4MLSA

Crystal structure of the spytag and spycatcher-deltan1 complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
81
structure length
81
Chain Sequence
b'SATHIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPGKYTFVETAAPDGYEVATAITFTVNEQGQVTVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibronectin binding protein
molecule tags Peptide binding protein
source organism Streptococcus pyogenes
publication title Structural Analysis and Optimization of the Covalent Association between SpyCatcher and a Peptide Tag.
pubmed doi rcsb
total genus 9
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17802 SpaA Prealbumin-like fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mlsA00
4JG0H 5E8OA 5MI0C 2Q7YA 4YHPB 3BQUA 5J1AA 2R0ZH 1WAAE 4RNRA 4JRXE 5D7KE 4ZUTA 1R6VA 4NUGL 4K9EC 3V6OE 3KVQA 4MJ2A 2R8SL 3BPOB 5AWNH 1UWGL 3WNNA 3CUPB 5FXCH 1T0MA 1BFVL 2A73B 3HI5L 4Y4KD 3BEVB 4Z7OE 4Z7UB 2EYRB 4ONGL 4GKZA 1J8HA 3C5ZD 3EYOA 4Y4HB 2PCPA 3TBWA 3JWDL 3CVHB 3IFLH 3CDGB 4XAKD 4PJFE 4PB0H 1ZT1A 1F97A 1YYLL 4Y4FC 4HUWA 2VABB 5CJ5A 3NH7H 3HS0B 3OKLA 3HCVA 2AI0H 1T1XA 3HI1B 4QRPA 1MRCL 4M5ZL 3A6CL 1A7QH 4MNHA 1TTFA 5FO7A 4JJHA 5DMKB 1K4CA 3B2VL 3RWCA 1UYWH 4U1IB 2ZCHL 4XVTL 2V5MA 1I8MB 4JCLA 3NFNA 5ETUA 4EN3B 3FFCD 3O41A 5EOTB 2ITCB 4FQCH 3AFLA 2JELH 4C4KT 3BMVA 3VD9A 3O8XD 5B21A 1VHPA 3QG7L 4JFOB 4IRSB 5JHDE 4F37F 3S5LA 5D5ME 2ESVA 1IILE 2AJVL 3DURB 4TRPL 5I6XB 3VXPA 4KK8C 4OD3L 5K9KB 1HWHB 1OL0A 4LSQH 5IFJA 1MFAH 1FE8H 3QUZA 4NQVA 4KI5C 5ERWB 4D0DA 1KN2H 4NOFA 3NCJH 1MY5A 3SDDB 2DI9A 3MLPA 3MBXL 1N3NA 2APBA 5FUOL 2X44D 4M3KB 1OAUH 4BFEA 5T5FL 4PRBB 1JZ3A 2EICA 2Z4QA 1G9NH 1JGUL 5MEOB 4FG6C 4AG4L 3QQ3A 3KPQA 5DK0B 1INDL 1CE1L 3IFOB 3MLVH 2I60L 4DN3L 1KCVH 1OB1A 3O2DL 2OZ4A 1GHFH 5L8LB 4HWEH 2QBWA 1DDHA 1NBZB 1OP3K 3TO4B 1AGDA 4JM2C 4K23H 1TJIH 3RVXD 2NY4D 3LIZH 2NTFB 5LBSL 1VADB 3F58L 4DFIA 1MELA 4B7IA 2DWDB 2X41A 5DD6A 4V1DE 4YXLH 2N56A 4XC1L 4BH7B 2P8LB 2FBOJ 4ODXA 4U0RB 4LLUB 1EPFA 3DROA 3QFDB 4JKKA 1A6TB 3VFGH 5C0CE 4AYFA 3BE1H 5E2VH 3LKSA 5D6CB 3VW3H 3FONB 3BGFC 1ULVA 5TQ0L 4WW1A 4XMLL 3OR6A 4JPVL 4U1KA 1Y6MR 1QRNB 2YXFA 1EZVX 4NPYA 2A6DB 4C54A 5LAXA 2NY6B 2IFFL 1YC7A 4OGZA 1HILA 1OVZA 1RUPH 2MQCA 3B5HA 1BD2E 3A67L 3RGVC 5C09D 4MJ5B 3UMTA 3VGAC 5EU4B 4LLMA 4MXQC 4EKXA 4Q58C 3SDXA 3PF2A 1YC8A 4JFFA 2UUDH 3A6BH 5EUOF 4UDTA 4CU8A 4KXZH 3QNXA 4GRLA 4GRMB 3W9EA 1XR8B 1NGPH 1NGQH 2QSTA 1QYGH 1JE6A 1OM3H 1NAMH 4Z6AT 5ID1A 4UT9H 1FBIL 2BSRB 5T3XH 5FF6B 4UOJA 1U8JB 1Q72H 3AS0A 4QF1B 1YEEL 3X11B 3NIGF 1XF2A 2AGJH 5HHOB 4TTDC 2BK8A 2NY3C 1J9CT 4RFOL 5DQJA 1KIPB 5SX5K 3O45A 2W07A 1AGFA 1S7XB 2XTLA 5GRXG 5JOPD 4I48B 3CFDA 4ZFOL 2VAAA 3BPLB 1PFCA 2CIIB 3AAZB 1FYHB 4Y4HC 1N8ZB 5K59F 1N5YH 2BMKA 4AQ1B 5EOQL 1HILB 1OLZA 1NUNB 2BVTA 1V7ML 3GIVB 3GZKA 4XP1H 2HJFA 4PRHD 5I30L 3IDJA 3P3YA 3TZVC 1I75A 1OAKH 3AY4A 3UPCA 4Z5RB 4TPRL 3I02A 3M07A 3B43A 4MSWA 5CINL 3T0DA 1K5NB 4YHOL 5BS0E 4M7ZB 5A2FA 4DUXA 4G8GD 2GEEA 3OX8A 1JPST 4JDTH 4TOYH 4OUUB 5TE6H 1BF2A 3QNXB 4GRLB 3W9EB 5I16A 2HN7B 1KFAH 3LMJL 4GKOA 4I8DA 4UI2A 4MAUL 1JHLL 4R9HA 3OJMB 4NQEB 3ZSSA 5J1TC 1MFCL 2QQKL 3OAYK 4IMLA 2VOTA 4ODTL 3AB0C 1UWXH 2IWGA 3LEVH 4M7KL 3PGDA 5FYJE 2NXYC 1EEYA 4G3YH 2Q86B 1JNHB 2PUQT 4GXVL 3HMWL 3KJ6L 1DP0A 3MROB 1PKQE 5HHPA 4NN5C 5IFAL 1W0YT 1CLYH 4XCFL 3ULUL 2VTFA 3VD4A 2F58H 2BSTA 5EFIA 1K85A 2XWTA 3PL6C 5H2BA 2A9NL 3HTLX 2F8VA 4YHLL 4PRIE 2VLLA 1U8NA 2B1HL 3HC3H 5IHBA 3V6BR 2NXZB 5D7IB 4YZFF 4P2OA 3JXAA 1KIQB 4M7LL 3TZVB 2FJGB 5KVGH 4OB5H 2VLKA 3O4OB 4JFYA 4Z9KB 1KEML 1EZVY 3HG1D 5FIEA 1CFQB 2V6HA 3W39A 2Y36L 4YIQA 1A8JH 3ZTJH 1X6NA 3KNBB 1VPOH 4FQHA 1T83A 2Y72A 3LDBC 3BQUB 5K93A 5J1AB 3D39B 3V52H 4L4TE 2DBJA 1D6EA 4KV5E 3L3IA 1I8KA 1Z3GH 3HMXL 4FTVA 4JM2F 1YPZA 1AGBA 3LEXA 4JPVH 2AEWA 1YNLH 4P2QA 3EOBB 5J06A 1NEZA 3QO1A 4P3CH 2IAMD 3DYPA 4CNIB 5EZIL 4C56D 5IOPB 2NNAA 3ZMRA 4QCIB 1S9XB 4I0PB 3X17A 5ISZB 5D7LB 4FS0A 4Q9CA 1U8NB 2Q3AA 4HBCH 2RCSL 3CZJA 5I8CA 2YD4A 1T0NA 4XMKH 1RJZB 4WI5A 1JWSB 4YFLI 2IBBA 1UM4H 4HUMB 5FKPA 3VMOA 1DQML 4FQHB 1AQDB 4QXGL 4LF3A 5ENWA 5IW6A 2XRAL 4QRQA 3GFUA 2I5YH 4UU9B 2A6KA 4EEEA 5DTFB 3I3DA 4GH7B 2R39A 3NCBB 1T6WA 2V5TA 5ALCH 5F97E 1HQ4B 2GK0B 1DVFA 5HHQA 2FATL 3QEHA 4L3EB 4Z7NE 1OAUL 1A0QH 2BY1A 1SVCP 1P9MC 1FFNB 5FV1L 1MCRA 1M71B 4UILL 3D85D 2NZ9D 4P5TC 4WFED 4YHYC 3ARQA 1NFDF 1KFAL 3VFMB 3EJZC 1IC5L 4F7TB 2APFA 1KG0B 3WFEL 3WSQH 2PW1B 1JRHI 5D7LE 2GJZB 3F62A 4GUPA 3D85B 5FKAB 2NR6C 1T1YA 1H3VA 2GY7B 4UINL 3QQ3B 2VH5H 4LLYB 4UQ3B 4CBPA 2V9TA 4WJ5A 3LEYH 4QRUA 4OD2B 5D1XD 2YEZB 4APQB 2B4CL 5DO2C 1LNUA 4QYOA 4X7SH 1F4XH 1JGLL 1F6FB 2FX9H 4Z0XA 1Q0YH 2FIRT 3L3OB 4QXTB 3BP5A 4KI5F 1HOCB 3LD8C 4LGPB 2WUBL 1HQ4A 1F4AA 2GK0A 1DVFB 3JWOL 4BK5A 3HI6H 4J3VA 5CD5C 2VDKH 4RAVB 4IJ3B 1FFNA 3BWUC 5HDQL 4J1UA 4PB0L 3K74B 3CVIL 4NT6A 5HGDB 5E8PA 1ZEAL 3TPUA 3ZHDA 4JO2L 4P4RB 1P6FA 1QFWH 1R3JA 5DJ0A 2XV6B 1YY8B 2Z0BA 1U42A 4X9IA 3FRPA 3HNTH 3CFEA 5DD0L 5EU7C 3QHTC 5DJ2A 3RTQB 4BH8B 5T3ZE 5KJRH 3ARBB 2OM5A 2ADGA 3JVGC 1KG0A 3CVHL 2A83A 4FQXD 1KTLA 1VKXA 3LKNB 4OGYH 3QUMB 4P4KA 2VL4A 1NC4D 1MLCA 3SKJL 5F8RC 1HE7A 3JZ7A 2Y6SC 4PJ5B 3IDNB 4NKMA 4U1GB 2O5YH 4BSWB 1AD9A 2X4UA 4Y1AA 4ONGH 5H94B 1LNUB 2ADFH 1ZANL 5GQBA 3TWCH 4PJ9C 5GRJH 4PRAB 4YZFE 5TFSH 1TIUA 2HJLB 3LQMA 4O2EB 5F88B 1A6UL 1S9WA 2NYYD 3IJSB 3WJJC 2GJ6B 4NBYB 2R4RL 4JFFB 1G84A 4XPHL 3BRDA 5I74B 3F7VA 5HPOA 5I1KH 1CICD 5TF1L 3QZWB 1RULL 2QKIA 4OLUL 4RRPA 1MFDH 5DHYB 3QPQD 2P24B 3ALWA 1XH3A 2BOCB 1S78D 4S1QL 3RVTD 3NOIA 1ZK9A 2XA8L 2A73A 5I73C 3N1QC 2AJYH 3BUTA 1KIRB 3CJJA 12E8L 5HHOA 4JFQB 1LILA 1I1AC 1DN0A 1W72H 1AH1A 3MO1A 5LJYH 1E27B 1MCPL 4G6KL 1T0MB 5CJQH 1ZLWK 4CU7A 4XCNA 3SE4C 3LN9A 5EIVA 3PGFH 4KKCC 1AGCB 3KXFD 4NQCB 4PREA 2Q3ZA 1RHHB 1KLFA 4OLYH 4Q9RL 4OLXL 1WF5A 3N9GL 4PJHF 3TYFA 4JFHD 5C8JB 4I13B 1KYOJ 5ECJE 1VA9A 3VDBA 5DJCA 3U4AA 4PLKD 3IYLW 5L6YH 3VGBA 1QNZH 5I16B 1QZ1A 3KPSD 1P2CA 3BUYA 3MYJA 3HCVB 5CD5D 2HTKC 3NACH 3F7YB 3I50H 1CFTA 4HKZA 4JB9H 5KG9B 1FNHA 1IGFH 4ORGA 3S4SG 3KPTA 4YDIL 5HJ3B 4P3CL 1YEDB 5GGUA 1FZMB 4G5ZL 1D5XB 3EO9H 5IESH 1KB5L 5DDHB 4EN3A 4X8JA 1N2RB 3ZKNC 5L0QB 1AC0A 1FFQA 5F1IA 1FP5A 1G0XA 1YPZF 3DLQR 4M8VA 4L8DB 1JMXA 4J23A 3MODL 4UT6H 1Q1JH 2ZUXA 4U3HA 1FRGH 3DPBA 2N7AA 3CLFL 4MA8L 4K3EH 5EWIL 5CFHA 2ARJA 2ICWA 3DJ9A 4BQ6A 2DLGA 5F1KC 5CUSL 2GIYA 2B8OT 3NTCL 4OCYH 5D93C 1HHGB 4DGIH 3OKMA 4FFVD 1QBMH 3PJSA 5F7KC 4QNPE 2VDKL 2XTJC 4Y2DC 4Y19B 1WBZA 5C0ND 2Q76A 4XPTH 3SDDA 4V1DB 1NMBH 3MRPB 4NO0D 2Q6WA 3HC3L 5CSBA 4U6YB 5LGJA 4KROD 5LQBH 1NLDH 4KAQH 4OD1L 4QOKD 4GJTB 5LWYH 2P48B 2VDRH 4GKSA 4O2CB 5FYJD 3BZFB 3RP1A 2VDML 3S37X 4UV4H 5GSRB 1EMTL 1QO3A 3VXNB 4F33B 3QUZC 1Z9SA 1JNLH 4XH2B 3OAZK 2HLAB 1NBZA 4MXWL 1I7ZB 3VXSA 3LB6C 5JPNB 5D1QD 5KSVB 5IOPA 4ZS7H 1WBXA 5AWNL 1MVFA 2R15A 4Y5XA 1U3JA 1YEHL 1AHWC 3CSPA 4U3CA 4MNQE 4LSSL 2UWEF 4OLZH 4F9LC 4L4TA 3K1KC 4GAGL 4Z7WE 1N6QH 3WXVH 4PJ7B 4G42B 1A6ZA 2DQDL 3KLAB 1OAXL 3D3VD 3DROB 2ZOKB 4LVEA 2X40A 3GUTA 1EV2E 3FRPG 3FB8B 4O58L 3TBVB 2GJ6D 3MBED 1IEAA 5JOEA 3ULUC 4MJIB 3HUJB 1I4FB 4Y4FA 1P7HL 4GAJH 5E8DH 5EO9B 1QHPA 4UV7L 1CG9B 1BM3L 4BZ2H 1T2JA 4YGAB 3PWPA 1HH9B 4PJ5D 5D8JL 3VXQA 5HYSG 1FPTH 5BV7H 1JGDB 1MHPH 3LRSB 1AO7A 4IOIA 3C60B 4N0UA 2HLAA 1KXVC 3QDMD 2VSDA 3MV01 5DK3A 1IT9H 4P5KA 4WTZG 5DLMH 4XB7A 2I5YL 3ARVA 2Z35A 1YEKL 1BFOA 2YUXA 5I19L 5DC4B 3LS4L 1OSPH 4YXKL 3SKMB 3X11A 1Q9LA 2OYPA 1MHCB 4R3SB 3LN4A 3E1F1 4P59H 3U30C 3QQ4A 3BQUC 4OM1H 3DMMC 3T0EE 1X44A 5CZXC 5IBLC 1X5FA 3UX9B 2FX7L 4Z77A 2WWKO 4GRWH 3VRJB 2UZYB 5DSCB 4LCWE 4TNWK 2XACC 2VE6B 4F9PC 2Z8SA 4MD0A 3E6HB 5EO9A 2Z93B 4KRPC 5IROC 4IS6B 4MA1B 3O2VL 1FO0A 5MENA 2NMSA 3MV7B 4KJYA 5H35B 2X4SA 1RURH 4MNQD 2P49B 4L29A 5EZIH 4P3DB 3L5XH 4HUXA 2GITB 3EKCA 1UZ8B 1EGJH 3QUZD 2FO1A 5BZWB 2B2XH 4NZUH 4Z7OF 3MCKB 4OIIL 2FL5A 4YAQB 3QJFB 2BCKA 3SGJC 2VLJE 4PJFA 1RZKH 4RWYH 1UENA 4PJBE 5JW4M 2E7BA 4R6UA 2CK0L 1P7KB 4OIAA 3PGDB 4QHUA 3RY6A 3BW9A 4PP2A 5ANMB 1R3IH 3B9KB 5JXEC 4RDQF 3GJFK 4DGVH 1TJGH 2EKSB 5B8CB 2BHYA 2A83B 2V2TB 3IXTB 3D9AL 2DQGH 1QP1A 3RWIA 5T1LD 3VRJA 5T33L 3G9AB 2ZOLB 1M7IB 1I1AB 3CK0H 4UTBH 4PY8I 1NCDL 5F3BA 1U8PA 2DYPD 4UV4L 1YNKH 1JPSL 4NM4L 3WIHL 1FFOB 4J3WA 3V0WL 5JXAL 1E28A 1GAFL 2OP4L 1LE9B 5HPMB 4I18C 5BOPA 3DX7B 4GKNB 4DGVL 3L1OH 5IV2A 1D7FA 1WFNA 2IEPA 4PGCA 5DJ8B 5JHLL 1CR9H 3KYNB 3QIBC 3FN0L 1X5IA 4GLRH 4MS8D 5BQ7A 1JPFA 3VXUD 3UPAA 3QZWA 2XPGA 5KVFL 2FBJH 5INCA 4EOWH 4KHXH 5DFWH 2UY7A 3TA3A 3MODH 2D9QB 2BSSB 4KK6D 1DBKH 2WBJC 3KDMA 3RPIA 3QPXH 5C08A 3MRJA 4L5FL 3SE9H 2FSEA 3GK8L 1F4WL 5IJVA 4QCIA 3ETBF 5FA3B 5SV4A 5JIKA 3HE6A 5FK9B 3QXTA 4Z7VF 5E2WH 2A9ML 4HUWB 2HMIC 5I8CB 2W38A 4YPGB 4PTUA 1F3JB 5D1QB 1MCKA 1DEEA 3RNKB 1QSED 1ZVSA 3MYZA 3L3KB 3F5WB 3RTQC 1IZKA 4JRWA 4YO0B 4XPTL 2C4FT 5CJOH 2CDEB 5EZOL 2ATKA 3GSOA 3O6FD 5KS9B 3HFMH 5GGTL 4PGCB 1M7DB 4HGMA 5DJ8A 3FB7B 4GS7B 1N5AA 2YD5A 5ACZA 1D5IH 1BBDL 4WNQB 4D8PB 4MHHG 2MQ0A 1QKZH 3ZT5A 4UT6L 5AUMA 1I3UA 5FUCE 5C9JB 4X4XA 2X4TB 1DLFL 5ICXA 5CBAA 3DXAE 4Z18A 3B8SA 3K8MA 4OQTL 1BX2A 3RZCC 1OAXH 1DBKL 3KGRA 1A22B 3BHBA 4PR5A 4RAUB 1PG7W 2YA0A 3NBNA 3VJ6B 3BN3B 5D71H 3BFOA 3MREA 3KPSA 1GGBH 3V95A 4L3EA 1DEEB 4KMTH 2D31A 4TTDD 3S96B 2DQHL 5F3HB 3EDDA 5GSVB 1YMMA 3C5ZC 1WTGT 4PGBA 3KPQB 3S35H 2ATKB 3BJLA 4RMTA 4XNQB 3MZTA 1A4JB 1R5IA 3QDJE 3IAPA 3JTSA 2FECI 4MB5A 1NUGA 2H45A 5J6GB 4WHDA 4JHAL 4HAFA 1GGIL 3C2AH 4ZXBB 4Y8AA 2ADIA 2W0KA 3QIBD 3GO1L 1UA6H 4EUPA 4F15C 5DVNA 5CZVH 1UQSA 2AK1L 1NGYB 5E4IA 5DHVA 4WHCA 4NO3B 3D39E 4TVPE 1TXKA 15C8L 2AGJL 4DZBA 4H0IA 2ZG1A 3H9SB 2ZG3A 2IADB 4P46C 3BHBB 2WLYA 3B6SA 1ORQB 3BP5B 3WJLC 3NCMA 1MFDL 5GS2D 2BRRL 1PSKH 4PP1D 1YY8A 4PS4H 5DD0H 2DQFB 4OFDA 3V4UL 1OTTD 1ZA6A 3UROR 3EOYG 4MDIA 4ODHH 3V0VA 5C0BE 3EDJA 1A47A 3V7MA 1G9NL 4X4MA 3BGMB 1MCNA 3BXNA 3MBEB 5AYUH 3LKOA 3S36X 1UT9A 5HHXH 4P4RA 2C1PB 4HF5L 4IHOA 1I85C 2VDOL 3QZWG 5CUSH 1EGJL 3W0WA 3BZEB 1HYSD 2FYYB 3F6LA 5KSBF 1IL1B 5I73B 3Q0HA 3L7EA 4Y1AD 3KAAA 4LAJH 2LABA 3GSWB 2GTZB 4PRAA 2N1KA 5D7JC 2VDPH 3FOLA 1P5VA 3QIUC 5DRXB 1IGYA 4JRXA 3BEWA 1CLOH 4BSWA 4HLZH 5F7HA 1H3TA 1UYWL 3D69B 2EDTA 2AJ3A 3C60A 4N0UB 1YECH 3RWEA 5JLZA 1WWBX 3MJ9L 3O4LB 4N0RA 1WEJH 2JB5L 3CZFB 3NCEB 1CLCA 5BS0B 1T22B 2BRQA 1EFQA 1FZKA 2W0PA 3AU1A 8FABB 1S7WB 4FMFA 2E27H 1MCOL 3AREC 4FZEH 2VLMD 3QSKB 4LVHB 2IAMC 5C2UB 5I17A 2EDLA 1RUQL 4LCWB 2VERN 3H0TA 3Q5YA 3HKFA 3WNLA 4CW1B 4OV5A 1BFTA 1U3ZA 1JYNA 2O61A 4OGAD 1H8NA 4NGHL 3SN6N 4PRIA 1UM6L 5HYEA 1IGCH 4GXUM 5CS7A 5D1XA 5DQ9A 3MRHB 5CSZA 2AAVA 5EA0H 4NHUA 3FO0L 1PJ9A 1KPVB 1L6ZA 3MXVL 4KJQD 4GAJL 5BZDB 5FHBL 3HPJB 3RKDD 4YHMH 1KCSL 1J05B 2X09A 3BEWB 3QH3A 3DTXB 2X70B 2JJSC 3EFDL 2HRPL 3L95B 4NQEA 1CN4A 3U0WH 2QHRL 3MLZL 4OFPA 4GLRI 5LGKA 1PYWB 4JGUA 2EDFA 3S34H 3S88H 4HT1L 1JMZA 1OAQL 1OSZA 5HGBA 3QWOB 3ORJA 1J11A 3VWKA 3UTSE 3IT8D 3TO4D 1X5ZA 5HTSA 4PP1C 1GC1C 4LVHC 1JZ4A 3X3GL 1DVFD 2AXFA 3E3QE 3MRNB 5GGRY 3TCXA 1P1ZA 3C60C 4CW1A 2EKSA 4J3UA 4HWNA 1CD1A 4OV5B 1QRNE 4Y19D 4K94H 5L2KE 1KB9J 3MA9H 1G9NC 4NGHH 2BX5A 3SDYL 5IB3B 1FG9C 1FL6A 5KJRL 1SM3L 2JELL 5D2LB 3HB3C 4WWKC 1U8PB 3Q6GL 3MRQA 3BISA 4YFEA 3K2MC 1F58L 4ZNEA 5KVDH 2HJKA 3BYYA 1MCBA 1QFWM 4Y4HD 4AENA 4TUKH 9CGTA 3BD4A 2VXVH 3OTTA 1RJLA 1U36A 2A1WH 4XCCL 1YDPA 2V7HB 3E6FA 3O0RL 3RWDB 1CT8A 4JGMA 3VFSB 3SGDH 5HDBF 1ZHLB 2FJHA 4JPKH 3MRRB 3F12B 4JVUA 3ARGD 1Q38A 5C0EB 2ZCKL 3V79C 3GK8H 1KBGH 5EPMB 5C08D 4NJ9L 1PAMA 4V1DA 1CDUA 2XKNB 4ZFOB 3I2CH 4OGXH 4Z7NF 5GS2H 5IKCA 3ARED 4CN4A 2HTLD 4OZGF 1T5XB 4ZPVB 4EXKA 3K0WA 3RPIB 1NMAH 4MD5A 1PX4A 4Y5XB 3FT2A 1RZGA 5JIHA 5IJKA 5FA3A 4LPUA 3QYCA 4S1RH 1ZSDA 1CU4H 5C0AD 3WO4B 2XZZA 3I50L 4JFEE 2XN9A 5BJTB 1LO2H 3U46A 3KLAA 4AEHH 2Y36H 4M6NH 1AQDA 1NPUA 4ZFGL 1NFDA 4HC1A 5INDB 5EU6E 4LHJB 4PJEE 2VSCA 3MMEB 3REWA 2A6KB 4KKAC 3WHE1 4BKLA 4ZNEE 4OLXH 5KSAA 5HYJE 5JHDB 2W65B 3GMLA 4ALAH 5T1LA 2CSPA 3ROOB 4PYHA 1ZT4B 5D72H 3G5YA 1W72B 3BN9C 1P9MA 3IDGB 4M00A 4DCQA 1N59B 3STLB 1CE6B 1DANU 4GXVH 1MI5E 4P9ML 5BW7A 2XG4A 4MD5B 4N8CL 4IRJA 3S35X 4HGWB 5CZVL 2H3NA 4TVPL 4L8SA 1OAZL 3LRSA 4G9FE 3C08L 4N5UA 4OV6F 5I1EH 3BKMH 3I84A 4KFZC 5D2NE 5EZJA 1OM3L 2QQNH 5I1KL 1QLRA 3LQAL 2QSCL 4G8GA 1YMMB 25C8H 4PGBB 1X5LA 4ZAKD 3GB7A 4FQPA 4PD4J 3O11A 5HDBE 5B8CC 2VE6A 4QYOB 2R23B 3MJ8B 4UIMB 3LN5B 4PRPB 4Z7VE 3L3OA 4QXTA 4CVWA 1QVOA 3ARPA 3GSRB 3GIZL 4YEEA 3LKRA 1U91A 2YUWA 4ZAKA 2HH0H 3EDFA 3SGEI 5IHZA 1KPRA 4RAVA 1YNLL 4DCQB 4KQ4L 4OZHF 3FJTA 1DJSA 1I9RL 2Z92A 4BSJA 1JYWA 3ZZ1A 2NW3B 5FOJA 1I3GH 4LIQL 3I6KB 2VRAA 5E08H 1NAML 2PXYD 5EUOB 1LEIB 5F9OH 2DQJL 2HRLA 5TH2B 5SWZD 3WS3A 2X89A 4Y4KC 4I1NB 3T04D 1Y6KR 4Z7QF 3NVQA 3U7YH 3ARZA 4HFWA 2E5EA 1C7SA 4PJ5A 3D2UA 5EH1A 1OCWL 2BNQA 2P5WE 4UTBL 2WUBH 5EO0A 3UBXB 4PRHB 2R9HD 1HZHH 1ES0B 4DGYL 4M6OL 3IB4A 1VSCA 4X4ZA 5GGSB 5TDNB 4PRPA 3FO9A 3VRIA 4WI8A 3ULUH 1HQRB 1IGTB 3D0VA 4MNGA 4OCWH 1FLRL 4Y16B 1QSVA 3G5XB 1CL7H 4JDTL 1BPVA 5ADPL 1L6XA 4QXUL 2CDFA 2H32H 3NIGE 2VZOA 3NCFB 3TCLB 1AXIB 1E28B 3GMMB 4TPRH 2KZWA 4OIIH 2VN4A 2AQ2A 2QQKH 5FYJL 4AEHL 3ARDC 5TDPA 5IB1A 1S9KC 5I2IA 2R2BB 5TE6L 4UILH 3WS3B 4LSVH 2J4WL 5EBMA 3S4SA 4JPIA 3SHSA 5J89A 2Y1VA 3O6FB 3T3MF 2RR3A 1MPAL 3C5JA 4K7PX 1F2QA 3VXMB 2YN3A 4QOKA 4KJPC 3AY4C 5T3XL 4KAQL 4OD1H 1C5BL 5IEKA 1K4DB 3N0PB 5A16B 1KJ3L 4NO0A 5FA4A 4NHUB 5DHXB 1BAFL 1FLTX 3MLVL 2BNQE 1W0VA 2VXTL 4Y4HA 4PJBF 2Y6SD 1VFBB 4NHCL 4HJ0D 3MBEC 5DEFA 1B0RA 3C5SA 3DTXA 3QH3B 4HMCA 3VXSE 5I1LA 1LO3L 5AAWA 3SJVA 5DD1L 5FYKE 1FGVL 2NY6C 2WW8A 5DLML 2V17H 2WANA 1QA9A 4XNMB 3G6DH 4LVOB 2UZXB 2P5EB 2Z91A 1R3HB 3SDCB 1IE5A 3P0YH 3GIZH 1JHKL 4MCZB 4X8JB 5B4MC 5CJQL 2CKBH 5D72L 4RIRA 4XHJD 4NZUL 5L2JA 1T6VN 5D7IF 2FH6A 2BVOA 2APVA 5C09E 2IPTH 4PG2C 6FABL 2AEQH 3DYOA 1CD1B 3SDYH 4U1SB 3GSXB 1WFTA 4WHTA 5D1ZD 2XTJE 4JDZB 4N9OB 4ENEC 4LLDB 3MRGA 4JFDD 2P4AB 1I1AD 3B9EA 5I8OH 3DIFB 4R7DB 3CFCH 3F6IA 4UOW1 5F7LB 3QHFL 4HS8L 3TBSB 1J1OH 2A2QT 1IGJA 5KVEL 1CF8H 3H3PH 4P49A 4PRBA 3RWDA 1MCCA 3QI9C 5TFSL 4M7LH 3GI9H 1IC7H 4M02A 4ZQKA 4PRID 3FKUS 5C0EA 2Q8AH 2A0LC 2H1PL 4NUJA 4DOHE 4S10A 2I60H 4DN3H 3GJEA 4OCRH 5E6ID 5IWLA 5DZOA 2VLME 1D5MA 4MQXC 5ERWA 5GGRA 4QT5B 3U4BH 4ALAL 1RZJL 2VZUA 2IANB 1Y0LA 1IAKB 5C6PB 4PJ7A 1NCTA 4KUZL 4Z78A 4X0KB 2P44B 5DRZA 1QSEE 4JO2H 2ZOKA 3QEQD 5E99L 4EI6A 2FX8H 4Y5XC 5SX5H 3TVMC 5DVOA 4NZRH 3PWVA 3Q6GH 2E6QA 2UZIH 5F9DC 4XNYH 5MHSE 1PKQB 1QSFA 1LEKA 3FB5B 2HKFL 4P9HC 1ND0A 1NFDB 2GHWB 1S5HB 1IGIH 1CU4L 2GCYB 4EDWL 4NDMB 5IM7A 4FFVC 2OI9B 2C1PA 3EDEA 2XTJD 1QPPA 4XVJL 2CGRL 3PQYB 4GG6B 5ILTH 2FJFB 4GT7A 2UUDK 4YDIH 2EDDA 2A6DA 5A2KH 5JIPA 1KCKA 1EXUB 4U1NA 4WUUE 3SDDC 3RWEB 3K3QA 3CH1B 4ELMF 4ELKB 2R0KL 1D5ZA 5EU3A 3BIKB 4LLMB 1UVQB 1S7RA 1VEPA 2ZCHH 4XVTH 4QTIH 5C3TA 5E8NA 4U0QB 4FQ1L 3U9UA 4KUZH 5D1QC 1WAAF 2X4QA 1QLEL 3O9WD 1V7NL 3DRQB 2IBZX 2CLZB 3H3KA 1UB6A 3LKQA 2YPKA 1ZV5A 4JRYA 1BMGA 5HHOE 4IS6A 5DMJB 4PV8A 5D1XB 1NJ9A 4S11A 3U0PA 3MACL 4L4VD 3G6AA 3VWKC 1XGUB 4CADB 2AP2A 4NRZB 3T77A 2GSGA 4S1QH 2IFFH 4HK0B 3EYUH 3LKRB 1H5BC 4KPHH 2OBGA 1A5FH 3L95A 3MCKA 3ZKXB 1ACZA 3GIVA 3UJJH 1LD9A 1C8PA 1YN7A 2AXHA 1UH3A 5D1ZA 1J1PL 3UJIL 4HPOH 3P4MB 2VNCA 2BFVL 3HE7D 1IBGL 3U36A 1MAJA 1U8HA 4JREC 1B6DA 3PP3H 3MNVA 4LP4A 4PJHB 1BWMA 1MJUL 2V2TA 4KPHL 1CGYA 3DARA 4M7ZC 1ZLVK 2FIKB 2M2DA 1IC4L 1KLUA 3WJJA 3TT1L 3DBXB 3IDJB 2EEBA 3GDBA 4JAMB 5C0AB 3BRFA 2QQQA 3IRPX 4HF5H 4OTXH 4PJ9A 4YHYB 4I3SL 3BDXA 2VDQH 4IRJD 4JN2A 1KGCE 1VDGA 1EEUA 5HXMA 5C0JB 2Q7YB 3ARRA 3SDAB 1D5IL 4Y16A 1X7QA 4X83A 1VPOL 4YBLB 2V5RA 3AC0A 1KNOB 1QBML 2DM2A 1ZT7B 3GHEH 2F9BT 1NCAL 1XIWC 1EEYB 1YJDL 3BPOC 2YPLB 5HY9B 1JNHA 1OGAE 3WHXA 1F5WA 4YDVA 5CEYB 1VB9A 4G8IB 3O6KH 3MNVB 5I18H 1TQBC 1WC7A 3DX6B 2FSEB 1ZHLA 2FJHB 4IIQC 1I85A 1HHKA 4HKXA 1GGUA 2VR4A 3H6JA 2CMRL 1DR9A 1K3ZA 3G6JF 3GMRA 3F7RA 4RQQB 1JZ5A 4KUCD 1DBML 1OTTC 4WHYH 3DX8A 3ZTNL 3F5WA 3DYMA 3SKOA 5IKCB 1EUTA 1ZLUH 1CK0H 5SX4I 4D9RD 5HYFA 2AABH 2NNAB 4W6YB 4KMTL 2QR0B 1XF5A 3FQWA 3HZYA 4P46A 5CLTA 4ERSH 2V2XA 4KTEH 5KVMC 3QDHA 3T08A 3B2UD 4TN9A 3TBYB 4X4YA 4Q6YA 4B5EA 4OF7A 1Q9OA 3LV3B 4V1DD 5ADPH 4Y8DC 5AUMB 3S36H 1UH2A 1I8LA 5HDLA 1QFWL 1S8DA 2W65A 2BRRH 3WE6B 3WFCH 2EE9A 5KZCD 3D2UD 5FKPB 3BD5A 4L9DA 4WFFE 4P23A 1WC7B 5D2LF 4MMXC 4ODSH 3KG5A 1JGEB 3E2HB 5ISZA 3NZHH 3RUGF 3W0WE 2ZJSH 1AO7E 1LK3H 3TFKC 2PXYA 5GS0L 1G7QB 3TJEL 1U93B 3N1PC 4A6YH 2ZKHH 3GMQA 4YGVB 2G2RA 4OFYA 4NQCE 5GGTA 4HG4J 4Q7DA 4JFPA 3S37L 5F72S 3MCG1 1T7XA 1IC7L 4QEGA 4PGDA 1HNFA 5JUEH 2OTUB 5J6GA 5IW6B 3S3SA 3FT4B 2DQEL 2AJUL 1HCVA 3U0WL 1M4KA 2P43B 1PEWA 5I30H 3JV0A 3TO4A 3RTQD 3KR3L 4NKQB 2PW1A 4X9BA 4P9HL 1DQLL 2Z31A 3MLUL 3CFJB 5HHQB 5IVNA 4NFDA 1N26A 1I7UB 1MCWW 1MWAH 1BIIA 4H88L 4UAOC 3DUSB 4NP4H 3U0TB 1KACB 1ZHBA 5TQ0H 5I0ZA 4PV9B 2PXYB 4ZO7A 1T21A 5GGRB 4Z0XB 4KV5F 1RUKH 1MIEL 1X5HA 5A43C 3I6LD 1NMCC 2D7PA 3LPFA 3RVTC 2QQLL 4LAQH 4UT7L 3ZTJG 4YXKH 1OPGL 1IAKA 4KK8D 3KHQA 1DQMH 3HE6C 4JFFD 3VFNB 1UCBL 1WWCA 5AG8A 2JLLA 2UWEA 1JWMA 3BP6B 5EZOH 3VG9B 2WBJA 1BJ8A 2YEZA 4EQ2A 2F8XC 2YZ8A 3QHFH 3GSWA 2F53E 4HEME 1TZIB 5I75C 4X6BB 2O5ZH 4RFEB 2KDGA 5IVXF 4NDMA 5IM7B 3Q3GA 4X99B 4JKMA 1MLCB 4W68A 4ZS6C 4KVCL 3U82B 4FQLH 4J8RB 3O6MH 1JF1B 4NWTH 4MA3A 1C5BH 1I9IH 35C8L 4NO2B 3U0TA 2WWKT 1G7LA 4PPTA 2EXWC 4JRXD 3X12B 5DA0B 4NIKB 5FGBC 2ICEA 3ZT7A 4HIHA 5JHDD 1Z3GL 3IJSA 5EU3B 5CGTA 3TN0C 2DAVA 3BWAA 3P2TA 2R2BA 5CJXC 1HEZB 4NNYB 5C08E 1G7HB 2F19L 5EN2A 1U92A 1RZJH 4L3AA 3WV0A 3BPLC 4CVUA 3TN0A 3CFDB 1T7ZA 2WBKA 4XPGH 1TJIL 3UPRB 3QEQA 2WBWB 1KEMH 2C4FU 3GJFB 3GSQB 2DBLL 1CVRA 3WFHB 1IQWH 3ROLA 2VDLL 4LCUB 3SDXE 3B3IB 1C1EL 3RAJH 3V9FA 4M7KH 2F74B 2VDMH 4P59L 3OWEA 1UA6L 4MQTB 4HIEB 2CH8A 2IG2L 3VD3A 1HSBA 1TDQA 3ZE2F 5I1LB 3G9VA 1U58B 4OZ4A 3BO8B 1T1XB 2KQMA 5HHMB 1LEGA 3OJDA 4TUKL 2XT1B 3RWCB 3RBGA 4KZEH 4U1HA 3ARFA 1T7VA 2YRPA 4FMKA 2HP4A 3BP4B 5L9DH 2IH3B 5JW5B 4JFDB 4HC1H 1CFVH 3ZKXC 1EO8L 3L5WB 3P9LA 3W9DA 4N8VG 2WMPA 2BVUA 5F9OL 4G8EB 4NQSA 3QEUA 1JUFA 3VFPA 5E08L 3AS3A 1FNAA 4XWOC 4XC3H 2DTMH 1EEZB 2XWJA 3CGTA 2OR7A 1LO4L 5JA9A 3HZKB 4JAMA 4R2GD 3QO0B 1YN6B 5F93C 4NQED 3UXFA 3I9GH 4OGAC 3W5NA 1C5CH 5LCVL 4Q9QL 1AR1C 3V6OC 5KAQF 1YNTB 2J5LB 3BE1L 1QYGL 4QRPD 1CD9B 4UB0L 1MCQA 3T0XA 4V2BA 3GKWH 4ZS6D 4ZXBC 5K9JH 2Y5TB 3RGVB 1YEHH 1PY9A 4MDJB 1LO3H 1LEGB 3OJDB 1LGVA 3RL1B 2OL3B 4JCMA 2DQIH 1ZKAA 4WI7A 1FZMA 4K71C 3ARFB 4XZUB 1AXTL 3GSVB 2DQJH 3U7WH 4AJ0A 2I27N 1NGPL 2EXYD 1IT9L 4Q9QH 3L5WA 5GISL 3TO2B 3WLWD 2R29H 4R0LC 1A3RH 1P84K 4LFHG 4LPWA 4YX2L 1OAZH 4XXDA 5GRVK 5IMMA 3WCYA 2Y07H 2VQTA 3QRGL 2PXYC 4O9HH 1DFBH 1G7PA 4P9MH 4X98B 4NBXB 1NUDA 4J6RL 3WDJA 3D0LB 4BA8A 2DL2A 5C71A 1HWGB 1I1FA 1BOYA 1DQLH 3BQUD 3CFKB 2L7UA 4XX1G 5DRWB 1F8TL 1MFCH 5KSVA 1YNTA 4JG0L 5INDA 2AJUH 3MMEA 1KENL 1FZJA 3PL6D 1IARB 4X4ME 3CD4A 4Z78B 1U8KA 3RX8A 4CRPA 4WW1B 3BZFA 4KTDH 1WCBA 1XF1A 4G42A 1PDKA 3PUCA 2X4PA 3FCTB 5DMIH 3MRFA 1J1XH 5BRZA 2UVFA 4AL8L 1N4XH 1G6RH 3UP1A 4A6YL 2CXGA 1I9JH 4R0LB 3E8UH 3FOMB 4WO4D 4M7JH 2W0FA 5EBWA 4JZOB 1A7RH 3MRBB 3BPCA 3WFDH 3EYQC 1YJDC 4RGNE 2P7TA 4JQIH 5DC0A 4XMPL 4ODHL 1OY3B 2E6JA 2HTLC 4GQ9L 4LGRB 1BQLL 1NC2B 1PZ5B 2AV1B 2XFXB 4IIQB 3MJ8A 5I1JH 1XIWA 3TJHD 5F96H 5SWZE 4F7EA 2Y06H 1KIPA 2VN7A 4N0CC 3RL2B 4YEFA 4ZXBD 1LP9A 4JR9H 1FNLA 4MWFA 4GXUN 3H7BB 5E9DD 4Y16C 2BMKB 1A7PL 1KJMB 1WICA 2ED7A 1RURL 2EYSA 3QDJD 3PXHA 5DD3L 1RZ8B 1NAKL 3RPKA 2H41A 1F11A 4DTGH 1U0QA 4OSUL 3DI2B 5FM4A 2VIRA 5AEAA 1T2QH 3D25B 3OJVC 4C56E 2IANE 3EIFA 4GS7C 3S3PA 3WLWC 1XGUA 4CADA 5EUOA 3Q48A 3OAUL 4P9HH 3G08B 3A0OA 1IGFL 5MEND 4GBXC 2VR5A 3RWFA 2BOBA 1FAKT 4KJWC 4PJ8D 4ODBD 5GS1A 4LRNH 3LKNA 1NCAH 4I9WD 5MERA 3SCMA 3OGCA 5D1ZB 1EFXA 3QBTB 4X6DB 5CHNB 1UXWB 2WIMA 5C0CD 5FM5M 2V2WA 5D1ZC 3VE0A 5F7NC 1RUKL 1CZ8H 1CXKA 3BW9B 2Z93A 2WBJB 1DFBL 2X4UB 4Y1AB 4CL7A 2ZNWA 7FABL 2DKSA 3MV8A 5IVZA 4BQBA 1CQYA 1FPTL 3IJYA 1CGUA 4LCYB 4X6CB 5I1AA 1MJJA 1S9WB 4RSVA 4RFEA 1MREH 5TJWK 3WNOA 2R29L 4WENB 2HFFB 3UO1H 1KJ2L 4PBWD 1JF1A 2AJZA 2Y7QA 3WUWG 3GMMA 3CSYA 3PQYD 4EI5C 3TEUA 3UTPE 1JFQH 3ILPB 3LS5H 2PYEB 1A7NH 1QFPA 4HGKC 2OQJA 5TDPB 3C6LB 4QRRB 2X7LB 3FHQA 3MLRL 3DMMB 4WO4C 3RHWK 5TQ2L 4ZOBA 4EDXA 2DLIA 1CXLA 3VH8G 4FABL 3TH3T 4C56A 3I9GL 3DGGA 5IBUG 5JORB 3W81A 1OP5K 4R4FL 3QIWD 1NGXA 3ULVC 1HINH 2V2WB 3WHXB 3TJEH 3MJ9H 1WZMA 2YD2A 3ZTNH 1MWAB 2W9DH 5B39B 1ONQB 2H9GA 4NYLA 1XGYL 1CXHA 5HYQA 3WNKA 3SDAC 1S9XA 2BSSA 4NJ9H 1ZHKA 2DDQH 1ZLUK 1DQDL 2ORBL 1BFSA 1S5IL 3DUUA 4RAHA 1AKJD 3OXSA 3KS0J 4RA3A 1CFSA 5LWYL 5J56B 2R9HC 3FFDB 2AJZB 2Y7QB 1RIHH 1INQA 2OCFD 3B9KC 1CGVA 1IVLA 4JR9L 3QDAA 4K2UL 1MCOH 4FZEL 4XNYL 4X7EC 4PRNA 1KJ2B 5J11B 5DF0A 2J2ZA 2IG2H 4YE4H 3VGAB 1WVZA 1BZ9B 1LDSA 1R3LB 5SWSD 5C08B 1BAFH 3PHQA 5J6HA 5C7XH 4GRWB 2XZAH 3K2UH 2DF3A 2XOTA 1M6OA 1PSKL 4YH6A 4GQPH 4G8EA 4NQSB 5E4EB 4R2GB 1WIUA 5IFAH 1CGXA 5D2NA 3QEHB 2IMNA 1MI5A 3DX9A 1GYAA 2R8SH 2GAZA 3DIFA 4MJ6A 1R24B 2IF7A 4X6EA 1ZHKB 3QUXA 1RZIA 2CK0H 5DJAA 1WISA 2APTA 1HYSC 1U93A 2B0SL 1I8IB 3VXRA 1MFNA 4Z7VA 5JTWA 4NN6B 1H3PH 3U83A 1BBJA 4PRHE 4HIJA 2D31B 4OFVA 1B90A 4HJJH 1T89C 5TE7H 4EI5D 4F3FA 2AEPL 1F6AB 3QG6A 3VXTB 1J1PH 4ZFZA 3ULUE 4UQ3A 2EE3A 3RNQA 5TGBA 2MSPA 2PO6B 5IB2A 1S7SA 4NWTL 3N1GC 2EDOA 3TF7C 3TO2A 5SV3A 2FR4A 1N5YL 2W91A 4PV9A 4HKJA 4N0YL 2NX5E 2R1YB 1I7UA 3VXPB 1U9KA 3DVNB 3H8NA 4OQTH 5C0RH 3QDMA 1YEEH 3ZKND 2ICWJ 1FFPB 3WNPA 3QCUL 5ESVB 1OOAA 5EB9A 1NFIB 3O9WA 4CKVX 1JF5A 3P9MB 3O4LD 3PWPD 1IBGH 2HA1A 3MLWL 4PRPE 4Z7VB 4ZTPH 3JV6A 4XI5D 5A40E 4DVBA 4RBPH 1FAIH 1BBJB 2RAMA 5ICYB 3S35L 1ORSA 1UQSB 4D9LH 1F6AA 2AEIT 1XAUA 1WK0A 2BHZA 3PWPB 1NGYA 3MBEA 3IDNA 1QRND 4NP4L 2NLJB 3JWOC 3SBWA 1JGDA 5C0NC 2YXMA 3LDBB 2W9LA 1SHMA 3OKEA 5GZNC 4X6BA 4XP4H 3TV3L 3QI9D 1CCZA 3CDYA 4HK3N 3UDWA 2GUOA 3QIWB 1TNMA 1RK0A 2AKRA 3IDYB 1WV7T 5EBWB 1HXYB 3DO3A 3UTQB 1OWWA 5C07A 3VFRB 3C8KB 1SQ2N 2BVQA 2AJ3B 3BESR 2ICCA 4GQ9H 3ZYJA 3OZ9L 5DHYA 3W0WD 2QL1A 1B9ZA 2BDNL 4D0CB 4Y5VB 2RBLA 5JXAH 3UPRA 5HYJB 2A6JB 3WFDL 3C6SA 1JZ2A 3W82A 3HB3D 5DWUH 4XAWH 1XCTB 1OAYL 1HZHL 3PG2A 5HVWA 1NKOA 4RISL 5ALBH 4MXWH 1U92B 4V2CB 3CIQA 3INUH 3LVEA 2ILLA 3H7BA 4EJ1C 4NNXB 2HVKB 4HS3A 4LU5L 4U6TA 1YEIL 4JG1L 4PJAF 4JHAH 2IAMB 4DGYH 1YN7B 4NCDA 3FQXB 3BVNA 1G7JB 5HHVH 4HS6B 3U36B 3IDMB 4W4OC 4OJFL 3PHOB 5KSUA 2LAGB 2BNRE 1TJGL 2IH3A 1VCAA 4U05A 4CJ0A 5B38G 1AP2A 3N85L 1BJMA 3P9LB 1PG7H 5ID1B 3QUYD 1EEQA 4XBGB 2FGWL 2YPLE 3BI9X 5DQDL 5FFLA 4FNLH 3O8XA 1YMHB 5D7JB 1I3GL 1N2RA 3ZKSD 4HUVB 5C9KA 4JFDA 4L3ED 3FFCE 2K1MA 4N68A 3WIFB 3L6FB 5CIPH 1MOEA 4U1GC 5E94B 1UZ6E 1HH6B 2VZ1A 1NCDH 5HI4D 4OI8A 1FV1A 2IPUG 5IROA 1OCWH 2AK4D 4QHKJ 1NGZB 5L9DL 1BP3B 3ZDZE 3MRQB 5I1DB 2OL3A 1DQQB 5IW3A 4FXKA 1J1OL 4UT9L 1HNGA 5IIEB 3HC0A 4KY1H 2OR9L 3DMMA 2AXFB 3P30H 1FNSH 1S7VA 4NM8H 2EDKA 2QADC 4I77H 3T65A 4F33A 3MUZ1 1I9RH 2MMXA 2LV4A 1DQDH 2ORBH 2Z31C 3GMRB 4RQQA 3V5HA 4K7FA 3HE6B 3Q6FB 4QY8B 1W72L 5HHMD 3SKOB 4LPVA 3MA7B 2FHFA 1ACYH 3CC5A 4LSRH 1M7XA 4LCIH 2R69L 2YSSA 3L6FA 4OAWB 3KR3H 3RWJB 2EYRA 2CRIA 1LO5A 5DRWA 4O58H 4K3DH 4G7YL 3VMPA 3F7PC 4S2SA 1T5XA 4U6XA 5IT2L 5ESAB 1IM9B 4X98A 5T3XD 2V7NB 2V7HA 3E6FB 4TULH 4QWWD 3V52L 1FV1B 1IQDB 3U4EB 3CNKA 1Z9MA 1A6ZB 4WI6A 5CJBA 4I0PD 4S1RL 3HS0A 3OKLB 2VYRE 4WNQA 4D8PA 1MLBA 2CUIA 1IM9D 3OJ2C 4X5WA 4HV8B 5FDWB 3QWRA 1CLZH 3OXRB 3FCTA 4YUEH 4OB5L 5BO1L 1NC4A 2H8PB 2VXTH 3VD7A 3QXWA 1GGYA 3GM0A 3WKML 3JWNC 5ETUB 2NXZD 2PO6C 1MFBH 2XZAL 4H0HB 1U41A 2UV3A 1TVHB 4FQCL 4FTVB 4HCRL 3MJ6A 2WINB 3UBXI 2W0FB 4LEOA 1FN4A 3ROOA 1O0VA 1T66D 1NCCH 5GS0C 4Q6IC 4WUUB 1FO0H 4NRXB 3JTTA 2MJWA 5JR1H 2O93L 3FHAA 5CD3B 5E8DL 1A1OA 2OK0L 3QUXB 1JCKA 1E4XH 4XNQA 4HGWA 4QRPE 2FGZA 4LRNL 5T1KA 2ICWI 3TPKA 5IHUH 1UKTA 4K3EL 5F1NA 1LO2L 2D4DA 5FUOH 3ZSTA 1JN6B 4U2ZA 2D7MA 1JRHL 2QTEA 1W72A 2NY0C 3LRGA 3I75B 3IFOA 2ICES 2JJUA 2FO4B 2JIXA 4NSKA 3WD5L 4HBQA 3R06B 1F02I 2QHLA 1X5KA 4UZGA 4UDUA 4X80H 3EOTH 4OCSL 3VGGA 5EOQH 1T3FA 4M6OH 4RZCA 1FRGL 1G0DA 1ORQA 4YPJA 1OAQH 4YDJB 3KWWA 3W2DL 1RPQA 3IETB 4LVOC 4NQTA 2DQFA 4I5BA 3QULA 3H9SE 5FO9A 1EMTH 2FDBP 3LAFA 1F4HA 3PE9A 2C5DC 4GG8B 1OP9A 4X7TB 4H25B 3ARDB 3EFDH 1TFHA 2BERA 1FFPA 3I6KA 3PDOB 5MEPB 2DICA 3BKYL 4G6JH 1INEH 3RI5F 2BOBB 4FQIH 4AIZB 2ARJQ 4KJPD 3U4BL 1MAMH 4O00A 4QWWC 1JYXA 4GUPB 3RVUD 3QA3A 3W11C 5C0RL 4I0PC 1A7RL 3TP4A 4PD4K 4AEIH 2ADJA 1HIML 1AXSB 2GTWA 3N9GH 2Z9TA 5F3BB 5HGAA 2WNGA 2HWZL 3QDME 4UTAL 4NQXA 3H9HB 2FB4L 4O2FB 3MA9L 1WWWX 4M43L 3UCRA 1CF8L 1UM6H 2VWEC 3GRWA 4XMLH 5IV2B 4DKEH 2HFFA 1BD2D 4AH2A 1OD7A 2CLVB 2VL5B 1GSMA 4X6CF 4JPWH 4U7SA 25C8L 1WT5C 4GRMA 2VITA 4N8PA 1N0LA 3D2UB 3QXVA 1MCHA 5INCB 4HAGA 4POYA 2YZ1A 2RJMA 5F1OB 3D3VA 3QCVL 1QRKA 4M43H 3FO2B 3S7GA 1A6WL 4TVPH 2X6MA 3CX5J 2NZ9C 1ZANH 3TWCL 2ZNXA 5EORL 1NANI 3VFOA 5CSZB 4PJCE 4OLVL 4WU5B 1T04B 3L3HA 5KS9E 4HJGA 2CMRH 1MQKL 4HIEA 5E9DE 1DE4A 4AEIL 4YR6A 3REVB 2Y06L 1T20A 3U79A 3SGEH 5DYOA 3DRTA 5D1QA 2DOCA 3TNMB 5DJZA 1INQB 3V4UH 4PLJC 5HGGS 2O5YL 4W4OA 4Z5RA 2DLEA 5IHUL 3I6GA 4UQ2B 1NDGA 1UB5B 2AW2A 5JDSA 3OMZA 3S98A 1OQXA 1J0JA 4PRNB 4XPFL 3QIUD 3GKZA 5GIRB 4XP9H 1EVUA 4U1IA 3IDMA 1KPUB 3FFCB 2OMBA 3F7VB 5E6IC 1RUML 4XHQA 4DUVA 4XNZC 4NKIL 1QLFB 2WUCH 1BGXH 5BMFL 2P24A 3MJ7B 4JFOA 1HKLL 1A9BB 1K8DA 2ZPKL 4X7SL 4WW2C 2ESVB 3DURA 4AL8H 3O8XB 3UTTD 3S9DB 1AFVL 3SQOL 4XPBL 3VXRD 1H8SA 4Y5YA 1HHJA 1T04A 3HMWH 1ZTXH 2EDYA 4PRDB 3MO1B 1XGYH 3KLDA 1M6OB 1MEXH 1DZBA 1S7UA 4JDVB 3WN5B 2YD6A 3BRGC 4QHKI 4WY7H 4ZOEA 5DEFB 5F6HI 5GJSH 3S5LB 4JM2B 3MREB 1RHFA 3TBTB 3WFEH 1FYTB 1K6QL 3WSQL 4BUGA 4LCWD 4OLEA 3ZKMD 1YEFH 1YDPB 4PREB 5FYJH 1QBBA 5CZKA 3K7UA 1D3CA 5EOCL 3SDCA 1XGPA 1CR9L 3HE7A 3OSKA 1KXQE 4F8TA 3VXRB 4Q9RH 3FFCA 5IWLC 3IS1X 2GI7A 1XF3A 4N9GB 1A7NL 2L0DA 3MRMB 5ID0A 1ERNA 3D39A 1M05B 2O5XH 4O4YL 1ZA3A 3V6ZB 3RQ3A 4FXGB 4AEEA 3GBNH 5DK0A 1AGEB 4NN7B 1K8DB 4YQXL 3MXVH 1CD8A 5ADOL 3K8LA 2X9WA 4JDZA 3INUL 3SJVE 4Z7WF 1QFOA 1LP9E 2X9XA 5I1CH 3HI5H 1Z6JT 2XA8H 3L9RA 3RZCA 5DC9B 2DQIL 2LU7A 3NFPA 1DVFC 4D94A 2IMMA 1I1RA 3VCLB 1Y6NR 5GRYA 5KN5B 2VLKE 1WFOA 3TYGH 3TBSA 5F7DB 3G5VA 4H20H 5JOFB 1P7QD 5TF1H 3P9MA 3U7WL 1U8KB 1WTLA 4FQQB 1MHHB 3I6LE 1IQDA 5I8OL 2HVJA 4UUJB 2FLRT 5T3ZL 4KKCD 3MFFA 3LHPH 3OR6B 2LTQC 5T1LB 2Q76B 4K3DL 2NLJA 1KF9B 2NY2C 3T4YB 3T0EB 5HGHA 5CJOL 2XXCB 4CAGA 1G7MB 4J3XA 3A67H 5ICYA 1WUNT 3BT2H 4B41A 1TZHA 4MAYA 3T4AB 4LCCA 5ICZA 1S9YB 3IF1A 4XP6L 4FP8H 2GCYA 3MRIB 3WS6C 1XR9B 5FUZL 3BZ4A 5FB8B 3ARGC 2W92A 4HK3J 5D70H 3PQYA 3IDXH 4FFYL 5EC1B 2EEAA 1HXYA 4HCRA 2FWOB 5JLZB 3VW3L 5T1MA 1CDIA 5IBTH 4D0BA 2BXZA 4NRXA 3N06B 4LHUA 3L1OL 2NY1B 3EZ8A 1NKRA 1LEKB 1QSFB 3IJHB 3BKML 1U8JA 1JHKH 3RL2A 5KVGL 3UTQA 1OGAD 5HYJA 1NBVL 4O51B 4MWFB 3RY5A 5E56A 3RDTC 1IGML 4G6MH 5AZ2H 2OR9H 5I8KH 3EGSB 2C3VB 2LVEA 5IVXA 4N0YH 3F8UB 3NA9L 5KTEH 3QQ9C 4TSCH 4APQD 2DBLH 5F7UA 2HVKA 1GAFH 4PJ7E 4Z7WB 1FIGH 2YPKB 5L0QC 1SEQH 3QUML 5M7QA 3AM8C 5FGSA 4KROC 1D5ZB 3HPJA 4HUUA 1TJHH 3MRIA 4MNQB 1D9KD 3LH2H 5FOBA 1S7RB 2HT4C 3O2DH 1KCVL 1G7JA 3A6OA 3LEVL 3GI9L 1IQWL 3GO1H 3QIBA 4OLWL 5F70A 3IETA 1WFUA 3GEWB 4ZFGH 1JHLH 3QXDA 4JO1H 3I02B 2DQCL 3V8OA 4GG8A 5L8KB 3L5IA 2X1WL 4MB3A 4P5MA 3FO1B 1Q9LB 2PYEE 4KC3B 4J7RA 3V2AR 5HI3C 1GL4B 1IAIM 4LMQI 2C3VA 3HNSL 4G7VH 1KT2A 2YK1L 3G6JA 4ZUWA 4ZODA 4FFWD 2BHUA 3VGHA 4WV1C 5L7XL 5BVJB 5EIIA 3WXWL 4ZTOL 1KIQA 1A7OL 4X6CE 3TZVA 4ISVB 3IVKB 4XCYB 3WIFA 5H94A 5MENB 2CK2A 1V05A 4KGJA 4K7PL 4W6WB 3WFCL 2ZWLT 1FNGB 2BSTB 1XF4A 3W39B 1R5VB 3A6CH 5D7IA 5C0JA 4PJCB 2FJGA 1JIBA 3QJFA 3CFCL 1BVKB 1XGQB 5JORA 4NC1C 2R0WL 1KNOA 2D7NA 1KTRL 3O6FA 3JV4B 4HW6A 4CMMB 1Z5LA 3LEXB 4FP8L 4GBXD 2D7TL 2YA1A 4HZAA 3QUKB 5HY9A 4UV7H 4WGVB 1U3HC 5HYQB 4GO6B 1S7VB 5DURB 4LASH 5B8CA 5EZLA 2RFXA 3FN3A 3GRWL 5A16A 1HHIB 3MV9B 1NBQA 1ZVHA 3FT2B 1OF2A 4PGEA 3DO7A 1JPTL 1UCTA 3EOBA 5FUZH 5CEXA 4YR6B 1XGRA 4MD4B 3QQ9D 3RWGA 1CI5A 2HH0L 3WXVL 4APQC 4ISVA 3DV4B 2VZ3A 4BQCA 4WFHD 1TPXC 4L8SC 5SWZB 1LE9A 4KI5E 5BRZE 1F2XK 1PGRB 2VMFA 1KLGA 5GZOC 3LHPL 3VXUB 5E8OB 4PJCA 4IJ3C 5GIRA 1RJZA 2DI8A 1SYSA 4MCYB 5GZND 4X9FA 3RGVD 1VGKA 2DYPB 4RGNB 3IFPA 1FVDA 3NN8A 1Q9OB 2VLRD 3LV3A 3OKNA 4K3GA 2E7LC 4P2RB 3IU3A 4K23L 2J88L 1ZMYA 2ZCLL 1CLYL 4LEOB 4XCFH 3UC0H 5JNYB 5DUBA 1A9BA 4RDQG 5I76B 1E6JL 1N6VA 4R96A 5HI3D 3MOQA 4H1LH 3CU7A 5DJAB 4B7LA 2F54B 5A2JH 4OZGA 4P57A 3ULVD 1II4E 1A64A 3Q2CA 4JDVA 3ARWA 1A02N 4JM2A 1S3KL 2HLFD 2BVPA 3DV4A 4JZNA 1YEFL 3GMQB 1G0YR 3QT2A 4X9HA 4OLUH 4Q6IA 2IC2A 3GB7B 1F13A 5TDOA 1WBYA 2VXQH 4NNPL 3HR5A 3IDXL 3QUYA 4FFYH 4M61A 3ECBA 4UIMA 1JF6A 4NUJB 5DXWA 5C0BB 3T0EC 2FR4B 2EXWD 2DLHA 4NZJA 1RU9H 3WDIA 5CGMA 2Q8BL 3GI8H 1OGTB 4M93C 5IHZB 1ZXQA 2X4OA 3O2VH 4IRSA 1YPZE 2EZ0D 2IANA 3MGTA 3IGAA 1GZQB 3MFGB 1B3JA 4P2CG 2Q7NA 2HKHH 4XHJC 1JNJA 1KB5H 2LAAA 4PJEF 1IKNC 3GHEL 4TSCL 2Y4SA 1FH5L 1XMWA 4FQ2H 1WBXB 1L9MA 1GCFA 2E9JA 4I2XB 4U6HA 3BKJL 3EOAA 4G8FB 4D0DB 3MLWH 3MV8E 1UJ3C 2PETA 4RMRA 1YA5A 5DMGD 4DW2H 4K8RD 2VLRE 4ENED 3TLRA 4I3SH 4G43B 3MR9A 4K3JL 4NN7C 5IMOB 1ADQL 2EKJA 4F57L 4UMGA 4GMTH 5IW1A 1CFNB 3SGDI 3FB8A 4MNGE 4JO3L 4PJXA 3PV7A 1BIHA 5J12C 2EC8A 3QFJE 5C07D 2VO5A 1ZHBB 4HEPG 3BX7C 1O7SA 1RIHL 2FZ3A 4NQXB 5KANG 1B0GA 4LFHD 5F9AC 2FLBT 1F58H 1CTNA 4TUJA 3AS2A 1AGDB 2DIBA 1MWAL 3MRLB 4LSDA 1LDPL 5HD8C 4DAGL 1BQUA 3H9HA 3U9UB 3TCLA 4PLNC 5HI5D 5T1MB 3O6LH 3CPLB 4H26A 4ODXB 1IC5H 1NC2D 4MQXD 3GBLA 2JTDA 1L0XA 4JM4H 2ICEB 2OL3H 3GNML 1FSKB 2VC2H 3B2VH 4LSUH 1X4YA 2B7DT 5MEQA 3MLSL 2FEDD 1ZTXL 1G7HA 4L4TD 1KIRA 1LDPH 1JWUA 1FVEA 1WWAX 1A5FL 5JZ7D 2NY7H 5DEZA 2HT3C 1ED3A 1EJOH 4G6AC 3VXSD 4WI2A 4LNRA 4WU5A 2AVGA 3DVGA 3J8F7 3MACH 32C2B 3T8XA 3TYFB 1FO0B 2XZCH 1GGCL 4FQJL 1A1MB 1MREL 3DI3B 5I0DA 1ZHNA 2PF6A 4XPFH 5CWSB 4DKFH 5I75B 5HYSA 1AGCA 1PVHA 1SBBA 5T5NG 3VGEA 2PO6D 3GKWL 5FAAA 5C0DB 1Z0MA 1CXIA 1F90H 3SDDD 1KN4H 3QP3A 5MENE 2BSRA 3MTRA 4BFIA 1GC1L 1HXMB 5E1HB 3VA2C 3QNZA 1AR2A 1T7YA 2IAND 3VRLF 3BKCH 3RVWD 4LCWA 2OTPA 5DVLA 1FHGA 4JZJC 4K8RC 2V5YA 2O61B 1CFTB 1Q9WA 3ZDYE 3E0GA 4KDTA 2HKFH 1PBYA 5GGUB 1G6RL 3G6JB 4N0FA 1CLOL 3MRHA 5ILTL 3T1FA 2NY3B 1NGZA 4LNRB 2B4CH 4PJIE 4NZRL 2LFGA 3K81A 2GFBB 3B8YA 4BQ8A 5FGRA 4BQ9A 3CVHA 4FXKB 2DQTH 4GSDH 4FHBD 1YN6A 1MH5A 4UIKH 5DD5L 3WJLA 1BGXL 2FHBA 5DFTA 1UFUA 1D5BB 4K07A 2K9UA 1CDGA 2BVYA 4L9LC 3DX6A 1PYWA 1JUFB 1O7VA 3PJSB 5DJ6B 5ANME 4HKXB 4X5XB 5FGCB 3SBWC 5IQ7L 1AQKL 4HX1B 4PJBB 3PV6A 4M3JA 3P73B 4F2MA 2B1HH 2VLJB 3QRGH 4O9HL 4XH2A 3QNZB 3MUGA 4JQIL 1JHTA 3WYRA 5SWSB 1UKSA 5IP4A 5F89B 4JANA 1JNNH 1P4LA 1I3VA 1HHIA 5GISH 3MRCB 2XG5A 15C8H 3C5ZA 5FCUH 3HZYB 2W9EL 4P46B 2V2XB 5D2LA 2CO6B 1XGRB 3QXUA 5HHOD 4OZHB 2F19H 3RL1A 1QSFE 3X13B 3B4NA 4M1CC 3WE6A 3RUGE 2DB8A 4KWUA 1MCDA 5JW4Q 2ATPA 2HRPH 2BFVH 3LSOB 3RA7H 4XPHH 4JPWL 3P40A 1I4FA 4Y4FB 1RU9L 4DVRH 1J0ZA 3KLSA 2WINA 3DVIA 3GJFH 4ZYKA 1FVDB 1KTDA 2G75A 5EO1B 1G7MA 1AO7B 1UEYA 4YWGL 3TO4C 2I9LA 4JKLA 1EH9A 1GH7A 1TCMA 3ILQC 4L8BA 7CGTA 2DD8L 5C6TH 1FORH 2J1KA 2BNUB 4ESKA 1RMFH 1RQ5A 2D7TH 5LG1A 3VG9C 3RVVC 3MRCA 1U3YA 1HH9A 4RMQA 5CGYD 4RGOL 4MXVF 4NFBA 4U7MA 4C4KO 3ZO0A 4JZOA 1BFOB 2ZCLH 3UC0L 4P4KD 3V5KA 1T0PB 2C3GA 1JN6A 4YDKH 3IU4L 4LVNC 2VB5A 4YK4B 3BKYH 4G6JL 4RX4D 3ELAT 5BJTA 3EGSA 3NABH 4GW4A 5D2NC 3ES6B 1UB6B 3SOBL 4FQ2L 1FH5H 4Z77B 1HHHB 4YDLB 1O5DT 1R5IB 5BV7C 2GY5A 4OZIB 4EQ3A 1A7OH 1I7TB 1N7ML 4PJGE 3VXOB 4XVSH 3C87A 4QRQB 1CBVL 4PJIB 2VZSA 5IVXB 4LSTL 3D3VE 4ZYKB 1W8NA 4MX7B 3U6RB 3HUJF 1TPXB 4Y5YC 3V4PH 1U8QA 1RJYA 5IGXL 1RZ8A 1RK1B 1FG2B 1RZFL 3PIQA 3FQUA 4DZBB 4HUUB 3NIFE 2I26N 4TSAL 5GS0D 1XR8A 5BZWA 2CKBA 3QNYB 3QA3B 2EO9A 2CXKA 4XXCA 4GW4B 2L7JA 4E5XA 1AXSA 2F5BH 1KLUB 2P5ED 1CS6A 4YHZH 1TJHL 4WEMB 2ZJSL 2ZOLA 3B9KA 1NCBL 4JQVC 4M1CD 4NZTH 3KPLA 3O3AA 4RFOH 4LKXA 1FFOA 1G7LB 3GSRA 2VDRL 4QXWA 4JN2B 4HKBA 1KOAA 3NFSH 5TE4H 2OMNA 4WO4A 1A6VH 1KCLA 4ZFFA 4RX4A 2XI9A 3KJ4B 2VH5L 4NQDB 2VAJA 3NCYP 3BN9D 1OGAA 5HYJD 2DI7A 1DUZB 5DWUL 1PZUB 3KJ4C 1BZ7A 2YC1A 1OPGH 5CHNA 3VFTB 3DSFL 1EHLH 3UTZB 2OSLB 2UYLB 2BJML 3ZYIA 3LMJH 1G1CA 2D0FA 2QADB 1T1WA 1LK2A 2XWBA 1WT5A 1FNFA 4L8CA 1U6AL 4OUOA 1QSFD 3MV9D 4KRLB 4PGZA 4ZMAT 2NXYB 2XPGB 1OF2B 3OBAA 4MAYD 1NL0L 3KPLB 4I0KA 4J4PD 2R69H 3ILPA 3GSNA 3KDMB 4JB9L 2AEPH 3W11D 1EHNA 1S7QB 1BBDH 1GZPB 4NO5B 5D9SB 2GYSA 4LBEB 3PL6B 4MNGB 1DUYA 1XT5A 4ZO8A 1UCBH 1QNZL 2J8UF 3GSOB 4MD4A 1KLGB 4U1HB 3HFML 4JFZL 5GGTH 3TBYA 4P2OB 4ZUTB 3FB7A 4UAOB 5JW5A 4ZPTB 2CLRA 3RNKA 5DVKA 5ACZB 3P11L 1UACH 1B6UA 1VGKB 4E42B 4D9QE 3DSFH 1DBBL 3OKKB 1LK2B 5JNYA 1QUNA 2X4TA 4UT7H 5J4MA 1RIVL 1JGEA 2BZDA 1MY7A 2DYPA 1S7UB 1J0HA 5I8KL 4XT1C 2KQNA 1ZLSL 4M93B 1RVFH 4P5TD 2JB6A 1R3KA 1INDH 1CE1H 1YPZB 4LK4A 1Q9WB 1NL0H 4LL9A 2XQBL 1NEZB 3EJZD 3GMNA 2LU4A 5JQ6H 5KVFH 4XRCA 4NCC2 5EULV 1H3PL 4MDJA 3PWUB 3RI5K 4ELMB 1FNEB 2GAZB 4MJ6B 4AM0A 5IB5A 4NJAH 5C8JA 3MOAL 1PG7L 1JK8B 3NA4A 4HHAB 4ERSL 1J0KA 4LDLB 3MRMA 1QEWB 1NCWL 2B2XL 4HUNB 3ZL4H 3OL2A 5M94B 3TV3H 2JJWA 1U8OA 1XEDA 43CAA 1QA9B 2I24N 4LIQE 4XNMA 4CUCA 2DLFH 4EUPB 5AZEH 1A6AB 1A4JA 1A6PA 4KRNA 4MCZA 4FFZL 3S8WA 3TT3L 4CDGC 3QQNA 5EPMA 5IFHH 3RZCB 5EA0L 1KBGL 1S7SB 1X3DA 1OP3H 3VFUA 2BVOB 3MUGB 3HZMA 4U49A 1JNNL 3B6SB 4Y2DA 1R3KB 3UEZA 5L8JB 3MPCA 4U1SA 4WUKL 3PP3K 3HAEH 5BVPL 4XWGH 1BOGA 4TYUA 4XAWL 2H32B 2HVJB 4UUJA 4LKCA 3NH7L 4J4PC 4F3FB 3MFFB 4LSPH 1NCNA 2DWDA 4OZHA 5DD6B 2Y5EA 4R2GC 4ZFZB 4LLWA 4EUPG 4ZD3L 3MCLH 5KOMC 1J10A 3OG4B 1SVZA 4HHAA 3H3BC 2R0KH 4WEBL 1EAPB 2X4RA 1QACA 3OHXB 4EVNB 1TVBA 4EN3C 4R0LA 5BOZG 4O4YH 1KB9K 2GTZA 4P2RE 4HPYH 3MR9B 5BV7L 1AO7D 4GAYB 5JHDA 2XTJB 3PP4H 4PG9B 3K4DA 3TESA 1B88A 4K8RH 3ZDXE 3KLHD 3QI9A 4PJXB 1F4YH 1MF2H 3RJDA 4OZIF 5C09B 3ZE0E 1MFEL 4FABH 1B0GB 1U95A 3O2WL 4L3EE 4PJEA 1CGSL 2R0ZL 4PJDF 3JSSA 3BSZH 3CX2A 2J8UE 3OGOE 4F7MA 1NC2A 5BS0A 1HOCA 3MRLA 1QQDA 1BF8A 4QNPF 5F6IB 1AY1H 3E2HC 3FB6B 4OF8A 1AE6H 2P5EE 3AU1B 8FABA 4LLVB 1E0OB 4HZLA 2A74B 2DJSA 5F8QC 1KN4L 2WBJD 1KJ2H 3O4LA 2J5LC 4D9RE 3U7AA 2C4XA 4ODWA 1IGCL 3UAJD 1MHPL 1ND0B 1RZ7H 4Z0BL 1L0YA 5IEHB 2HWZH 3HG1E 5BMFH 3NZHL 2EE2A 1IAOB 1XCTA 2H2SD 4S1SL 5DJYB 5LBSH 3ARFC 3O6FC 1HDMA 4JY6B 1AD9B 4UNUA 1U58A 5KW9H 1F3DJ 2QSQA 2YD7A 4GW1B 5B22A 4IOIB 1GVIA 1U8QB 2YN5A 7FABH 1QR1A 5GS1B 1MQKH 5C2BH 1KPVA 2HJLA 4O2EA 3DVGB 5JMOC 1OARH 2Z92B 3MGOA 4Y5VA 2XKSA 1EFXB 3B9VA 2X70A 3GGWB 4KTEL 5GRZA 4Q97A 2PR4L 3UJJL 4DGIL 2WSKA 2HKHL 2P8PB 1U8MA 3WFZA 2X4QB 4Z8FH 1KT2B 2Z8VC 1MRFH 3IDYC 1W8OA 3MRDA 2MTPA 1X6LA 1G6RB 1FE8L 2W9EH 5HBBA 4M1DH 1T03L 4YJZL 1EVTC 5JDJA 1OTSD 1YMHA 1URLA 3GHBH 4EI5B 1VESA 3GMPB 3TJHC 4MD0B 2I07A 1IAOA 4EN3D 2H2PC 2AXJA 2B1AH 2ZPKH 4P5TB 5GRJL 1WITA 2D4FA 4ZSOE 2R56H 1R5VA 4PLOB 1MH5B 5I1IL 2AS5M 5DUMH 3QIUB 4TSBL 4P3DA 3FQNA 5C0BD 3P0VH 5C7XL 1MRFL 4HH9B 1WGOA 2VLLB 1UZ8A 3KLHC 2UZIL 4JQVA 1JFQL 3T0ED 1G7IB 4M1GL 1D9KC 1PKOA 1Z5LB 4K94C 5IMKB 1EHXA 1KN2L 1VFOA 5IIEA 1NEUA 4QTHA 3SKNA 4XMPH 1MWAA 2G9HA 3VFVB 5I1IH 2FX9L 3ULSB 5EBMB 5DUPH 2VDQL 2QSVA 4DKDC 4QHMB 1JZ8A 4ZO6A 3F12A 5HJ3A 4EIZC 1UWEH 1BZQK 1AGBB 1T03H 5CP3A 2BSED 3D48R 5DDHA 1AXTH 1EBPA 5C0AA 3Q6FA 4QY8A 4N90E 2W9DL 4HFUH 5DEGA 3BAEL 2DLFL 4PJAA 1ITBB 2EIEA 3CC5B 5I1DA 4ZPVA 3CH8A 4YIQB 4HULB 5D7LD 1TMCB 3ULUD 1GC1H 3EJYC 1W0VB 2EDQA 2ZUYA 4KH2A 4POUB 1I8MA 4LVNB 5GRVL 1D6VL 2F53B 3HAEG 4J6RH 4TULL 5IUSA 3PHQB 3KYOA 1X9QA 5F9JA 2MCPH 5CAYB 3T3PF 3RJQB 3STBA 3JBG7 3WS6A 3SQBA 3MRPA 2Q6WB 1L9NA 2G9HB 2I25N 3SGKC 4X5LA 2H8PA 4JHWL 5E7FA 1A1NA 3WBDA 3QHZL 5HI5C 3QUZB 4HLZG 2E6PA 4MXVE 1QO3B 2FNBA 2ZUTA 1L7IL 2BVPB 3CXDL 4GMSH 1EIBA 5H37H 3T0BA 3GSXA 4LSPL 3MUJA 3MV7D 5TF0A 1WQVT 3DMMD 1LVEA 1OTSC 3BDYL 2KBGA 3BKJH 1ZVSB 2EH7L 3OXRA 2SEBB 4XAKE 4ELMA 5JO5A 4NC0B 2PNDA 3EYVA 4IRZH 4R7DA 2HAZA 3MLYH 1A1OB 3EUUA 1JV5A 4IRJC 4K7PH 3RNQB 4DK6A 3MQIA 4L9LB 4OCLC 1LP9B 4PYGA 3OKDA 2RGSA 3KYOB 4ZTOH 3WXWH 4OF3A 5K9JL 5MP6H 1PW3A 2D9CA 3QPXL 1DBJL 5DT1L 2EIZB 4KJQC 1XCQB 3QUXC 1DQTA 1G6VK 1FL3A 1MCIA 4MX7A 1I8LC 2Q1EA 5DRNA 5E8EA 1F4XL 5E2WL 1MVUB 4LLYA 1RJYB 2VDNH 4G7YH 5AD0A 3M8OL 2CKBL 2XIDA 4FOMA 4YFLF 3M1BB 1M71A 1T7WA 5GS3A 5FECB 1A7PH 1XGTB 2ESVE 3O3DB 3WO3B 1U91B 5JXED 5ESVA 4RAUA 1G7QA 3WLBA 3RWFB 2AEQL 3O4OC 4YGVA 4Q0XH 5FHAH 1DANT 5IHLB 1FYTE 4XP5L 5FKAA 3QWQB 3G6JE 4TNWF 4X7TA 3LZFH 4X0KA 1TITA 5JO5B 2EC9T 5E8PB 4PGDB 3NGBB 2P1YA 4WCYL 2COQA 5IQ9A 1R3JB 4GFTB 4L9LA 4YLQT 2A9NH 5TH2A 5J1SC 4F58H 3QEQE 3IJYB 3OKEB 4QRSB 3D9AH 3HN3A 3VH8A 3CFJA 4XNXL 3MJ9A 1FL3B 2GUOB 1Z9OA 3SKUD 3STZB 5EO0B 4LP5A 3OG6B 1TETH 5I1HH 2FEEI 2FJFA 4PJIF 1RZ7L 2OXGA 1PQZA 1HQRA 3D0VB 3MV7A 5ABDE 2OQJB 5FECA 4P2YA 1BVLA 4ONFH 3CCHB 5MI0B 4D9QD 1R5WA 1DBBH 5MEPA 5DGRA 3LY6A 4LHUD 3GMOB 2RQ8A 4I3RL 2JK5A 4JO4L 3TFKD 4QF1A 4RGND 3NAAL 4KK6C 3FTGA 3HG1B 3VRLE 1OW0A 4WWKA 4LLVA 1JWUB 1YUHA 2AXGA 1RZKL 3F65A 3FQRA 4WI4A 3VFNA 3ZE2E 4MJID 4ZSOB 4YBHA 1ZLVH 3KPRA 5GGQL 2BC4A 3FRUA 2YUZA 5DMGC 1HK6A 2D0GA 1I7RB 4QXUH 2FD6H 5FYLD 2PCPB 5IEKB 4KK9C 2EYTB 1EDQA 2Q20A 4YXHH 2R2EA 4JFQA 1UG9A 5CWSA 4U1JB 1OSPL 1VFBA 1Q72L 3HAEB 4LARL 2HN7A 1L7TL 1N0XH 2YOCA 3DXAD 4W4NA 3O81A 1QR1B 1FYTD 4HWBA 1GZPA 2V17L 1JPGB 1RHHA 3O3UN 1DUYB 3FO2A 3I6GB 1IRAY 2NX5D 4PY7B 4UQ2A 4Y0GA 5CSGA 3C08H 1DBAH 3FTGB 3HG1A 2E7CA 1HEZA 4NNYA 5GS1C 3RZCD 3NTCH 5HYIA 3UYRH 3TIEA 3WFBL 1YEKH 1X5JA 3MYJB 1P2CB 2KH2B 3NMEA 5FYLL 2WK2A 3RVVD 1SM3H 2E7MA 4S0SD 4WIQA 3UTSB 4HKZB 3GJFA 4Y1AE 3T1FB 4DZ8A 5K9OA 4RWHA 5DJZB 3KJ6H 1YQVL 5DMYA 4C55A 1NDGB 2VQ1B 2DTML 3MRJB 1T80A 2JB6B 4AM0B 1QBLH 1D5BA 3C6LD 4QRRD 4U7KA 3H9SD 4GAFB 4OQTA 1F3JA 4DFHA 3VWJA 1QEWA 4PY8J 1X7QB 5I1EL 5J9PB 1LQSR 3L3DB 3FN0H 4TSAH 1KCSH 1J87A 5CMAA 1CL7L 4TVPD 3GSUA 1U8LB 2JJVA 2XQBH 3VFVA 1VFMA 3QEUB 1SEBA 4TUOA 5LGHH 3VFPB 1M05A 3NA9H 1MCPH 1RZKC 3SOBH 3NCYS 3QUYC 2ARJB 2ICWB 5GSRA 5C9JA 1NCBH 2NXYD 1OAYH 3UYRL 4ODSL 2DQGL 4E41B 2XQYK 1T1ZA 2A77L 1BX2B 1CDCA 4LLQA 2EDRA 3RVWC 3X13A 3HC4H 2A38A 1MLBB 4OCYL 4KDWA 3LSOA 3LRHA 3BH9A 2ENYA 5JOFA 4TSBH 2X9YA 5D7SH 5E5RB 1S5HA 4KUCF 4FXGA 1MHHA 1AKJA 4IOFD 1H9VA 3K4AA 1L0QA 3VXNA 1QFUH 2YMXH 1NMAL 4XP6H 5CMAB 1FL5A 2H6PA 2AABL 4YXHL 2MKLC 1CD0A 1Z0NA 3FB5A 4MA8H 3NCJL 3ULVH 3GSUB 3NFPB 4HQQH 1NFKA 5HVHC 4WY7L 5GJSL 3JTTB 1KC5L 3WDHA 4XXDB 3QFJD 2IQAA 1VENA 5C07E 4P99A 4GRWF 1SEQL 3V6FA 1J18A 1S9YA 3IF1B 3I3EA 4GG6A 5JA8B 2YRZA 3ARDD 4XWOD 5KBNC 5EG6C 3C8KA 5LXGH 4E41A 4XCCH 4YBQD 1I1FB 1BJ1J 3WIIL 5C70A 1SBSL 4AMKL 3SEPA 1OLLA 2GJZA 4G6ML 4JFPB 5AZ2L 1Q94B 2IFGA 3VI3F 3ULVE 3OF6A 2Z35B 1QQDB 1H8OA 1EX0A 1AC6A 1NQBA 3C8HA 4M5YH 2X89D 1WIPA 2A74A 4FQXB 4O5LH 5IEHA 3HLAA 3PWJA 3K2UL 3LN4B 3RKDC 5CEZE 2DKUA 3BDYH 4OLYL 2MPAL 4HS3B 2GSGB 5ISZE 1VFAB 3L7EB 4XB8A 1MAML 4F58L 4HWZB 4ZUUA 2J8OA 1K5NA 2ITDA 5CBEB 1N59A 3STLA 3U2SB 2WP3T 1LWRA 4JQXC 4EXPX 3GSNH 3L3JA 4HPOL 4MNQA 3GBNL 1GIGL 3G04A 2R4SL 1MHCA 4R3SA 4JFXB 3RTQA 4BH8A 3MLZH 5SWQB 3IAGC 3QIBB 1TTGA 5AG9A 2DQDH 3V7AE 4JFDE 3OKOA 2BCKB 5GRWA 4XNUL 1NUFA 3DECA 4O02H 4HXAH 3MRDB 3GGWA 4KTYA 1REIA 4NKMB 1XIWB 2UWEB 1A14L 4WI9A 4H20L 2Y23A 1RAMA 5D6DA 1GPOL 5IGXH 4JEGB 1SJXA 2C1OB 2QJDA 1KELL 3WD5H 4OFYD 4L29B 4PTTA 4J3OC 1F3DH 3PXJA 5GS0H 2ESVD 1X5XA 2XWTB 4PRIB 5K9QI 4R90L 1DBJH 1VFAA 3RWIB 1QLEH 4ZUWB 4AH2B 4A6YB 1FZOB 3OR7A 2YC1B 4MA3B 4HWZA 2ZSVB 2YBRA 2AV7B 4W70A 1CFQA 2XA3A 4JM2D 3UTZA 2NY4C 5JQHC 5ITBL 2Z8RA 2OK0H 3DNKA 1FNGA 2VXVL 3NIDE 3GMOA 4HH9A 2AI0L 4PJGB 4NQDE 3VFOB 2C3WA 2E27L 1H15B 4YBQC 3CFIC 1MUJA 2IALB 2Z8WC 1DE4B 1FGNH 3R1GL 2HYMA 4Z7QE 2J12B 3C2SA 3QEQB 3MV7E 1FJ1A 1MCEA 3V4VH 4LBEA 1ZWIB 4K94L 4WVRA 1UJ3B 4Y4KA 3ROLB 5EZLB 2X4NB 3AS1A 2WAHA 3QWRD 3RVUC 3B5GA 2B4CC 2DQUH 1UB5A 4LEXL 1IM9A 5EOCJ 2EE6A 1TTUA 2QR0A 3AM8A 4F7CB 1H3WM 5EU6D 3G5XA 4KQ3H 2W0LA 4NJAL 3IS0X 4PTUB 4KXZI 5CJ8A 1QLFA 4CMMA 5F9JB 2OL3L 3GNMH 2P5WB 3ARGA 3CMOH 3DOSA 2YPLD 5IT2H 4FZ8H 5F7EL 2NYYC 4LF3B 5ENWB 4KRMB 4K55A 5KS9A 1JTTA 3MZGB 3EJJX 3MV9A 1C08A 1JPSH 3WIHH 1OARL 4B0MM 1TVHA 4F9PA 5GGVL 1EO7A 5IJVB 1N64H 4YHNB 3W9DB 3TBWB 4IDLA 4ONHB 2NQCA 4M48L 4MA1C 3NPSB 2XWJB 1FJ1B 4MVBC 4M7JL 4OZHE 5K9OB 1BD2B 5CEZD 1BWWA 4OCNC 4ZAKC 2VXUH 3WFBH 4HS8H 3WIIH 4PBXA 1ETZB 3LOWA 2Q8AL 4GMTL 2D03H 5C0CA 1M7DA 4Y19A 4M4RA 4MAYC 4OF0A 5T1DL 4YK4C 3VFMA 1SYSB 3EHBD 4MCYA 1XF3B 4PJGF 3QCTH 4CMHC 3SJVB 2WP3O 1CGSH 1SJHA 2KZ1B 4LPTA 4PLJD 4HWBL 5DUML 3MNZB 5FGCE 3ULVL 1Z2KA 2P5EA 1JV5B 2OTUA 2VKXA 2Z91B 3NCCB 4DK3A 5FEBA 4QRUB 2NW2A 1QBAA 1RZJC 2CGRH 1KULA 4HBCL 4WTXA 1C08B 4RMVA 3QEGH 5K9KA 2ZSWA 5JPNA 3K8KA 4KTDL 5IB4B 4N1EA 3NPZB 4I5BB 1EERB 1WCQA 2H32A 5F9WB 2V9QA 1MI5B 4WTZA 2X4OB 3Q5TA 5DS8B 4J1UB 5DD1H 2DMKA 2EIBA 3RUGB 1GZQA 4F9LA 4G80B 1H3UA 1IM3A 2R0WH 4M8QB 5JW3H 3M45A 5E6YA 4YX2H 3QUYB 1T21B 1NSNL 3NAAH 2VJXA 1IEAB 1N3NB 2ADGB 1HN1A 4G8FA 3BH9B 4POZD 3EFFB 4G6AD 5HSFA 5E03A 3QUMA 4P4KB 3WO4C 1IAII 1YEIH 3A6BL 4RRPG 5L88H 5IQ9B 3TT3H 1MFBL 3MGTB 1F3RB 3W2DH 5IW1B 1FDLL 1U95B 4NZDA 1IKFH 2CQVA 3E3QC 3MXWL 4L3CB 4KKBD 5I1GL 1TZIA 1VFUA 4UBDC 3ET9F 1E4KA 4OCSH 4R26L 2IH1A 5D5MB 3ESUF 4HKJB 3QFDA 3V6FB 5F7MC 4EIGB 3DVNA