4MN8B

Crystal structure of flg22 in complex with the fls2 and bak1 ectodomains
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
175
structure length
175
Chain Sequence
NAEGDALSALKNSLADPNKVLQSWDATLVTPCTWFHVTCNSDNSVTRVDLGNANLSGQLVMQLGQLPNLQYLELYSNNITGTIPEQLGNLTELVSLDLYLNNLSGPIPSTLGRLKKLRFLRLNNNSLSGEIPRSLTAVLTLQVLDLSNNPLTGDIPVNGSFSLFTPISFANTKLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LRR receptor-like serine/threonine-protein kinase FLS2
publication title Structural basis for flg22-induced activation of the Arabidopsis FLS2-BAK1 immune complex.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase/transferase receptor
total genus 42
structure length 175
sequence length 175
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00560 LRR_1 Leucine Rich Repeat
B PF08263 LRRNT_2 Leucine rich repeat N-terminal domain
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4mn8B00
3CIYA 4R6JA 1P8TA 1OTMA 1M9SA 3P72A 1O6SA 1OTOA 2Z66A 5AWCA 2WQUA 1H6TA 3E3ZA 2OMWA 3RW7A 3WPCA 2WFHA 1QYYA 2Y5QA 1DS9A 4PSJA 3UL7A 3OGMB 2IFGA 4R09A 4AW4A 5B0TA 3E2JA 4QC0A 4LXRA 3ULUA 1A9NA 5AWBA 3WPFA 3RFEA 4ARRA 5IJCA 4CNMA 1M10B 2OMUA 2OMZA 3UL9A 4KNGA 4QXEA 1FO1A 3CVRA 4Q3IA 4LSXC 2JE1A 3M19A 1KOOA 3WPGA 2OMTA 3ULAA 4K17A 4L3FA 2BEXA 2P1MB 1FS2A 1XEUA 3RGZA 2P1NB 3WPIA 4C2AB 3WPHA 4R08A 3E6JA 2O6QA 1DCEA 5IJDA 4R5CA 5CMPA 3ZYOA 2O6SA 4FMZA 4L3AA 5GMHA 2ASSB 3E4GA 2JQDA 2Z64A 2WQWA 4V2CA 5GQRK 1LTXA 4M7EA 1GWBA 4PQ8A 5GMFA 3SB4A 4OQTA 3VQ1A 4RWTC 4Z64C 3BZ5A 4LI2A 4BV4R 2O6RA 3W3GA 5B4PA 3ZYJA 5GS2B 2WQVA 2Z65A 3WPEA 5CMNA 4LSXA 2ID5A 4KT1A 3KJ4A 2JE0A 2V70A 2Z7XB 5IYXC 2FT3A 1W8AA 4PERA 4R07A 3PMHG 4NKHA 1D0BA 4P91A 1XCDA 4MQWX 2P1QB 2RA8A 3REZA 2ELLA 5B0NA 4M7EC 5GMGA 1OTNA 2V9TB 1O6VA 2Z7XA 3OGKB 1XKUA 4Z8GA 1JL5A 2XWTC 5GS0A 4PEQB 1WWLA 3C6OB 5LFNA 4EZGA 2XOTA 2WQXA 4CC4A 3GOZA 3UL8A 4R6AA 1YRGA 4CP6A 3WPDA 4FDWA 3JB9j 4B8CD 4ECNA 3W3KA 4WP6A 4KXFB 1XWDC 4NKGA 4R0AA 4R5DA 4XSQA 3C6NB 1M0ZA 1FQVA 3W3JA 1IO0A 3O53A 4RCWA 3RW6A 3W3MA 1KOHA 4Q62A 2P1PB 5D3IA 5A5CA 2CA6A 4Z61C 1XECA 1K5DC 4CC4C 4RCAB 3C6PB 4U09A 3ULVA 3G3AA 2ASTB 5AZ5A 1P8VA 5IJBA 4LI1A 3G39A 3W3LA 4CILA 4R6GA 4V2EA 3OGLB 2UZXA 4U7LA 4G8AA 4TZHA 3FXIA 4UFRA 4ECOA 4FS7A 3DZEA 4J0MA 4LSCA 3RJ0A 3RGXA 3RFJA 2Z81A 1G9UA 4BSUA 3UN9A 4XOSA 1OOKG 4H09A 3A79B 5FTTB 4MN8B 2R9UA 2Q4GW 4LXSA 1FT8A 4XGOA 3G04C 4Y61B 2BNHA 4GLPA 4PKIG 3M18A 4R58A 3ZYIA 1Z7XW 5AWDA 3TSRE 5AWAA 1DFJI 3RFSA 2OMXA 4FD0A 2OMYA 2Z63A 5HDHA 5HZLB 4U08A 4AY9X 4QBZA 4R6FA 4ARNA 3O6NA 3G06A 4FCGA 4YEBB 4LSAA 2Z62A 2RR6A 4CNCA 1A4YA 4HQ1A 1K5GC 4IM6A 1PGVA 4C2BB 1U0ND 4V2DA 2OMVA 3CIGA 3WPBA 1SQ0B 4U06A 4J4LA 1O6TA 3OJAB 4GT6A 4FHOA 4BSSA 3WN4A 4BSRA 4Z79A 3ZYNA 4Z94G 4WYKA 1P9AG 1ZIWA 2V9SA 1OGQA 3W3NA 1H6UA 3G3BA 1M9LA 2P1OB 2A0ZA 4P8SA 3RIZA 3OJAA 4I6JB 2Z82A 3VQ2A 4Q3GA 1OZNA 2UZYA
chains in the Genus database with same CATH superfamily
3CIYA 4R6JA 1P8TA 1OTMA 1M9SA 3P72A 1O6SA 1OTOA 2Z66A 5AWCA 2WQUA 1H6TA 3E3ZA 2OMWA 3RW7A 3WPCA 2WFHA 1QYYA 2Y5QA 1DS9A 4PSJA 3UL7A 3OGMB 2IFGA 4R09A 4AW4A 5B0TA 3E2JA 4QC0A 4LXRA 3ULUA 1A9NA 5AWBA 3WPFA 3RFEA 4ARRA 5IJCA 4CNMA 1M10B 2OMUA 2OMZA 3UL9A 4KNGA 4QXEA 1FO1A 3CVRA 4Q3IA 4LSXC 2JE1A 3M19A 1KOOA 3WPGA 2OMTA 3ULAA 4K17A 4L3FA 2BEXA 2P1MB 1FS2A 1XEUA 3RGZA 2P1NB 3WPIA 4C2AB 3WPHA 4R08A 3E6JA 2O6QA 1DCEA 5IJDA 4R5CA 5CMPA 3ZYOA 2O6SA 4FMZA 4L3AA 5GMHA 2ASSB 3E4GA 2JQDA 2Z64A 2WQWA 4V2CA 5GQRK 1LTXA 4M7EA 1GWBA 4PQ8A 5GMFA 3SB4A 4OQTA 3VQ1A 4RWTC 4Z64C 3BZ5A 4LI2A 4BV4R 2O6RA 3W3GA 5B4PA 3ZYJA 5GS2B 2WQVA 2Z65A 3WPEA 5CMNA 4LSXA 2ID5A 4KT1A 3KJ4A 2JE0A 2V70A 2Z7XB 5IYXC 2FT3A 1W8AA 4PERA 4R07A 3PMHG 4NKHA 1D0BA 4P91A 4NZTM 1XCDA 4MQWX 2P1QB 2RA8A 3REZA 2ELLA 5B0NA 4M7EC 5GMGA 1OTNA 2V9TB 1O6VA 2Z7XA 3OGKB 1XKUA 4Z8GA 1JL5A 2XWTC 5GS0A 4PEQB 1WWLA 3C6OB 5LFNA 4EZGA 2XOTA 2WQXA 4CC4A 3GOZA 3UL8A 4R6AA 1YRGA 4CP6A 3WPDA 4FDWA 3JB9j 4B8CD 4ECNA 3W3KA 4WP6A 4KXFB 1XWDC 4NKGA 4R0AA 4R5DA 4XSQA 3C6NB 1M0ZA 1FQVA 3W3JA 1IO0A 3O53A 4RCWA 3RW6A 3W3MA 1KOHA 4Q62A 2P1PB 5D3IA 5A5CA 2CA6A 4Z61C 1XECA 1K5DC 4CC4C 4RCAB 3C6PB 4U09A 3ULVA 3G3AA 2ASTB 5AZ5A 1P8VA 5IJBA 4LI1A 3G39A 3W3LA 4CILA 4R6GA 4V2EA 3OGLB 2UZXA 4U7LA 4G8AA 4TZHA 3FXIA 4UFRA 4ECOA 4FS7A 3DZEA 4J0MA 4LSCA 3RJ0A 3RGXA 3RFJA 2Z81A 1G9UA 4BSUA 3UN9A 4XOSA 1OOKG 4H09A 3A79B 5FTTB 4MN8B 2R9UA 2Q4GW 4LXSA 1FT8A 4XGOA 3G04C 4Y61B 2BNHA 4GLPA 4PKIG 3M18A 4R58A 3ZYIA 1Z7XW 5AWDA 3TSRE 5AWAA 1DFJI 3RFSA 2OMXA 4FD0A 2OMYA 2Z63A 5HDHA 5HZLB 4U08A 4AY9X 4QBZA 4R6FA 4ARNA 3O6NA 3G06A 4FCGA 4YEBB 4LSAA 2Z62A 2RR6A 4CNCA 1A4YA 4HQ1A 1K5GC 4IM6A 1PGVA 4C2BB 1U0ND 4V2DA 2OMVA 3CIGA 3WPBA 1SQ0B 4U06A 4J4LA 1O6TA 3OJAB 4GT6A 4FHOA 4BSSA 3WN4A 4BSRA 4Z79A 3ZYNA 4Z94G 4WYKA 1P9AG 4NZRM 1ZIWA 2V9SA 1OGQA 3W3NA 1H6UA 3G3BA 1M9LA 2P1OB 2A0ZA 4P8SA 3RIZA 3OJAA 4I6JB 2Z82A 3VQ2A 4Q3GA 1OZNA 2UZYA
chains in the Genus database with same CATH topology
3CIYA 4R6JA 1P8TA 1OTMA 1M9SA 3P72A 1O6SA 1OTOA 2Z66A 5AWCA 2WQUA 1H6TA 3E3ZA 2OMWA 3RW7A 3WPCA 2WFHA 1QYYA 2Y5QA 1DS9A 4PSJA 3UL7A 3OGMB 2IFGA 4R09A 4AW4A 5B0TA 3E2JA 4QC0A 4LXRA 3ULUA 1A9NA 5AWBA 3WPFA 3RFEA 4ARRA 5IJCA 4CNMA 1M10B 2OMUA 2OMZA 3UL9A 4KNGA 4QXEA 1FO1A 3CVRA 4Q3IA 4LSXC 2JE1A 3M19A 1KOOA 3WPGA 2OMTA 3ULAA 4K17A 4L3FA 2BEXA 2P1MB 1FS2A 1XEUA 3RGZA 2P1NB 3WPIA 4C2AB 3WPHA 4R08A 3E6JA 2O6QA 1DCEA 5IJDA 4R5CA 5CMPA 3ZYOA 2O6SA 4FMZA 4L3AA 5GMHA 2ASSB 3E4GA 2JQDA 2Z64A 2WQWA 4V2CA 5GQRK 1LTXA 4M7EA 1GWBA 4PQ8A 5GMFA 3SB4A 4OQTA 3VQ1A 4RWTC 4Z64C 3BZ5A 4LI2A 4BV4R 2O6RA 3W3GA 5B4PA 3ZYJA 5GS2B 2WQVA 2Z65A 3WPEA 5CMNA 4LSXA 2ID5A 4KT1A 3KJ4A 2JE0A 2V70A 2Z7XB 5IYXC 2FT3A 1W8AA 4PERA 4R07A 3PMHG 4NKHA 1D0BA 4P91A 1XCDA 4MQWX 2P1QB 2RA8A 3REZA 2ELLA 5B0NA 4M7EC 5GMGA 1OTNA 2V9TB 1O6VA 2Z7XA 3OGKB 1XKUA 4Z8GA 1JL5A 2XWTC 5GS0A 4PEQB 1WWLA 3C6OB 5LFNA 4EZGA 2XOTA 2WQXA 4CC4A 3GOZA 3UL8A 4R6AA 1YRGA 4CP6A 3WPDA 4FDWA 3JB9j 4B8CD 4ECNA 3W3KA 4WP6A 4KXFB 1XWDC 4NKGA 4R0AA 4R5DA 4XSQA 3C6NB 1M0ZA 1FQVA 3W3JA 1IO0A 3O53A 4RCWA 3RW6A 3W3MA 1KOHA 4Q62A 2P1PB 5D3IA 5A5CA 2CA6A 4Z61C 1XECA 1K5DC 4CC4C 4RCAB 3C6PB 4U09A 3ULVA 3G3AA 2ASTB 5AZ5A 1P8VA 5IJBA 4LI1A 3G39A 3W3LA 4CILA 4R6GA 4V2EA 3OGLB 2UZXA 4U7LA 4G8AA 4TZHA 3FXIA 4UFRA 4ECOA 4FS7A 3DZEA 4J0MA 4LSCA 3RJ0A 3RGXA 3RFJA 2Z81A 1G9UA 4BSUA 3UN9A 4XOSA 1OOKG 4H09A 3A79B 5FTTB 4MN8B 2R9UA 2Q4GW 4LXSA 1FT8A 4XGOA 3G04C 4Y61B 2BNHA 4GLPA 4PKIG 3M18A 4R58A 3ZYIA 1Z7XW 5AWDA 3TSRE 5AWAA 1DFJI 3RFSA 2OMXA 4FD0A 2OMYA 2Z63A 5HDHA 5HZLB 4U08A 4AY9X 4QBZA 4R6FA 4ARNA 3O6NA 3G06A 4FCGA 4YEBB 4LSAA 2Z62A 2RR6A 4CNCA 1A4YA 4HQ1A 1K5GC 4IM6A 1PGVA 4C2BB 1U0ND 4V2DA 2OMVA 3CIGA 3WPBA 1SQ0B 4U06A 4J4LA 1O6TA 3OJAB 4GT6A 4FHOA 4BSSA 3WN4A 4BSRA 4Z79A 3ZYNA 4Z94G 4WYKA 1P9AG 1ZIWA 2V9SA 1OGQA 3W3NA 1H6UA 3G3BA 1M9LA 2P1OB 2A0ZA 4P8SA 3RIZA 3OJAA 4I6JB 2Z82A 3VQ2A 4Q3GA 1OZNA 2UZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIY A;  4R6J A;  1P8T A;  1OTM A;  1M9S A;  3P72 A;  1O6S A;  1OTO A;  2Z66 A;  5AWC A;  2WQU A;  1H6T A;  3E3Z A;  2OMW A;  3RW7 A;  3WPC A;  2WFH A;  1QYY A;  2Y5Q A;  1DS9 A;  4PSJ A;  3UL7 A;  3OGM B;  2IFG A;  4R09 A;  4AW4 A;  5B0T A;  3E2J A;  4QC0 A;  4LXR A;  3ULU A;  1A9N A;  5AWB A;  3WPF A;  3RFE A;  4ARR A;  5IJC A;  4CNM A;  1M10 B;  2OMU A;  2OMZ A;  3UL9 A;  4KNG A;  4QXE A;  1FO1 A;  3CVR A;  4Q3I A;  4LSX C;  2JE1 A;  3M19 A;  1KOO A;  3WPG A;  2OMT A;  3ULA A;  4K17 A;  4L3F A;  2BEX A;  2P1M B;  1FS2 A;  1XEU A;  3RGZ A;  2P1N B;  3WPI A;  4C2A B;  3WPH A;  4R08 A;  3E6J A;  2O6Q A;  1DCE A;  5IJD A;  4R5C A;  5CMP A;  3ZYO A;  2O6S A;  4FMZ A;  4L3A A;  5GMH A;  2ASS B;  3E4G A;  2JQD A;  2Z64 A;  2WQW A;  4V2C A;  5GQR K;  1LTX A;  4M7E A;  1GWB A;  4PQ8 A;  5GMF A;  3SB4 A;  4OQT A;  3VQ1 A;  4RWT C;  4Z64 C;  3BZ5 A;  4LI2 A;  4BV4 R;  2O6R A;  3W3G A;  5B4P A;  3ZYJ A;  5GS2 B;  2WQV A;  2Z65 A;  3WPE A;  5CMN A;  4LSX A;  2ID5 A;  4KT1 A;  3KJ4 A;  2JE0 A;  2V70 A;  2Z7X B;  5IYX C;  2FT3 A;  1W8A A;  4PER A;  4R07 A;  3PMH G;  4NKH A;  1D0B A;  4P91 A;  1XCD A;  4MQW X;  2P1Q B;  2RA8 A;  3REZ A;  2ELL A;  5B0N A;  4M7E C;  5GMG A;  1OTN A;  2V9T B;  1O6V A;  2Z7X A;  3OGK B;  1XKU A;  4Z8G A;  1JL5 A;  2XWT C;  5GS0 A;  4PEQ B;  1WWL A;  3C6O B;  5LFN A;  4EZG A;  2XOT A;  2WQX A;  4CC4 A;  3GOZ A;  3UL8 A;  4R6A A;  1YRG A;  4CP6 A;  3WPD A;  4FDW A;  3JB9 j;  4B8C D;  4ECN A;  3W3K A;  4WP6 A;  4KXF B;  1XWD C;  4NKG A;  4R0A A;  4R5D A;  4XSQ A;  3C6N B;  1M0Z A;  1FQV A;  3W3J A;  1IO0 A;  3O53 A;  4RCW A;  3RW6 A;  3W3M A;  1KOH A;  4Q62 A;  2P1P B;  5D3I A;  5A5C A;  2CA6 A;  4Z61 C;  1XEC A;  1K5D C;  4CC4 C;  4RCA B;  3C6P B;  4U09 A;  3ULV A;  3G3A A;  2AST B;  5AZ5 A;  1P8V A;  5IJB A;  4LI1 A;  3G39 A;  3W3L A;  4CIL A;  4R6G A;  4V2E A;  3OGL B;  2UZX A;  4U7L A;  4G8A A;  4TZH A;  3FXI A;  4UFR A;  4ECO A;  4FS7 A;  3DZE A;  4J0M A;  4LSC A;  3RJ0 A;  3RGX A;  3RFJ A;  2Z81 A;  1G9U A;  4BSU A;  3UN9 A;  4XOS A;  1OOK G;  4H09 A;  3A79 B;  5FTT B;  4MN8 B;  2R9U A;  2Q4G W;  4LXS A;  1FT8 A;  4XGO A;  3G04 C;  4Y61 B;  2BNH A;  4GLP A;  4PKI G;  3M18 A;  4R58 A;  3ZYI A;  1Z7X W;  5AWD A;  3TSR E;  5AWA A;  1DFJ I;  3RFS A;  2OMX A;  4FD0 A;  2OMY A;  2Z63 A;  5HDH A;  5HZL B;  4U08 A;  4AY9 X;  4QBZ A;  4R6F A;  4ARN A;  3O6N A;  3G06 A;  4FCG A;  4YEB B;  4LSA A;  2Z62 A;  2RR6 A;  4CNC A;  1A4Y A;  4HQ1 A;  1K5G C;  4IM6 A;  1PGV A;  4C2B B;  1U0N D;  4V2D A;  2OMV A;  3CIG A;  3WPB A;  1SQ0 B;  4U06 A;  4J4L A;  1O6T A;  3OJA B;  4GT6 A;  4FHO A;  4BSS A;  3WN4 A;  4BSR A;  4Z79 A;  3ZYN A;  4Z94 G;  4WYK A;  1P9A G;  1ZIW A;  2V9S A;  1OGQ A;  3W3N A;  1H6U A;  3G3B A;  1M9L A;  2P1O B;  2A0Z A;  4P8S A;  3RIZ A;  3OJA A;  4I6J B;  2Z82 A;  3VQ2 A;  4Q3G A;  1OZN A;  2UZY A; 
#chains in the Genus database with same CATH topology
 3CIY A;  4R6J A;  1P8T A;  1OTM A;  1M9S A;  3P72 A;  1O6S A;  1OTO A;  2Z66 A;  5AWC A;  2WQU A;  1H6T A;  3E3Z A;  2OMW A;  3RW7 A;  3WPC A;  2WFH A;  1QYY A;  2Y5Q A;  1DS9 A;  4PSJ A;  3UL7 A;  3OGM B;  2IFG A;  4R09 A;  4AW4 A;  5B0T A;  3E2J A;  4QC0 A;  4LXR A;  3ULU A;  1A9N A;  5AWB A;  3WPF A;  3RFE A;  4ARR A;  5IJC A;  4CNM A;  1M10 B;  2OMU A;  2OMZ A;  3UL9 A;  4KNG A;  4QXE A;  1FO1 A;  3CVR A;  4Q3I A;  4LSX C;  2JE1 A;  3M19 A;  1KOO A;  3WPG A;  2OMT A;  3ULA A;  4K17 A;  4L3F A;  2BEX A;  2P1M B;  1FS2 A;  1XEU A;  3RGZ A;  2P1N B;  3WPI A;  4C2A B;  3WPH A;  4R08 A;  3E6J A;  2O6Q A;  1DCE A;  5IJD A;  4R5C A;  5CMP A;  3ZYO A;  2O6S A;  4FMZ A;  4L3A A;  5GMH A;  2ASS B;  3E4G A;  2JQD A;  2Z64 A;  2WQW A;  4V2C A;  5GQR K;  1LTX A;  4M7E A;  1GWB A;  4PQ8 A;  5GMF A;  3SB4 A;  4OQT A;  3VQ1 A;  4RWT C;  4Z64 C;  3BZ5 A;  4LI2 A;  4BV4 R;  2O6R A;  3W3G A;  5B4P A;  3ZYJ A;  5GS2 B;  2WQV A;  2Z65 A;  3WPE A;  5CMN A;  4LSX A;  2ID5 A;  4KT1 A;  3KJ4 A;  2JE0 A;  2V70 A;  2Z7X B;  5IYX C;  2FT3 A;  1W8A A;  4PER A;  4R07 A;  3PMH G;  4NKH A;  1D0B A;  4P91 A;  4NZT M;  1XCD A;  4MQW X;  2P1Q B;  2RA8 A;  3REZ A;  2ELL A;  5B0N A;  4M7E C;  5GMG A;  1OTN A;  2V9T B;  1O6V A;  2Z7X A;  3OGK B;  1XKU A;  4Z8G A;  1JL5 A;  2XWT C;  5GS0 A;  4PEQ B;  1WWL A;  3C6O B;  5LFN A;  4EZG A;  2XOT A;  2WQX A;  4CC4 A;  3GOZ A;  3UL8 A;  4R6A A;  1YRG A;  4CP6 A;  3WPD A;  4FDW A;  3JB9 j;  4B8C D;  4ECN A;  3W3K A;  4WP6 A;  4KXF B;  1XWD C;  4NKG A;  4R0A A;  4R5D A;  4XSQ A;  3C6N B;  1M0Z A;  1FQV A;  3W3J A;  1IO0 A;  3O53 A;  4RCW A;  3RW6 A;  3W3M A;  1KOH A;  4Q62 A;  2P1P B;  5D3I A;  5A5C A;  2CA6 A;  4Z61 C;  1XEC A;  1K5D C;  4CC4 C;  4RCA B;  3C6P B;  4U09 A;  3ULV A;  3G3A A;  2AST B;  5AZ5 A;  1P8V A;  5IJB A;  4LI1 A;  3G39 A;  3W3L A;  4CIL A;  4R6G A;  4V2E A;  3OGL B;  2UZX A;  4U7L A;  4G8A A;  4TZH A;  3FXI A;  4UFR A;  4ECO A;  4FS7 A;  3DZE A;  4J0M A;  4LSC A;  3RJ0 A;  3RGX A;  3RFJ A;  2Z81 A;  1G9U A;  4BSU A;  3UN9 A;  4XOS A;  1OOK G;  4H09 A;  3A79 B;  5FTT B;  4MN8 B;  2R9U A;  2Q4G W;  4LXS A;  1FT8 A;  4XGO A;  3G04 C;  4Y61 B;  2BNH A;  4GLP A;  4PKI G;  3M18 A;  4R58 A;  3ZYI A;  1Z7X W;  5AWD A;  3TSR E;  5AWA A;  1DFJ I;  3RFS A;  2OMX A;  4FD0 A;  2OMY A;  2Z63 A;  5HDH A;  5HZL B;  4U08 A;  4AY9 X;  4QBZ A;  4R6F A;  4ARN A;  3O6N A;  3G06 A;  4FCG A;  4YEB B;  4LSA A;  2Z62 A;  2RR6 A;  4CNC A;  1A4Y A;  4HQ1 A;  1K5G C;  4IM6 A;  1PGV A;  4C2B B;  1U0N D;  4V2D A;  2OMV A;  3CIG A;  3WPB A;  1SQ0 B;  4U06 A;  4J4L A;  1O6T A;  3OJA B;  4GT6 A;  4FHO A;  4BSS A;  3WN4 A;  4BSR A;  4Z79 A;  3ZYN A;  4Z94 G;  4WYK A;  1P9A G;  4NZR M;  1ZIW A;  2V9S A;  1OGQ A;  3W3N A;  1H6U A;  3G3B A;  1M9L A;  2P1O B;  2A0Z A;  4P8S A;  3RIZ A;  3OJA A;  4I6J B;  2Z82 A;  3VQ2 A;  4Q3G A;  1OZN A;  2UZY A; 
#chains in the Genus database with same CATH homology
 3CIY A;  4R6J A;  1P8T A;  1OTM A;  1M9S A;  3P72 A;  1O6S A;  1OTO A;  2Z66 A;  5AWC A;  2WQU A;  1H6T A;  3E3Z A;  2OMW A;  3RW7 A;  3WPC A;  2WFH A;  1QYY A;  2Y5Q A;  1DS9 A;  4PSJ A;  3UL7 A;  3OGM B;  2IFG A;  4R09 A;  4AW4 A;  5B0T A;  3E2J A;  4QC0 A;  4LXR A;  3ULU A;  1A9N A;  5AWB A;  3WPF A;  3RFE A;  4ARR A;  5IJC A;  4CNM A;  1M10 B;  2OMU A;  2OMZ A;  3UL9 A;  4KNG A;  4QXE A;  1FO1 A;  3CVR A;  4Q3I A;  4LSX C;  2JE1 A;  3M19 A;  1KOO A;  3WPG A;  2OMT A;  3ULA A;  4K17 A;  4L3F A;  2BEX A;  2P1M B;  1FS2 A;  1XEU A;  3RGZ A;  2P1N B;  3WPI A;  4C2A B;  3WPH A;  4R08 A;  3E6J A;  2O6Q A;  1DCE A;  5IJD A;  4R5C A;  5CMP A;  3ZYO A;  2O6S A;  4FMZ A;  4L3A A;  5GMH A;  2ASS B;  3E4G A;  2JQD A;  2Z64 A;  2WQW A;  4V2C A;  5GQR K;  1LTX A;  4M7E A;  1GWB A;  4PQ8 A;  5GMF A;  3SB4 A;  4OQT A;  3VQ1 A;  4RWT C;  4Z64 C;  3BZ5 A;  4LI2 A;  4BV4 R;  2O6R A;  3W3G A;  5B4P A;  3ZYJ A;  5GS2 B;  2WQV A;  2Z65 A;  3WPE A;  5CMN A;  4LSX A;  2ID5 A;  4KT1 A;  3KJ4 A;  2JE0 A;  2V70 A;  2Z7X B;  5IYX C;  2FT3 A;  1W8A A;  4PER A;  4R07 A;  3PMH G;  4NKH A;  1D0B A;  4P91 A;  1XCD A;  4MQW X;  2P1Q B;  2RA8 A;  3REZ A;  2ELL A;  5B0N A;  4M7E C;  5GMG A;  1OTN A;  2V9T B;  1O6V A;  2Z7X A;  3OGK B;  1XKU A;  4Z8G A;  1JL5 A;  2XWT C;  5GS0 A;  4PEQ B;  1WWL A;  3C6O B;  5LFN A;  4EZG A;  2XOT A;  2WQX A;  4CC4 A;  3GOZ A;  3UL8 A;  4R6A A;  1YRG A;  4CP6 A;  3WPD A;  4FDW A;  3JB9 j;  4B8C D;  4ECN A;  3W3K A;  4WP6 A;  4KXF B;  1XWD C;  4NKG A;  4R0A A;  4R5D A;  4XSQ A;  3C6N B;  1M0Z A;  1FQV A;  3W3J A;  1IO0 A;  3O53 A;  4RCW A;  3RW6 A;  3W3M A;  1KOH A;  4Q62 A;  2P1P B;  5D3I A;  5A5C A;  2CA6 A;  4Z61 C;  1XEC A;  1K5D C;  4CC4 C;  4RCA B;  3C6P B;  4U09 A;  3ULV A;  3G3A A;  2AST B;  5AZ5 A;  1P8V A;  5IJB A;  4LI1 A;  3G39 A;  3W3L A;  4CIL A;  4R6G A;  4V2E A;  3OGL B;  2UZX A;  4U7L A;  4G8A A;  4TZH A;  3FXI A;  4UFR A;  4ECO A;  4FS7 A;  3DZE A;  4J0M A;  4LSC A;  3RJ0 A;  3RGX A;  3RFJ A;  2Z81 A;  1G9U A;  4BSU A;  3UN9 A;  4XOS A;  1OOK G;  4H09 A;  3A79 B;  5FTT B;  4MN8 B;  2R9U A;  2Q4G W;  4LXS A;  1FT8 A;  4XGO A;  3G04 C;  4Y61 B;  2BNH A;  4GLP A;  4PKI G;  3M18 A;  4R58 A;  3ZYI A;  1Z7X W;  5AWD A;  3TSR E;  5AWA A;  1DFJ I;  3RFS A;  2OMX A;  4FD0 A;  2OMY A;  2Z63 A;  5HDH A;  5HZL B;  4U08 A;  4AY9 X;  4QBZ A;  4R6F A;  4ARN A;  3O6N A;  3G06 A;  4FCG A;  4YEB B;  4LSA A;  2Z62 A;  2RR6 A;  4CNC A;  1A4Y A;  4HQ1 A;  1K5G C;  4IM6 A;  1PGV A;  4C2B B;  1U0N D;  4V2D A;  2OMV A;  3CIG A;  3WPB A;  1SQ0 B;  4U06 A;  4J4L A;  1O6T A;  3OJA B;  4GT6 A;  4FHO A;  4BSS A;  3WN4 A;  4BSR A;  4Z79 A;  3ZYN A;  4Z94 G;  4WYK A;  1P9A G;  1ZIW A;  2V9S A;  1OGQ A;  3W3N A;  1H6U A;  3G3B A;  1M9L A;  2P1O B;  2A0Z A;  4P8S A;  3RIZ A;  3OJA A;  4I6J B;  2Z82 A;  3VQ2 A;  4Q3G A;  1OZN A;  2UZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...