4MLSA

Crystal structure of the spytag and spycatcher-deltan1 complex
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
81
structure length
81
Chain Sequence
SATHIKFSKRDEDGKELAGATMELRDSSGKTISTWISDGQVKDFYLYPGKYTFVETAAPDGYEVATAITFTVNEQGQVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibronectin binding protein
publication title Structural Analysis and Optimization of the Covalent Association between SpyCatcher and a Peptide Tag.
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Peptide binding protein
total genus 9
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17802 SpaA Prealbumin-like fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mlsA00
5BRZE 2C1PB 3RVXD 2APXA 4J1UA 2CUMA 3GK8L 4FRWA 4GW5A 3QUZB 5DHYA 3RVUD 4ZD3H 1PVHA 3BGAA 4PJAE 1IAIH 1T03L 2ZJSL 3KPMB 4XP4H 4MD5B 1MCNA 1YPZA 1FNLA 3SEPA 3M8OL 5JW3L 3F8UB 2XA3A 4M7LL 4L4VD 5JHDD 2OZ4H 1X4ZA 5I19H 4QRSB 5E2VH 4P3WA 1II4E 4XWOC 2OXHA 1P69B 2VITB 2ZG3A 4Q0XH 4N0FB 4Q6IC 2YN5A 3IFPB 3WO3B 3LQAL 2GJJA 4JN2B 2X4RB 2ATKB 2VDPL 3FCTB 5GGRY 4NM4H 4H0GA 2J4WL 4S10A 4IHOB 3B9KD 5B21A 3TC9A 4LCWD 3TO2B 4U6VH 5DUMH 1S7SA 2VLME 4XC3H 5J13C 4OM1L 1B90A 3HI6L 5CILH 1AP2B 5E8PB 3VXME 1F2QA 4M8QA 1EUTA 2J8UE 3INUH 4I8DA 4JY4B 4AT6B 4YBHA 5B8CC 4ZO7A 3SE9H 2B20A 2JELH 1N0XH 2A9MH 2HFGH 3I2CH 3EYOB 3QXAB 1A3RH 3GRWL 1P84K 5A2IH 1K4CA 3TPUB 4S11A 4W4OA 32C2B 2EDFA 3FN0L 5I1CH 4IEFB 1BGXH 4K3GA 1PSKH 4YPGA 1FRGH 5BO1L 1VCAA 3MJ6A 3FB5B 3T1FB 1QSFD 4PJCB 5E2UH 3MPCA 1KXQE 3QH3A 4HV8A 4EEEA 4U1MB 4TUOA 4TVPL 3QNYA 4MMZC 1PY4A 1T22B 1EFXA 3VXRE 2IBBA 1OCWL 3MJGX 3WUWB 4KKCD 2XIDA 1MWAH 4GRLD 3MRBA 5HVWA 3HNTH 4P46C 4YDVA 2MJWA 4CNIA 1G7MB 2BNQD 5EIVA 5A40E 2KH2B 4L1HA 2HTLC 5FKPA 1OTSD 5FO9B 4G9FE 4XWGL 4FQLL 3WXVH 1NSNL 4U6XB 4BM7A 1LK2A 2Z4QA 2A77L 3MLWH 4MWFB 5F7FA 4FFYL 1T6VN 2BNRD 4WVRA 5CBEA 5CJBA 2K1MA 3U36B 4AIOA 1O7SA 3B2VL 5MP6L 4FQPA 5CAYB 1ZT7B 2NX5B 5DD0H 4L4TB 4O2FA 1CGSL 1CGYA 5EUOA 3AY4C 3QDME 3E6FB 2JK5B 4R96A 3I85A 1DEEB 3MXWH 4UB0L 3IYLW 3A0OA 5EN2A 3O0RH 4QGTA 5J6HB 2OTPA 5H94B 4KK6D 2E7LC 4XXDA 1CLYL 1BREA 1CBVL 1DBAH 1FQ9C 2VNCA 3WN5A 3SO3B 5FGSA 3TA3C 1XCTB 1CQYA 5SX4H 1S7UA 3VFRA 3HC3H 1A5FH 3BIKA 2CRZA 4KUCD 2OYPA 3GMOB 4C56E 5GGTH 1VGEH 3BEVA 3PDOA 3U7YH 3PWLB 2DBJA 4MD4A 4MNHB 1T20A 4UV4L 5HDBE 1D9KD 2HVKA 2VERN 1JPGB 4KY1L 4NC0B 5HYFA 4L3ED 3ZE2F 2HJFA 4LEOB 2M26A 1NGQL 3F7QA 2V9QA 5I8EA 4YHZL 3KPRA 3L5JA 3EOBA 4K2UH 3SGEI 4Q9BA 2XN9A 1FIGL 1LO4H 2X4QA 1JIBA 5KG9A 2UY7A 1UXSB 4KVNL 4XPTH 2EYSA 3BUYA 5FO8A 3QYCA 2PNDA 1MUJB 4P4KD 4CADB 1KIUA 1T7ZA 1A1NB 5JA8B 4FQHA 3VFOB 1QFUH 1DVFC 1KBGL 1S9VA 2LVCA 4KUZH 1IGYA 3KPQB 5E2WL 4JKMA 4CMHB 4F3FA 2D7TL 4PP1D 2AEWA 4PJAF 3LRGA 1CICA 4Y16A 3UYRH 5H8DA 1NEZA 4IIQA 1JZ7A 5CZXC 1KJ3L 1PX4A 2ICEB 2H32B 2R1YB 4MA3B 3SDAB 3X14A 5IM7B 1A3QA 3W2DH 1OAKL 2DQDL 5E8NB 1TZGH 1CFBA 1AE6L 3VG0L 4HK0B 3MLYL 1WIPA 1ZA6A 1JFQH 5F3HB 4PGBB 1U3HD 3QFJD 1ZLWH 2DJUA 3SDCC 5GRYA 1WWCA 2JIXD 1LEGB 3IDXH 4FQ1L 1UB5B 4Z7UB 4JB9L 2BCKA 2DQCL 4M93B 2BY2A 2VXQL 4CW1B 2CDEB 1B4JH 3D0VA 1JNLL 1G6RA 1UVQA 1G7QB 3G04A 1EO8H 1D5IH 1HH6B 1NFDA 4UAOC 5C9JA 4PJ7E 3G5VA 3BZEB 1GGYA 1UWGH 4Q2ZB 2FWOA 3PV6A 1TPXC 4QNPE 2CIKA 1HSAB 3BD5A 5DRNB 1TQCB 5IEHB 1EHNA 4UV7L 4CJ0A 5HHVL 5E8DH 2V2XA 4PRAA 4XC1L 3T0EE 5FUZL 1JE6A 4NRZA 4TSAH 2E6PA 3EYFA 1YPZB 2I25N 1YZZA 2E7CA 3QDJA 1U8OA 1EAPB 5SX5K 5AYUH 4N1EA 3CLFL 1JVKA 2F54E 5L2KA 1AXTH 5D96C 4JG1L 3LS4L 1KJ2A 4I77H 1XF2B 2A6KA 4Q7DA 3IJYA 3WMSA 3RUGE 1LILA 1OLZA 2ILLA 3ZZ1A 1NUNB 3S5LB 4Z7VE 4QRPD 5FHAH 3SJVA 1U41A 5I1LA 4YIQA 4JHZA 3MCKA 1VPOL 4F2MA 3I84A 3BKJH 1ETZA 3ULVL 2X7LA 5DTFA 4X6DF 2GJ6D 4DKAA 1UZ8A 3ROLA 1J5OH 4X6CF 3CD4A 15C8H 1G0XA 4J2XA 3PWVA 4EI6B 1D3CA 4D9RD 2YZ1A 4ODVL 5DXWA 1HIMH 4P99A 1YNTB 4GAGH 4M8QB 4F8QA 1KCKA 1SYVB 3O2DL 1RD6A 3B4NA 4WDIB 4PJEA 3UYOD 4MDIA 4P5TC 5F7DB 5LBSL 4H1LG 5AG8A 1QLRA 4HC1A 2OJZH 3CFKA 1M7DA 2H1PH 4DEPB 4N0YH 4BSWA 3FOLA 2F5BL 3BX7C 3WD5H 2XQYK 4LGRB 1K5NB 1ZS8A 5CZVL 2D31A 1OGAB 4LDOB 3GMLA 1F8TH 1HK6A 3CMGA 2PXYA 4WFFD 4JANA 1MHCA 4HV8B 2GCYB 4FXKA 4TUOB 4HS6A 4FS0A 5LGJA 5D7SH 4QKXB 2WZPD 5CJ5A 4Q9RL 2VLLA 3E0GA 2AEQL 3QUYC 5K9OA 1EFXB 4B5EA 5E1AA 1FAIL 3ME0A 3GNML 3BD3A 4LDEB 5FM5M 5T3ZL 4CN6A 3VXUE 3JWNC 4XNZB 1NCAL 2DDQH 1KEML 3KXFA 3MREA 4CNIB 2I60H 3TBTB 5C2BH 3CVHA 3HCVB 2UUDK 4NQSA 3LVEA 1CFNA 1LP9A 1FYTD 5SWZD 1GGIH 3IAQA 5HYSA 4KQ3H 3CFDA 4NO5A 5D7LA 4X5WB 3DMMB 3E3QE 1JHTA 2JJTA 1DQML 2AJZB 1MRFH 5D6DA 5L0QC 1CYGA 2Z93B 3O6MH 3L3OB 5I73C 2BVTA 2NR6D 2Z4QB 1X5KA 1KPUA 4DGIL 4LHJB 1UENA 3AREA 3VJ6A 1G9NL 2FEDC 5GHWL 3TBVA 3DXAE 3MRFA 4TTGA 2HRPL 2IWGA 3EO9H 4MLIA 2VXTL 3VGBA 3AFLA 1A6UH 4X7TB 5I1JH 1M05B 4R96B 1U8LA 5DGRA 3IFOA 1RZ7H 3LDBC 3X11A 1K2DA 4YUEH 1CG9B 5HYJD 1NKOA 1XGTA 2R39A 5FYKH 1JHKL 1Q0XL 1N59B 4Q9QH 2YA2A 4XXDB 3CU7A 1T4KB 1A6VH 4D3CH 3WN5B 5AAMA 5F9AC 2Y36L 5CIPB 2AV1B 1C08A 1OVZA 5DVLA 3BIKB 3EFDL 2FEEI 3G08A 2IC2A 3ZHLA 3UPRA 2J1KA 1KTLA 2YMXL 4JRXE 1OAQL 4HQQH 4G6JL 3BEVB 4ZTOH 1QSEE 4KKNA 4MD4B 5LXGL 2Z0BA 4LSTH 4QHUA 1T7WA 2ADFL 3ARDC 2DI8A 3P0YH 3UC0L 2DOCA 1D5BB 2NY1B 3QDGE 3QCTL 4LF3B 2HJFB 1UGNA 4KTDH 3NPSB 3JBG7 1GGTA 5I8EB 5T1KD 3KPRB 3TBWA 1J1OH 3IKCA 1VERA 1ODAA 1NGWA 5FK9A 5IB4A 1QR4A 2X4QB 1MJUH 5KG9B 3CMOH 2XI9A 2EYSB 3F7RA 3ZKMC 5C0EB 5KVGH 3VMNA 4GUPA 1BLNB 3T77A 2AJVL 2VKWA 2NY2D 5D70L 1LO2L 1R3HA 1S9VB 4N1HB 1IGYB 4RFEA 1HE7A 4GW4A 1ZTXH 4QNPF 3CZFB 5DO2C 3VFUA 5DMIH 4KTYA 3AUVA 4R0LA 4F3FB 4MXQD 5KVDH 4EDXA 3PJSA 3SPVB 4RAVB 1ZT4A 4PJCE 3CLEH 2XACC 1TTFA 5JXAH 1IILE 1IM9A 1NC2D 1UWXH 3UO1H 4HPYH 3G6JF 4PJ5A 1CICB 3WKMH 1NEZB 1UACL 4HS3A 4IIQB 4XXCA 1UA6H 3BJ91 3MOQA 3RBSA 5HPMA 4YXHH 4NN7C 1F58H 4MJIB 43C9A 4HDIA 2H41A 1FZJA 2DYPA 2DQHH 1F6AA 2X41A 1U91A 3VGFA 2AQ2A 1ZA6B 5FYKE 2AQ3A 3RUGF 1IKFH 1MJ8H 1Z5LA 2GEEA 5EU4A 3JVGA 4HBCL 5JOFA 2X4TA 3GGWA 1NANI 5E00A 5K9KB 3BW9A 2CLRA 3D0VB 5LVEA 3G04B 1MREL 1JGVH 3BMWA 1NFDB 3UROR 3G5VB 4DZBA 3C5ZD 1ZKAA 2FWOB 4U6VL 3UAJD 3PV6B 5DUML 4CRPA 4XC3L 3LN9A 4OLXH 1KCSH 3FHQA 1U9KA 5ICYA 5EBGA 2Z31B 4JRWA 3O81A 4YC2B 3NCBB 2MCPH 3INUL 2V2XB 2Q8BH 1U0QA 4ONGH 3ZKXC 4PRAB 5GISL 2DQGL 1Q9KA 1N0XL 2A9ML 2HFGL 2NLJA 4L4TE 1I3RA 1NLBH 4NRZB 3GSWA 4F15C 1A3RL 4PRHA 1WC7A 3SY0B 1QPPA 1N6QH 3VXQB 1I7RA 1BGXL 2HJLA 1H8OA 4RMRA 5L2KB 1FRGL 1NAMA 1KJ2B 3UTSE 2G5BB 4EQ2A 1AIFA 5JIKA 3IJYB 5E2UL 1QG3A 2NY7L 5IFHH 2NCMA 1YA5A 3MV7D 3FQRA 5D7JC 3QPXH 4I5BA 3SJVB 1RY7B 1FFPA 5I1LB 4OCMC 1RUAH 2WANA 3MCKB 4F2MB 2HT4D 1ETZB 3DVIA 3ROLB 1WLHA 3BKCH 3DRTA 4ERSH 3PWVB 2A73A 4JKWA 1INDH 1MWAL 5CGYC 3H3BC 4KJYA 3Q5YA 3PWPE 5BQ7A 3QI9C 1TIUA 5HHPA 4PJEB 4MDIB 4GRMA 4FNLL 4NQUA 3IS0X 2A6JA 1YEIL 1QLRB 1M7DB 4F9PA 2FBJH 1I85C 5DFTA 2H9GA 2OMNA 2DQEH 2NTFA 1EEZA 1XIWA 1TZHB 3KR3L 3WXVL 4PRIE 4GMSH 4KDTC 1XF1A 4MX7A 4BFEA 3HE6B 2VDML 2D31B 5E1HB 1F97A 3GMLB 3MLWL 4XI5C 5HGAA 2FGZA 2PXYB 3B6SB 4G43A 4JANB 5DUPL 4DVRH 2FX8H 2AK4A 4D9QD 2EXWC 5BS0A 1RUPH 3OQ3B 1UEMA 1LHZA 5LGJB 1I3GL 5E56A 2VLLB 5K9OB 1KLGA 2P45B 4TVPD 1R3KA 2OSLA 3MXWL 4NWTH 1E4JA 3O0RL 1V3KA 4HKXA 4OLZH 1D6VH 1MAJA 5EO0A 4QOKB 4MA1C 3KXFB 5ANMA 2O61B 5EA0H 3MREB 1L4IA 1X5XA 4G8IA 2FHFA 5ENWA 4P3CL 3QHZL 4Z7WF 4MZ2A 3UJIH 4KRLB 4JQVA 2Z35B 1LP9B 1MAKA 4M8VA 4O02H 1VADA 3KS0H 4R7NA 5D8JH 3CFDB 4G6FD 4RFOL 1U92B 5D7LB 3HC3L 1A5FL 4NCC2 1TETL 1JHTB 4WFGE 4XBGB 4X6CB 3LIZH 4KROC 2K7QA 5GGTL 1VGEL 3KG5A 1M6OA 4FTVB 5DRWB 1SJVA 3A67L 4EOWH 1YMHB 2LU7A 1KPUB 4WUUB 1I1YA 2DQTH 5L2JA 3AREB 3VJ6B 1IZJA 4LHUA 1QACA 1J0ZA 3CFEA 4MNQA 3RVWD 4LSUL 1NAML 5J57B 3T3ME 1R24A 2C3VA 3GJFK 4Y4HA 3V52L 4E5XA 3V8CA 4JY6B 1TCRA 4XMLL 3DUSA 1YUHB 3DARA 4JKKA 4GRWH 1YQVL 4MD0B 1G7LA 4H26B 4HMEA 2OBGA 5IW1B 2JCCF 3U0WH 3X11B 1K2DB 1CD1A 5J11B 2IBGA 4F37K 5B3JE 4H1LH 3LKPA 2QADD 1XGTB 3VRLE 1YPZE 4JVPA 2I5YL 3SCMC 5GZNC 2DL9A 4X6BA 1SJHA 3VE0A 2KKQA 1QUNA 4DAGH 4A6YH 4ZQKA 3TH4T 4NYLA 4RMWA 1C08B 4P57A 5D1XD 4O5LL 3UPRB 1KTLB 2APVA 2Y25A 1CLOH 1YEEH 3ZTJG 3UYRL 2Y5EA 3O41A 1AI1L 2IAMB 4R4BB 1KXTB 4QHUB 5EOTB 1KCUH 3B9AA 2F15A 3GSUB 5FUCE 2FO1A 4HXBH 4I18C 4M5ZH 3RNKA 1TNNA 4BZ1H 4NN5C 4WEBL 4AENA 5FOBA 4WJ5A 2OQJA 5KVEH 1T0MB 2ERJB 4JFDB 2J5LC 4IRJC 4ZFOL 3MUJA 4YHYC 1ZANL 1PYWB 1ZLUH 2Q76A 1F4XH 4PS4L 3NCJH 2VH5L 5IVXA 1JPST 4OZIA 4LLWA 3N9GL 4U4BA 5F7EH 5FFLA 4OCWH 4FQXA 4GUPB 4LVNB 3FJTA 3T77B 3CXDL 2MSPA 1P9MA 1W0WA 1FJ1A 1B4JL 1DUYA 1MPAL 2NY6D 1EO8L 1D5IL 1R3HB 5ACZA 1CGWA 4N1CA 1QNZL 3TO4B 4GG6F 5HGBA 1YJDC 2FR4A 4W6XB 4KDWA 3VFUB 5I1DB 1E27A 1UWGL 3QIUB 4R0LB 4R2GC 4EDXB 3MODH 1EK3A 1ZT4B 4OLWH 4ELKA 3LEVH 5E8DL 4PJ5B 3WJLC 5F6IB 4WO4D 5FKAA 4FABH 4HS3B 4H5SA 4GLRH 1MNUH 4KMQA 1MCPH 3NABL 1RPQA 1G9MC 5HPMB 1MVUA 43C9B 3PDDA 1LEIB 1F6AB 3CVIL 4OCXH 2H3NA 5AYUL 2DLHA 2P5ED 3CNKA 1AXTL 4YK4B 4DFHA 1WZ1L 4P2RA 5C07A 1Z5LB 2AJUL 1ZGLB 1H3TA 2Q86A 3ZYOA 2Z9TA 5JOFB 1A7BA 1S9WB 3GGWB 1EV2E 2CLRB 2X70B 3BW9B 1KB9K 3VFWA 3WE6A 4LFHG 4KZDH 5FHAL 4F58H 1YMMD 5I1IH 3U2SB 4UQ2B 4NUGL 4UT6H 4MB5A 1A6PA 3O45A 2LQRA 15C8L 2AJ3A 1IC5H 5E24E 2R9HD 1SJEA 5HVGB 1HIML 4ZG1A 5ICYB 1JGDB 2F74A 2NQCA 5IT2H 3U79A 4EQ3A 3CX2A 2B8OT 3C6LC 5B39A 5A16A 1Q9KB 3IRPX 1BBDH 1I3RB 3L3JB 3GSWB 5EUOE 1P5VA 2YA0A 4AH2B 4QHMA 3TT1H 2NY5H 2ZSVA 3GB7B 2NY0B 2BSRA 4N0YL 4Q6IA 3RTQD 1AC6A 3ZSTA 4LCYB 3QCUH 5C0CA 1I7ZA 1I7RB 3ALWA 5J06A 1NAMB 2YKLL 1F8TL 4KDVA 2EEDA 2VQ1B 3BZ4A 4R4FH 2PYEA 3G6JB 1AIFB 4HHAB 3MRKB 3ARBC 4RBPK 5TQ0L 1KENL 5D7SL 1FFPB 2XTJC 2WQRA 5SV3A 3ZO0A 1T6WA 4KPHL 4G6KH 3DHJA 4OGXH 5FGCB 2ENYA 1RQ5A 5SWSA 3WIFB 2A73B 5F1NA 4O51A 4JZNB 4ACPA 4OJFH 4KGJA 4Z7NE 3EOTH 4XGZB 2VDOL 4KJYB 5FA3B 5BQ7B 5J0BA 4IS6A 2I60L 3PXHA 2VXUH 4XX1E 3BZDA 2NYYC 3CSYA 4M43H 3QP3A 1RV6X 2XN9E 3UZEA 4B41A 2H9GB 2YN3A 3MRNB 2NY3C 3I02A 4ZOBA 1MQKH 1S7QB 2NTFB 1EEZB 2EIZA 3DIFA 1E0OB 3O6ML 5C08D 5I9QB 4KK9D 3PHOA 3NCCB 3U7AA 3QG7L 2GSGA 2P1YA 1OWWA 3L5XH 4B53A 4J4PD 1NEUA 2AI0H 4G43B 1IQDA 2ADIA 1YEKH 3AB0C 2ZNXA 4U7KA 2AK4B 4QWWD 1MFDL 5BS0B 1HHGB 4KJWD 3EO9L 5DK3A 4P9MH 2A0LD 4ZFOB 4LPWA 1A6UL 1AGCA 1Q94A 5TE7H 5I1JL 4Z77A 3MCG1 1WIOA 5GGVY 5AYQA 1GZQA 1MRDH 4ZYKA 3H9SA 1RZ7L 3HZMB 1Q9WB 1DBBL 4OFYA 4M6AA 5M7QA 5LAXA 3EYQD 4RSVA 3BWAB 4YUEL 4HKXB 4QHNA 2PO6C 4HKZA 5GQBA 5EU5B 5TE4L 4ZXBA 4Z95L 5ANMB 3MRRB 5D7IE 4G8IB 4OD3L 4IMKA 4JFEB 5ENWB 1L0YA 1A1MA 3CAFA 3D1MC 3MR9A 4JCLA 5IW6A 1A6VL 4D3CL 1NDMA 4JJHA 4X0KB 3WCYA 1VADB 2YSSA 4OI7A 2KDGA 2K3TA 4R7NB 3O3AA 4XPHL 3OR7A 4UINH 3T0AA 2Z31D 4CBPA 5EZLA 2MMXA 5D5MA 3DWTA 2EH8H 4HQQL 5I1EH 4ZTOL 1Y6KR 3ULUE 4P5KA 5TF0A 4PV9B 1I1YB 3F65A 4U6HA 1NFDE 2VDLH 5ITBL 2UZYB 4LHUB 5AZEL 2GITA 4MNQB 4HJ0D 3KLAA 5T3ZE 4HS8H 3CH1A 4RGOH 3WXWH 4Y4HB 5JO5B 4E5XB 2IPUG 3CK0L 4R26H 5DT1L 3ZHDA 5D72L 3NH7H 3AS3A 3V5HA 1BAFH 4S1QL 1G7LB 3ZYZA 4Z7OF 4W6WB 5ITFA 4ZNEA 3CMOL 4PLJD 3BIBX 4U2ZA 5IV2A 2V17H 5LJYH 1DE4B 3D85D 5KVGL 2QSVA 5I1KH 3WNNA 1JBJA 3IGAA 3QDHA 3DECA 2LVEA 4N0UA 4X6BB 1R0AH 3CVHH 3MRDA 4AY0A 2X5PA 1MVFA 1SJHB 2HMID 1I9JH 3QDJE 2BMKA 1MF2H 3O6FB 5DJYB 4OSUH 5CKAA 3BT2H 5L2KE 5DMIL 4GAJL 5EZIH 4GG8A 5KVDL 5F3BA 5LGHL 2XWBB 3CLEL 4NPYA 2BNUB 3DOSA 3P4MA 4P57B 1U8MA 5JXAL 5CLTA 3UO1L 1N5AA 2KBGA 2QQLL 4ZDHA 4QT5A 3QRGL 2Q7YB 4Z8FH 3IDGA 4LNVA 3WKML 4KRMB 3O41B 4MYWB 3WS6C 4DTGL 4KZEL 2W65A 3PHQB 4GRWF 4EZMA 1UA6L 2AV7A 4ENEC 2LU4A 4IOFC 1X4YA 3GHBL 4ZS7L 5B3NA 4Z7WB 4UIMA 3E2HC 4V1DE 5ERWB 2E9JA 5CJOL 3RNKB 1F58L 1ND0A 3P77A 3WV0A 3HE6D 5FOBB 4WJ5B 5KBNC 4BFBD 1IGTA 5DJDB 2FYYA 2Q76B 4H88H 3RIAK 1DLFH 2PTUA 2CMRH 3C87A 4WWID 5KN5B 4OZIB 3HAEA 3T04D 4LLWB 1JWSA 2QEJA 3D0LB 1Y0LB 1W0WB 1FJ1B 1DUYB 2H45A 1HYRC 1IAMA 3QIWC 6CGTA 3FB6A 1UADC 3WBDA 5HGBB 1EBAA 4U1LA 5FUOH 4JN1H 1E27B 4QGYA 2J2ZA 4KJPD 1NCWH 2VZSA 5FO7A 4OLXL 4ELKB 1KCSL 4I1NB 4QOKD 1CF8L 5INDA 3WNMA 5LQBH 1IFHH 2D0GA 3DYOA 1QSZA 2Q8BL 2FIKA 4M7KH 4ONGL 1RU9H 5FKAB 3TVMC 5EUOF 4H5SB 1GHFH 1J88A 4HJGA 5D1ZD 5IKCB 1NLBL 3ZKQD 1MVUB 2PF6A 3QUXA 1IGCL 4XBEH 1AD0A 1JCKA 4FTVD 1CD8A 1OAZH 4QRTA 4U0RC 3W0WA 4ONHA 3PG2A 4JKPL 3KXFE 1J8KA 1T89A 5IMKB 3ARTA 2MKWA 2X4OB 1EAJA 1T1YB 3IDUA 9CGTA 2FB4L 1BX2B 2B5IC 1INEH 3HRZB 2VWEE 2Q86B 1LP9E 5IFHL 1OAYL 4G9FD 1A3LH 4XVJL 2OL3A 3QPXL 3VFWB 3WE6B 5D7LE 4M00A 1JZ5A 4TUKH 4IRZH 4XTRD 1A14L 4EVNA 3GMNA 3EJZC 3JV4A 4ERSL 3BYYA 4Y7MA 2Y23A 2B1HL 1FFOB 3TZVD 1KFAH 3S4SG 3KLHC 1V8HA 1FVEB 5A16B 3SOBH 5HHMB 4XH2A 4XVSH 4S2SB 3QDMD 1Z6JT 4JCMA 4NOBA 2ZSVB 3MYJB 2FBJL 4P9HL 2HT2C 3L5IA 5JA9A 1UG9A 5TE6L 5C0CB 5EC1A 4HH8A 5E7BA 2DD8H 2FATL 3BZ4B 4D2NA 3BGFB 3MV8E 4POUB 3Q6FA 2C26A 2GT9B 1CL7H 3RY6A 4JFDD 4C56D 1BOGB 4LBEA 4LSSH 4HZLA 1A6ZA 3LKSA 5C6TH 4KK8D 4OZHE 4JREB 3RPIA 2VABB 5F1NB 2D03H 2FZ3A 5D7IF 1GZPB 4O51B 5HDLA 3IJSA 4DCQA 3HMXA 4OGZA 5KZCB 1RZIA 3JWOH 3K1DA 5IWLC 3TO4D 2EE9A 3EDFA 3JWDC 4Y4KD 5ID1A 5BXFA 2APWA 4WFHE 3PQYA 3MV9B 3QIUD 1MI5E 5DD1H 4C58B 4JRYB 4UI2A 5BMFL 2Z8VC 3I02B 1QYGH 1MFNA 4Z0XA 5KVFH 4IRSC 5DDHA 2ZCHH 5IP4A 1UC6A 4WI2A 2Y1VA 3D3VD 1IQDB 2ADIB 4QTIH 2V2WB 5BVPL 5DWUH 4KK6C 1ZGLP 3RQ3A 1AGCB 1Q94B 1J8HA 2IJ0C 4P4RA 4Z77B 5KW9L 3DX7A 3VFNA 5ADPH 4PJ5E 4IDLA 1U2CA 3FO0H 1YYMH 5IFJB 1V3MA 4OGAD 4ZYKB 1YEJH 2B4CH 3H9SB 3MLVL 3HA0A 1YY9C 2G2RA 1S7XB 2Y6SD 4QHNB 4RDQG 3PP3H 4HKZB 3MBEC 4M48H 4ZXBB 3UJTL 2JLLA 4PJBE 4LU5H 3BP4A 8FABB 2W07A 3GSRA 4HSQA 1WK0A 3IT8D 1OF2A 4JLRA 1REIA 3MR9B 2IANA 5IW6B 5FDWB 5E6IA 2YRZA 5JOEA 3GUTB 1JPTL 3VGHA 2IPKA 4XPFH 3MRGA 1HXMA 2YSSB 1FNSH 5FYJE 1A2YA 3OR7B 4LCIH 2YD9A 3IU4H 3BP7B 3CPLA 1E4KC 5D5MB 1P1ZB 1YEFL 2YRLA 4JPKH 5EOCL 3K80A 4U1IB 4DOHE 3WO4B 3CFCH 4G6AD 2HA1A 5AG9A 5F93C 4Z7QE 4U6HB 3TH3T 2M2DA 1MFEH 3KLAB 2F19L 3BQUA 4HXBL 2RFXB 3CH1B 3BPCA 4N5EC 1INQB 3NZ8B 1CDCA 1WEJH 1HHKA 4M5ZL 4U1KB 4ZUSA 4N8VG 4NZRL 1WSST 4X7EC 3V5HB 4TULH 2R2EA 5ITFB 1F4XL 3QPQC 5CBAA 4L8SC 4FFVC 2FX7H 1HI6B 1OSPH 2V9TA 3CUPA 5F7EL 4OCWL 1RZKL 3IETA 5DMKB 4NO3A 1I8LA 4PRHE 1IC1A 4N0UB 2G75A 5HPOA 1J10A 3MRDB 2FL5A 1A9EA 3KJ6H 1ZGLM 2BMKB 4HCRA 4L3CA 2F54D 4QY8A 4KGLA 4GG8B 5F3BB 1KXVC 3MODL 4PJHA 3VXOB 5IBTH 1AC0A 4NPYB 4OLWL 3FQXA 4YBQC 4PLKC 1N5AB 3QB7C 4TOYL 1YECH 3FQTA 3JV6B 3RA7L 2X4SB 5DMYA 3BISA 5EPMA 4KRPD 2W65B 5KOVC 2ZP0T 4PG2C 1MCPL 4JO1L 4UIMB 1QFPA 2KL6A 1NUDA 1QOKA 2VISA 4E0RB 3SQOL 3OBAA 4GFTB 1P2CB 2IPTH 5EG6C 3SDXF 2GSIA 3W5NA 3UBXG 1JPSL 4OCXL 1KB5H 1IGTB 1NMCB 4BZ2H 4HK3J 5FAAA 1YC7A 5E5MB 2DRUA 5EWIL 2DM2A 3HAEB 2IQ9H 1BVLA 4K8RH 4NBZB 1U8HA 3VI4E 3C9NA 5JIHA 3FB6B 3D69A 4WHTB 5C0IB 1D5MA 1NGXA 1BEYH 1RAMA 4UT6L 4U1LB 3PDGA 4I4WA 3KYKL 1QR1A 5FO7B 2ZUYA 3P4OB 2AK4E 3DX9B 5INDB 4PJ8A 5BS0E 1KOAA 5DVKA 5TPWL 5IT2L 4BUHA 1ED3A 1FG2A 4HJGB 1JNHA 1TVBA 1BBDL 3KDMA 3FQNA 3D48R 3K4ZA 3TEUA 5C1MB 3QUXB 4U1NA 1AD0B 4DN3L 4TNVK 4QRTB 2JJSC 3AS1A 4ONHB 2FSEA 4K7PY 4ZFFA 3NCYP 3RZCA 2RQ8A 5GGSB 3P0VL 2HT3C 1J0JA 1WZKA 4ZUUB 3BD4A 1ORSA 3QCVH 4BQ9A 4ODUB 3ZHKA 2Y5TB 4GRWB 2EE6A 2OL3B 3GDBA 1FE8L 3FL7A 1Z3GH 1NC4B 4OZHF 4PP2A 2CQVA 4RGMC 3J8F7 4EVNB 4YX2H 4H1LB 3GMNB 3FFCA 4YDIH 4HCRL 2PW2A 5B38A 4WIQA 5GJTH 4MNQE 3IDYC 4OJFL 3OXSA 2GFBA 4OF0A 2WBWB 3NVQA 1ZT1A 2R56H 3SHSA 5IGXL 4Z76A 3O6FD 4KI5C 2DLFL 1RK0B 3Q5OA 3LPGA 3QZWA 3S96A 5IROA 4N90D 2GYSA 2AGJH 1MQKL 1ZHKA 3QA3B 1LQSR 2QSCH 5EC1B 3G9AB 1JNNH 2CDGA 4I9WD 4LVHC 3QEQB 1DSFH 2EXYD 2GAZB 1FVDA 4JJ5A 4L5FL 3ARFC 2JJUA 1OW0C 2AI0L 3TN0A 3Q6FB 2B1AL 2XQYG 4EUPG 1AQKL 3V4UL 2V7HA 4YGAB 4M3KB 4Y5XC 1XGPA 1T80A 4GSDL 3V0VA 5L8LB 1AH1A 3K7UA 5TE7L 3EYUL 4JRXD 4Q58C 4LBEB 1I1AA 1Q9LA 4N0CC 1FL6B 1A6ZB 3LKSB 4LLYA 4ZUWA 2HKFH 3GI8H 1MRDL 3RPIB 1RJYB 3PV7A 3AXLB 2PCPA 2GK2A 4PJBF 1EHLL 5CINH 1FGVH 4GKNA 2FZ3B 1I85A 4OUUA 3QUZC 1ZA3B 3VW3H 3TIEA 3QJFA 4P59L 3HG1B 1LVEA 3FB7B 2ZUSA 3TPKA 2DI7A 4UNVA 2Y72A 3M1BA 5IVXE 1IC7H 4OZIE 3C8KB 1YNKH 4W6YB 1NBYA 4X9IA 4GXVL 5I1EL 4Z7QF 5T1MA 4MVBC 4Y4FA 4I0PD 3I3BA 4OBSA 5ICXA 1P53A 2LABA 3CDGA 2H2PD 3D18A 3EGSA 1X9QA 3M17B 3U6RA 4RGOL 3WXWL 3IB4A 4HIJA 1WAAF 4ZSOA 4YHIA 3ABZA 5HHOD 5HXMA 1J8HB 4P4RB 3DX7B 3LZFH 4M1CC 3VFNB 4NO2B 4R3SB 2ZNWA 1AGFA 1PKQE 2G2RB 2GKIA 3JUYA 2V17L 4TRPH 2NMSA 3BP4B 5EFIB 1BZ7A 4OLUL 1UEYA 1E4WH 1JHLH 4JLRB 1HQRA 2IANB 4TPRH 5E6IB 1SHMA 1I9JL 1ERNA 4JFHE 4JPWL 2QHRH 1CXEA 5FYKD 3ECBA 4OSUL 5D1QA 3MRGB 2GI7A 5T1LA 5EZIL 4P2RE 1JF1B 5C07E 3CPLB 4KU1A 1A1OA 1K8IA 1OTUC 3KGRA 4NQDD 2XT1B 1CFVL 3U0TA 2IF7A 2QJDA 4ODWA 5F70A 4LHQB 3OXRA 3WIIL 3O8XB 1SBSH 4DKFH 3FT3A 3T3PE 3BPCB 4P2QB 4U05A 1DN0A 4ZUSB 1IBGH 4E41A 4JHBA 1Z2KA 3SCMA 2APBA 1ZLSL 3V6FB 2FRGP 4WWKA 3MJ8A 1AGBA 4H88L 2GW5A 4GBXA 5CBAB 1DLFL 5HHME 5J6GA 4RISL 2UWEA 4XMKL 5ELIA 3CUPB 3K4DA 3IETB 4NO3B 5BJTB 1LO3L 1LDPH 2G75B 3DI3B 3G5ZA 5KAQG 3TESA 1A9EB 1UCBH 4L3CB 1N3NB 5HTSA 4JN1L 5DD6A 5FV1L 4LKCB 1QBMH 3EJJX 4PJHB 1NCWL 2UZIL 2PYEE 3AGVA 1QQDA 4I18A 3FQXB 3TM6A 3P4NA 4M1DL 4XNMA 4JFPA 5LQBL 3MA9H 1IFHL 1WCBA 3D2UA 3SKMA 1GOFA 5T3XH 2CR6A 4MS8D 1GHFL 5J4MA 3KYMB 4JZOA 4JRYD 4BSVA 1UT9A 1FPTH 4G7VL 2P8LB 1EIBA 4Q74A 1T2QH 3DETD 4MDJA 5SWSE 2NXYD 4OF7A 4XBEL 4HEPG 5FCSH 1HN1A 2GSIB 4Z0BH 5JXEC 3PWPD 1UH3A 2XZQH 3LB6C 4U49A 4PBXA 4XBPB 2NY4B 3ZE1E 1ZE3C 3WLBA 3H42L 5DC4B 2P5WA 5C3LD 1INEL 2OR9H 2HJKA 1BVLB 1S7WB 1U8HB 3MOBL 4PRID 5CMAA 1P6AB 4FN0A 3SO3C 1D5MB 1NGXB 4G8EB 4PJXF 1CLZL 5DMGC 2P24A 2COQA 3SGJC 3OZ9H 1HOCA 3V6ZA 4PJ8B 5JW5A 4I3RH 1BHGA 1FGNH 3OB0K 5KS9B 2VC2H 1ED3B 5CD5C 1FFNA 1FG2B 3SOBL 1JNHB 1TVBB 1KNOA 3KDMB 3FQNB 4FFZH 2AQ1A 3H9SE 3HUJA 3T4AA 4J6RL 3SKNB 5DRXA 2ZUQB 2WP3O 1RZJL 4XRCA 3MROA 4JO2H 4P2OA 4ZFFB 1EJOH 3ARGA 3AROA 3DO7A 1K4DA 2DD8L 2VAJA 3LQAC 1CIUA 1QEWA 2KQMA 3MBXL 3PGFL 5JDSA 5I6XB 1JRHH 5DHVH 1CL7L 4OQTH 1RIVL 2ARJQ 1DCLA 4MQTB 3C2AH 1O7VA 2EDJA 2V9RA 4LSSL 5IBUG 3C6LA 1AD9A 1A7PH 3T0DA 4CMHC 3SDXB 3FFCB 5B38B 2D03L 1IZKA 3GKWL 3ULSB 2WMPA 1GGCL 1U3JA 2WUCL 3BRFA 3JWOL 1O0VA 1ZT1B 2V5SA 1F90H 2P46B 4YH6A 3SDAC 3LS5H 4PYHA 3KLDA 5DD1L 5H35A 5IR1A 4FQ2H 4ZNEE 2YXMA 4WW2A 1KCRH 1ZHKB 5IB3B 3WIHA 4DW2H 3N50A 3UTTA 1R3LB 5KVFL 3L3GA 1NBZA 2ZCHL 1KGCE 3OPZH 1P7QA 1FVDB 4JJ5B 1CXIA 5F97E 5CJXA 3X3FL 3D39A 2GHWB 3VWKA 3KVQA 5E9DB 1NDGA 4M93C 4NKMA 4NT6B 3UTZA 2NZIA 4GO6B 3V0VB 5DWUL 1FAKT 3IF1B 3VI3E 1QRNB 1ZHNB 5KSAD 5DLML 3DV6A 3NZHH 1I1AB 1YQ2A 1Q9LB 1S7TB 1OP3K 4PV8A 5ADPL 4ZUWB 1WCQA 1P4BL 4Y5VA 4NN6B 1T0NA 5I0ZA 1IEBB 3H7LA 4UU9A 2B4CL 3UDWC 2PCPB 3FAWA 3WNKA 3V4VH 3UJJH 1TQCC 4BQBA 4RWYH 3V5KB 1ZHBA 4GKNB 1N26A 4OUUB 3L95A 4M48L 1SY6A 5MENA 5J7CC 3F7YA 1I4FA 4OLVL 4KKAC 2O5XH 3F7VA 1DR9A 1A6AA 1M7XA 3OKNB 1DQDH 3NTCH 5D6CA 1OTTD 3H0TA 4XPFL 1R3IH 1WUNT 1T3FA 1SEBA 3M1BB 4LCIL 2OXGA 3IU4L 2P8PB 3HB3C 2EDTA 4JAMA 5MEQB 3GSXA 3U7WH 3O4OC 1A7NH 4KTEL 5SX5H 5T1MB 5HI5C 3S8WA 4W68A 4Y2DB 4Y4FB 4KKLD 3T3PF 1KIRA 4APQA 3CDGB 4DZ8A 3OB8A 1MFEL 2BK8A 2VO5A 3D18B 4WY7H 2XY2A 3JSSA 2R29H 4NKIL 5BZWA 2PO6A 1WEJL 4L3AA 4NCDA 4ZSOB 3RVTD 2E9IA 4JPIA 4YHIB 4G80A 3ZT5A 1RUQL 1IRAY 4JFFA 3WLWD 1J1XH 1CWVA 1T0PB 1TQBB 1DQLH 1DQQA 4TULL 3RWCA 5LCVH 4S1DC 1AGFB 4PB0H 2JE8A 4HH9A 3ARUA 3QO1A 3HMXH 3IXTB 2IBZY 1NMAH 1OHQA 1JYWA 5T1DL 1BZ7B 4D8PB 2HLFC 1HQRB 1NGZA 5TJWK 3DURA 3W0WE 5DS8A 1JMXA 5D1QB 1EEYB 4D0CB 4DEPC 5T1LB 4KHXH 2VN4A 1CXFA 5IBTL 2G60H 4NZUH 1K8IB 4MAYA 4W4OC 4F7MA 3ALXA 3C5JA 3QULA 3U0TB 1J1PH 2VYRE 3WIHL 3P11H 3O9WD 4M02A 3OXRB 4NHUB 4OLYH 5GSVA 1QKZH 1WITA 1BD2B 3LEXA 4YGVA 1DN0B 2H26A 3ZKNC 1X6NA 1TJIL 1N7ML 3G9VA 4WWKB 5FYKU 3MJ8B 4NGHL 1JN6A 3ZE1F 5L8JB 1KB5L 1AGBB 3ARPA 5GGRA 3P73A 4Y1AD 4DUWA 5J6GB 1IEAA 5DYOA 2IQ9L 4QXUH 4XNZC 1ZMYA 4QXTA 3ARZA 4PJIA 4K8RL 4X7CC 3W9EA 4MAUH 1R5VB 1D7FA 3PL6A 1C5BH 3V5DA 4PRNA 1Q72H 2UUDH 5C0RL 4QRRA 3DMMC 3HZYA 1QQDB 4LK4A 4X6EA 4XNMB 3HE7A 4JFPB 3U30B 1WCBB 5CGMA 4OIAA 1X44A 5IMLB 2R8SH 3FO1B 4HJJH 3I75A 3HG1D 4AK1A 2YD5A 4U1SA 5BV7L 4JZOB 3EBAA 1VFBB 2AXGB 4BSVB 5MEPA 4GKSA 4OFKA 4M1GH 4R8WH 4MDJB 2EDHA 3REWA 2WBJB 1MCRA 1QRKA 2X05A 1L0QA 4JO4L 4POYA 1IC4H 1BVZA 3VXTB 2YD3A 1XR9A 2N7AA 4YO0A 1G9EA 2P5WB 3PQYE 2V7NA 3GBNH 3O4LD 2XN9D 4DWHA 4PTTB 3ISWA 2DQUL 2XY1A 4PUBH 1Z3GL 4L4VA 3CIQA 5CMAB 5JHDA 4K9EH 3WN5C 5DJ8B 5I76B 1MELA 2UV3A 3C09B 4JDVA 1KTKE 2PYFA 3DVNB 1DP0A 3TP4A 1HOCB 3BI9X 4D94A 5I1AA 2QQNH 3O6KL 5JW5B 3VFMB 5DRZA 1J8HE 4RDQF 4PJFA 4Y16D 1ZHLA 1OP5H 2NY1C 4LCWA 2J6EH 1CE1L 4B7IA 3JTSA 3HUJB 3S35H 1C5DA 3T4AB 4ETYA 3NPSC 1W72H 5DJCA 3MLZL 4P3DA 4XRCB 3MROB 1XCQA 2F53D 3ARGB 2EDQA 3HKFA 3NIGE 3DO7B 2NZ9D 3O8XD 2ZOLA 5C92A 1LO0H 5JDSB 3VI3F 2IH1B 4MA7L 4Z18A 1A7RL 3ULVC 5INCA 3OJ2C 1QP1A 4NQEE 4X6FA 2R0LH 3QUML 2HKFL 3GI8L 1EGJL 1CN4A 3Q6GH 3SDYH 1RZ8A 1QSFA 4OGYH 1KACB 1FGVL 4YXKH 1WBXB 4LAQH 1YYLL 1ITCA 4M6NL 1CICC 3CJJA 1D5ZB 1Q38A 4LLDB 3IJHB 4IIQC 4KK9C 2VDKH 4P5MA 1Z9SA 4HUWA 1RSFA 5H35B 1QPXA 1BWWA 4NWUL 4NDMB 5DEGA 3VFSA 3LRSA 3OKEA 1UM5L 2IGFL 3LMJH 3HNVH 3UTTB 4B0MM 1IC7L 2A0LC 4PJXB 1YNKL 3L3GB 3REVA 1NBZB 1JI1A 3RDTB 2W9LA 3RFZC 3MRPA 1XF4B 4LIQL 4TTDD 1P7QB 5KSBE 2A6DA 3D39B 1F13A 1HKFA 4NKMB 3UTZB 4DKEH 4LAJH 3ULUC 3WFBH 2XQBL 1BP3B 3QJHB 3L1OH 3UXFA 4HFWB 5IWLA 4GXUN 2VDNH 4PV8B 1MCJA 1XGQB 3RY5A 4Y5VB 4HLZG 3P30H 1T0NB 4PBVC 3QNZB 4UU9B 3LKQB 2QLVB 4Y19B 5LG1A 3U4AA 1FNEB 4DGYH 1J11A 2W0PA 3KPSE 2AJSH 2BNRA 2Z31C 3L95B 4V1DD 3B5HA 4TRPL 4YC2C 3F7YB 1VGKA 5GPRA 1CR9H 1E4WL 3F7VB 2FJFA 4MHHG 2AJXH 5D6CB 1J0YA 3H0TB 3VG9B 3HMWH 1P6FA 4UQ3B 3NACL 4K7PX 1DQTA 2YHGA 3BPNB 2IG2L 1T3FB 2DIAA 1SEBB 3RKPA 5JMOC 4U6YA 1RJCA 4JAMB 3TGXA 1LGVA 3RAJH 1VFUA 5BV7B 3BOVA 2ICWA 1QLFA 3RGVD 2BVEA 1LK3H 4OD1L 4EIZC 2R2HA 3ARSA 3EO0A 4APQB 1SBSL 4DKFL 4RMUA 3ZT6A 5BZWB 1PLGH 1NMBH 5C7XH 3MBEA 4DVBA 4JPIB 4G80B 4EDWH 3GSNH 4JFZH 2G9HA 2BVPB 5CZKA 2C3WA 3K46A 1D9KA 3C8HA 2WUBH 4HH9B 3QO1B 3MRHA 2YPLD 4L3EA 3IAGC 1T5WB 1LDPL 5IUSA 4XNUH 5F6HI 5JDJA 3QQ9C 1J87A 5DS8B 1FO0H 3PWNA 4OKVB 1T83C 3S3JA 4UDUA 1YN7A 3C6SA 4MAYB 5A43C 4F7MB 4P4KA 4OZGA 5MI0B 2IALA 3C5JB 3MA9L 2ADJA 3SDDD 2BHYA 5T3XL 3VH8A 4LEXH 3QAZB 5M95B 4LRIC 2PXYC 3F12A 1J86A 3TBYB 2XTLA 4G7YH 1FPTL 3BWUC 3WFCL 4NFBA 4L8SA 3LEXB 4IDJL 4YGVB 1T2QL 1GOHA 5CWSA 4LRNH 4F9LA 3BN9D 2HVJA 4KMTL 4AIZA 1I1FA 4QRQB 3H9YA 2C9AA 2WIIB 3VWJB 4FG6D 3MJ9H 3BKMH 5GGRB 3CDFA 5CHNA 5JOPE 2IEPA 3P73B 3V6OC 3W39B 1IEAB 1R5WB 2HTKC 4XNXH 4YPJA 1T04B 2OR9L 5E99L 4HFUH 1AR2A 4QXTB 3WDHA 1QRND 3W9EB 1U8QA 3QUMB 4ZTPH 1I8KA 5KTEH 3NPZB 3DV4A 3PL6B 2E7MA 4GMTH 2X44D 3V5DB 2EZ0D 4NNPL 2VWEC 35C8H 2GQHA 2R1WB 1MCFA 1MCEA 3U0PB 2ICES 4NC2B 5DZOA 2YXFA 4KMLB 1U3HA 4IOIA 3QFJA 4Y88A 2QBWA 3MV8D 2MNUA 3EYVA 3MGAA 3HZYB 4X6EB 1A4JA 2JJTC 3QR2A 4PJGF 1HH9B 3HE7B 3MLTB 4XB8A 1BJ1J 4G3YL 4HMCA 4X83A 1FGNL 5FM5O 5FHBH 1KJMA 2VC2L 2W0KA 5JHLH 2R23A 1SYSA 3AREC 5MEPB 4GKSB 4XNYH 3LSOA 1KEGH 3Q2CA 4KHTH 5CLWA 3VRIB 4FFZL 4XAWH 3EUUA 3REWB 1A9BA 3GJFH 1UFUA 3K2UL 3L7EB 4RGND 2FBOJ 1D5XA 3BGMB 4AMKH 5CSGA 3S36H 3BP6A 3NIGF 1TZIB 5A2KH 4Y2DD 1XR9B 2VL4A 4NP4L 4WFHD 3OAYH 4YO0B 1MI5D 5J11C 3L9RA 2WWKO 4KV5F 3GKZA 1GCFA 1CXLA 1HXYB 1JRHL 3HPJB 2E9BA 4FQJL 1WZMA 2ATPA 4H8WC 4OQTL 5JHDB 5HYQB 3MRMB 3C2AL 1C1EH 1V7NH 4L4JA 2I27N 2X89D 1MAMH 4JDVB 5EZOL 3RWDB 2PYFB 3HR5A 1CFSA 2JB6A 4TYUA 3E8UH 4ZSOE 4HUVA 2OLDA 2IAMC 4QRPA 1F90L 3K3QA 1KTRL 4NRXB 3LS5L 3C60D 3B9KB 5J3HD 1N8ZB 1ZHLB 2YPVL 1OM3L 4LCWB 3WDIA 2GJ6A 3FQWB 1C5DB 1Z9LA 1KCRL 3WL9B 4K3HA 4DW2L 3BVNA 1F00I 1P4LA 4KKBD 2ERJC 1RFDH 1UJ3A 3FRUA 4JQIL 1XCQB 5KSBF 1PG7H 1V7MH 1CTOA 1YJDH 5F1SA 1PZUB 1EBPA 2ZOLB 2ZOKA 1BD2D 3RX7A 5LWYH 3THML 1DANT 4LVNC 3FRPA 2CKBA 5DJ6A 4HZAA 5INCB 3RL2B 2Q6WB 3TO4C 4M9OA 1NCBL 3QIUC 4R0LC 1G9MH 3WUZA 1RZ8B 1QSFB 2SEBB 3V4VL 2E6JA 3TYGH 2LV4A 1S8DA 2HN7B 3VXSA 1HWHB 4PR5B 1J0HA 5F6IC 2O5XL 3ES6B 4LLQA 4V2BA 4E41E 1IGIL 2I24N 3DVFA 3NTCL 4HUWB 4HEME 4ZAKD 1AR1C 1F5WA 3DUHA 5F7LB 3MRJA 1OW0A 4OB5H 1R3IL 5DEGB 3VFSB 1L0XA 1Y6NR 2UWEE 4GRLB 2C4FT 5CSZA 4PRHD 4YK4C 4PJDF 3BXNA 3S3PA 4UTBH 4U3HA 4QTHA 2FO4A 3SGKA 2DS4A 3KPPA 2BNQB 1ZOXA 3JVGC 1FLRH 1FYTA 2Y6SC 4JY5H 2WBJD 3F6LA 2R29L 4WY7L 5SWZA 4BFGA 1YY8B 4WI9A 4NQXA 1NLDH 3TA3B 3QIBB 3O3DB 3HRPA 3JTTB 3VRJB 1J1XL 3QUZA 4W4NA 1CK0H 4M6MH 1ROWA 3QHFH 1DQLL 4QRUA 5LCVL 4MD5A 3QWQB 1ZAGA 5EU6D 5JPNB 3LN5B 2FJHB 1NMAL 1H0DA 1VGKB 1N6UA 1XGYH 3IFLL 3STBA 4HXAH 2LFGA 1C16A 1NCCH 2ZPKH 3UBXI 2W91A 2XZZA 3GSOA 2NY0C 4KHXL 5IF0B 1FNAA 3S98A 1MOEA 4N0FA 5DZNA 2P5WE 1BM3L 3IFPA 2CLVA 4NZUL 4U6YB 3WYRA 5HYJA 2X4RA 2VLKE 1S5HB 3FCTA 3D5OF 3MOAH 4MXVE 5L9DH 4ZOCA 4TUJB 4K07A 3TO2A 4OUOA 2EYTA 2R2HB 3EO0B 3N1GC 1AQDA 4OCLC 1U58B 4Y8DC 4JPVH 3FT2A 4LL9A 5C3TA 1AP2A 2EYRA 4HUXA 4DVBB 4FMFA 5K33A 1K6QH 3NFNA 1FYHB 1CU4L 5D2LB 1D9KB 1M4KA 4OLEA 1MEXL 4OZFG 4X8JA 2D4FA 1XF5B 4DQOH 3HUJE 3I50L 2Q3ZA 4L3EB 32C2A 5GS0C 1ACYL 4LQFL 4X4YA 5T1KA 1C5BL 5J56B 4C4KT 3AU1B 3PWNB 3T1FA 5H37H 4F9PC 4XCCL 4R97B 1CVRA 4UDUB 2A6IA 3Q3GB 4U1MA 1XIWC 1YN7B 3C6SB 7FABH 2APTA 1ADQL 5HVHB 4P4KB 5I9QC 3VFTA 1BPVA 3UEZA 2R8SL 1WIUA 4PB9H 4HJJL 1T22A 3UBXB 2O93L 3WUWA 3LQMA 4M1GL 4R8WL 4ODBD 2HH0H 3IU3A 2ITCB 4M7JL 2HVJB 4AIZB 3WS3A 3V0WL 5EOQH 1IC4L 5H2BA 5ISZD 1VHPA 5GRVL 4WI3A 3B3IA 5CHNB 5JZ7C 5I1HL 1AO7E 3IS1X 4G42B 5FO9A 1DFBH 1QFWH 3U4EB 4U6XA 4BZYA 4ZUTB 2I9LB 1U8QB 3UTTE 3DV4B 2UZXB 5FYLH 4K9EL 3S34H 4GJTB 3MC0A 4MCYA 3HC0B 2XTJE 3SGDH 4K8RD 1U3HB 3QFJB 3EOYG 2MPAL 3D39E 4JFQB 3OAZK 2JIXB 1FH5L 3U36A 3NFSH 4L8CA 5CEZE 5DJXA 5C0ND 3VXNA 1ZT7A 2NX5A 1JWMB 1KJMB 5JXEA 2R23B 1P5UA 1SYSB 2JK5A 5A3IC 3B2UC 3C5ZA 1C7TA 1VEPA 2J6EL 2J88H 1HHIB 4Y4HC 2VQUA 4LP5A 3VD7A 3LY6A 1W72L 1M1SA 1XT5A 4NQCD 5MENE 2AXFA 4F7PB 3B8YA 2VLJD 2X42A 1RIHL 4MXWH 3L9RB 5I30H 1OPGH 3W11C 3CFJA 3P4LA 4F57L 1OGTB 2ATPB 5AD0A 1N5YH 1OD9A 1LD9B 3QISA 4XHJC 4MNHA 4Z5RA 25C8L 4ZO9A 1CFQA 4XMPH 3VDCA 3I9GH 4I2XB 1JPGA 3CDCA 3NIFE 3AVEA 2R0WH 3HR5B 4JR9L 1U8IA 4LAQL 4RFNB 1KPRA 4WV1A 5DMJB 1EERB 3MV7A 4U2YA 2DMKA 1TFHA 2ARJB 4HUVB 2WK2A 4JFFE 3O2WL 1WFUA 1IGJB 5IW3A 2GJ6B 2YOCA 2UWEF 4ZPTA 4EUPB 1KIPA 5DQ9B 1MUJA 3ARYA 4OFIA 3HNVL 4HIIB 1A1NA 3HFMH 1P4LB 1UJ3B 3FRUB 3VFOA 3QFDB 4YHLH 1UWEH 2DTMH 3U4BH 4PJGB 3KPQA 1UQSB 4KVCL 4CU6A 1BIHA 1AKJD 2ZOKB 2JF1A 1L9MA 4FQXC 2VL5B 3LKRA 2CIIA 1P9MC 5C07D 3LN4A 1Z9MA 4EJ1C 2DQFA 2CKBB 3WFBL 5IK3B 3EZJB 1WWAX 4EI5D 3L1OL 3VWJD 4NZDA 2OCFD 4R4NC 1BZ9B 2R2BB 4MA3A 4JM4H 5IM7A 1ZK9A 4D9LH 1FL3A 1TMCB 5JUEH 4DGYL 5IHZA 1S8DB 1U8NA 4RMTA 4LCCA 4RNRA 4F80A 1JI2A 2GJZB 3V79C 1CR9L 5IJKA 3I6GB 1RHFA 3GI9H 4J3VA 4R6UA 5FYJU 2AJXL 2W59A 2ARWA 3HMWL 4H20H 1LEGA 3QHTC 2DBLH 2ZCLH 4Z7UA 1I9RL 5ESAA 4XWOD 3ELAT 4WNQA 4MXVF 4CW1A 1B88A 5MHSD 3RAJL 1G7QA 4BELD 4C55A 2EKJA 4PJIE 4OTXH 5CSZB 4F7EB 3T8XB 3TCLB 1NBVL 5F7HA 4OM0H 4XPBH 4Q2ZA 3AMKA 3UDWA 5SWZB 3KAAA 5E2TH 2V5YA 5C7XL 4NQXB 4QRRE 4EDWL 5TQ2H 4XPAH 4NZTL 1JGLH 4ONFH 3UTOA 5IFAH 4JFZL 2JTDA 3KHQA 4QRUB 3VFGL 4KK5C 2WUBL 3TFKC 5B4MC 2DF3A 4YWGL 3AS0A 4GW1B 4XP1L 1H0DB 1Z9OA 4IJ3B 3A6CH 5F8RC 3RWGB 5C0FA 1YC8A 1ES0B 1EAPA 4AEFA 4XNUL 1C16B 3OKKB 4NQVB 1Q9OB 5IHUH 5A1AA 1FO0L 2X4NB 4RIRA 5DSCA 1XF2A 3GSOB 3F58H 2CK0L 3CU1A 5I15L 2RGSA 4RAHA 2CLVB 1OY3B 1MJ7H 2CO7B 5IJVA 5HYJB 3S5LA 2EIDA 5J1AA 4LEXL 5FM4A 3BAEL 4L4VE 5JHDE 1UKQA 3BGFC 2EYTB 2Z8RA 3L7FA 2P44B 4UBDC 1AQDB 4JHAH 1W72B 4EI6A 1A7QH 1VDGA 4JG0L 4M6OL 3FT2B 1YNTA 3VU2A 5CKGA 4YFLI 2EYRB 4HUXB 3QXUA 3MACH 1CTNA 5D1XA 1MLCA 1SYVA 3JWDH 3NFNB 5CP3H 4WTWA 1WBYA 4WDIA 3S3SA 1WFNA 4JFOA 4JREC 5F7DA 3MJ9L 4FZ8H 4X8JB 4P46D 4G8GE 3LKOB 4PJFE 4RQQA 3PWUB 4LCWE 4HFUL 4OFYD 5EDXA 1FFRA 5L7XH 1K5NA 4G8FA 4ZTPL 5KTEL 4X4YB 2OTUA 5CS7A 5T1KB 1OGAA 5DFVD 2FJGB 2EDYA 4QCIA 2IQAA 3MJ7A 2A6IB 4Z9KB 2GCYA 3DETC 4HULB 3FQUB 4PLNC 4YEFA 3VFTB 4HKJB 2NY2B 5C2UB 5FHBL 4NSKB 4UIKL 4NCC1 1CS6A 1CXHA 5CJQL 4XNYL 4HIHB 5T3XD 1XR8B 3IU3B 1PEWA 5GRZA 4AMKL 1NC2B 3WS3B 2EIBA 1MCCA 3TBTA 2OP4H 5IVNA 5H2BB 3B3IB 1WBZA 3HCVA 5I1GH 1L7TH 4LSVH 1JGUH 3MUZ1 1L6ZA 4ZXBC 3HC4H 1F3DJ 4X5WA 3DMMA 3TA3D 3QIBD 2AJZA 4IMKC 3TBSA 5C09E 4U7SA 2Z93A 4F15B 3L3OA 1X7QA 3LRHA 4MCYB 2A83A 1KGCD 1V7NL 3NIFF 3MXVH 1HHHB 1KPVB 3DRQB 1I8MB 1L7IL 1BECA 5IOPB 3ET9F 1PZ5A 4L8CB 3CSPA 5DJXB 4E42B 2VIRA 3WO4C 4X7TA 1WF5A 3G6AA 3E8UL 1M05A 3VXNB 2BVQA 2V5TA 5DQDH 1FNGA 2AJYH 4HK3N 1YMMA 3C5ZB 5D7JB 3WFEL 1CG9A 5FM8A 5BCAA 1S5IH 2AEIT 4NZJA 2X9YA 2BNRE 4OZFH 1J18A 4TSBH 1N59A 2AXFB 1T4KA 3FB8A 4ELME 3IVKA 1T7VA 5CP7B 5EBWB 1V7ML 3MCLH 3ZT7A 5IBUB 1FZOB 2FD6H 1OQOA 5CIPA 5TDNB 1DVFD 2AV1A 4WTXA 1KJVB 3QI9B 3GBLA 3CFJB 5AD0B 4JKLA 3RTQA 3ROOA 1YEGL 3BO8A 1P4IH 3SKOB 4JO3L 4Z5RB 2FX9H 4XP9H 1GXEA 1GVIA 3AC0A 1CFQB 5EZJB 4XCFH 2CO6B 1FG9C 1G9ML 4AJ0A 1D5BA 4J3WA 3TYGL 2XA8H 5CZXD 2L4OA 4LF3A 1U8IB 7CGTA 1KPRB 2MCG1 4WV1B 3MV7B 5IESH 3L3DB 1X5FA 4K3DH 4P9HC 5E2JA 4N8CH 3MNVB 2I07B 5D2NB 3G5XA 1EUUA 3OR6B 1TJGL 4OB5L 4ZPTB 5C0EA 2EIEA 1KIPB 4K7PH 1C5CH 3DI2B 1BLNA 4ALAL 2FNBA 3SDCD 1OB1A 3X3GL 4L3EE 1NMCC 1MRCL 3A6BH 3EDEA 1U8JA 4K71B 3CZFA 1E6JH 3BUTA 5EIIA 3SPVA 4HT1H 4RAVA 1FLRL 4JY5L 5GGQL 3LKRB 3O2DA 2CIIB 3LN4B 3C2SA 2DQFB 2EEAA 1HHJB 1BZQK 4OZGE 1CK0L 4M6ML 1JWUB 2CK2A 4OCSH 3QHFL 3KYNB 3S88H 2AABH 1ORQA 1U36A 1FL3B 4J4PA 2ZKHH 2W9DL 12E8H 5IHZB 4O4YL 1U8NB 2JJWA 2UVEA 4LCCB 4RNRB 3QRFM 1G1CA 1EEUA 3BPOB 4MJIA 1CIDA 4HWBH 1XGYL 1W8OA 1U8PA 4R90L 3HI5H 1A6WL 4E9LA 1NCCL 2BJML 1FN4A 2ZPKL 1T66C 4LLMA 5GIRA 3QUXC 5FA4A 3RIAF 4OV5A 2OJEA 5ESAB 3U9UA 4WNQB 3MZTA 4HPOH 2BOBA 3RVTC 1GAFH 5K9KA 2O5YH 4NC1E 1AGEB 3MOAL 1T89C 1E4XL 3V4PH 2RB8A 2P8MA 4XT1C 2KQNA 3IDNB 4X8XA 2CJUH 1Q0YH 2B0SL 1PKOA 3UCRA 3DSNA 1G7IB 3Q48A 2J8UF 5CUSH 3QFJE 4G6FB 5GGVL 2Z31A 4WEUD 1K6QL 5C8JB 2CUHA 4BFIA 4YDLB 3D87B 2A9NL 1BFTA 3MLSL 2EECA 4PJFF 2XZAH 2YD8A 4M5YL 5JLZA 4LSRH 1CD9B 1C7SA 4RMVA 1KN2L 4P5TD 2YZ8A 4OKDA 4YEEA 4UILH 5C0FB 1RIUL 2MKLC 3SY0A 3VXQA 2P48B 1HEZA 3EJYC 4RIRB 1FSKB 5DSCB 2G5BA 5DURB 3TNMA 3WKNA 4FXGA 7FABL 5IJVB 5IBLC 2QADB 4MNGE 3I6KA 5MERA 3LH2H 1UCTA 4GQ9L 5DJZA 4OF5A 3NCYS 4PB9L 1I9IH 5J1AB 3CX5J 3L7FB 2BERA 4FFWC 3QUYD 2HH0L 2DJ4A 3RY6C 5D1XB 1NL0H 3HNSH 4ZFGH 1MLCB 1RURL 4H0HB 1A6TB 2BC4B 3EIFA 5F96L 3WEXA 1WBYB 4JFOB 2LE9A 4QRPE 1RZKC 1J9CT 3GIZH 5IB5A 1I9EA 1T83A 2FIRT 4RQQB 3FZUD 1C12B 3LHPL 2P47B 4AZ8A 3W82A 2GJ6E 1TZHA 2IFFH 2FHBA 1OP9A 4D9RE 4GKOA 4G8FB 3HE6A 1RZFH 2OTUB 5FYLL 3DGGA 5CEXB 4LRIA 3B6SA 5JTWA 2R4SH 1DJSA 1IGFH 4QCIB 2IQAB 3MJ7B 4C54A 3UYPA 2VLRE 4L29B 3RJDA 1E4XI 1HINL 2BDNH 2FEDD 2H8PB 1OAUH 4PRPD 2NY6B 4NQED 1XZ0A 1FZMA 3K4AA 3UTPD 4KI5E 3V6OA 1BF8A 1E6OL 2GK0B 4D0BA 1N4XH 1W2KT 4ODTL 4WFFE 1OOAA 4ELMF 4QOKA 2E7HA 3PNWA 3VXSE 2O61A 1MFAH 2OS7A 1Y18A 1NFKA 4K23H 3UZVB 4WO4B 1WBZB 5D1ZA 2Z35A 5JMRA 1OARH 3TT3H 5I30L 3F62A 2O26U 1OPGL 1U92A 2HFFA 5JQHC 3RVVC 4WCYH 4LPYA 4X6DA 4XBGA 6FABL 3TBSB 4X6CA 5HDBF 3OKLA 1X4XA 5DRWA 5E6IC 2WWMC 4FTVA 1X7QB 1YMHA 2AP2A 2A83B 4WUUA 2P5EB 3HPLB 3NCEB 4XMPL 2XKSA 3OX8A 3SKJH 2YK1H 5EOCJ 2R0WL 3ARDD 4YNYB 1PZ5B 1FYTE 5SWZE 2E27H 4JY6A 2VIRB 3G6AB 4XCYB 1YUHA 3VD3A 3C5SA 2MQ0A 3IFNH 2VKXA 4MD0A 2BVQB 3MRQA 4PY8I 1FNGB 1YMMB 4H26A 5I18H 3ZL4H 4LP4A 2CGRL 4XP5L 5IW1A 3MFFB 4YDKL 3BQUC 1HILB 3KPSD 1DUZA 3QQ3A 2Y06L 3Q5TA 5E6YA 5GRJH 2C3GA 3FT4B 3TZVA 3FB8B 1ZEAL 3ZKMD 3IVKB 3RKDC 2DTML 3U4BL 2C4XA 5IMMA 5DK0A 1MCWW 1LEKA 5DUBA 4NKOB 4MHHI 1GGBH 3QDMA 5BZDA 1I8LC 3RTQB 4OZGF 5DO2D 3ROOB 3FMGH 3BO8B 2BVOB 5HYJE 4NNYA 1HYSC 5F7WC 1HZHH 2IAMA 2WLZA 3R1GH 4R4BA 4U1HA 1OP5K 3WNOA 5EOTA 1S7VA 1NEZG 1TVHA 3GSUA 4OCRL 5TH2A 3TF7C 5JUEL 4M61A 4P2YA 4M7LT 2CDFB 4YQXL 2F58H 4OAWB 1JUFB 1T0MA 4EBQH 4JFDA 3EAKA 1IM3B 4TTDC 1ITBB 1PYWA 3FTGA 3G5XB 4NHCH 2DTSA 3UTQA 2P42B 1AJ7H 2DBLL 2ZCLL 5CCKH 3TNNB 5K9JH 3WJJA 4M03A 2ORBH 1OB1B 4PJ7F 1KCVH 3TO4A 5F88B 4Y4KA 2W0FA 2NY4C 1AXSB 1U8JB 4OM0L 4XPBL 1CFTA 5I1DA 1EVUA 3QIUA 1MWAA 3GK8H 5EIIB 1T03H 5E2TL 1OAXH 5ID0B 2ZJSH 4ESKA 2AKRA 2HKHH 1JGLL 2HWZH 4ZD3L 5C08B 5IFAL 4S1SH 1IAIL 3STZA 3LCYA 4M7LH 1ORQB 4XP4L 3D3VA 5C0DB 3EZ8A 2ZZUT 4PJ8C 1DBJH 3A6CL 1YNLH 2WM0A 1LEIA 1U8PB 2OZ4L 2X9WA 4GXUM 5I19L 3OB0H 5IQ9A 5E2VL 1AHWA 3LQAH 1FN4B 2BXZA 1NQBA 4LLMB 5GIRB 3F58L 4Q0XL 3DROB 5HI4C 1ZGLA 4FXLA 5FA4B 4Z7VF 4OV5B 5HDOA 2OJEB 4ODHH 4MJ2A 5F21B 1S9WA 2ZUQC 3U9UB 2BOBB 2CLZB 4ZMAT 1R5IB 2X70A 3BZFB 3HI6H 1AY1H 4NM4L 2P8MB 4NKDB 4WI4A 4ZS6C 3RZCC 3U2SA 5DQJA 4UQ2A 5D7JD 5DVOA 5JNYA 2EDLA 1W0VA 2DM4A 4JHAL 5I6XC 1TDQA 5HGGS 5CILL 2HP4A 2Q8AH 1FIEA 3O6LH 1JGDA 5DR5H 1JZ6A 5F1IB 2DL2A 3BE1H 4KRNA 3JWDL 3GRWH 4BFIB 2H32H 3SE9L 5C0JB 2JELL 2NX5E 2L7UA 3I2CL 5CGYD 4FZ8L 3L3JA 4YHNB 3FN0H 4AH2A 5JLZB 3F7PC 3QI9D 3GB7A 3MRIB 4HF5H 2X40A 2PTTA 5IMOB 3MQIA 4MMXC 5GGTA 3PGDA 4LCYA 5L7XL 1EHXA 5I1CL 5J12C 1HEZB 3E2HB 1PSKL 4TNVF 3BHBB 4CVZB 3ZDYE 2VQ1A 5IROC 4NNXA 2XV6B 4PJAB 3G6JA 4MLSA 1JZ3A 3TNMB 4FXGB 4HHAA 2VXSH 4XI5D 1I75A 1OCWH 3D85B 3MRKA 3SGEH 3V6BR 3I6KB 5MERB 1UB6A 4JE4B 5DJZB 2EXWD 1F3JA 4KI5F 3TN0C 2H2SC 2E3VA 3WIFA 4JFYB 3D25A 1KC5H 2EDOA 4JZNA 1DBMH 3BDYH 2GY5A 3SQBA 4XGZA 1F11B 5FA3A 5F7UA 3HNTL 1I1AC 1IAII 3WEXB 1TXKA 2I26N 2IMMA 2OP4L 2XXCB 4FQLH 4NN6C 1OP3H 1NSNH 5I1GL 1XF3A 2Z91A 5IB5B 2AERT 3V7AE 4LSVL 2A77H 3MRNA 1S7QA 2EDKA 3HC4L 4OIIH 3X13A 5HYSG 4FFYH 4GS7B 1LE5A 1Q1JH 4Y5YA 2J8UB 2BP3A 3DGGB 1F6FB 5DVMA 3RWFB 1FVCB 3B2VH 4KROD 1S78C 4CU8A 1CGSH 2E9WA 1HHGA 5FIEA 4ZFOA 5CSBA 3GM8A 5DD0L 4X9FA 5I8OH 2LTQB 4BQ6A 4Y2DC 4Y4FC 2AJYL 3MFGB 1XZ0B 1FZMB 2X2YA 3HZMA 1Q9WA 3BWAA 3QDAA 4D0BB 2DM7A 5EU5A 3PNWB 3IAPA 4HX1A 3MRRA 4J3SA 4JFEA 4QYOA 3RGHA 2Q87A 3RBGA 1TQBC 1Y18B 4ETQB 1NCNA 1DBAL 5K59E 5GZND 4E41D 3SCMD 1XGUA 5D1ZB 4X0KA 3LV3B 3VXRB 4UV4H 4TVPE 2HFFB 3NIDE 3QQNA 4X6DB 4Z7UE 3OKLB 3U7YL 1JGEB 1IAKB 2P43B 4XP9L 2RAMA 4PV9A 5D1QC 1NGQH 4XCFL 1G1YA 3OX8B 2BVYA 1NGYB 1FIGH 1H3GA 5JO5A 1PEZA 4G9FB 4KVNH 1YEDB 1NH6A 3C5SB 4K3DL 3MRQB 4K2UL 4Y2OA 3D2UD 3OAYK 4N8CL 5M94B 1LO4L 5DURD 5EH1A 1RZJC 4XPTL 4IRJD 5DZLA 1DE4A 4UT7H 5E2WH 4K7PL 1DUZB 1C5CL 1IAOA 1GGUA 3QQ3B 3TV3H 4WWKC 2D7TH 3TZVB 1V5JA 1QFUL 5IMMB 4KUZL 4GBXC 5DK0B 3A6BL 1LEKB 1A02N 3O6FA 3QXDA 5DJYA 5DUBB 1E6JL 4PJCF 5GZOC 3QDMB 3ZSSA 3BMVA 4HT1L 2XWBA 5BZDB 1KN4H 5IQ7H 4LCUA 2BNUA 3L3HA 1F4AA 2V5RA 5D7KD 4G9DA 1QLEH 2Q7YA 2DLTA 2DQDH 2VLKD 4NNYB 4J3XA 3BJLA 2GUOB 1AE6H 3PABA 4U1HB 4OCSL 3KJ4C 3PHQA 5ESQA 1S7VB 3MNWA 1TVHB 3W2DL 5TH2B 1UKSA 4KJQC 2ZKHL 3BSZH 3EHBC 2O5ZH 4M61B 12E8L 4Z7WA 1TZGL 5ERWA 5KJRH 1SQ2N 5C0AD 4FQCH 2HYMA 3F6IA 4HWBL 4FQ1H 3DX8A 1G0DA 2DQCH 4C56B 5DJDA 1JFQL 1I7UB 3FTGB 5IVZA 3UTQB 3RNQA 2NNAA 5KN5A 2CD0A 3IDXL 3D0LA 3PGCA 1Y0LA 4HPOL 4XCNA 4RX4A 4S0SD 2C7UB 4RMQA 4UV7H 4Y4KB 2W0FB 1EHAA 5CIPH 4XHQA 2CJUL 1Q0YL 4BUGA 1CFTB 1OGAE 5SX4I 1J0IA 4ODXB 1MWAB 2BRQA 4HWEH 4XC1H 2WW8A 1ZLVK 1F4WH 1CDJA 3O3EB 3DTXA 5CUSL 1WWWX 2AKRB 3B9DA 3MTRA 2JCCA 4P49A 5D71H 4X7FC 2VMFA 3STZB 5IKCA 3PWJB 1ZVSB 4TSAL 1XFPA 2XZAL 3D3VB 4I0PA 3C6LD 3CFBA 4LSRL 4XVUC 2MTPA 2N56A 4JG1H 1PAMA 4LOUC 1UXWA 3HTLX 4Y89A 5HHOA 1LO5A 5IQ9B 4YZFE 1AHWB 5IMKA 1PW3A 1OT2A 4M9PA 4XPGH 2X4OA 1JZ4A 2ZUXA 3H7BA 1T1YA 4I77L 4BH7B 1BX2A 4ZO8A 3WNPA 2J12B 3HRZA 1VPOH 1AO7D 3RWJA 3ULVH 3W81A 3MX0A 4P2OC 4CAGA 3ARGC 3OMZA 1I9IL 5DQJB 3ARBD 3RPKA 2J7LA 3BKJL 5JNYB 2ESVD 1J5OL 3O2DH 4U1JA 1W0VB 2XTJD 2L7JA 2LU3A 4O9HH 5F9DC 4JDZA 4GAGL 1FFOA 4NQDA 4HD9A 1FVEA 3ZKSD 4ZPVA 4S2SA 2OJZL 3GIZL 5EC2B 4PJ7B 1TLKA 1T1ZA 2H1PL 1MJJB 3MYJA 4WFEE 2PTTB 1EFQA 3NAAH 2NYYD 4J3OC 4ZFZA 4GG6A 1JK8B 3PGDB 3WD5L 1J05B 3MLUH 3KPNB 2BVUA 5I0DA 1RZFL 3SE3A 5MEND 5KANI 4HG4K 3T0EB 5E8OA 4NNXB 4Q9RH 3L5HA 3BIAX 4WW2C 4JM2F 2GT9A 1G6RH 5C0BD 1F02I 3ULUH 4N9GA 3OAUH 1UB6B 2BDNL 3QEGH 2Y9RT 4LSDA 3RDTC 4ORZC 1ZSDB 3GNMH 1WQVT 1F3JB 1BOGA 4RA0C 5T3ZH 5CJXC 3VWKC 4IBLT 2F54B 4Q9CA 1JTPA 3P9WB 1JMZA 2IH3A 2VABA 2UY6A 5AZ2H 3D25B 1GZPA 1N4XL 3OKDB 3RUGB 2DDQL 3HZVB 3QWRA 5K59F 1MFAL 2VR9A 2YR3A 2PO6D 4Y5VC 5C71A 4XB7A 3MV9A 3KPRE 5C2BL 4JFFD 4KRPB 1XF3B 2Z91B 4JRYA 2E6QA 1GGIL 1OARL 4KQ3L 3TT3L 1BJ1H 4Z7UF 4OD2B 1I7TA 4WCYL 3X13B 3O11A 4U0QB 5E5UB 1MRFL 1LE5B 2CRYA 4Y5YB 2Z92A 2HRPH 3JUZA 3BP5B 1KJ2H 3ULVE 2EDWA 3PWPA 3VG9C 3ALPA 5FCUH 3BPNC 3T3MF 2V2WA 3U1SH 3HI1B 3SKJL 1I8IB 3C8DA 5FYLD 4XCEA 5BV7C 3VD9A 1F6LL 5FGRA 1HSBB 1KT2A 1CXKA 4PRIA 4YR6B 4WGWB 1JHKH 4G5ZH 1B0RB 4APQC 5IFJA 4PLOB 5B3JF 1NANH 3RIFK 3OJDA 3VRLF 3EDDA 1YPZF 1S7XA 3FKUS 4X80H 4RGMB 3P9MB 8FABA 5FYKL 4HX1B 2Y36H 2DWEB 4MA8H 4Q9QL 4MJIE 4QYOB 1JTTA 5HSFA 2E5EA 3EFDH 4HC1H 5FDWA 1XGUB 3GUTA 2EO1A 2GTWB 3KYOA 4G6JH 43CAA 3ILQC 5JIPA 5LXGH 3BP7A 2ADFH 1PG7W 3IDIB 1P1ZA 4U1IA 3UC0H 3DO3A 3QCTH 4LSTL 1HZHL 3EFFB 4YHOH 3P0YL 5L6YH 4RZCA 3Q1SH 4MAYC 2RFXA 1INQA 3NZ8A 4U1KA 5FXCH 4QHLA 4KTDL 4IOFD 3ARFB 4ENED 3ESVF 4QRRD 5BRZD 1P7KA 3QAZC 1J1OL 2VZ3A 4XNQB 3DUUB 4PG9A 4AIXA 4NHCL 5D70H 1MJUL 1MCBA 3MSPA 1F45A 1HI6A 1AJ7L 5CCKL 4HAGA 1IAOB 4HG4J 1IVLA 5DMKA 2ORBL 2KZWA 1KCVL 3OSKA 4GQPH 1VEMA 1ZTXL 3QXDB 3DHMA 3QIWD 3VFVA 5HGHA 4YDJB 1UACH 3VXOA 2D7MA 4RAUA 4LCUB 3H8NA 3L3HB 1OAXL 4HUNB 3ARQA 4G9DB 2QR0A 2HKHL 1FZKA 1WFOA 4HPYL 3PL6C 1QZ1A 3JV6A 2GTZB 2HWZL 2X4SA 3O2VH 3SJVE 4GH7B 4CMMA 3PABB 3VGGA 4S1SL 5ESQB 2XKNA 1BJMA 3PP4H 1L6XA 3MNWB 5E95B 3OF6D 1V3JA 4KI1A 3TVMD 1DL7H 2VLMD 4YXHL 4MQXC 5T5FH 3HE7C 2EKSA 3LEYH 4E0RA 3VXMD 1DBJL 1P2CA 4YZFF 1DTUA 1YNLL 3H6JA 3N1FC 1MCLA 2DQHL 2ADGA 5KSAA 4HBCH 3DLQR 3DX8B 3MO1A 4JRXB 3T65B 3QT2A 5HI3C 1QSEB 4PJEE 5E5MA 5IVZB 4YXLH 1Z0NA 1MREH 1IKFL 3UPCA 2X9XA 3RNQB 2AVGA 2NNAB 1MJ8L 4B7LA 4G8GD 4H8WH 4ODHL 3PGCB 4LSQH 1SMOA 4XCNB 2CXGA 3BYTA 3QDGB 1W0YT 3RVXC 3V7MA 1HNFA 1JGVL 3RVUC 5K9QG 1AY1L 2VXVH 4WHTA 5C0IA 4LASH 4EXKA 3ZDXE 4PY7A 3J7HA 5GISH 2DQGH 4BA8A 2WNGA 3DJ9A 3DTXB 3GSQA 3DX9A 3P4OA 2Q8AL 3O6LL 5DR5L 1RJZA 2JCCB 3EJZD 3BE1L 4HGWB 2MCPL 1KLUA 5J8OA 1XAUA 1G7PB 3VXRD 5B39G 3KLHD 4I0PB 3CFBB 4HF5L 1N0LA 3MUGB 1X6LA 3V6OE 1CDIA 3RJQB 5EO9B 1UXWB 1N6QL 4QOKE 2NY7H 5HHOB 1LO5B 1HCFX 2HT2D 3B9KC 5GGSA 3H7BB 4V2CB 4ZUUA 3OGCB 2ITDB 4K3JH 4ODUA 2UYLB 3RWJB 2VXSL 2Y5TA 1K9TA 5HHQB 1HWGB 3OG4B 3PE9A 3H9ZA 3QBTB 5I66B 4X6DE 1NC4A 5C09D 4X6CE 1RUAL 4FTVE 3L3IB 4KXZH 3MRCB 1G0YR 4H1LA 3BKCL 4U1JB 4WUUE 4F8TA 4Z7NF 4FNLH 1KC5L 1YEIH 4JDZB 1DBML 1INDL 3BDYL 3JV0A 4NQDB 5JW4Q 2DWDA 4A6YA 1YDPB 3KR3H 5DFVC 4ZPVB 1RK0A 3O9WA 3R8QA 3D6GA 4HW6A 3K0WA 2VDMH 1T1ZB 2ZSWA 5J89A 1PD6A 4ZFZB 4K7FB 2DQEL 4GG6B 4OIIL 3QA3A 4GMSL 1WFTA 3OHXA 5DUPH 3ULVF 5E08H 1WJ3A 4ZO6A 5FYJH 1Q1JL 5F6HJ 2X10A 4Z6AT 5F9JB 3QEQA 2GAZA 4LPUA 5EB9A 5E8OB 4IRSD 1I3GH 1IAIM 3U9PH 4DVRL 2FX8L 4KKCC 4Y1AA 2XPGA 3ARRA 4PJ9B 4N9GB 3P40A 1RUPL 4GRLC 5A2FA 4LPXA 4I48A 2A74A 5J9PA 3AAZA 5CGTA 5I8OL 1FL6A 3VFPA 2YEZB 1RJYA 3AXLA 4NWTL 3QHZH 4P3CH 2IH3B 1U3YA 1OTSC 2C3HA 3UTSB 4OLZL 1D6VL 3QWOB 3QIBC 4JGUA 1YY9D 5EA0L 1ZA3A 4RFOH 3MBED 2WINB 1TETH 1PQZA 3HG1A 1UYWH 4JFDE 3UJIL 3FB7A 2DM3A 3S35X 1X5ZA 3VGEA 5KSUB 4O02L 1FC1A 3A67H 2BHZA 5D8JL 4WRLA 1I7TB 5HYIA 2BOCA 2ENSA 3C8KA 2NXYB 3O11B 4F33A 3ULUF 3LIZL 2Z92B 1NAMH 4LSUH 4YJZL 1NFDF 3V52H 4EOWL 3PWPB 3FN3A 1TTGA 4UOW1 2DQTL 4XMLH 1MHEB 3SBWC 1P84J 1YQVH 1RUKH 3M17A 3O4LA 4XCEB 5IHLB 4QHKI 4CVXB 1KT2B 1C8PA 4PREA 4PRIB 4N5ED 4J3TA 1GIGH 1T1XA 4NO2A 3KYAA 2I5YH 1BQUA 3GEWB 4R3SA 3IDMA 3TIDB 3OJDB 3U0WL 1B6UA 1RHHB 4X9HA 3D3VE 1NCDH 4UT7L 5EFIA 2YUVA 5GS0H 3QPQD 3TV3L 4FFVD 4PRBA 1LNUA 4JM2B 5F1KC 4GAYB 1D9KC 1ZV5A 4O5LH 4DAGL 3KYOB 4G6MH 4A6YL 43CAB 1RI8A 4LLVB 1AI1H 1JF1A 3F5WB 4EN3B 4DK3A 2E8ZA 1KN4L 1K8DA 5F71A 5IQ7L 2X4PB 1J0KA 1QLEL 1CLOL 5DHXB 1YEEL 2YD4A 1BFOA 3GIVB 5D7IA 2F53A 4XAKE 4WEBH 3E6HB 4YBQD 1NUGA 5E8EA 3N1PC 4PLKD 4ORGB 4R97C 2XZCH 3O8XA 1KCUL 1BBJB 1H5BA 4HKBA 1VACA 3BSZL 4RZCB 2O5ZL 5SWQA 1ZANH 3GMMA 3MRLB 5KJRL 4P2QA 5HVHC 4P4KC 2YC1B 4PS4H 3N06B 4FQCL 4QHLB 4U1GB 4UZGA 4BZ1L 2VH5H 4U3XA 3V6FA 4FP8H 5KVEL 1P7KB 4PJEF 3N9GH 1V3LA 3G5YA 3RHWK 1D6EB 2ZUWA 3T0ED 4HGMA 3CXDH 1FL5A 4PG9B 1FP5A 1MPAH 4NO0D 1H9VA 3NCJL 4OF6A 1QNZH 5FB8B 4F9LC 1OSZA 4PP1C 4BQ8A 5ETUA 5BJTA 3HAEG 5DJAB 1CE6B 4YFDB 1NFIA 4P23B 3ZDXF 1JJUA 1U95A 1N3NA 4J1UB 2YPKA 3VFVB 4HWEL 4LKCA 4GW5B 5DHYB 4AEHH 5HGHB 4NC1C 4RAUB 1F4WL 3G6JE 2QR0B 3LEVL 1FZKB 3NABH 5D71L 4X5LA 1K85A 4FABL 4CMMB 3KYMA 2XKNB 3KHOA 1U3HC 3CVIH 1MNUL 2P8LA 4YBLB 5FGCE 1EO5A 3MLRH 5JW4N 3O4OB 2OMBA 3OAZH 2EKSB 3H3KA 1CDBA 1WZ1H 1GL4B 3ETBF 1X5YA 3VGAC 2AJUH 1RZGA 2ADGB 5KSAB 3TJEH 3MO1B 2ICWJ 1KG0A 4Y8AA 4XPGL 4XBPA 1LP9F 5I8CA 4R7DA 4NUGH 2MQCA 1H3XA 1S7WA 2HT3D 4V1DA 2RCSH 1S7SB 4KZDL 5F7NC 4IOSD 4YFEA 4F58L 3WDJA 5I1IL 4G8EA 4PY7B 4OCYH 3NFPA 1EZVY 1IC5L 1RK1A 4O9HL 3GSQB 2Q3AA 2VLRD 1RJZB 3NGBB 3WHE1 1KLUB 1HDMA 5KS9A 3OKOA 3BFOA 1K4CB 3RGVA 5GXBB 2FEEL 1VFMA 3TT1L 2NY5L 4KI5D 4YPGB 4RFNC 3NAAL 3SO5A 2YKLH 3SKNA 1WT5C 4M4RA 3MLUL 3VXUD 2VUOA 3QCUL 4CKVX 3VXSD 3QH3B 5ICZA 5ANME 4N8PA 4JFEE 4TNWK 5HD8D 3OKYA 5TQ0H 1KENH 3QNYB 4R4FL 3HZKA 3X12A 5DGQA 4KPHH 3ULUL 1G6RL 3ARFD 1UJ3C 2XYCA 3OAUL 3DGCR 2YPLA 3QEGL 3NA4A 3BH8A 5ECJE 3RI5K 4G6KL 2PN5A 4OGXL 3M45A 2VDOH 3MRBB 4UOW0 3SDXA 4YDVB 3LD8B 3V8OA 3FZUC 3DXAD 5AZ2L 4N0CD 1H3PH 1WVZA 4POZD 3ULSA 3EOTL 2BZDA 4GLRI 2DWDB 5FKPB 4A6YB 4FZEH 2VXUL 3SDDA 2L0DA 3O9WB 4M43L 3DBXA 1LK2B 3QUZD 1HKLH 2ZSWB 3S36X