JKVA 4GH5A 4J43A 3S1LA 1G6KA 2D3TA 2IEDA 3K31A 5IXSA 2HAEA 3WGIA 4IJVA 2P91A 1ONNA 2EP5A 4F46A 1CIVA 5A9TA 2JCXA 3CINA 4CR7A 3W6ZA 4FC6A 1B8PA 2EGHA 4OQYA 2A94A 3Q3CA 3ZW8A 4I9HA 3TZQA 4OXYA 1QP8A 4CUZA 3QWHA 3QWBA 4G2NA 4ZHSA 4KZPA 3WICA 2NQTA 4W6ZA 4CMEA 1P1KA 2O50A 3UUWA 3B70A 3S2IA 2FR1A 3LLSA 4HFMA 3I23A 3BZUA 2EKQA 2CD9A 2WE7A 1DFIA 2NVUA 1U5CA 1QMGA 5T8KC 1MG5A 2YFHA 3A06A 4IBOA 4UEKA 4AJEA 1LI4A 4E2XA 1IZ0A 5CEFA 1YDEA 1LLQA 3QLJA 4ESOA 1CJCA 3D5TA 5DBGA 5CG2A 4UULA 1U1IA 3ULKA 5CEEA 2W2LA 3LSYA 1T4DA 4PLWA 2BFOA 3MTJA 4FOOA 3LYLA 1GL3A 1YJ8A 3PZRA 3B6ZA 3UVEA 3V2UA 1UXIA 2CZCA 4L9RA 5I9LA 1JW9B 4BQPA 5KKAA 2ZYAA 1BDBA 1M2WA 4A5OA 1KC3A 4J0FA 2J3JA 1TA4A 3ZZNA 4G81A 2VHWA 1N92A 2YZ7A 3PWZA 4LRTB 5COAA 3E9MA 3PLNA 5EL0A 2E48A 4YT2A 4KMSA 1GZ4A 3ZW9A 5T5QA 5FF9A 4N7RA 4LCEA 2Q22A 1KBZA 3CMMA 1QKIA 4BNMA 4E21A 4D0SA 1OAAA 3HE3A 1UH5A 3BMCA 4IIUA 4BO0A 2P2SA 4YT8A 3FHLA 2WE8A 1IE3A 4Z3KA 5ER9A 2PZMA 2NLOA 1U8XX 4J4TA 5U4QA 3JD2A 1DBVO 4XA8A 4R1UA 2PNFA 2P5UA 3GVHA 3RKUA 3ADPA 4R5HA 1E6WA 4DWVA 1EQUA 2P68A 1B3BA 1VL0A 3RIHA 1Q2XA 4NU6A 4PLZA 3G17A 5L53A 4OL9A 5AQ1A 3ZU5A 2DTDA 5FWNA 4YT5A 2FP4A 2HMUA 4CM3A 1DIAA 5JDCC 3UGKA 2B37A 1X1EA 4BNUA 5DCYA 3EUWA 2BGMA 3F1LA 3VHRA 4BNLA 1Y8QB 2W4QA 3OMLA 1H6AA 1PJLA 2PD3A 3WQRA 3VKVA 1SMKA 2HMSA 4BNKA 2Q49A 1YO6A 1HSZA 4MIOA 2Z95A 1A4IA 1PJ2A 5AXBA 2NU7A 5KJFA 1R0KA 2C7VA 5AOVA 4CM7A 1HWYA 4IQ0A 4HFRA 1ZJZA 5JNLA 5ADHA 1AXEA 4J1TA 2DTXA 3B1KA 4CQLB 1TEHA 2YV1A 4CLRB 2XOXA 3ZU3A 2FY8A 1ISIA 3F5QA 3RFVA 2V6MA 3S2EA 4IDEA 3DHYA 1AGNA 1U4OA 4J9VA 3PHIA 4FQ8A 5MGBA 3WYBA 1WP4A 4I5EA 4E6PA 3JQEA 3PK0A 1JKIA 3SEFA 1W8DA 4BGUA 5C7OO 5BNTA 1EVJA 2WJPA 2J5KA 4DA9A 3K5PA 3NEPX 4RLSA 1ZBQA 4BNTA 4ZJUA 1CQIA 2ZCVA 2XAAA 3DTYA 1BW9B 1GEGA 1IYZA 4DVJA 2HO5A 1ZK1A 3DZIA 4XIJA 4G5HA 4RORA 3OM9A 3FBGA 2I5PO 2XF8A 1KOLA 4F45A 1M6HA 1SOVA 1FDSA 3OJ0A 1VC2A 2QX7A 3ZV3A 1BG6A 1JAYA 3OIFA 2H5LA 1X1TA 2PZKA 5U1PA 4OH1A 4I9UA 1F17A 2C54A 1EZ4A 4BGVA 1VE9A 3GUCA 1HYGA 4KQWA 2H63A 4R54A 1PL8A 3PYXA 2D5CA 2VNSA 5A02A 2IRWA 2B83A 5JXWA 4MVJM 4CLOA 3INRA 1SZJG 4D46A 1I10A 1KY5A 3MJEA 2PTGA 3GN1A 4DXHA 3QV1A 1NAIA 2P9GA 3S2FA 2VQ3A 1WDLA 4GWGA 4L0QA 2PWZA 4I5FA 5TLSA 4PLFA 4QO8A 1MB4A 3ZHXA 1PQUA 3GF4A 4E31A 5CDGA 3ETEA 3M6IA 3OFSA 2VRCA 4I5DA 1XR3A 2G1UA 1HDCA 3DBLB 1RKXA 3QRWA 4W7IA 1D4FA 2Q3EA 3NV9A 1YJQA 4FGSA 2ZJ1A 4D41A 1WXDA 3WSWA 5EMHA 3ZWAA 4G65A 3CPSA 2GZ1A 3GOHA 4U6SA 5TC4A 2P9CA 1VKOA 3HFSA 3WB9A 3I4CA 4MDHA 5DBIA 3U09A 1K89A 4OGWA 1A7KA 5JCJD 2Y0EA 5TGDA 3QWIA 3GEDA 3OQ6A 4RVHA 4IIVA 1V9LA 1NNUA 4R3WA 3H4VA 1LLUA 4IGFA 3LVFO 3E5MA 1PEDA 3JSAA 3UXYA 1T4BA 1SOWA 3GZ4A 3QY9A 4XEHA 2AQIA 4P38A 2RHRA 1EUDA 2J5QA 4GSLA 4KWHA 3DDNA 1BGVA 4FPXA 2HK7A 1EFKA 2O7QA 2FR8A 2AEJA 3JQ9C 4EBFA 4M86A 5AXDA 5HM8A 3SLGA 3WMXA 4B3IA 1M76A 1XA0A 5COBA 1NQAO 4WKGA 3I1JA 4MVJA 1PJTA 4CL8A 3WSVA 3FNFA 2X5JO 2QYSA 3G0OA 3K8ZA 1EBFA 4CMKA 4DBZA 2GPTA 3QWFA 4IXTA 5MDHA 3IKTA 3QVWA 3HB4X 2Q99A 3JQAA 1HDRA 2IDZA 4ZRNA 4BKOA 4L75A 5T64A 1NAHA 3W8DA 1NXQA 3OJFA 3SX2A 3WGQA 3JTMA 3L6EA 3ZDFA 2B5WA 3AY7A 4Q3EA 2OP0A 3STHA 1HTBA 3L4BC 1JTVA 4RV9A 1O89A 1QYWA 2Q2VA 1NVMB 1QYXA 1BDMA 1DRWA 2WD8A 4WOKA 3OJLA 4KWIA 5EQDA 3KHUA 1LC3A 4E5MA 3JQ7B 2X22A 3QE3A 4Y67A 4TSKA 4YR9A 1O0SA 4M87A 1HXHA 3JV7A 4Y8VA 1Q0HA 2FPGA 3ANLA 3AWDA 5GY7A 2PD4A 4URFA 5IN5A 3RFXA 3W6UA 4MVJP 4PN3A 2DPGA 3L6OO 2R2GA 4YA6A 3U49A 3FTPA 3AUSA 1T2FA 1UDCA 2I6TA 1DIGA 4M49A 2HK9A 5J9GA 2Y99A 3X2EA 4BNXA 4XGNA 2NVBA 4BNJA 3BTVA 3TRIA 1GTMA 1XQ6A 1DXYA 1PZHA 4XIYA 3K9QO 3HN2A 3LZ6A 4M55A 4YJHB 3A9WA 2YHIA 5IDWA 4BB5A 1RM4A 1MFPA 4IDBA 2ZB7A 2DVMA 4BNWA 4HV4A 1F0YA 2I3GA 1E3LA 1PZGA 1K5HA 3MWEB 3GNQA 1EVIA 2ET6A 1G0NA 2VHZA 4I5GA 3NX4A 4TRRA 5KJEA 3GC6A 4WNCA 2Z1NA 1SC6A 2IZ0A 2PV7A 3Q2IA 4Q3NA 3HHPA 3JQ6A 3VH3A 2HRZA 4OMUA 2D59A 1GADO 1ZW1A 1IB6A 5TJ9A 1I2BA 3NJ8A 5IZ4A 4Y9DA 3P5SA 2NWQA 3ITDA 3H7AA 1BVUA 3JD1A 1U2DA 1E6EA 5DCWA 3JYNA 3T4XA 1JDJA 5G4KA 5A06A 1FDWA 1FK8A 1PQPA 5KVSA 1E3WB 1U28A 4LW8A 3I83A 5DULA 1U7HA 3H6KA 1IOLA 1I0ZA 1ZEJA 4ZQFA 4E32A 2QW8A 3WXBA 1ULUA 3IKVA 3RI3A 4ZVVA 3WBBA 1LX6A 1P45A 4BV8A 4PG7A 1LSOA 4K6FA 5EINA 1VKNA 4NJMA 3PHJA 1U4SA 3PWSA 3G49A 3E5RA 5B12A 3OSUA 3GRPA 4PVDA 2C0CA 1HDOA 3DZHA 2CUKA 4YJGB 1TLTA 2GASA 1PJQA 2NTJA 5IXYA 1U3TA 3NDIA 5H82A 1V8BA 1V3UA 1GCUA 2PK3A 3IQDB 1O6ZA 3GVIA 1OC2A 5I8ZA 1L1FA 5HRUA 4E2ZA 1U3VA 1QLJA 2Q1UA 3JYPA 3RJ5A 2PKRA 1A4UA 1YE3A 1KVTA 3DZKA 4BKRA 4JGBA 2V6FA 4D79A 3FNHA 1NTOA 9LDTA 1UP6A 4MKXA 2X9GA 2BGLA 5DBFA 1ORRA 3LQFA 5I7FA 2O48X 4TWRA 3KETA 2QZ9A 3K73O 3A14A 3IC5A 1EVYA 4Q39A 4U0KA 4WLNA 2IZZA 1T1RA 5JW6A 2VHVA 3TF5A 3F9IA 3U9LA 4MO2A 3PYLA 3OH8A 4RVSA 2OBYA 2X86A 3PI7A 2OP1A 5KCZA 5KKCA 1M67A 2V65A 1AUPA 3MJCA 1EEHA 2HJSA 3BTSA 3JQFC 5BT9A 4R51A 4XB1A 2W2KB 4XKJA 3V1TC 5IZCA 1LTHR 3AY3A 3UAGA 2IXAA 2FPPA 2G0TA 4HBGA 4R1TA 1WVGA 2Z5LA 4RGBA 1L7EA 1P74A 2DLDA 2AEMA 3WFIA 3WNQA 1BXGA 1AE1A 1LDMA 1YB1A 3UKOA 1MLDA 2NNLD 4FS3A 1DEHA 3KRTA 4QUKA 4N5LA 4DL9A 1Z75A 2OORA 4D0RA 3KYCB 4DMLA 4XCVA 3WFJA 1RYEA 1NHGA 4PLGA 2Y1CA 2Q45A 3ITKA 1GV1A 4CR6A 1DIHA 1IY8A 4BNGA 1ZFNA 1P31A 4XGIA 1GV0A 3RCBA 3ZWPA 3D1LA 1T25A 1ZMTA 4NH4A 4RPJA 4XJSA 1WMAA 3KEOA 4CM6A 1WPQA 1UXHA 2WM3A 1C1DB 1PZEA 3JQ9A 3N74A 1PS8A 1E3IA 3C7DB 5F1OA 4AJ1A 3RUFA 1JKFA 2X7HA 4XB2A 3H3JA 5A04A 2YQ5A 5DF1A 3BMQA 2Y68A 5L4LA 3PWKA 2P4QA 3ASUA 1B7GO 2VOJA 3ON5A 4QSMA 4BNYA 4OXNA 4CL3A 1UAGA 5A5FA 5KNLA 3NTRA 1DC3A 4E4YA 1EDZA 3VTZA 3DMYA 3G1TA 3I4FA 3TZCA 3DB2A 5DCUA 1W4ZA 4O59O 1NP3A 3ROMA 1UZNA 3D3EA 2ILTA 1WDMA 5F5LA 2H1SA 5T6BA 2Q1WA 4CQMA 3DBRB 3DWFA 2UVDA 4IDFA 2PFGA 3L4BA 1HETA 4WCDA 3AFMA 3KLMX 1HDYA 3BAZA 3OA2A 3JQGB 2HCTA 4NNJA 3JD4A 1O9BA 4L74A 4CMBA 1DFHA 2W98A 2BGKA 5TIIA 4J3FA 3HNPA 1DRUA 3WYEA 4E0BA 2GF2A 1HE2A 2C5AA 3UCFA 4AL4A 4WOJA 1R4MB 3V8BA 3VPXA 1MV8A 3ENKA 3TQHA 4RZHA 4J6FA 1JVBA 1X0VA 3QHAA 3I9LA 3IJPA 1R15A 4WNIA 3H5AA 1X13A 2C82A 2R6JA 1Z74A 1IULA 1I8TA 2GUGA 5C5IA 1J49A 2QHXA 2VT3A 2Y1EA 4ZRMA 3TZHA 1Y7TA 1JN0A 2B69A 3QQPA 4J4BA 3ETGA 5K0ZA 5DOVA 4L8VA 1XU9A 3GLQA 4QECA 5IAAA 2BHLA 4YWJA 2PKQO 4W99A 1E1NA 3RBXA 1CYDA 4FFPA 3CE6A 1WDKA 1LU9A 4WUVA 1SBYA 2UDPA 3RWBA 5C7IO 5JAIA 5HS4A 2IXBA 2NVWA 3W4JA 1PX0A 3H65A 3MCVA 4LCJA 1R4NA 3TNLA 2Q2QA 2EERA 5ENDA 1ZUD1 4XQCA 3GZNB 4NDNE 3BMOA 4CM5A 4MVJD 3ZWOA 5H83A 2NQ8A 4X54A 3GRKA 4DYVA 4PLVA 2WYWA 5CG1A 4HP8A 1KY4A 5AYVA 3U3XA 2FPIA 2WD7A 3ICCA 2VYNA 3RC1A 4HWKA 3M1LA 4Q3CA 1WZIA 4J4HA 3DO5A 1X7GA 3UH1A 2ZTUA 3PIDA 4R16A 3WG9A 1GR0A 4WGGA 4FFRA 5BSFA 3E18A 2Y1GA 5TT0A 5ILOA 1NVTA 2Y05A 4LSMA 1PGOA 4I9NA 4OO3A 4AJPA 4ZQGA 2BFMA 5BQFA 5THQA 4XZ3A 2WSBA 2VHXA 2FZWA 4J7UA 1K0UA 3KO8A 3RSHA 3MJSA 1J4AA 3AM5A 3NJ4A 4S3MA 4OIMA 1M6WA 2O2SA 1JA9A 1SB9A 2RIRA 2VZ9A 2UYYA 2NU6A 5A4DA 3MJTA 1IZ9A 1K6JA 1V6AA 3QW2A 2WD7B 4RVDA 4WCFC 8LDHA 3AUAA 1SCUA 3L9WA 3ASVA 3GZNA 1DO8A 3HZZA 3AOEC 3EZLA 2VZ8A 1ZSYA 3IUPA 2X8LA 2GRAA 1R4NB 4M89A 4JX8A 5KWEA 1WZEA 1ZKMA 2OO5A 3RVDA 4A10A 5JBIA 1WW8A 4EUHA 3TOZA 4KP7A 3IDSA 2Q1TA 4AJ2A 3I9MA 3DC2A 4L4XA 2BELA 1P0FA 2VT2A 4EEZA 3H3FA 3SC4A 4CM9D 3FNEA 4IXWA 3ENNA 1RPNA 2VYVD 2IE0A 1ADFA 1H2HA 4GLOA 3RC7A 1MC5A 1QG6A 3GEMA 3U5TA 3PTZA 5JDIA 2YV3A 3LC2O 1PJ4A 4IMPA 3TSCA 1RM3A 3NGLA 3VH2A 3C1AA 5F5NA 3KYBA 3BIOA 1X7HA 1NPTO 2D8AA 3FWZA 1R4MA 3EW7A 4NBWA 4E30A 4BO7A 5IDXA 2X5OA 1OC4A 3E6AA 4RF3A 2J3KA 1NQTA 3B1FA 4ILKA 4YTEA 4B3JA 4DQXA 1IHYA 2B0JA 1K6XA 4NI5A 3EAGA 4N5MA 1F14A 2FWMX 3FRJA 3QSGA 1UDBA 3KUXA 5KIAA 3DBRA 1WNTA 1PGQA 2Y0DA 4YAJA 4D7AA 5G0TA 4GKBA 1W0CA 3DMTC 3VTFA 4RF5A 5CP8A 4YRDA 4BO9A 1RJWA 1YOVB 2PA3A 4RF2A 3GN2A 1G0OA 4ND3A 1I5RA 1XELA 1QR6A 4L4RA 4BNVA 3PQEA 5GZ3A 2ZTVA 2YV2A 5A05A 2DBRA 4ITUA 3R1IA 4CR8A 3WDSA 3I9OA 2CNBA 2PD6A 1VJ1A 1JKJA 1GZ6A 5KTKA 4JXKA 3S55A 1B3RA 3W1VA 1E0DA 1HE4A 5F21A 1T24A 3TZKA 4P4NA 3DHNA 4B3HA 1QRRA 2EV9A 2P4HX 2VWQA 4KTTE 3ZI0A 4WEOA 1PSDA 1D8AA 4NHEA 5EIOA 5T73A 4YJFA 1DIBA 1F8FA 4ALMA 4RLHA 3NDJA 2TMGA 2X1HA 1HYEA 3GDGA 2VRBA 1MP0A 5A1TA 3VDQA 1K3TA 3KV3O 4R69A 4B4WA 1E1LA 3HWRA 5JO0A 4KDEA 2EP7A 3PDUA 3MWDB 2VNAA 3E9NA 2X6TA 3OBBA 4R68A 1YQDA 4D3SA 1SEPA 3DOJA 3FPLA 4JJFA 4LMPA 5JE8A 1F06A 4EITA 1XCBA 1YXMA 2Y1DA 2JFHA 5FI5A 1R37A 1ONPA 2CDBA 2YDYA 3VVBA 1PJSA 3DXFA 2VWPA 1GAEO 4AJIA 4CLXA 1YS4A 3EVNA 4GLLA 4B8ZA 2VYVA 5EESA 2VHYA 4P22A 2DUWA 3Q9NA 2OUIA 3PHHA 4CM9A 2YQ4A 4DPMA 1HT0A 1GYRA 8ADHA 1H9BA 1KIFA 3C1OA 1ADGA 2XPCA 1NPYA 2HU2A 3U62A 2AQKA 3ZWYA 5TF4A 2W2KA 2HMTA 4J1NA 3ICPA 3ROPA 2PGLA 2PZLA 2RHCA 3GG9A 3SJ7A 4QFDA 3C24A 3R6DA 4JROA 4Q3DA 3T7EA 4TKMA 1U7TA 2PGJA 4WECA 2D2IA 1Y8RA 4UVEA 1GZ3A 1T26A 2X5KO 3HB5X 1ID1A 1GPJA 2PH5A 2ZYDA 3NRCA 2VYND 4JNKA 4PFJA 1ZK4A 3H8VA 1Y8RB 4KUHA 4PG6A 4Q3BA 1GUYA 4FN4A 3E9QA 1QLHA 3MTGA 3UICA 1ZSVA 1FJHA 4GAEA 3IS3A 3F3SA 1I3MA 2H9IA 4BO2A 3LF1A 4YJGA 1GEEA 3QA9A 1HYHA 1H6DA 1ZXBA 1S7CA 4MKRA 5L40A 2SCUA 4U0JA 4ZD6A 2PZJA 1KYQA 4WPGA 1SNYA 1Z73A 2E49A 3CTMA 4CLDA 2X0NA 1YBAA 1ADCA 5FEUA 4HNGA 1OI7A 3PJDA 4CMAA 3ZWNA 1MC4A 1DHRA 1H6BA 3PHGA 1CF2O 1VL8A 3WJ7A 2AE1A 2DFVA 3EHEA 4FW8A 5DP2A 1E5LA 3VC7A 5DNAA 4GMGA 3I6QA 4IPTA 3P2YA 1XEAA 3GQVA 2ZK7A 3VZRA 5HTOA 1KERA 3QVSA 3RU9A 2IEBA 4DC1A 2JD2A 3JYOA 3E8XA 3KSUA 4FFOA 5G4KB 1PIWA 3DONA 3I5MA 4IJUA 1P44A 1Q7BA 2C29D 2VTEA 4DLLA 1IUKA 4JJIA 3JD0A 2YYYA 4KDFA 4IINA 4CJXA 4NZ9A 3G79A 4QTZA 4XR4A 5IF3A 1U3UA 3Q11A 4ZQBA 1JU9A 4UUOA 1C0LA 3ZWVA 4YJFB 2CDAA 4AICA 3O38A 4LGVA 2EKPA 4JBGA 4B7UA 1LRJA 2FHSA 4BO6A 4A0SA 3D4PA 1Z6ZA 2ZB3A 3AOEA 4FFNA 1UAYA 3PP8A 4XGKA 3HDQA 1JQBA 1PZFA 4HY3A 4W7HA 4Y6PA 3VZQA 5I7VA 3ABIA 3VOSA 1NYTA 4OHUA 3EY4A 4JN6B 1HL3A 3AI1A 2YHIB 1YGYA 4YJHA 3OIDA 1D1TA 3WGYA 1YOVA 3M2TA 1ZMOA 3PYMA 2XXJA 4H16A 4JBIA 4YYZA 1HF3A 4UVIA 5JFOA 4FFMA 1N1GA 4TVBA 4J49A 1K6IA 5B4VA 4J90A 5G0SA 3I6IA 2Y0CA 4NK4A 1EK5A 2D4AA 2E4AA 3WTBA 1E7QA 3D0OA 3GAFA 2WEKA 1ZH8A 2C2YA 3AU9A 2CF5A 4FR5A 3IIEA 3RC9A 4JLWA 4Q9NA 2C07A 1U9JA 3LDHA 1DAPA 4NQZA 1WLYA 1C0PA 1VLLA 4BNZA 4ALKA 2HJRA 4B4UA 1IHXA 3JQCA 4GSKA 1ARZA 3TFQA 4O6VA 3GT0A 4ND1A 2YDXA 3ZNNA 1B15A 4NFSA 3TJRA 1LJ8A 3AY6A 4GVXA 4II3A 4DYDA 1IPFA 3ZU2A 3NYWA 4I1IA 2C5EA 1R12A 4NBUA 5IJZA 3DZGA 3K92A 3HDYA 4B79A 1E5QA 3VDRA 1OBFO 4TRJA 3DZBA 2RH8A 3FR8A 3CSDA 1P1JA 3FF4A 1HLDA 3I9KA 5TRTA 1HKUA 3CMCO 4XRGA 2D5AA 4R1SA 1XKQA 3D64A 5GZ6A 5THKA 3K6JA 3GNSA 4CMHA 5JMWA 1NR1A 4J16A 1H0KA 2A92A 3GVXA 2Q4BA 3PEFA 3KSZO 2W8ZA 2X0IA 4EJ6A 5IG2A 4DUPA 1XDWA 4KUEA 4W4TA 3G1UA 4GVLA 4BMNA 3EC7A 4TVOA 2V6GA 1A72A 4BO3A 4QT0A 2AG5A 4EUFA 1R66A 3WX0A 2BFAA 1UXGA 2GZ3A 3GA0A 3C7AA 3AJRA 4PLPA 4A73A 3FWNA 2E37A 2DC1A 3I3OA 3WMWA 3UHAA 1JAXA 1B8UA 1ZCJA 3PXXA 3JQBA 5TQVA 1KS9A 3BYZA 1GYPA 2NADA 4B4OA 4J1SA 4YQYA 1EMDA 1GQYA 3ONEA 5CHEA 4YCAA 1YONA 4QXMA 3VPGA 2OMEA 1Q7CA 3NTQA 3BMOB 3G3EA 2FMUA 1P77A 3E1KA 2R00C 3V2HA 2RAFA 2HRBA 4NMHA 3DBLA 4XRRA 4BO4A 3NDRA 3WWYA 3LC7O 3OEYA 2YHUA 5JMPA 1PS9A 4RQTA 4CMCA 4OQZA 2DBZA 4HFNA 4BUCA 4GMFA 1NQ5A 3H2SA 2P9EA 3NKLA 4DBVO 3H9JA 3R0IA 4FC7A 2AA3A 4YRBA 3CH6A 3INTA 3QWAA 4BVAA 1P33A 4NBRA 2BMAA 2VCYA 3ZHBA 2E82A 4QFCA 1BTOA 1ZO8A
chains in the Genus database with same CATH superfamily
2PCJA 1Y9JA 1VE5A 2XIQA 1Z6GA 4C89A 1GP2A 4UBKA 1JJIA 1K1EA 5JAQA 3BWYA 1IZ8A 1UBMS 2VKQA 3ZWQA 5ELLA 4FNMA 1OLXB 3BH7A 1EWVA 2OZKA 3L7CA 3ISVA 4JYCA 1P17A 4LDAA 4P86A 5E0KB 1QHSA 2BGUA 1R0LA 2AMYA 1ISFA 1LC0A 4GC5A 1KRXA 1ZUIA 4NV3A 2AC2A 2Q1SA 5MF6A 2VK8A 2NV0A 3PQFA 4LAFA 2P3SA 2OY0A 3LDAA 3LLVA 5BR1A 2C4NA 2J3LA 3TLEA 3JQGA 5ESWA 2R6DA 1FP4B 1N8SA 1T5TA 1DLJA 2B8EA 1V3VA 2EZ8A 4MTLA 1HLPA 3Q0EA 1C5KA 4EY4A 1ZCFA 2AT1A 1XYGA 2WWWA 3FPJA 1N0WA 3W5VA 3Q6MA 1UC8A 1REQB 2EQ5A 3DS8A 2W6CX 1E3SA 4XWGA 1VKZA 1X3LA 3R6LA 3V48A 4QQFA 5ECYA 2R7NA 1DOHA 3PSAA 2NTYC 1JA0A 4G2TA 3H0WB 4LYGA 4BX3A 4GI5A 2WY2D 5LXTA 4YEDA 2P9QA 4CI0B 3T3HA 1R0BA 2WNSA 3VMMA 2OENG 4MP8A 3EX7C 1OX5A 3VPFA 3SKYA 2IODA 3KQWA 1ID8A 4BJ5A 1QHXA 1ZONA 3CG4A 3E84A 4CLRA 3QMMA 4INPA 2CSUA 1Q6YA 4F3CA 3MTBA 1VRVA 5H16A 1NJ6A 4AG3A 3GMIA 3B1JA 2XEDA 4MP6A 2WDPA 1M1UA 4Z8YA 3VDMA 2W70A 4ZO8A 1P1IA 4E14A 4M7PA 5M6DA 1H93A 4YRNA 1WG8A 3KKMA 4WAUA 3T5AA 1PWZA 4E3ZA 1DAEA 1J0EA 4AKSA 1IJBA 2F64A 2W6PA 1EUZA 3LQ2A 2C4KA 4ARBA 5CLFA 1GFWA 1YWGO 1GUBA 2JZOA 5KNCA 3O8OB 5FPPA 1I24A 5LR6A 1RVV1 3N58A 5AIBA 3R9KA 4V0NA 4DANA 1IC6A 3ROEA 3L5KA 1VL1A 2R87A 3RJ9A 5DIFA 3ZK7A 1R00A 2JIDA 1IMJA 821PA 1KYVA 4IDQA 3KYCA 1Z13A 2PEZA 2AXPA 1MO3A 3DZFA 3B8EA 1IVNA 4JXXA 2PUDA 3AUKA 2VAXA 1Z0UA 2JGAA 4PGGA 2OL4A 2ZIWB 3F5FA 1Y6RA 1DCFA 1TFUA 2WJYA 3KOMA 1PYDA 4N5IX 2IUFA 3EDMA 4X1KA 2GK4A 3V1LA 1R74A 4WBNA 1FUIA 3MJVA 2QS9A 4N40A 2R66A 1N8NA 3F46A 3KKKA 4NECA 3E4CA 4LVNA 2PMDA 5CNMA 3U80A 4CVNA 4MWDA 2ECOA 1U6JA 2ONCA 2Q2NA 3DL2A 3HB7A 1J06A 4R9SA 4DC0A 3LCVB 5KPDA 3DKRA 3VM6A 3LLCA 4ZI2A 4YACA 3O1LA 4HAUA 4YPOA 2QRHA 4EUSA 2EZTA 4DRYA 3E2PA 1C0EA 3M1YA 3PNPA 3ZE0B 2PX5A 4KOAA 5BUZA 1QIJA 4YRCA 2YFQA 3GIDA 3P26A 4Q9DA 1BYUA 1QRDA 3AKCA 3KB6A 2ZQZA 1W4RA 3L0PA 1LQUA 5ES3A 4XQ9A 1CZNA 1GTG1 1GU0A 4D0NA 2QMHA 3IKJA 1ZVMA 4B46A 3DM9B 1JHRA 4U7GA 4WASA 1JP7A 3WYDA 4P2GA 1AQNA 3OP4A 4MQEA 1P5RA 2CNDA 4NMWA 1AUOA 2EBWA 1L7MA 4ZPJA 5J2TF 2BOVA 1OT3A 1NSYA 2OHJA 3JWJA 5DDIP 3LT1A 1V8PA 1QXSA 1A9TA 2UZ0A 3CX4A 1NQUA 2V4MA 3OKCA 1W36B 4MGHA 2FEOA 3MSXA 4LOIA 2BTQA 4GEKA 5J5CA 5LB2A 4LYYA 3T94A 2G4VA 2C2OA 1VHJA 5KDLA 1XRSB 5A6SB 4JUBA 1S2NA 2XZPA 4A5SA 4E5KA 5K2OA 1VRWA 2GPNA 4F3TA 3V42A 3A6DA 4PRLA 4TWBA 3BICA 4FX2A 5HGJA 3SQDA 2GN4A 1X7WB 1I51A 3GCGA 4NFLA 1E7SA 2WAXA 4WLEA 1XNHA 5LBTA 1M1XB 3ZNPA 2J32A 3TGLA 3FVWA 5CM2Z 2EFCB 1WB4A 3D6UA 2HJVA 5B37A 1T2DA 2VSQA 2KE5A 2FUEA 3DMGA 2EHJA 5KMGB 2GBPA 10MHA 4IIJA 3GG2A 4ND4A 1B14A 1V8DA 1SKYE 4G89A 1TIPA 1TM7E 3D7RA 3AHCA 4QTUB 4UUBA 3S2GA 2JFNA 2XUJA 3ACDA 2Q5IA 2ZAMA 3N0WA 2XT6A 4Z9FA 4K88A 5T41A 1IOVA 2ZM6B 1T8UA 1VPDA 3GGJA 3EQ9A 1KEUA 1JYFA 1U2DC 5BOSB 4BO1A 4MNTA 4DSUA 4YUAA 4PAWA 2VPPA 4LJRA 3DZ3B 1ZH6A 5IYZA 4H3KB 2R47A 1CY4A 2NIPA 1BJRE 4KWTA 1ZIOA 4UMFA 3UQZA 2C8KA 2CLCX 3CVYA 4LWQA 4XDYA 4V1CI 3H2YA 4QGSA 1EXDA 2DQKA 1MAUA 4WJKB 5TS3A 5JFGA 4IWYA 3II6X 1X94A 3PFHA 4MP3A 1PGJA 3K70D 4PM4A 1JFTA 2ZE5A 3OZDA 2FRVA 1XEWX 3AK4A 3NATA 3URKA 5ILOA 3BTUA 3UW3A 1M5TA 1F0KA 3NXKA 3H9EO 1TAHA 3GPLA 3V1YA 5IK2A 4C6TA 3QKRA 1EP1B 2H0AA 4IZIA 4AX8A 4ZOLA 4Z9XA 3SGLA 2AJTA 2B4RO 3KSBC 3EQ8A 1XOIA 2I34A 5FWDA 4LC0A 4ECEA 2QOEA 3IOCA 3OX4A 4BXOA 2B8NA 2CYCA 3MIZA 4KN8A 3IUBA 2TSYB 5FA6A 3KBBA 1ZJWA 1NI5A 3IJRA 3W5BA 3FSRA 1OH7A 3NT5A 2XZDA 3WYFA 3ZDQA 1JPNA 1JQKA 2L82A 3TECE 4TYQA 1N0VC 5ISMA 2EBUA 1JWBB 3CH7A 5EZYB 4GQAA 3H1FA 1VPVA 4J0CA 2NU8B 2RIPA 5AW5A 4TQGA 4F6RB 1A27A 4K28A 2DQ4A 2HSWA 4P0PB 1TZBA 1DG3A 3AL3A 3PVZA 2Q3JA 1GG2A 4TTPA 2OR3A 5AW9A 2FU5C 4G85A 1O6CA 3W7AA 3WNCA 2D2VA 1JECA 2EIHA 1E9EA 3ML1A 4Y9RA 3LBAA 3NB0A 4L72A 3W2EA 4BAZA 4Z86A 3BN3A 3ESXA 2HIHA 1R7RA 3LXRA 1QSGA 2EX1A 3JQFA 3VHLB 1D4OA 2GD6A 3EIOA 3EXHC 3L6CA 3GEGA 5CBPA 1ZHOA 1LB1B 3OECA 3WLMA 1CJVC 4CIDA 4R9NA 4LNHA 1YFKA 4HB4A 1KEPA 2CL0X 4NFHA 4Y2HA 1O58A 4YAEA 1DRKA 1GKUB 3E9ZA 2QIPA 2R84A 2ZEJA 3T6KA 2CK3A 3ZI4A 4CHGA 1PFWA 2QTNA 1XZGA 1A1VA 3GXOA 1XZIA 5JH7A 1UXJA 3E7XA 3HYNA 2JIZD 2O06A 2CCJA 2LDXA 4FJ1A 4TN1A 4BNDB 5J4KA 1YJXA 4EBBA 4A15A 2C98A 2BH9A 1X19A 3RYCA 2YUIA 2JFXA 2JLQA 1DKLA 2GETA 1XMOB 1OQAA 4RK5A 3IAHA 3NBUA 3TLGA 1P0CA 1XQWA 1EP2B 4B3BA 1DPGA 3KKLA 1YDWA 4Q4DA 3O4JA 1YTUA 1CEQA 1NHWA 3KR1A 1TJPB 1C3XA 2RGCA 2HTFA 2V4UA 4ZOEA 3LA6A 5K0EA 4FBLA 3TCKA 1F12A 4LXYA 1SUBA 3GI1A 4Y6RA 3FB1A 2OKGA 5M29A 2AI1A 2BFPA 4PXAA 4MVJF 4S1PA 4M1EA 3LFTA 3FDIA 1BX1A 1TYDE 4TYMA 1QORA 2A4MA 1Q20A 3KZVA 2ZJ0A 1DKOA 5I7SA 4DGSA 4OQXA 3FDJA 2GKGA 5IJAA 2GNAA 2V96A 1XALA 1CJMA 3VJKA 4O63O 4X8OA 2NTVA 2ZSBA 3D4OA 3N3AC 4FE7A 1TUIA 1XSEA 2X9NA 3RS4A 2PUJA 2YXNA 1QFYA 5TPZD 3U3OA 4DLZA 1QPBA 2SNIE 1NUTA 2ZUBA 2O23A 3C7CB 3V6LA 2J9FA 1UUFA 4IZHA 4L6IA 1I36A 1M8KA 4IX9A 4L9WA 4P82A 4Q18A 3UYLA 4JJZA 1CZOA 4EFLA 3KEQA 2AMFA 2IYOA 2NP7A 3Q85A 1N6IA 3BA1A 2BI7A 3V8RA 1AMUA 5ULLA 3GMSA 2C5LA 2FZ5A 4CE6A 3WK8A 3CURA 1YQEA 4F84A 1V9CA 2W2LD 4I1VA 4A0RA 2NP6A 3UN1A 5AVOA 2CZQA 5ALDA 4M1TA 4HWOA 4XFDA 3FR7A 4PIVA 2RHLA 5TX7A 1A96A 1IHUA 1LLFA 1TKRA 1UBNA 2BM1A 2WZBA 4OB6A 4D8VA 2I7CA 1FP2A 1GO2A 2HB6A 1G5FA 2IBMA 5JYAA 3BC1A 3L77A 4G5QA 1NVGA 3DL7A 3PHLA 1GUZA 4IS3A 4W5JA 2HU5A 3ZZ1A 3FUTA 4WRRA 2BFCA 2CXPA 2J3DA 5FOWA 3OC6A 4CGYA 3E9YA 5AI6A 1DEXA 1G60A 4MQ4A 5IM4F 1UZMA 2P0AA 5LQUA 2I3AA 1MMFB 4XXHA 3GBVA 2WPDA 3KB1A 4J2OA 4JP2A 4XCXA 5L7TA 3UMBA 3EZGA 3ZZMA 1YS7A 1KJ8A 2B1RA 2V6IA 3IE2A 4EENA 1PWEA 3N87A 3IP1A 1KKMA 1L5YA 2NXCA 2EARA 3DMRA 4NS1A 3CRVA 3C3JA 3ZCXA 2DWCA 2NXNA 1NVFA 4WK6A 3HH8A 3RYFA 1P5HA 2GLXA 4YP6A 2BAGA 2UZ1A 1IK4A 1TAUA 2GM3A 1SXQA 4DQVA 2EBHX 1RM5A 2O2ZA 3IAM6 4B76A 5DM70 1F38A 3RRBA 2O3RA 3IQIX 2XQJA 3H42B 3H8WA 3VRHA 4U8GA 1O96B 1FX0A 2Z09A 3NLLA 2DPHA 3ZW8A 4BQOA 1A9ZA 4FFBB 3FVRA 3VC3A 3QVGA 3KPYA 2V7BA 2OQIA 3K7EA 3AUUA 4QEZA 4F04A 4YMHA 1X8XA 1Z2AA 1SC4A 1IEWA 2WKQA 5BSHA 3WL7A 3PPIA 1RLJA 5BOVA 1QVAA 1SXJD 3AM4A 1PV2A 1R2QA 1KWKA 4JLJA 1E1KA 4M1SA 1BW9A 2OO3A 4DIKA 4QNRA 4K0KB 5DI3B 3RT1A 3N2LA 4UVGA 5L3SB 5J2TA 3S40A 3O8NA 4GMKA 5LB4A 4JLSA 2WSLA 3IRVA 5HE9A 4HI0E 3EG5A 4DGQA 3DMDA 2FN9A 4G0ZA 4GLBA 5HMMA 3SS7X 3AUTA 4OXQA 4H1HA 3TFOA 4CKCB 5BQPA 3ONDA 3EGCA 3HCDA 4J7XA 1D2MA 4Q1AA 3CVOA 3IDQA 1DKUA 4AK9A 2O1SA 4WBSA 3DYBA 4LOHA 1A9YA 4N8DA 1SCJA 3EFEA 4EHBA 4F3KA 2BR5A 4G37A 3TPCA 4E13A 1Z4KA 3P52A 1P2GA 5FORA 1TA9A 2BFEB 4L15A 4KAXA 3TI7A 3VKUA 2XUHA 2F9FA 3NS7A 5DZSA 2B5OA 2Y1WA 5LBUA 4DHEA 2H2AA 3IEVA 4NCKA 6ADHA 3WRYA 2I91A 2XRZA 5IAKA 2AFHB 4KKXB 1MIOA 2VAMA 3QEMA 4RMJA 2ZJ8A 4DR2B 2XMQA 1WZUA 3H9CA 4NAVA 2W8BB 2BV3A 2IA5A 1P19A 4WCFA 2C3YA 1UADA 3WGZA 2XMCA 3FNGA 5HCNA 5CB4B 4AI6A 2NU9B 3UXMA 2Q46A 4RCVA 4BMVA 2H7CA 3MQFA 4KO1S 3OZUA 1V1RB 2O14A 2EJVA 5CHYA 3X1WA 1E20A 5JZ9A 1HDGO 3VR5D 3AKDA 5AW8A 4DSZA 3HA3A 1CUDA 1GPLA 2D1TA 1MEEA 2XYRA 2OHOA 2V9CA 2XYPA 4KLZA 1T0PA 1I7MB 1UJ6A 2W58A 5E6SA 5G2OA 1PI3A 2HIGA 4BIIA 1SIBE 4OHPA 4X00A 3I52A 4DV0B 3TOCA 2GMWA 4KQEA 4ZHQB 3C8DA 2Z4SA 4JP1A 3VR4A 4MVJG 5K8CA 5BY2A 3FGNA 1DU4A 4XWYA 3V8VA 4IY1A 3T7CA 3SVTA 1J1ZA 4QG7A 3NM6B 1J0XO 1U9CA 1J2TA 2AFRA 4QDUA 3VU0A 1DAOA 2FWIA 2Y1FA 3QE4A 4ONEA 4HN4B 3HA5A 4IF4A 4TV8F 4WI1A 3AYXB 1Z7EA 1TDJA 3R7FA 3HBNA 4KMOA 3GHYA 3AV3A 4OYRA 4F9FA 2B35A 3CG0A 2LXNA 2K5UA 3PF9A 5E2BA 2PKCA 2XMBA 5AKJA 4CKZA 4PBTA 1GYQA 2G82A 3M4ZA 4F06A 2V3VA 2C4WA 5HK8A 2ZUVA 3VR6H 4H4DA 3KXIA 2FF7A 3THOA 2JHFA 1HEUA 4IAOA 2LVBA 3W8FA 3U16A 1X74A 2VBFA 5LL6P 1IUOA 1QV6A 4D6YA 2OM2A 2FRDA 5K20A 2VBCA 1XRRA 4FBGA 5IBPA 1UBCA 4QUHA 3OT5A 3HN6A 2JA1A 1RWBA 3AJAA 3CR3C 1M2JA 1T35A 4IHJB 3WBFA 2PKEA 1NJFA 1RLTA 2UXBB 3KVOA 3TBKA 4K6CA 4M9CA 2VZEA 5JYFA 3AQIA 3H11A 3ROKA 1K7EB 1BMTA 3DMTA 2A5JA 2FW9A 4MW2A 4O08A 4RD6A 1VHTA 2F1KA 2ECQA 4PX5A 4EZEA 3WMEA 4RVOA 2L2QA 3D3KA 5ICCA 3W5AA 3GPDG 3UYKA 1FJ2A 3HUFA 4O4LF 4A36A 3F4LA 3RS7A 3ST7A 5HJEA 3JWPA 1DKQA 3G2LA 4LJ9A 2GXAA 1I6WA 3WTCA 1VKRA 4PYIA 1NPDA 3TW8A 5CDFE 1N2OA 2RGWA 3CPJB 3DBVO 5ED4A 1JENB 5BWNA 4HH4A 3A11A 1QO7A 3IP8A 3P4XA 4JSTA 4LHYA 4UOQA 3VDNB 3WIOA 4CUJA 2WJ6A 4UJ3A 1GAQA 5F76A 3I1IA 3S3TA 2JARA 4AKIA 2NO0A 1FUKA 2CVHA 3DEYX 2MMCA 2Z2YA 2NUPB 4IV5A 3M83A 4QRDA 4N0QA 3WLLA 5I9TA 4B6EA 1ISGA 3EQ7A 1D5WA 4KE6A 1EXMA 4EP1A 2H3EA 1T5OA 2EP8A 3OIGA 2O0MA 3OJEA 5HKBA 4J0IA 4QC2A 4DDHA 2R1VB 4F97A 4DDVA 8ABPA 3AO0B 4WJZA 4JI2B 3IPAA 1C3LA 3K30A 1BHJA 2H7XA 1ZZEA 1QFJA 3KOUA 2D54A 4YREA 3HFGA 2C0QA 3OTHA 5JIBA 4P84A 1GAJA 3EPJA 3M89A 4PQFA 5HIMA 2F4VB 1BSVA 3G2PA 1IY1A 4FZ3A 3JWIA 4P8RA 1NXVA 1SXIA 2X42A 3CA8A 4V2IA 1AC5A 5KNBD 5FKJA 4RQAA 2XHEA 4WLUA 4JCCA 1UK8A 3ITNA 3PDJA 3RWMB 4BVLA 5F23A 3ZHOA 3C8MA 2O8DB 1CKEA 3H4TA 3RVJA 4IJQA 3E53A 6AT1A 1NASA 3LJKA 2GEKA 1XD2A 4RJIA 1U65A 1KOFA 3OPYI 3PGA1 4L27A 4QU9A 5A5VA 1FRQA 1EDOA 2XNDD 4HQRA 1RAHA 3T1TA 3HUDA 4JH0A 1PFYA 2XDQB 1OB5A 2ALJA 1R0SA 2A59A 2YN2A 1G21A 1X9GA 1YA6A 1S3GA 3FLMA 1FTQA 1M0SA 3M6MD 3N3BC 3OD5A 3OWHA 4M54A 521PA 4C21A 2AF4C 1KEWA 3C3AA 3IWCB 1ST3A 1MUUA 2QD1A 1YQGA 2D1FA 3LIPA 5JEDA 4KUGA 3AFOA 1SQ0A 2O6HA 2OK7A 3PKIA 5F51A 1T3TA 4PX9A 1BD3A 3TI9A 1N2ZA 3DQQA 3RQSA 3NGMA 2QQ0A 5BN3A 5JCXA 2Q6KA 2FWNA 3Q3HA 3VZPA 4RMGA 4TKLA 5J2UF 1MXFA 1XFAA 3KL2A 3TUTA 1KVSA 2QQFA 2LR0A 1GCOA 4HADA 1NIPA 3H1TA 3BHJA 4H6WA 4LY6A 4NYMR 3X1DA 4B8WA 3RF6A 4C5BA 4CMIB 1USWA 4COKA 3DFZA 4ARVA 1A5ZA 2IE8A 3EXG1 3I42A 3P1JA 1TT5B 4LPKA 4OJYA 2OYCA 3DXYA 2GRUA 1HE5A 3EIWA 3RAPR 3TTXA 2I2BA 2LUOA 4Y6SA 4FYHA 5H81A 1E1RA 5I51A 2CXXA 4PNEA 4JI3B 3LHIA 5CVTA 1XZ8A 3KOYA 2AX3A 2DKOA 4YQZA 1GR1A 2NTNA 3DFUA 5EC8A 2IHVA 3NHAA 4IDOA 5IH3A 2D74A 3EEYA 3TL3A 1WE2A 3K9FC 3AJ8A 4I50A 1KYYA 5CTAA 3FBTA 2WA2A 3PL5A 5ER6A 3WQQA 3ECCA 1Z28A 1TEZA 4N65A 4B74A 3TCNA 5LJIA 2X4IA 1CNFA 2ZIXB 1IFXA 3JZAA 3VI4B 1GZHB 3E7FA 1ENYA 3LX4A 3DEAA 3A6EA 4H6PA 5JC8A 4E15A 4GIBA 4EW1A 4IIEA 3ZHTA 2DBVO 1AOXA 1JWAB 3CNQS 5BQ5A 3TSOA 3UGTA 3AV0B 3BK1A 3RUAA 1VG8A 1G7RA 1KI9A 1LRKA 2I3BA 2JD0A 3OKAA 3RBZA 4Y9SA 1PDVA 2WIAA 4B81A 5E1BA 3TIGA 1AH2A 3MUOA 2Z2KA 3MAAC 1ZICA 3AHJA 3ORQA 4YNBA 3PQ7A 4QPNA 2O6LA 1Z4NA 3LV8A 1YQ9A 3QOXA 2YW9A 1FMTA 1V37A 4OQFA 3UA3A 2IL1A 4LTMA 3VI3B 4AY5A 5LDHA 2ZS9A 3TBHA 1DRVA 1QO9A 1V45E 2ZVDA 3UG6A 3L0ZA 4CEHB 4YRTA 3SM3A 2DR2A 5IK2D 2R7MA 4NICA 2PFKA 3DBHB 4HDOB 2R8XA 2C1EA 3HUUA 4EGSA 3EP8B 2FPSA 2I6FA 2NO9A 2JGMA 4HQKA 3DULA 3ZWMA 3WL4A 2CLKB 3KKEA 2Y2UA 3ZWBA 3LK7A 3MWJA 1VM6A 1TK2A 2EQBA 2FV8A 2WTBA 4J2HA 4JJ6A 5EJ4A 3OTQA 3O8QB 4AY4A 1Y80A 2SKCA 3IBFA 2YMPA 5ICSA 5KTPA 4K26A 2XWPA 3S0JA 5MFPA 3STXA 1LW7A 3MWFA 5DO9A 4AB1A 3KIPA 5K8IA 1I6LA 1OLSB 3O9ZA 2DUNA 5CLGA 4B3DA 4UAGA 5CBKA 2JIQA 1RC8A 5KJ1A 5JG7A 2CN1A 4CMEC 2W4IA 2IZ7A 1DBRA 2X0RA 5PGMA 4B47A 3O03A 2CY0A 3I0MA 1RHRA 4MS3A 4EPVA 3EN0A 4C7VA 2COUA 1VJ0A 5KVVA 1TTPB 2DPXA 4FMPA 4K6OA 1OOEA 3RVLA 4OYYA 1X77A 1U5BA 2J0SA 2OXEA 2HU8A 4PICA 1J07A 1KP2A 3ZVMA 4FCWA 3I61A 2O8BA 4QDJA 2FE4A 3IVRA 3VC2A 3M1AA 5CNIA 4YRKA 1U5AA 3T41A 1SK8A 1SC9A 2ODBA 2BP7B 1EWRA 1BN6A 4IWNA 5CAEB 4BEWA 4EATA 2ZSAA 4K1LA 4IRUB 4UHKA 4MVJE 4KO4S 3ZHVA 4P08A 3TB6A 5ESRA 3QOFA 4F5YA 3C97A 3FOCA 3U6BA 4DCTA 3NUGA 2KLBA 1JBKA 1Y1LA 1JHOA 3BXXA 3RSGA 3GHHA 4YJ3A 4BB6A 4EMUA 1FVHA 2DEUA 1NLYA 1W4AA 2OHVA 4PPQA 3SR3A 3T7IA 2IP1A 5KOHA 5MGNA 1LDYA 1RE1A 2DQYA 4LE0A 1G55A 3DR5A 4HDMB 4OOFA 3O74A 3S2YA 2FQWA 4PPFA 4KH1A 2JFQA 3KLBA 4PRZA 1WAMA 1TCCA 2DSNA 2XNDA 1QNLA 3OMXA 5DWVA 4YX9A 8AT1A 5FCDA 3E9EA 1RRKA 3EP5B 4KWEA 5C1OA 4OSEA 2AJLI 4S1NA 3KFLA 1XVTA 3SZRA 4K8RB 4TL9A 4GBJA 3PI6A 2K7FA 3MGCA 2IOYA 1WY5A 1DC4A 1AQUA 2Y93A 1QGAA 3AR7A 4CV0A 5L51A 2XW6A 1I4DD 2JFGA 5FAKA 2DHRA 2FSSA 1XQVA 2Q8NA 1OZAA 1GA1A 2JH8A 1J7JA 3FMGA 4QHTA 1XWWA 1LX7A 4QFBA 1RI4A 1UPCA 3WWEA 3NDPA 2RHWA 5I9MA 1AXGA 4OAQA 1KJWA 1LSSA 1N2HA 1PJ3A 2DX7A 4O4LA 4HYQA 1GNSA 3EGXA 3A1WA 3K35A 3ETDA 4NBSA 4EKGA 4JC0A 2HCJB 4F71A 4LRYA 3EZYA 4ARCA 5JJIA 1W30A 1B2RA 1YVEI 3RSOA 4MGZR 2FCRA 1EQ2A 2QMUA 5AKKA 4RKYA 3ZNOA 5BWLA 4F38A 3WQSB 4XD2A 1W9HA 3O73A 4JT2A 1BWSA 1D5CA 1QQ6A 2OG2A 5ECGC 4ZT4A 1T5IA 4O0LA 2GDJA 1NQOA 2DOKA 1W59A 2B0CA 4GICA 3V1UA 1B23P 3O0DA 1DSSG 3AEUB 1M72A 3JZDA 5ALUA 3Q1LA 2RKOA 3U17A 3MN1A 5GOTA 3JQDA 4N47A 4PFKA 1FDVA 2C59A 3VV2A 1CRPA 3CIOA 1XA4A 1E59A 1PUXA 1L1RA 1ZJYA 1WRBA 4URYR 2QQ5A 3CF6R 3SDZA 3H9UA 4YROA 5IJXA 3NTOA 2O7VA 1AK2A 2ZI9A 4L76A 3JAWA 2R2AA 1VSUA 2N46A 2J09A 4HRXA 2V7QD 3IHWA 2PGIA 3GAAA 1TCBA 2PSEA 1KMHB 1SOUA 4RWEA 4MQ5A 1PR2A 4AYXA 1TZCA 3T4EA 3Q2OA 2PPLA 1CQJA 3ER6A 4LN1A 5L45A 3B60A 3ZJTA 1I01A 3KE8A 4R8MA 1XI2A 1PGNA 1YL6A 1Q0ZA 2C0PA 2PSFA 4GBGA 4MVJI 4YAFA 4KQ2A 4A6DA 3EYAA 3DAPA 1L5ZA 4I81A 1U8FO 1KI1A 1BX0A 3C6KA 3RT7A 3ZE8A 4D4IA 1O1YA 1QKJA 3LFUA 3OZEA 1NWCA 2ID4A 2FW1A 3COSA 2IYSA 3L84A 1WX1A 2BWJA 4FMDF 3O84A 4LY3A 4EL5A 4DR1B 3NANA 3CZMA 4FJ2A 4RPHA 1KSFX 1CUBA 3QA3E 3DNPA 3L7MA 1OW3B 1QMIA 5BW4A 1DBWA 1RPZA 1UK7A 1VSVA 4LYDA 2UAGA 3DC7A 4HAOA 1ECBA 4KE9A 4YMWA 2JLXA 4CT5A 2BCGY 3OQJA 4HDNB 2GN2A 4EPXA 2QYTA 3AOGA 4O29A 1QE5A 3HY4A 3QKSA 4OEHA 1HDEA 3TV1A 4RADA 2J46A 3KD2A 3ICWA 1VPWA 3H9QA 1FVFA 2FWAA 3KTDA 4EMSA 2VHQA 5SV2A 4IO0A 1A1SA 5TQ2B 4BE4A 3K0KA 4B9AA 4RESA 1G5QA 2Z30A 4DVGA 3RK4A 1BO6A 1U0GA 4ENQA 1ZK0A 1P7VA 4BGEA 2YMMA 2Q4TA 4IIXA 3UMCA 1QGZA 4ZYZA 1DQZA 3RIEA 5EMMA 2PT7A 1UOQA 1GNTA 3GEPA 3K0BA 1YDGA 5GV7A 5HFJA 2XB4A 4KIGA 1B8VA 4GX0A 4YI3A 2UZ3A 1B16A 3MHPA 3THRA 3HNOA 3DGFC 2W42A 1LV7A 2HF8A 4G36A 1RTTA 4KAJA 5JAHA 1SHTX 2YY5A 3KAQA 3UK2A 4CF6A 2Z8XA 1N6NA 3ZHYA 4IEEA 4NMLA 1QIGA 1VP3A 4C7OB 5L9AA 3K1AB 1P5ZB 2ZI3A 1K9VF 3HKEB 2VZ0A 5HF6A 5T4BA 1YDFA 1H9AA 1XD8A 3OHSX 2I1WA 4E88A 5K4HA 2UUAB 1QU2A 2BFBB 2W2MA 3QOWA 1B26A 1YH3A 5AM5A 3QXHA 3VSAA 4BUZA 5CLJA 1I3NA 1D6MA 1MPTA 3ND7A 1XQ1A 1K7FB 3CYFA 1KQFA 3K2QA 1L5SA 2PGOA 4AMZA 3RFTA 1Z06A 3U9SA 3FGOA 2GSWA 1P5JA 2EWWA 4GRIA 2G07A 3R9XA 3BB4A 3VKWA 4Y3UA 2C7BA 1Z4QA 2R79A 5K1ZA 2DJ5A 3H7IA 4MX8A 4NEGA 2HLHA 1K4YA 2QRGA 3KDSE 4AQ7A 5H59A 2IEDA 1SUAA 5KUTA 5IXSA 1T4MA 4NENA 3R3ZA 1ZN9A 2HAEA 4C0WA 4UTVA 3WGIA 4NPHA 4B1FA 5TDHA 1YMQA 1RQGA 4V03A 5K3AA 3R5XA 4ILEA 1PNOA 3WGLA 3QK7A 3B3JA 5FOTA 4FC6A 3TTWA 3TKYA 1B8PA 2AXEA 1NA5A 1G7CA 2RGUA 4HF7A 3KL4A 1HTWA 1HQKA 3NCHA 3LVRE 4I9HA 4RKRA 5KSOA 1QP8A 3X1YA 3GLFA 2O59A 2NO4A 1AF4A 3QWBA 4P0TA 5DU2A 3ORYA 1RRGA 2BJVA 3CRMA 3EZ9A 2XDWA 1KQGA 4M8LA 3KKQA 3LO8A 1P1KA 3P9IA 2PSJA 4U2KA 3DWGA 3UK0A 4UQPA 4DRXB 3ZGZA 2IYEA 1T13A 1OAOA 2H52A 4G1CA 2BONA 4RKEA 4X1OA 3R7AA 2EKQA 3QLUC 1W94A 1XAGA 3PUZA 2H4JA 2WE7A 1L7PA 3M6UA 3R7SA 3H2BA 5HRCA 5LPNA 5H80A 2YRXA 1LTQA 1VLVA 1A4XA 1CR1A 1CQWA 1JYEA 1MG5A 1YIOA 2YFHA 4OUDA 4CIYA 2PL5A 3KKOA 1U6IA 4UEKA 1ECFA 2ZE7A 3JPWA 4UZSA 2IH5A 4GO1A 3FLBA 3MF4A 1IZ0A 1OWLA 1LKZA 2OZLB 3FFXA 1XMXA 4NCAA 1QH8A 3IJ5A 1ZOIA 4KFSA 4L8LA 4ESOA 4PC1A 1ZUNB 3N2NA 4MQMA 2WAAA 3B1VA 3QBTA 3JVUA 4RYLA 3NETA 2IW1A 3FWYA 5DBGA 1ZC3A 2O5VA 5JVDF 3CVVA 1EHIA 3ULKA 2ZREA 2W2LA 2BBOA 1KWGA 1GL3A 1T1IA 1JW9B 2ZS8A 5FUYA 5KKAA 5AM1A 2O52A 4BQPA 2ZYAA 1BDBA 1IY9A 2AOVA 2H0QA 4A5OA 1TA4A 3AUYA 3HWSA 3IAM1 1JHXA 1KYWA 2OBMA 5KYUA 2ZT7A 3F3YA 4IIYA 5GONA 5KU1A 2CFTA 3OKFA 2IP2A 4EKDA 5JJCA 2QEQA 4MUGA 1YULA 5IJ0A 3PNSA 1QP7A 3NHRA 5JJBA 5COAA 3THSA 1WF3A 2G5GX 4XGRA 5KYKA 3E9MA 2A0YA 2OD7A 5CDFA 1F9EA 1P29A 3QIAA 1AKEA 4YT2A 4X60A 5FF9A 4BRWA 4N7RA 1IU9A 1NN0A 3PEEA 5L3VA 2IZOA 3GYGA 2PT6A 3K6SA 3WBJA 2DZDA 2Q22A 2IY9A 2ZSDA 3CMMA 3HZOA 1QKIA 2JVIA 3R3WA 1NI3A 1NN1A 4NAUA 4D0SA 1WDTA 4IIUA 2IYVA 9ABPA 3R5SA 5SZJA 4TLEA 2ASVA 2P2SA 1XTVA 4G23A 1UPUA 4F7DA 2AMJA 4H59A 4O3MA 3BQMB 2JI6A 2PZMA 3VYWA 3Q3VA 3K70B 3JD2A 4L3OA 4N6GA 4R1UA 4QEKA 4I1PA 3RODA 2JANA 2BTEA 1G9XA 1QHHB 2HBQA 3ADPA 3B3FA 4Z4EA 2KM1A 2P68A 5B1HA 4O5AA 2Q4RA 1Q2XA 1D04A 4X61A 3RIHA 5GGYA 4NU6A 5JD3A 1M9NA 1AF7A 1JIVA 2QVZX 2RG1A 3G17A 4RJLA 3VOTA 5L53A 5AQ1A 4P3KA 3V7UA 4GRAA 4G1VA 4B7AA 3ACCA 5C32A 1DBQA 2G09A 2WM2A 3Q4GA 4JA2A 3V33A 1JUDA 1IVSA 4F2WA 4I5IA 4DAEA 1DIAA 2PUCA 4DV6B 4BZQA 2X8BA 2B37A 3A1FA 5D3KA 1WW3A 1SVKA 5DCYA 2VJCA 1R9JA 3T7JA 1XT6A 2QUIA 3HSYA 3UAXA 5CFLA 1U94A 3M82A 1L5MA 4NE2A 1BDJA 4BMZA 3TK1A 3KZMA 3LQQA 3ANTA 5JSZA 4U7DA 1ODFA 1YO6A 1BQ3A 4B6RA 4Q93A 5I7OA 1OLUB 1V25A 2WAOA 2Y6VA 4KOEC 2VNHA 4ERXA 2PUBA 4HQFA 5AKIA 3W2FA 4DMKA 1KR2A 2C00A 2PU7A 2QUHA 5BYAA 1JA1A 1L9KA 3VYRB 3GJ6A 3UH0A 4IQ0A 4HGYA 3TQOA 4BIMA 5HPYB 3V6MA 4AMBA 1W4BA 2VQ6A 1FTGA 5D7NA 3ADCA 2DYKA 3B1KA 3C0KA 3OFND 4JA0A 2YV1A 4CQLB 1NULA 2EYUA 3IQZA 4R1QA 3UWPA 5BN4A 2J7PA 3QU4A 3NC1C 5I5EA 5A9SA 5JSUA 4PC6A 3VV3A 4D26A 3UM9A 3TQCA 4UUQA 3D8RA 3BT7A 3SIXA 1GZUA 3R0ZA 1HY3A 1AGNA 1U4OA 4J9VA 1Z5UA 3ZWDA 2PS0A 4HDRB 2DUMA 1N3BA 1YFJA 2J0QA 4H9GA 3NEAA 3PXAA 1JB1A 1Q0PA 1V4VA 3H0EA 4BGUA 3FZEA 3L6RA 5BNTA 2ZCJA 1EVJA 3MBIA 2J5KA 5EVCA 5EVJA 4DA9A 1TU3A 3FVQA 1P60A 3SZGA 2R48A 3TMKA 4KX5A 4ZJUA 4BNTA 4XH9B 2ZI5A 4GQBA 5K2MA 1S0UA 2GEDA 2XSZD 3GMTA 3Q98A 4EARA 5KOJB 1GEGA 2WTUA 2CLHB 1C7EA 1BXRA 3FRIA 3P2KA 3QPCA 5F2NA 2HHLA 1FYVA 1ZGCA 2FSIA 1OUMA 3O93A 4HK4A 4UTXA 3DZIA 3PQ4A 1EP9A 3FIUA 2QTVA 3Q9LA 2X5NA 3FBGA 3OM9A 2FPWA 3HM9A 1M34E 1I0IA 1WCIB 3JZIA 2J0UA 3TSYA 3TXXA 4C5AA 5HIKA 1C3OA 1M6HA 4CIXA 4EI2A 1CY6A 1N2GA 1SOVA 4WN9A 2C4HA 1R4AA 2FK7A 2QX7A 1BG6A 1JAYA 1XZBA 3OIFA 3ADBA 3GGDA 5U1PA 2VXYA 1JJBA 2CUZA 5JS2A 1O4WA 2YRWA 4P1ZA 3W2IA 4PEVA 4R54A 3PYXA 3VOBA 5A02A 2IRWA 2QE6A 3ZXYA 5JXWA 3BRWA 2YH2A 3UPUA 3NHPA 3LWBA 4F4IA 3NKVA 2ZJOA 1H85A 3S2FA 2P9GA 3HU3A 2VQ3A 1R5BA 3D31A 4GWGA 3K4PA 2PWZA 4I5FA 5TLSA 3P2JA 3KQHA 2AFIE 2VH1A 2GBLA 2ZJFA 3SBXA 3G0GA 3QE0A 1PQUA 3KGDA 2WF9A 2PBLA 5GJCA 4W1SA 1MO2A 3O8CA 3MLBA 2FJ0A 4XDGA 4ETNA 4WKCA 1WULS 1TVKA 5EE3A 4N0EA 5DW0A 3IFSA 1YJQA 2BM9A 4FGSA 3DB1A 4RD4A 2CWDA 1WXDA 4RH0A 4MHOA 3T7AA 3N5CA 4ZK2A 4M46A 3NBKA 2ZYTX 3WSWA 2WYOA 3C3EA 4X8MA 1M0WA 4MHSA 3NHKA 1SHJA 2GZ1A 1PUJA 4NU0A 4JKIA 2LZ0A 5TS2A 3HFSA 2QR3A 1HBJA 1ZQ9A 3HB1A 3TQTA 4WADA 3VR3A 4L4YA 5DBIA 4QPCA 5IAOA 3TBFA 3CRZA 2OBLA 3A6JA 3LUJA 2JATA 5TE9A 5M04A 4IIVA 3SC2A 5EXTA 4C0QC 3SJZA 1U3GA 5ELXA 4BLPA 3EEBA 2QSZA 4O4IB 1T0UA 5JMOA 3E5MA 3MQ4A 4DNPA 1RWPA 4HDQB 4JR2A 4DARA 3E8SA 3ROGA 1G20E 3UJ8A 3RRFA 4LGMA 2WW8A 1XLWA 4MS1A 3LUPA 4CEIA 3B5IA 1SOWA 2PZAA 3EULA 2CW5A 3GFRA 2CVFA 2AQIA 2ENUA 2JCBA 2RHRA 4UEQA 5DGTA 3F6SA 4GU5A 5I4BA 3Q10A 3HCOA 4ZCMA 3HB9A 2ACWA 3JQ9C 4KSBA 4EBFA 1TUBB 3BXZA 4M0DA 3SLGA 2CBXA 1VIYA 2A0FA 4U7PB 4MV6A 1E1CB 2FUCA 2P1DA 5CR9A 1N36B 3H2IA 1XNRB 4NRDA 1HURA 3I1JA 4CL8A 2BGTA 3V32A 4WZBA 2X7XA 5F52A 3WSVA 4EA6A 1TRHA 3DCJA 4OFZA 5E7MA 1VCNA 1FRVA 1O5OA 3TFWA 5LNK6 4AY6A 2F8SA 3HKBB 3G0OA 2GPTA 1MRNA 1Z33A 2QTTA 3QWFA 4IXTA 4QPJC 3QVWA 4POAA 2MDTA 5KWIA 1AGRA 1ISRA 3IKTA 1BCRB 4KK3A 1QGED 1W46A 5UKDA 4YRIA 3CBQA 2YTZA 3HABA 4ZDIA 4AZSA 2WZDA 4LNUB 4W9NA 3HCBA 4CZ2A 4CKWA 1XDBA 1EJBA 2CJPA 4MLDA 1Z3CA 2D1RA 1X80B 4P3YA 4RA9B 4JODA 4UFOA 4ZRNA 1U0TA 5FADA 4L75A 5TY0A 4BKOA 5IUJC 3L92A 1XVUA 1WSDA 1WU7A 3C41J 3OJFA 3WGQA 1A50B 3JTMA 3ZDFA 3OPVA 4W5WA 3WL3A 1JEQB 1E79A 1HTBA 1QCZA 3AP3A 1GZSA 2AZMA 2LBPA 3OCVA 2V59A 4RV9A 2Q2VA 4M1KA 3ZVLA 1DAKA 2QL5A 5ALLA 4V24A 4US2R 1CVIA 1K6EA 3P94A 5BV0A 3G2NA 1E63A 4CKEB 3OJLA 4NBLA 3UWSA 3WISA 3KR2A 3C6QA 4KWIA 1BX3A 5CW1A 1MTZA 2JFOA 3H18A 2G9UA 1I3CA 3EBLA 4E1BA 1P80A 4E5MA 2X22A 3BRSA 5DSZA 4QICA 2IS1A 1O0SA 4IH4A 1XAIA 3JV7A <