4MNGA

Structure of the dp10.7 tcr with cd1d-sulfatide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
273
structure length
273
Chain Sequence
RLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
publication title Crystal Structure of V delta 1 T Cell Receptor in Complex with CD1d-Sulfatide Shows MHC-like Recognition of a Self-Lipid by Human gamma delta T Cells.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 67
structure length 273
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mngA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4mngA01
3M45A 4ZFZB 1X6LA 3ARSA 3L3JA 4EUPH 3X3FL 3WIIL 1NFIB 1RFDL 3MOAL 3UPCA 1AGCA 5C6WH 4O9HH 4YX2L 1U8PA 4LKCB 1T66D 4C57C 1G6RB 4K8RC 5JNYB 3BXNA 3OKKB 2IADB 1KIUA 2DQDL 4M7ZB 3UJIH 4GRLD 1F3DJ 4PGEA 1TZIB 3SQOL 3CFIC 1UA6H 3EYQD 3PWJA 4XVTL 2BSSA 3ARZA 5T3XH 3V0WL 1AGBA 4HKBA 3BP6A 3K2UL 4K94C 4AEHL 5C7XH 4LAQL 4Z7WE 1J0IA 3HMWH 2YD9A 3BUYA 5AWNL 1OSPH 3V5DA 4KQ4H 3DBXA 3GMOA 1GGCL 4Y89A 5TFSH 1D5XB 5HVFB 3NN8B 1U8HB 2A2QT 4KUZH 1PEWA 3WIFB 1NBVL 3CVHA 3FZUC 1UCTA 5T1LD 1A4JB 3JV4A 4RFNB 4OV5B 3BIKA 4JO3L 5C09E 4WI8A 2OI9C 5GGVY 2XA8H 4OLXH 2VDNL 1XGPB 4Y4HA 3CZFB 2YZ8A 3K46A 5GJTL 4O4YL 3E6HB 4Y5VB 3DX6A 3T4YA 3QUXB 4PJDB 4PJHE 4HIHA 4LSSH 2R15A 3DRQA 4P5TB 1NC2B 3CGTA 5FXCH 4YK4B 5GGUB 4LCYA 1X7QA 3C60D 4GW5B 4QCIA 4WO4B 2BERA 4L4TE 4BA8A 5C9JB 4YHKL 3SCMC 3T8XA 3DETD 4YE4L 2YD6A 1F6AA 3CAFA 4EEEA 4UBDD 1FH5H 2NY5L 5GGRB 3ZKMD 3WFEL 1K4DB 3ZKXB 2XN9A 3O4LD 3O0RH 2IANB 1FO0B 4PBWD 4OD1L 1J11A 3X12B 4OT1H 3WD5L 4LCCC 5DHYB 1JUFB 2L4OA 5EO1B 4ZUUB 3OXSB 2YA0A 1J87A 4B53A 4KRLB 1W72H 4R7NA 5MENA 5DFVD 5J13B 4RAVA 4LSUH 4LSQH 1B4JL 2IAMA 4L5FL 2DQFB 1VEOA 2MCPH 4PJ5D 2W0KA 5D5MF 5CINH 5JLZA 1YZZA 4IRSB 4L3AA 4MQ7A 1RZJL 8FABA 1E4XI 3MGAA 5DHVA 5HGAA 1DUZA 1P7KA 2FL5A 2ATPA 4M1GH 3ZYZA 3RRQA 3BDYL 3GBML 5T3XD 5IB5B 3ZE1F 1FIEA 1FVCB 3B2VL 2DQTL 3KAAA 2AXJA 2Z93A 4Q9CA 5E8EA 4K3DH 4PRBB 4BZ2L 2X41A 2YA2A 3LD8C 5EIIA 3P73B 2X89A 1TIUA 2MKLC 3HG1B 3SDDA 1DN2A 2E6JA 2WIIA 4XTRC 3RP1A 2E9IA 5D93C 1J7VR 1QBLL 4LSPH 2X4OA 1QFUL 5F7DA 1MWAB 1ZLVH 3G08A 4QNPE 1ZV5A 2XXMB 3L6FA 4H1LA 5D2LA 4MVBA 3HI6L 3QDJB 4GRWF 5GRVK 1ZVSB 4XP1H 1UWXH 2CMRL 3ZT7A 1JPSL 5SWZE 4UOJA 1JMZA 4YO0B 2ZCHH 4U1JA 4ZOBA 1IE5A 3FOLA 1J0ZA 4JZOA 3QA3A 4K23L 1ZHNA 3MV01 1YEHH 2C3HA 1IT9H 3RJDA 3FL7A 4ONFL 1FRGL 3R0NA 5D2NC 4X9HA 4F80A 1EHLL 3QWRA 1K2DA 2R69H 1LO0L 3T1FB 2KL6A 4XCNA 4H1LG 5IVXB 3VWJA 1VPOL 2R29H 3N1QC 3SEPA 3V0VB 1KLFA 1SBBA 5J6HA 4LOUC 1IBGL 5DVNA 2Y72A 3K81A 4PJEF 4U6HB 5DEGB 1CGXA 4XPGL 2V9RA 1PAMA 1U8OB 3HMXL 4JY5H 4PG2C 4I9WD 4NO3A 3MUGB 1JFQL 5H35A 1FIGL 2LVEA 2FHCA 4LEOB 5SX4H 3VFGH 2K7PA 3LEXB 3PL6D 2H26A 4GAGL 5DMGC 3ULVL 3KPQB 2M26A 3VH8B 4R3SB 5D6CA 3BKMH 2XQBH 1P9MC 4NC1E 4WEBH 1ZHLA 5J06A 4HUUA 1ZLWH 1Q8MA 3EGSB 2VABB 5D72L 5KVFL 4YDJB 4H26B 3TBYA 2DQGH 4O2EB 4ODSL 4YDVB 2OL3L 3DHMA 3RWGA 1FBIL 4XBGA 3ZKNC 4G6KL 3BO8B 3O9WC 5MENE 4OAWB 4GXVH 2CKBL 4TULH 2QQNL 4PRHB 5DI8A 4B0MM 4C55A 3MA9H 5MI0C 2AEPH 2OZ4H 4D9RE 5JR1L 1F6FB 3SE4A 5IW1A 5B39A 5GS0C 1R3IL 3C2AL 4MAYD 4DKEH 5DK0A 1T1XA 4PRPB 3RWCA 2P7TA 3GSUA 3TT3L 3CFCL 3OAZH 4NZTH 5GISL 4JM2B 2FR4A 4RWHA 4Y4KA 4OZIB 3A67H 3O8XA 4CVZA 1U8JA 3KPTA 5BO1L 1T0NA 2B5IB 4D0DB 3FQUA 1GYAA 1YEGH 3GSRA 4GUPA 3SBWC 4APQA 1HZHH 2E27L 4R26L 3O3DB 5EU3B 5SX5H 3EDKA 4JLRA 3BPOC 4HFWA 5AEAA 3BEWA 1FCCA 1AXIB 4XZUA 2W9DL 2BHZA 1EFXB 4X98A 2NTSP 1DEEB 4M1DL 1UADC 3IDMA 4N68A 2E8YA 4UQ2A 4M5ZL 2IF7A 3QXAA 4FNLH 4JPVH 4F3FB 3DARA 3SY0B 5GJSL 5K9JL 5E5RB 3KWWB 3SKNA 2G60L 5I71C 3W5MA 3VD9A 1EUUA 5BS0D 4P2RB 2XG5A 3TNMB 4DTGH 2ITDA 3STZA 2ICWI 4OLZH 3VRIA 3ULVF 1FN4A 2R9HD 2XG4A 2GK0B 4N1CA 3FO2A 3NCFB 1MCOH 3QFJD 2UYLB 5D7IF 1NCBH 2VO5A 3BYYA 1NBYA 1I8KA 2YD7A 4FQ1H 35C8L 3ZSTA 3FKUS 1MIEL 5FHBL 3U4AA 3PDDA 1XZ0B 2BOCA 4K7PY 4QTIH 1TJIH 1HHKB 1OAZH 3CSGA 2Y4SA 1YN6B 4JFEA 4NKIH 4PGCA 1WK0A 4N9OB 3MFFA 4PJFE 3O6LL 4P57A 3WE6B 1UB5B 5IHLB 3DUSB 3L5JA 1GGIH 1RFDH 3MOAH 1A9BB 5J1AA 2QR0B 3LKSA 3SE9L 3D0LB 4MB3A 4QXTB 5F88A 1CU4L 2AW2A 2VAJA 3NH7H 4IRZL 4UT9L 1M7IA 2DQDH 1DBKH 5EULV 2NCMA 5DMJB 1KCSL 1I85A 1MRCL 1ZHBA 2IPUG 4KKAC 3E3QA 3SQOH 3E1F1 2OI9B 5SWZD 4L3ED 4XVTH 3DUUB 3V0WH 2X1QA 4Z7VF 5B4MD 5KAQF 3K2UH 2ICWB 4OCRL 1IM3A 4AEHH 1QZ1A 1C08B 1EV2E 3ILQD 1A6WH 5DJ8B 4LAQH 4K2UL 4NHUA 2VC2L 1TCMA 2MQCA 2YN3A 2KUTA 4L4VA 5AWNH 2HP4A 1TDQA 1GGCH 5I30L 1FDLL 3ZT6A 1P1ZB 3REWB 2MSPA 2ZOKB 1E6JL 4ELMB 4OCMC 3NAAL 5DRNA 1JHLL 1MEXL 5DWUL 4P9HC 3RUGA 3HCVB 2NTFB 3GDBA 3SCMB 2NW2A 5C0JB 3MRRB 1NUDA 4JO3H 3VXNB 1IQDA 3QBTB 3PV6A 4LHUD 2FECI 5H2BB 3UAJD 4X7SL 3NCYP 2VDNH 5GJTH 3GRWA 4O4YH 1G7JB 4FQHB 3GIZL 1HOCA 3CLFL 1XF1A 3HPJA 5KOMC 2FDBP 4K9EC 4KJQD 2OM5A 1CFQA 1RZKL 2CLVB 4LCCB 2IC2A 1AXTH 4MA3B 3X17A 1G7PB 2VDRL 4P4KC 4CADB 3ARGC 1UENA 1TITA 5I1DA 4YHKH 4QRTA 2G75A 2V2XA 4YE4H 5MEQB 3HI1B 2NY5H 3W5NA 4QWWD 1S9YA 1WBZB 4U2ZA 5EN2A 3IAGC 1KTDA 4TNWK 1OD7A 4F15C 2F54A 5GRJL 3WFEH 3UP1A 3E2HA 2RAMA 1QSED 2R1WB 3BD4A 3T2OA 3RVUC 3IU3A 4PG9A 1F4HA 1BQHA 1QACA 4XGZA 2PETA 2QADC 3WD5H 4AH2B 5E2TL 4NN5C 4DZ8B 5HHOB 3LD8B 1FLRL 4NN7C 1P7QA 3WXWH 1GJIA 3C8KB 4TOYL 4YFLI 3IAQA 2OTWA 2JKXA 4JN1L 4URTB 5F1IB 1HCFX 5D93B 4OTXL 4R4BA 4N1HB 3FQNA 5IMOB 1FO0L 1KTRL 1AC0A 3MJ7A 5IEKA 5DUPL 5IW3A 3WSQL 3MRNA 4U1KA 3BDYH 1V3MA 4IIQB 1BQHG 1ZOXA 2DQTH 1GGTA 4JGJA 1ZSDA 2FZ3A 4MX7A 1GZPB 4HS3B 4I4WB 3ALXA 1ONQA 4JFEE 2Q87A 4OF6A 1M4KA 2X4TA 5FF6A 3VE0B 4ZAKC 1SBSL 4WFGE 3A6CL 3VWKC 2MHAB 1QBLH 3HR5A 1ZLUK 1QFUH 4LDEB 5CP7B 3ECBB 5D2NB 4RAUA 4HUXB 3B6SA 4X4YA 3E3QE 5H37G 3HI6H 4KK6D 2QSTA 3U46A 5ICYA 4Y5YA 4FFWD 4KTDL 2CMRH 4HULB 5A16B 5I1CL 3NFPB 3PNWA 3KLAA 5CMAA 1OAXL 4ZDHB 4NHUE 1MWAL 4L4VE 5FO9A 4MD0A 5DK2A 5JPMB 1JNHA 4ONFH 1FRGH 1P53A 1EHLH 1WAAA 3UTQA 3H8NA 1DEDA 1FNHA 1LO0H 3S5LB 4P49A 2VISB 3RUGE 5ICXA 3C6LC 1VPOH 4X6CE 4PJDF 4EOWL 1QG3A 1NANH 3VA6A 4P3WA 1KPRA 1FVEA 4X7EC 1IBGH 1SVCP 1ACZA 1XF4A 2HFTA 3MBEA 4OLUL 5CSBA 4Y19A 3PABA 1SY6A 1T6VN 3AXLA 1UACL 2AJXH 1JJUA 4JFYA 4NQTA 3ET9F 5IB4B 4PTTB 1JFQH 1BBJB 3HZVA 1E4XL 1FIGH 3EJZC 3P4MA 5ID1B 3BH8B 1BZ7B 1MCRA 3RL2B 3QDGD 3NIFF 4K07A 4OFDA 1I8LA 4N8CL 3W0WA 3WKNA 4OB5L 3O9WB 4G6FB 2YPLA 3F6IA 3OX8A 3ULVH 1J05A 3TNNB 1OW0C 2EDRA 4RMRA 5E8NB 4V1DA 5MI0B 3VRLF 1IM9B 1DCLA 1BJ1H 4PTUB 3LHPL 4HGWA 4B50A 3QQ4B 4PRIA 5F9OH 4O00A 2VZ1A 2F54E 4WTZA 3MPCA 5T1KA 5J56B 1Q9LB 1U95B 3R8QA 1FVDB 5D72H 5KVFH 4XMLL 5T1DH 4XCFL 2XPGB 3BN9D 1T7WA 4ODSH 2OL3H 3V6OC 1U58A 4HZLB 1IAMA 1CFSA 4R6UA 5DRXA 1G9EA 3FFCD 1FBIH 4GG6A 4G6KH 2EKSA 2DQJL 1IC1A 4RBPH 1VFOA 3STLA 2W9EL 4LLYA 4EI5A 2CKBH 4NYLB 1GC1C 4FRWA 3BWUC 2BHYA 4NKDB 3K4AA 5JR1H 4PYGA 3BPOB 5C08B 2BHUA 5CJXC 2V7HA 3MR9B 1ZVHA 4WTZG 3C2AH 4DWHA 4KI5F 1G9ML 4MXQC 4BKLA 5LGJB 5B22A 3QEHB 5FGBA 3WS3A 3EOAB 3AFLA 3TT3H 2OJZL 4UQ3A 5GISH 1KG0B 5K33A 3RPIA 1MCSA 1FJ1B 2Q3ZA 4UB0L 3GMQB 4X9BA 3MRGA 1Z0NA 3QIBC 3L3HA 3QUYA 1O5DT 3NZHL 1R5VB 3RZCD 3MRCB 1KLGA 4KK9D 4F2MA 4DGYL 1RHFA 3QQ9C 4KXZI 5I71B 2E27H 4R26H 4WI5A 3TFKA 4G5ZL 3GNML 1CLCA 2W9DH 4NKMA 2NX5D 4NQXA 1Z3GL 3MNVB 3FOMA 3QO0B 1NJ9A 4X80H 4M1DH 5C0DB 3WEXA 1D7FA 1HYRC 4M5ZH 4OLEA 5I19L 4KRPD 2ZSVB 4L1DA 4WHCA 2J12B 4NGHL 2EKJA 5GJSH 5K9JH 4GMSL 1IC4H 4O51A 3QNXB 1ZE3C 3ULVD 4PP1D 2I9TA 4QF1A 5L7XH 2EIZA 1OTTC 3OBAA 5M94B 1JHTB 1KB9K 3MV7A 4RDQF 4U49A 1WAAE 2Z4QA 2WANA 4WTXA 4QHKI 4HPOL 1KV3A 5ALCL 5C0FA 4LF3B 2X4SA 3PQYD 4KDVA 5FM8A 4N5UA 1A14H 3MGTA 3HZYA 4E41A 2Y5TB 1F4XL 3TYGH 3T2NL 5K9KA 2EDOA 5FHBH 4XAKE 1LP9B 5D1QD 3FT4B 1EEZB 2VUYA 5D6DC 4IRJA 2ZG2A 3TH3T 2GIYA 2MQ0A 3VXUA 1UJ3C 2R8SL 4RRPG 4K3GA 4X5LA 4J3WA 4W6XB 2VZTA 3RL1A 1T83A 4PGDA 3O6LH 4V1DE 3BKYL 5IG7B 4NUJA 4D9LH 3VCLA 1LO5A 3B9VA 2Q3AA 4K8RL 5DF0A 3MLTB 5JO5A 1ZT1B 4KJWD 2CRMA 1ZGLB 4PRIE 3SE9H 1CU4H 3B5TA 2BVQA 3ALPA 3MRKB 1BX2A 4IRZH 4UT9H 3T0EA 2BY2A 5DJDB 1KCSH 1MRCH 4P99A 4OCWH 3QG7L 5TE6L 2V5TA 4K94L 4GG6E 2W0PA 3BHBB 3GSXB 4YHLL 4NQDE 3O3UN 5H37H 4OCRH 4FFYL 4QRUA 2GSGA 2VC2H 1P4LA 2EDTA 3P0GB 4HUMB 3V52L 4JM2F 3LEYL 5I30H 2CLRA 1FDLH 1A2YB 3I02B 1T5WA 2X7LA 4OZIF 3WDJA 4AG4H 3QIWD 4P4KB 1ZMYA 5EU4A 3ARGB 1E6JH 4Q9BA 4ZXBA 3LN5B 1JV5B 1MEXH 3NAAH 4XNQB 5DWUH 4JM4H 5ACZB 1KNOA 5I75C 2HJLA 2LQRA 4KKCD 3P0VL 3NTCL 5B38A 4X7SH 4LLUB 2GUOA 3OB8A 1KIQB 4F15B 1MLCA 4ORGA 3CLFH 2F53A 5E6IC 2DS4A 3MV9B 1KEGL 5I2IB 2E7BA 1RZKH 2QADB 5T33L 3KPSA 4PV9B 4NN5B 1LEGA 3LKRB 1IGML 5ANMB 2VDRH 5IOPB 5H94A 4NN7B 4LLAA 5I8CA 5BMFH 3EDEA 1CGWA 2HVJA 3BGMB 3H9SD 3U2SA 3G6JA 4XHJC 4Y4FA 3SJVD 4YDIL 3M17B 5B38G 5I18H 1WWAX 3LKOB 3OKNB 1DN0B 5TQ0L 3AC0A 1LVEA 3GMRB 4I0PA 1W0WA 5GRJH 5L2KD 3FB5A 5GRYA 4MJ5A 1N59B 4MNQE 5DZNA 1UG9A 1UXSA 2MQ3A 4KHXL 3FO1A 1NBQA 3VI4F 3MV7E 4V3DB 4N0FA 4R4NC 1EDQA 5GZOD 4DVRH 4PBXA 1FLRH 4CVXA 3AMLA 2N7BA 5LBSL 4ZAKB 4TOYH 3GK8L 4FQPA 2BSRB 4JN1H 3FFDA 3ARTA 4PJXA 4OTXH 3VWKB 4Y2DD 1F4AA 4HIIB 1D3CA 4W68A 1A6ZA 4E41E 5EG6C 2G5RA 4GO6B 1FO0H 4X6FB 5DUPH 1RJLB 3WSQH 1K8IB 4JQXC 3DECA 4QRRB 3EDDA 4HK3J 2ZUQC 1KJVA 5KANG 3VXUE 4JDVA 3RU8L 2YD2A 1NCAL 3OXRB 3OKYA 3RHWF 3B9KC 3I6GA 2J8UB 1U0QA 1LGVA 1ES0A 3ZDYE 1MFNA 3NZ8B 4AL8L 5BRZB 3PE9A 1NLBL 3DIFA 4I0CC 3DO7B 1SBSH 4CDHA 1CGSL 3A6CH 2FECL 4RQQB 1YMHA 5AG8A 4L4JA 2QQKL 3MLUL 4QHMA 3S96A 4JDTH 4PP2A 2O61A 1CGTA 4PB9L 3KHQA 2YA1A 3IFOA 3QUKA 3T0EE 3H9HA 3Q5OA 3UYOD 3C6LB 1F4WH 4G43A 4KTDH 2HJKA 5I1CH 3EJYD 1MFEL 1QHPA 3ZMRA 1RMFL 1SEQL 2WBJA 3MRJA 1A7BA 3MCLL 1HSBB 2ORBL 5ESAB 4PD4J 4KRMB 5EC1A 1FFOA 2AEIT 1NGYA 4ELMF 3ERYA 3SDCC 2EC9T 1PSKL 3MLXH 1S78C 4JY4B 2H8PB 4P2QA 1ITBB 4IDLA 5IEHA 1OTUC 4BQ6A 1MH5A 1MUJA 3SKUD 1LMKA 4ZTPL 4IOFD 4MQXC 4YDKH 2EH8H 4JFQA 2YEZB 4XWGL 4OFVA 4OLUH 1JYXA 4KJPC 4A2LA 4S1DC 2FB4L 1UACH 4XAKD 2ADIA 2F53E 4X7DC 4TYUA 3G6DH 1OGAA 3HE7C 3PIQA 5JOEA 1QA9B 1E4XH 3GM0A 1P7HL 3KPSE 4EN3D 4GXUN 5J0BA 4N8CH 5CKAA 4OB5H 4OI7A 3HLAB 4NO0D 3HI5L 3BD3A 1XIWD 1JGEB 1IGTA 3MLVL 5CGYC 1OAUL 5IHBA 3T77B 3G6JE 3H0TA 3KXFD 3SGKC 2KH2B 1XT5A 3LHPH 2YPVL 5GIRA 4OZGB 4KFZC 2YXMA 1EVTC 4O2CA 3AREA 3MRQA 1WZ1L 4OUUA 4MNGA 3OAZK 3SKMA 1T1WA 5C1MB 2OTUA 3UZEA 4XCFH 5DGQA 5DRWA 1LEIA 5FK9B 2DLIA 5AD0B 5IVOA 2N4IA 3H3PL 2DQJH 3QIBB 2P48B 2HFEA 2W9EH 4NQDD 5SX5K 1N2RB 1VFAA 4PJXE 2Z91A 3V6ZA 2OR9L 3WN5C 4I77L 4KMTL 4BUHA 4M7LT 4DKFH 4JFFA 2FWOA 3MZTA 2VLME 4ZFGL 12E8H 3U9UA 4P2CG 3DX8A 3JWDC 4N0YH 4GKZA 1KOAA 2AXHA 2OJZH 5ISZA 2JJWA 1JI2A 5ESVA 2X4QB 2A83B 4Y8DC 4UB0H 2XWJA 4HH9A 1MVUB 4NQCD 4HFUL 3NZHH 2NZ9D 2W59A 1E0OB 4ZFOA 2OZ4A 4DGYH 2FJFB 4ZODA 3VGGA 1IL1B 2OR8A 1X5IA 5E5MA 2R23A 4G5ZH 4PJCB 4GS7C 1Z3GH 4Y4KC 5F7HA 2CLZB 1YPZB 4G8EA 3VXMB 1B88A 1VB9A 5DJAB 5HPMB 3MRHB 3V5KB 2PW2A 4G8GA 1R3LA 1J1XL 2GJZB 4LLMB 3GUTA 5FKPB 5I19H 3UBXI 3UYRL 4APQC 2AK4B 3TPUB 4NGHH 1NCCL 4XB7A 4YFLF 1R5WB 3DMMC 4PJBB 4BFGA 4GMSH 1PLGL 4P5MB 4JFDA 4TTDC 4MNQD 2ENYA 2CDGB 4A6YA 1ND0A 1CDGA 2EE6A 3LSOB 1UJ3B 4N5EA 4N8PA 3AS2A 4P2QE 1HWHB 5EU5B 2EDWA 3P30L 3QUZD 4HXAL 4NOFA 4HPOH 3TPKA 5ALCH 3QDMB 3VD4A 2ITCA 5F44A 4S0TD 1WITA 3HR6A 5EA0L 2EYRA 3L3IA 5TGBA 2FSEA 5JW3L 4DAGL 3EFDH 2NNAA 5EU6A 3ARDA 4LK4A 1XAUA 1C1EL 1MHEB 4HC1H 2IH1B 2GT9A 3QFDA 5AUMB 4UNTA 5C0AD 3T2NH 5HDQL 1B0GA 3FB6B 4U31A 5ITFB 1P6FA 2WY3A 1OGAE 2AEQL 5CSZB 5D1XA 3DHJA 1XGTA 3MROA 1CTNA 2R8SH 5GGRY 4UUJB 3L3JB 1KF9B 4BJLA 1WISA 3EJJX 4OFYA 1WFNA 3M1BB 1VADB 1X9QA 3BKYH 4PGJA 5L88H 4FFVD 2EDFA 1OAQH 5KSAA 4HCRL 3KPRA 1LE5A 1VFUA 1C12B 3ARBA 1ZWIB 4JPIA 4G9FB 4MNGE 5JOFA 4EDXB 3L7FA 4G80A 4ODTL 4GW4A 5CIPB 3ZDZE 5KVDH 3QG7H 5TE6H 5DT1L 1P2CA 1BD2D 5DHXB 3DVGB 4UILL 5DRZA 1UVQB 3R06A 3IAPA 4C4KT 4X6DF 2XY1A 4YHLH 3GMOB 4MS8D 3BH9A 2CDEB 4M6NL 5D5MA 3ZSSA 5E6IB 1DZBA 1PJ9A 4JFFE 5EOQL 5DJ6A 4NP4L 4HWEH 4X5XA 4QOKD 5TDNB 4P9HL 2XYCA 2F5AL 5CBAB 1JPFA 3EYVA 4OM0L 3W9EB 3L5XL 4HIJB 5FCUH 1EGJA 1H9VA 4MQSB 3MXWL 2NY4D 3N1PC 4WHTB 3HPLB 3KPNA 4MD5A 4G6AC 3P0VH 2KKQA 5DUBB 3NTCH 4MD4A 2VLJA 1KTLA 4YAQA 4DZBA 4F37F 4DQOL 1RI8A 4AEEA 2R4RH 5KS9E 1AO7B 4HMCA 4S10A 3AAZA 1AGEA 1KEGH 5FYKH 1WBYA 3QQ3B 1AR1D 4KZDL 4XHQA 4YEFA 1IGCL 3LVEA 4HQQL 2HKFL 2G2RA 1KYOK 2N7AA 4OD3L 4V2CB 2XNAA 1NFKA 4PJ8C 2D7MA 1I3RB 1WZMA 4G8GE 4QT5A 4Y16A 2LTQC 4HIEB 1HH9B 1TVHA 3FRPA 3SDYL 5TQ0H 2I9LA 2J1KA 4Q7DA 4M8QA 4PJ9D 1EO5A 1S7RB 2HFGL 1AGFA 4JFDE 1R5IB 4LRNL 5I73C 1AH1A 1EXUB 2ZUQB 3MRFA 2C3WA 5A2FA 3CU1A 3MJ8A 4KHXH 3D3VB 4UDTA 1CG9A 4PR5B 3B9KB 1CT8B 4QO1A 3WS6C 4TVSa 3VXQA 3P4NB 5IW6A 5JLZB 1IAOA 3RGVD 1X5XA 8FABB 3HAEB 1D6EA 5EOTB 5HGAB 5LBSH 1DUZB 4OGYL 3X13A 4G8IB 1LP9F 1NMCC 1UB6A 3MACL 3TN0D 3FRPG 4Z5RA 3MNZA 4MMXC 2VZ3A 4BQ8A 5DS8B 4PJEA 5E9DE 4JB9H 4UZGA 3LS4L 3F6LA 2PYED 3RU8H 1NCAH 4L8CB 1NMBL 1T21A 4YPGA 3V5HA 3W39A 5AAMA 4FOMA 2Z92B 4DCQB 1GZQA 2YHGA 3U79A 3DYMA 4AL8H 5J12C 2X4OB 1NLBH 2HT4C 4R90L 3KPRE 3G08B 4M48L 3SDCB 3FB8A 4YFDB 4WWKA 2QQKH 3MLUH 4U7SA 4WIQA 4RGNC 2DL9A 5E8OA 2ZP0T 1MJ7L 5D7KE 3HE6A 3L3DB 4PB9H 4X7FC 2A6JA 2X6MA 1YQVH 2NY6C 5F89A 4OF5A 2NXYD 3MBXL 4J6RL 4MZ3A 2FATH 4U1JB 5HHMB 4WUUB 4PJGB 1MFEH 5FYKD 1RMFH 1SEQH 3CXHK 4WU5A 3D85A 2ORBH 3IRZA 5JOPD 1CGYA 2CUHA 5F8RC 4F33A 3HE7B 1I1AA 2F58H 5FO7B 1IC7L 4PJ7B 2W65B 3DJ9A 1D9KD 1MCCA 3V95A 3MJ9A 4WHDA 4P0DA 2YOCA 3SHSA 2UV3A 4MSWB 3ZE1E 4ZTPH 1J86A 2EC9U 3QNYA 4HKZA 4D8PA 1SQ2N 2VLJE 4KKBC 4ETQA 2OCFD 1IILE 1YC7A 3LKNA 2FB4H 4RX4D 3AS3A 4QTHA 1EMTL 3BP5B 3SDAA 1VACB 5F1NA 3EOBA 3FT2A 4FTVB 1JWMA 2PO6A 43C9B 3DX7A 3QPXL 2C7UA 1FYTB 4RBPK 4YUEL 1GIGL 1FNAA 3U0TA 3HI5H 1YDPA 5FOBA 3MLVH 2BFVL 4GRWE 2HLAB 4HLZG 5C8JB 4LMQE 3S98A 2OS7A 2Z35B 3TZVD 3WN5B 3RVVC 5IB3A 3OF6A 2YPVH 5DYOA 2DI8A 4FN0A 4H8WC 4JQVA 3NCBB 3HMXA 1WZ1H 5CUSL 5CJQL 2BCKA 4DVBB 2JK5A 3B9EA 1IVLA 2E7MA 2X2YA 4DKDC 5CZXD 3QO1A 4GKNB 1IAIL 3UTOA 3QYCA 1GC1L 3H3PH 3VMPA 2R39A 1N5AA 1JP5A 1VSCA 5D7IA 1F00I 4QRPA 3ZL4H 1HILB 5HYJA 2GJ6D 2OR9H 5IQ9A 2H3NB 4I77H 4KMTH 4Y7MA 4FMFA 4YC2C 4PJEE 4ZFGH 4WDIA 1FLTX 2J8UF 5IF0A 1QOKA 1WT5A 3R0MA 4GS7B 3LEVL 2C9AA 4LVOC 1Q9OB 4NBXB 5F1KC 5BZDB 3JUZA 2ED9A 2GAZA 1T0NB 4EI5C 3D25A 3H7LA 4FZ8L 4GUPB 1J0JA 3F7RA 4Q6IB 4APQB 3Q6FB 3JZ7A 1U3HC 3O41A 3EYOA 3DMMB 4KJYA 5E00B 3CSBA 4ONGL 5CD5C 3MV8A 4L8BB 4BZ1L 3ULUC 3WNMA 2ESVA 3P9MB 2HVKA 1DUYB 3U48A 4ZO8A 2PW1B 2HN7B 3OR7A 3RDTD 5C3LD 4ESKA 3CH8A 1GOGA 4LLWB 1CF8L 3QUYC 4HF5L 2P45B 4NT6A 1J1XH 4CVUA 2APWA 7CGTA 2BRRL 5C0BA 3UYRH 2DM7A 3TA3A 1U8IB 1NGPH 2YUZA 2DKSA 4JRYB 1NCCH 4NDMB 5EO9A 1INEH 4BQ9A 3QDHA 3ZKSD 4Z7VA 1E28B 1PLGH 3G9VA 2XT1B 5GGSA 4X5WB 2FHBA 1I9RL 4JZJC 1F6LL 1MFAH 4F9PA 1A1MB 1IGJA 5DURD 1D5ZA 2W60B 1T66C 3KYNB 1EIBA 3S7GA 3P30H 4HXAH 3A0OA 3PGCB 2EZ0C 3TO4A 1ORSB 1I9IL 1I8KB 1RULL 3TM6A 2ICEB 5EA0H 2A74B 1KPUB 3K1KC 4GRLC 2YK1L 5JW5A 4WW1A 4ORZC 1QVOB 3PXJA 5JZ7D 3S37X 2VIRB 1C1EH 4YHZL 2G9HB 2DQUL 4MJID 3QPQD 5GRZA 1CD1B 3P4OB 5E9DD 2UUDH 5KAQG 2ZUWA 4N9GB 1FV1A 4JHWL 4NQED 2AEQH 3LN4A 4OQTA 3O2DL 4MDIB 4BFEA 5CJ8A 4X99A 5JXEA 1N3NB 3KS0J 4ZNEA 4MWFB 4LEXL 2COQA 3HB3D 3V4UL 3OR6A 3DV4B 3B2UD 1U8MB 3DTXB 3HZKB 1KCGC 3QXWA 4OZGF 3GJEB 1D5IH 1CVRA 1CDUA 4PIRF 1RSFA 5BV7C 3X11B 4JZNA 2PUQT 4BSWB 4JFXB 2EDEA 4JDZA 1JZ5A 4RNRA 2X1PA 5KN5A 1BWWA 3PWNB 3WDHA 1SJEA 1PQZB 3LRSA 3TIDA 4LLDA 3VXTB 4KXZH 4P23A 4JEGB 4M5YH 1OLZA 1ZGLP 5E2JA 2NY0D 3F7VA 5DT1H 3I50H 5D7LA 2PXYD 3P77A 4J12A 4LIQE 4AENA 4UILH 1KCVL 4WV1A 1G7QB 3AUVA 3MRPA 1KGCE 2BK8A 2DWEB 3SE3A 4FQLL 5D7IE 4QRPE 3CFKB 5HYJE 1L0YA 1XCQB 4M6NH 3DETC 3F65A 4HK0B 4UV7L 1J8HB 4Z7OF 4UBDC 3BQUD 4P2OD 3BESR 5EOQH 4F7TA 4NP4H 1A7PL 4TVPL 2VQUA 2NW3B 3ZKMC 1HHHA 2F5AH 2QKIB 1IQDB 4OM0H 1C5DA 1G7MB 4NBZB 1BREA 1CBVL 4PJ8B 2UWEB 3MXWH 1B9ZA 3UX9B 2LTQB 4U1IB 1JZ2A 4YBQD 2K1MA 4ZFZA 1HOCB 1NFIA 4HZAA 1T89C 3L95B 4Q74A 5JMRA 3GB7B 4X6BB 5DFVC 4LKCA 2HA1A 3MV8E 5I73B 1G6RA 4PJCF 5JNYA 3OKKA 3WNOA 2IADA 2ESVE 3FN0L 4KZDH 1MNUL 1IGCH 2DIAA 4HQQH 3F58L 4YHIB 1BZ9B 1TZIA 3LQZB 5HYFA 1QFHA 4UTBL 1S9YB 2DLTA 4QHUB 5HDLA 5GGQH 4PJBF 5F1OB 1NMCB 2B1HL 4M00A 2QHLA 5FA3B 2BY1A 5C0BE 1LO3L 4G42B 3B43A 3SDYH 1KTKE 4XI5D 5JIPA 4TSBL 3OPZL 1U36A 3AM8A 4ODWB 4Z8FL 3WHE1 2F15A 2HFGH 3VFMA 5DVOA 4LRNH 3KYAA 1D5XA 3NN8A 1U8HA 5EORL 1J5OL 2LU3A 3EW3B 5JHDD 3WIFA 1CFBA 3JTSB 1CR9L 1WFTA 1A4JA 4CU6A 4OV5A 3GBNH 3UTZB 3S36X 3I75B 4JVWA 5C07D 4IEFB 5J12B 5E8PB 1XGPA 4MLSA 3C8HA 3CZFA 4OGYH 2F74B 3E6HA 4Y5VA 3QUXA 3UTSB 3MACH 4PJDA 3KHOA 1WWCA 2E6QA 5FUZL 2E9JA 3IT8D 4CJ1A 4RGNB 4P5TA 2DAVA 4JRXD 1MCEA 1NC2A 5GGUA 3ARYA 1NL0L 4GW5A 2NY6B 1C8PA 5JA9A 1JGVL 2RJMA 5I1KH 5C9JA 1NMBH 2YN5A 5F3BB 2DKUA 4JGMA 1GAFH 1YNKL 4WFEE 1CD0A 3ARRA 4Y1AB 4LVEA 5GGRA 2L7JA 3QJHB 4HUVB 2FRGP 2LV4A 1K4DA 1BLNB 1RUAL 3D87B 1MJ8L 4R90H 4M48H 2IANA 1FO0A 4OFIA 4LQFL 4RA3A 5F9AC 5DHYA 1JUFA 1RJYB 5EC2B 5EO1A 1MJ7H 4ZUUA 1JRHI 3MBXH 5DLML 4HDIB 1MCLA 3IS0X 4J6RH 1MY5A 4LSRL 2Q8AL 1YEIL 3L5IA 1OF2B 5KSBB 2AK1L 2DQFA 3KLAB 3ZLQC 1FNSL 2D7PA 4IRSA 4XPTL 3PL6C 1EAPB 1MLBA 2RBLA 2FHFA 1U91B 1RZ7L 4OSUL 1X4XA 5AYUL 1ETZB 5IB5A 2V5SA 4IHOB 1IC7H 1FVCA 4G7VL 4KKNA 5D1ZD 2CPCA 3UDWC 5LGHL 1MAML 4NC2B 1KPRB 1ZEAL 3GFUA 3P73A 5CEZH 4K7FB 3HG1A 1X5HA 3TJHD 1LE9B 1T0PB 4YWGH 1WLHA 1RZIB 4P4RB 2VLRB 1PDKA 3G5XB 3W0WB 1O7VA 1MWAA 3T65B 4RGOL 1BIHA 5EZOL 5IBUB 1KB9J 4KWUA 3QDJA 3GSNL 1QP1A 1ZVSA 4M02A 3QPXH 4LGPB 4LSDA 4YUEH 1GIGH 4MAYC 3I3EA 4ZS7H 1AKJD 1K4CB 3QEUB 1OD9A 1TZGL 4YO0A 2BFVH 4LPTA 5I8EB 1S7QB 4OCYH 4IMLB 3TBVB 5A3ID 2C4FU 3FQTB 5C0RL 4YC2B 1MJJB 3CPLB 4RISL 5IM7B 3RWHB 1TFHA 5CUSH 5CJQH 1Y6MR 1CICD 5MEPB 2EKSB 5DTFB 3T1FA 4EI5B 2YD4A 1FFRA 3V0VA 5FGCB 1IAIH 3FONB 1B0RB 1QRNB 1MCIA 4CGTA 1JNNL 1U3HB 5DEGA 1BQSA 4U6HA 1BM3L 5IK3B 1U8OA 1G84A 4PJDE 1FNGB 3MUGA 3QIUD 3S6CA 5E2VL 4PFEA 4LP4A 1WTGT 4HJGB 4LEOA 4LRIA 2FBJL 3LEVH 3LEXA 3KG5A 2ZG1A 3HUJB 1DVFD 2J88H 1UYWL 3KPQA 1JN6B 1L4IA 3NIFE 4RDQG 4FZ8H 2P5WD 3VH8A 4F2MB 4R3SA 1NEZB 3PWPD 2FH6A 2R9HC 5FYLL 2AKRB 4ONGH 3QH3B 1QFOA 1JWSB 3OQ3B 1P5VA 1A64A 3HS0B 4LGRB 5A1AA 5JIIA 4JZJB 3EGSA 2IANE 2VABA 4H26A 5CEZD 4O2EA 4YDVA 3FQWB 2HRPL 4ODVH 3BO8A 1S5HB 1PEZA 1CDBA 1CF8H 2ICES 4OAWA 4KK8C 4GRLB 2XIDA 3VH8G 4PRHA 4I18C 1JTOA 1S9VB 5BOZG 2I9TB 4PJ7F 1HQRB 1V8HA 4H88L 5HY9B 1QEWB 2WMPA 1I9RH 2QV2A 3E8UL 3CMGA 1BOYA 2ADFL 2BVOB 4PS4L 1LO2L 4JM2A 4KI5E 5INDB 4ZD3L 4OZIA 1AR2A 1I9IH 1TQBC 4PREB 4HUWB 1RULH 4DFHA 5T1LB 3HG1E 4D0DA 5K9KB 2YK1H 4JHZA 4MXWL 5BV7B 3GGWB 4YHZH 2JCCB 3O3DA 5EU3A 5C0CE 2WQ8A 5GS3A 2C4XA 2IALB 3QCTL 5B4MC 4JHWH 3U83A 5I74C 4MB5A 3OKEB 1EFXA 3ILQC 5IFAL 1KB5B 2EDDA 3RHWK 3QDJE 2PF6A 4LEXH 4WFED 5GZND 4HV8B 3V4UH 3QNZB 4F3FA 1EJOL 3LAFA 3MTRA 1RZFH 2CO7B 3SY0A 1S8DB 4DW2H 4M6AA 3KWWA 5EO0B 3UAJC 3OKLB 4Z7UE 2DTMH 4P2RA 5D1XC 2J6EA 3TNMA 3RIAF 3NACH 1F2QA 3O4LB 1IEAB 4M3JA 4F57L 2E8ZA 1OARL 2GK0A 4KJQC 5IVXE 3VI3E 4DFIA 5B21A 3WFZA 1T0MB 2UYLA 2ZPKL 2VE6B 3BPLC 4WFFE 5C3TA 3IJYB 5DQJB 4EUPB 1RUPH 3UZQA 1KCVH 4ZTOL 1EFQA 3O4OC 3ULSB 2RB8A 1XFPA 2Q7NA 4FQLH 1R0AL 2IFGA 4KMLB 1BP3B 1XZ0A 5DQDL 4RWYH 4PJ5B 4CAGA 4UV7H 4JPKL 3TYFB 1HHKA 4QWWC 1A7PH 4TVPH 5IKCB 3SGEI 4WU7B 1YN6A 2WK2A 1KJ2B 3QXUA 5EZLB 3CX5K 1NUFA 4NKOB 2R1XB 5HHPB 1CLZL 5DD5L 4M4PA 5MEOB 3WE6A 1UB5A 1Z9SA 3DUSA 1T7ZA 3T0AA 1A9BA 2QR0A 3D0LA 4QXTA 1TJHL 2E9WA 3MRBB 1BBDH 2LE9A 4LNVA 4Z0BL 1NGZB 4N0UB 3FN0H 1MNUH 2DBLL 5J1TC 3U2SB 3F58H 5FOJA 1EEYB 2OI9A 2RIKA 2I60H 3DUUA 4UTBH 1XGYL 2VR9A 2B8OT 1HH6A 2ICWA 1AY1L 3NFSL 3ZO0A 2H45A 4PRHE 3GKZA 1C08A 1LO3H 5DJ8A 3OPZH 2V7NB 4OZHB 3S4SB 1YJDL 3DROA 3F62A 3VFUB 1M05B 2JIXD 5DD6B 4ELKB 4PRPE 1YEEL 1P1ZA 1QTYT 1J5OH 3REWA 1H3VA 2ZOKA 4ELMA 1QLFB 5I8OL 1WWBX 1DR9A 5BXFB 3HCVA 2NTFA 3SCMA 5C0JA 3MRRA 4OZIE 3HC0B 3VXNA 2VWEE 2P8MB 4LGSB 4ODUB 3EAKA 4Z0XB 1CDJA 2CIKB 5H2BA 5E6ZA 5MHSD 2KQNA 3BZEB 1G7JA 1MCJA 4FQHA 4KK6C 4JREC 3DXAE 3H9ZA 4FFWC 5FDWB 2VLKE 1G0DA 5FUZH 1F4YL 1A7OL 2CLVA 3TEUA 4LCCA 3OTTA 1I3GL 4MA3A 4WO4D 2CUMA 1NL0H 1W72B 1MPAL 4CADA 4KVCL 1QLRB 1JGVH 4FXKB 4WY7H 4R0LC 3STBA 3MOQA 5MEQA 2NY5C 3HI1A 3PL6B 2XICA 1SM3L 1MIML 5CJBA 1WBZA 4TVPD 3ZZ1A 4S0SD 3BMVA 4RFOL 1DBML 5IJKC 2R1WA 1MJ8H 4ZPTB 1F02I 4KTEH 4P2RE 1Q1JL 4C4KO 3EO9L 3O45B 4LQFH 4AH2A 2DBJA 4DZ8A 5FYJL 5HHOA 5DLMH 1NAKL 1I9JL 3SGJA 1C5BL 1KEML 3RVXD 2P8LB 2Q8AH 1YEIH 3C8KA 1H8OA 4ENED 2AK1H 4U6VL 1UJTA 5F1IA 2RGSA 4XPTH 3S37L 1JF5A 5IMOA 4X4MA 1ACYL 1RZ7H 2C1OB 1A6VL 4OSUH 5AYUH 4IIQA 3JBG7 4G7VH 4HWBH 2UWEF 3T1WA 1HCVA 2WAHA 1MAMH 1GZPA 3OKOB 4HS3A 4I4WA 4MAYB 4NHCH 1ZEAH 4P2YA 5ILTH 2PTUA 3BN9C 1KULA 3VE0A 1E4KC 3WXVL 1HKLL 5C0CD 2ED8A 1C5CL 2CDFB 2MHAA 3C5JB 4FQXA 3ZYJA 5CP7A 3CDGB 3ECBA 5D2NA 1NPUA 4HUXA 4RGOH 2HJFB 5EZOH 2X4NB 1YQ2A 3RWIA 4PBVC 1YY8B 2AJ3B 3GSNH 3U9PL 3KYMB 3F7YB 5A16A 4XXDB 2P47B 5K9QG 4HPYL 4XP9L 4P3CL 5GIRB 3NFPA 5E2WL 1U42A 5IP4A 3P2TA 3T0VA 1IEBB 4ZDHA 3O6FA 4NC0B 5C0RH 4YBLC 2YD1A 4P48A 4RISH 3WNNA 5JPMA 3UPAA 3RZCC 3BJ91 4KK9C 1NCTA 4RCAA 5FYKU 4ELME 1LK3H 1CVSC 3S5LA 5BS0B 2VISA 4XP4L 1A5FL 4GQ9L 3RKDD 1JRHL 5DGRA 5T3ZE 4DUWA 1PZ5B 1JNNH 1NLDL 1I75A 4EBQL 1P9MA 4YR6A 3QFJB 1JPST 1MCHA 1MI5E 3C09C 1BM3H 3LIZL 4ZOAA 2GCYB 5IB4A 4WRLA 4PTTA 1BBJA 1CLYL 5E2VH 1VGKB 5ID1A 4PLOB 1RUMH 3BH8A 3OL2A 4ZMAT 1BZ7A 2A77H 3RL2A 4JHBA 1I8MB 1QFWI 3T08A 3MXVL 3V8OA 2FBJH 3IKKA 4WUKL 1N5YL 1DE4B 3O9WA 4BSVB 3ULVC 4PP1C 1LDSA 3TNNA 5I1EH 1UYWH 4H25B 5IBLD 3OGCB 5E8NA 2ZG3A 2FEDD 2BVPB 4I18B 4A2MA 3AROA 1IM9A 5E94B 2QQLL 4C56E 3MGOB 4PTUA 2VQ1B 3EZJB 4WJ5B 5FYLH 4F37K 3QQ4A 2EDQA 2W07A 1W2KT 4U3CA 1WT5C 1Q9LA 1KN4L 1U95A 1FVDA 5HHXL 1C16B 2XPGA 1FNLA 5KSBF 4HZLA 4B7LA 4JAMB 3GUTB 2Y36L 4L9LC 5D1QC 1TQBB 5HHOE 3S36L 4NYLA 3TC9A 1RU9L 2QBWA 3SBWA 3GSWB 5D4QA 5SWZB 4NKDA 4L3EB 2UUDK 1CFVL 1P69B 4X6DA 1G7IB 4LBEB 4X4ME 5C08A 4J3SA 1F5WA 3MR9A 4H88H 5I74B 5C0EB 1DQJB 1ZS8B 5FAAA 5LGJA 2BMKB 2DQEL 4PRPD 1QUNA 3QEHA 1MRDL 3E8UH 3ZYIA 4KJWC 1B6UA 3EOAA 4M6OH 5CHNB 2ADFH 5DMIL 4PS4H 1LO2H 1KG0A 3PG2A 1FJ1A 1WZKA 4ZD3H 1KYOJ 5EU6B 3GMQA 2AERT 1O7SA 2I24N 2YBRB 4Z7QF 2Z8WC 3J8F7 1A3QA 1R5VA 3MRCA 3KDMB 4HGMA 3DXAD 3I9GH 4MXWH 3VXSD 2VLKD 1F97A 1EO7A 4LHUB 4F9PC 3WIHA 3QCTH 5D2NE 3SOBL 4S11A 2Q86B 5BOPA 5IFAH 3MNVA 2D0FA 3TO4C 5CLTA 3QO0A 2BOBB 5EBWB 5C0DA 1MCPL 5KZCD 1VFMA 3BPLB 1LO4H 3O4OB 5DEFB 3DOSA 5BV7L 2ZSVA 3QIWC 1CS6A 1I7UB 4UDUB 3WFCH 5F9DC 4UINL 3U0PB 3QNXA 2V5RA 1J0HA 4KKCC 1LQSR 5HPOA 1JHTA 5CCKL 2X4UB 1X5YA 2VRAA 1QSEB 1EA9C 1A4KB 1CXLA 2FEEI 2H32H 2ILLA 3QI9D 5HBBA 4F57H 4YBHA 1Z9MA 1I3VA 4LF3A 4HW6A 1WIOA 3ULUF 4ZTOH 3BOVA 3UXFA 5HSFA 2Y5TA 4OF3A 5FHAH 4I5BB 1R0AH 3QJFB 3QCVH 4RMSA 4M7JL 3D2UD 1LP9A 3LRHA 2IBBA 3FT4A 4HCRA 4EQ2A 1EEZA 3IETB 3BZ4B 3HUJF 4JPKH 4OFKA 1ZA6B 2DLFL 3F5WB 1BQLL 3N06B 4MQTB 4RFEB 5ECJE 4JFHD 4WV1C 2FX8L 3FAXA 3RWFB 1CLZH 5DD5H 1K8DB 3CCHB 5IG7A 2CUIA 2DM3A 3GZKA 3CXHJ 5GZOC 3NCJL 2XTJD 2YKLL 3MLTA 3O3BB 1ZT1A 2R0ZL 1ZGLA 1WBYB 4NIKB 3UJIL 1TJHH 1FL5B 1MRFL 3AB0C 3QUMH 5DD3L 3MRKA 1KJ2L 4Y2DC 2FLRT 3DURB 4Z0BH 5F72S 5DJDA 1NFDB 2E9BA 2DBLH 3GSOB 5FGSA 5C7XL 4X83A 3V7AG 1OTSD 4J4PD 4EI6B 3BHBA 3GSXA 3IFNH 1BJ1J 4J3VA 4S0UC 3NFSH 4DN3L 1AY1H 4JREB 1INDL 3MUHL 4YGVB 2P42B 3GBLA 4KDWA 5C08E 1YJDH 2XRAL 1A2YA 3I02A 1PGRB 1MHCB 1YEEH 4P4KA 3OWEA 3ARGA 2XA8L 4R0LB 4IS6B 3NIDF 5I8OH 1JV5A 4P46D 4XNQA 1SMAA 2YMXL 5IB1B 3DGCR 5ACZA 4Z78B 1U92B 3QWOB 3BIBX 3D69B 2ADJB 3T2PA 1Q9KB 2JCCF 2AAVA 2WP3O 5HI3D 4CMMB 4LLUA 3FQXB 1KIQA 3RWJB 1MI5D 5LKNA 5D71L 5HGHB 3DPBA 1TPXC 1T80A 4F7EB 4I48A 1UM4H 4J3TA 1F4YH 3EJYC 3MO1B 1A7OH 3MV9A 1RZKC 5I2IA 2AXFB 1N8ZB 4PV9A 1BHGA 3LKRA 1MPAH 3W39B 5ANMA 5IOPA 4YHPB 4KVCH 1Z9OA 2VERN 4XPHL 3BGMA 3QDGB 3VGEA 3M17A 4Y5VC 3VXRD 4C56D 1SM3H 1MIMH 3QCUL 5DSCB 3LKOA 3OKNA 1DN0A 1OP5H 4PJFB 3GMRA 4RFOH 4IOFC 2VDLH 3REVA 1N59A 3FQRB 4LVNC 1W72L 5A43C 1Q1JH 3VFWB 3EO9H 4NO5B 1DBAL 2CD0A 4W4OC 3ROLB 1CXKA 5FYJH 5F9JB 1NAML 2EH7L 5E1HB 1NAKH 3X3GL 1KEMH 4N8VB 3G04B 4ZAKA 5F7EL 4EN3C 4U6VH 2BSRA 3FFCB 2IWGA 1KPVB 2DIBA 3VWKA 3S37H 3KPMB 4HIIA 3L3GB 1XIWC 4G6JL 3T0WA 4X6FA 4CBPA 1RJLA 1K8IA 1LP9E 1A6VH 4QRRA 1FGNL 2X70B 4FQIL 5I8KL 2J8UA 2ZOLB 2Q20A 1BFTA 3V7AE 3NZ8A 1CIUA 5EOCH 5BRZA 4MXVF 3DO7A 3WXVH 4YZFF 1AFVL 3HFML 4RQQA 4YBLB 1IKNA 1C5CH 1N6QH 1CTOA 3RZCB 3OG4B 4L8SC 3T3PF 1X44A 2DIJA 1K5NB 1DQLL 4LPYA 1CQYA 2VYRE 1ZT4B 3WCYA 5FOBB 3O3AB 3C6LA 2FO1A 2NYYD 2CQVA 1BEYH 1AI1L 4R7DB 3U9PH 1HSAB 2C3VB 2NX5B 4S2SB 2JF1A 4JRWA 3DNKA 4JY6B 3RZWA 4HPYH 4XP9H 3C09B 1QNZL 4OZHF 1HSBA 2N56A 4P3CH 5E2WH 5D7JD 4XMKL 4ZUSB 5LG1A 1QHOA 4KRPB 5I76B 2R69L 1ODAA 1H8SA 1G7HB 4QRQA 2NZ9C 4JY4A 2H8PA 5EBMB 5TDPB 4X6EB 1OW0A 4XP4H 1D5BB 2DJ4A 1A5FH 4GQ9H 2EO9A 3U36B 3WFHB 3OAYH 2IBGA 5LAXB 3W81A 1JRHH 1NUGA 1GGYA 3MYJB 4ZS6C 2YEZA 1E6OL 1NLDH 2XOTA 4EBQH 1X6NA 2DMKA 4FXGA 1A1OB 2IQAB 1MCFA 1SEBB 3PQYB 3LIZH 1FAIL 3VFGL 3QISA 5FYJD 4CNIB 2VL4A 1CLYH 2XZAL 3MV9E 1QA9A 4H5SB 2OL3B 2MOVA 2YZ1A 4E9LA 3V6OA 1OGTB 4JFPB 3MXVH 4L9LB 5D1QB 1W8OA 4WUKH 3HLAA 5ANME 2OQJB 1N5YH 1YMMD 5EZJA 1A0QL 3OJ2C 4BK4A 1JGEA 2CKBB 3T77A 4LCWD 2XFXA 2NY3D 1FZJB 3QUZC 3P4LA 2QQLH 5IHZB 2HT3D 1EHAA 5GS0D 5CJXA 2DQGL 4OZGA 5CJ5A 4MXQA 5T5NF 3NOIA 4LRIC 4WFHD 5A2IH 4D0BB 5HHXH 4AZ8A 3ARFD 2C26A 4TULL 1F58H 5FK9A 5AD0A 2Y36H 3JWNC 4H0HB 4HUKB 3FN3A 3S36H 5LQBL 3QIBA 3VDCA 3D0VB 1ULVA 2GYSA 4OJFH 3HNSL 5GGTH 1RU9H 1RK1B 1N2RA 1DQQB 1CFVH 1IZKA 4UV4H 1A6AB 4NZTL 4M93C 4YHNA 3MRDB 4QRRE 3P9LB 3A67L 5KSUA 1ORQB 2J8OA 1MRDH 3WLBB 5DMIH 2J8UE 5JDSB 2X4QA 3WL9B 4WW1B 2A83A 1QPXA 2LFGA 1OPGL 2P4AB 3QIWB 2GFBB 1MVUA 4M6ML 3SDXB 4M62H 3VFNB 5BRZE 4XVSH 2YC1B 4X6CB 2DJSA 1FV1B 2EDNA 3NCCB 2GY7B 2VR5A 2FJFA 1QR1B 3OV6A 1IL1A 2Y5EA 1T04B 3TF7A 3U1SL 3NA4A 2JJSC 3SOBH 4KPHL 4MS8C 4PJCA 5IB2B 2XACC 4XPAL 2CLZA 3VXMA 3PUCA 4OIIH 4J1UB 5HPMA 3MRHA 1MCPH 5IR1B 3V5KA 1QFWL 2GJZA 4LLMA 4KAQL 5FKPA 1I8IB 3TVMD 1LEKB 2ARJB 5BV7H 2AK4A 4TSCL 2BNRD 4N90E 3TPUA 3BP4A 1R5WA 4JDZB 4PJBA 3H9SB 2NY4C 4P5MA 4UINH 3SJVB 5D6DA 4LLDB 1QSFE 2CDGA 3JUYA 3RY6C 3LSOA 1UJ3A 1J88A 5CCKH 3EO0B 5D7LB 5EU5A 3RIFK 2BNUB 5L2KB 3O11B 4AENB 4WV1B 3QDMA 3O2DA 4X0KB 4CU7A 1P84K 1AR1C 1NCUA 4KUCD 4XCYB 4EVNA 2EEBA 1UH3A 3OG6B 1MHEA 5TDOB 1B3JA 2IH1A 4XH2B 1BFVH 5AUMA 2V5MA 3FB6A 5ITFA 3LDBC 4M7JH 3AB0B 3DVNB 3D39D 3T2QA 5ABDE 4Y2DB 2VKXA 2DLFH 3NCMA 4NKIL 2AV1B 3V6OE 4PJ9C 3G6AB 2GEEA 4UUJA 2CKNA 1GGIL 1XF3B 2FX8H 3QHZL 4KK5D 1ZTXH 4ODHL 1FG9C 1VADA 3M1BA 1XF5B 3GSVB 3NCJH 2YKLH 3NH7L 4XRCB 1DBKL 2R0ZH 3V0AC 1C12A 4OZGE 3RGVC 3NCYS 1ZWIA 1L8JA 4G9FA 2P5ED 1MRFH 4EDXA 5DD3H 1CFTB 4WHYH 4Z77B 1H5BC 1KJ2H 1ERNA 4OIAA 5CIPA 4W6WB 1EBAA 5HYIA 2XWBB 4YPJA 2XKNB 3DVGA 3VD3A 1UVQA 1A6WL 2PR4H 5ERWB 1RD6A 1TPXB 4YLQT 4DN3H 3VFMB 1INDH 5I6XC 1RZGB 2CDEA 2XZQL 5E6IA 1BMGA 3QXTA 4NFDA 2RFXB 5TDNA 5HHQB 2XRAH 2QSQA 2P44B 4YGAB 5CBAA 4UT7L 2BNQD 3W9EA 4HIJA 2A9NL 2YMXH 1JGDB 1KELH 4WHTA 3HPLA 2CGRL 4NWTL 1H15B 2FEEL 4P59L 5DUBA 3G5ZB 1DBJL 3RKPA 3DVIA 5D71H 1AXTL 4XNUL 1AO7A 2ED7A 4LVNB 2X4RB 2M2DA 2K9UA 3QQ3A 4OZ4B 2CRYA 4PJCE 4DUXA 2X5PA 1YPZE 4L29B 1FGVH 4XC1H 4U1LB 5I1HL 1I3RA 4XPHH 4EN3B 3SGEH 3UTTD 3QEQE 4HIEA 1HH9A 5EBLB 3KLHD 4NO0B 2EEDA 1RVFL 3QCUH 1FHGA 1XIWB 4OCXL 4UIMB 4XCCL 1S7RA 4JQXA 1R5IA 1RURL 3OB0H 1XGQB 3KXFB 1EXUA 2CR6A 3D3VA 1S9XB 3B9KA 4PR5A 1CT8A 3WXWL 3IVKB 5GS1C 2X9YA 1DBAH 1JFMA 3QDME 3P4NA 1CD9B 1JNJA 1NAMH 2EH7H 3X3GH 1EERB 1MLBB 3HAEA 5EOTA 1CDYA 5F7EH 4G8IA 5J8OA 5FO8B 2IBZX 3RTQD 2R1YB 3FB7B 4OZFH 5FV1L 2A6KB 3LMJL 3F7QA 4MJ6B 1YA5A 3CU7A 5DS8A 1V7NH 4G6JH 3TV3H 5E1AB 4PJAE 1HI6B 1I7TB 2OXHA 1WCBB 4L8SB 3BPCB 2EE9A 3TZVC 3U4BL 2B2XL 1FGNH 4L8CA 3SGJC 4FQIH 5I8KH 4I13B 3ROOB 1A6UH 2EXWC 4DCQA 2Z92A 3NCEB 3HAEG 4LU5L 5CZXC 1AFVH 1R3HB 1JZ8A 2YWZA 3HFMH 1FFPB 2AVGA 2VDPL 4NQCB 5F6HI 3SDCA 4IIQC 3PWLB 1G7LB 1NFDF 4UU9B 4G9FE 1LHZA 2CIIB 1M7DB 3L3DA 4O58L 3CDFA 1DQLH 1X5AA 2JJVA 5IMMB 1AI1H 2QTEA 3EUUA 3GKWH 4GSDL 5KG9A 4WUUA 5HHMA 4PJGA 2VL5B 3UO1H 4FQXC 4NRXB 1QNZH 4XMKH 3VD7A 1FL6B 1RUQL 4Z6AT 1QSFD 5CLWA 3HE7A 2BY3A 3M8OL 4KH2A 5DJ0B 5FO7A 4PJ7A 2W65A 5F8QC 5F97E 1IARB 3DYPA 4U2YA 3RIAK 1RZ8B 2IMMA 2HT2D 4MYWB 4MNQB 1T4KB 5E4IA 2B1AL 4MSWA 4K7PX 4L3CB 2AJXL 1U41A 3QUZB 2Q6WB 3BGAA 3SGKA 3C6SB 1E6OH 3F7PC 3O6FC 3RDTC 5E08H 1BVKB 4IDJH 1FAIH 1AO7E 3MZGB 3BP5A 3DGGB 2HTKD 3QZWB 3BRDA 1VACA 4TUKL 3THML 1DLHB 2XZAH 2WINB 5C0AB 4FTVA 4DGVH 3DVFA 4PLJD 43C9A 4G6ML 1FYTA 1A0QH 2ICWJ 4PRAB 4PJFF 5F9OL 4F7MB 2HLAA 2Z31D 2XN9E 5EFIB 5C8JA 3WN5A 2Z35A 5M7QA 2OXGA 5JDJA 5T1DL 1P5UA 3MODH 4M93B 2QEJA 2GHWB 32C2B 3CFJB 1M71B 3PHQB 5JZ7C 4DVBA 3IXAB 3D3VE 4HUNB 3QPQC 5MERB 2AXGB 2P49B 4GKNA 5D70L 3CX5J 4WI9A 4PLNC 5MP6H 5LQBH 1NGXB 2Z9TA 3VRJB 2ZJSL 2H1PL 3HNSH 1BD2B 1HILA 3QQ9D 4HS6B 5DJYB 3K4DA 5HVWA 2H3NA 3B2UC 1JPGB 3MCKB 3TP4A 5KANI 1T5XB 1GL4B 3Q5TA 4NN6C 2IBZY 1L0QA 5C09D 1UWEL 4P3DB 1WIPA 4C59B 4HT1L 1Q9OA 5BZDA 4QOKB 3C08H 4DUVA 4Q6IA 4W4NA 2DMCA 3Q6FA 1OPGH 4XP6H 4U4BA 4M6MH 3DMMA 5E00A 2NY0C 5B39G 3AGVA 2NY4B 2O26U 2PXYC 4L8BA 3FN9A 5IHUH 2AJVL 4L4TD 4NPYB 3P9MA 2FBOJ 4X80L 1DUYA 5D2LE 3U1SH 1KENL 4KPHH 4XPAH 4DOHE 2PW1A 2HN7A 4NM8L 5DO2D 4X7TB 1JE6A 3BQUC 4LLWA 4P2OC 3CVHH 4RIRB 1QFWH 3QEQD 3VXPB 3I6LE 1IC4L 4KAQH 3HA0A 4UT6L 4WUUE 4F7CB 4PJGE 4AEFA 1U8IA 2DYPD 5BJTB 4TSCH 3IDIB 3QULB 4ZPVB 3CC5B 5L7XL 3BD5A 4JRYA 4NDMA 2C3XA 1I1YB 2EDXA 1E28A 3LDBB 2WWMD 4K55A 1HYSC 1EAJA 4LL9A 4X5WA 1BOGB 4GBXA 1A1MA 4PJ7E 5CP3A 3RVTD 1VKXA 4PJ9B 1AD9B 3WJLC 4FQCH 4RMUA 2W60A 1A7QL 3KYNA 3C5ZD 2LABA 1IZJA 1A14L 3PGCA 1NC4D 1ORSA 4N0CD 4GH7B 2ICEA 4PB0H 1MHHB 3TYGL 2A74A 4PV8B 1I1CA 1KPUA 3BMWA 1QVOA 5FUCE 4HEPG 2VIRA 2G9HA 3Q3GB 4Z7NF 3RGVB 2GKIA 3ZKQD 1CD1A 3P4OA 2AI0L 4N9GA 4TQEL 2CH8A 4D0CB 3TN0B 1H5BB 3K3QA 2BSED 4MDIA 1OY3B 4FTVE 1N3NA 4MWFA 4U7MA 4D9LL 1NGQL 1FYTE 2YSSB 3L5HA 3DV4A 1U8MA 3IJHB 3DTXA 2PYEB 3QHZH 3HZKA 2KZ1B 2EYTB 4ODHH 3GJEA 3GMPB 5FA4B 5I6XB 3X11A 4BSWA 4JFXA 1RIUL 2SEBB 3RAJL 5DHVH 4OCWL 1HIML 3PWNA 1PQZA 4XPFL 5IV2B 3VXTA 2DWDB 3AS0A 5JPNB 3T04D 3L3KB 5CBEB 4RAHA 1HH6B 3HC4L 4CUCA 1G7QA 1U3JA 4MAUH 2NXYB 3CMOH 2A6IB 2DWEA 3GMMB 2JJTC 3CFKA 1VESA 2V17L 3DROB 1XCQA 2XZQH 4HK0A 4KZEL 4AG4L 1J8HA 2XWTB 1JNLL 2WUBL 3D9AH 4JM4L 2NW3A 1OB1B 4UT7H 2QKIA 3H3BC 1G7MA 1NCWL 1PY4A 3SDXF 4PJ8A 3KYOB 4Y4HD 2A9NH 4WNQB 2UWEA 4WGWB 4V3EB 4X6CF 4H1LH 4XWOD 4U1IA 4ZSOB 1Q9WB 2CGRH 4NWTH 4OFPA 4P59H 1OP5K 1Z0MA 3OSKA 3L95A 1DBJH 3GB7A 4X6BA 4S1QL 5JQ6H 4XB8A 5CGMA 4XNUH 4NZDA 1F11B 1N7ML 4LDOB 2NR6D 4K3JH 5GS1B 5BMFL 3WS6A 4YHIA 1BZ9A 5IMLB 4KRNA 3LQZA 4NNXB 4JKKA 4BFIB 5I18L 5I1HH 1I4FB 3DRTB 5D1ZC 4QHUA 1AQDB 2O5YH 1V3JA 3VMNA 1PYWB 5FA3A 1Q72L 2XN9D 4G42A 1X5KA 3EOTL 1RVFH 2VZUA 4OCXH 4XCCH 3S35X 3U0WL 1CWVA 4ODWA 1OVZA 5GGVL 4M7LH 1RURH 3G9AB 4FS0A 4DVRL 3TZVB 1B6DA 5E7BA 5F6IC 1IGFH 5MEND 2JB5L 3JTSA 3H7BB 4W6YB 4LPCA 5SWQB 2IAMD 1JWUB 3UTZA 3DSFL 3I75A 1TMCB 4D9RD 5E8PA 2PCPB 4WEUD 2F74A 1A6PA 3UTSA 1JF1B 2EDKA 3LMJH 2QHRL 5HHNB 5FEBA 3KGRA 4XCEB 1UQSB 5A3IC 5F7LB 2GJ6B 5KSVB 3U4BH 2B2XH 3RNQB 1PG7X 2F19H 2X89D 5IMKB 1IGIL 3SDDD 5F3BA 3BWAB 5F93C 2X1WL 4ZUVA 2OTPA 4Y1AA 4QYOB 4FQXB 4LU5H 2ZWLT 5ADPL 5IVNA 2FIRT 3QJHA 4JDTL 4NZUH 4HUVA 1CD8A 1BLNA 2VTFA 1L9MA 4JR9L 1T1ZB 4R97C 2VDPH 2AEWA 3BVNA 1BF8A 1S78D 1AE6L 4MVBD 3RWIB 1F4WL 2ICCA 5EC2A 1RJYA 5KS9B 2NXZD 4O58H 3OAYK 1N0LA 4HDIA 3EHBD 3QIUC 3TIEB 5HJ3B 2PTTB 1OF2A 5BQ7B 4UMGA 5KSBA 4GSDH 2I27N 5DXWA 3BDXA 3O6FB 3RDTB 1A21A 4JFZL 1EAPA 3WHE0 1IKNC 3ZTJG 1DVFC 1AIFA 1B2WH 3MLXL 3O3EB 4OV6F 2QSCL 3MLYH 3LKQB 1U91A 1RUQH 3QWRD 1ETZA 1J8HE 3M8OH 4EDWL 5C0IA 4IHOA 2FD6L 3TBWB 1CXHA 3P3YA 3VWJD 5DD0L 4PRNB 4YDKL 2EH8L 2B1AH 2I07B 3ZTNL 5DURB 4YR6B 1PD6A 1G6VK 4K7FA 4HBCL 1LE9A 3WV0A 1T03H 1JPTL 2APFA 3IF1B 3G6DL 1MQKL 4FHBD 5FUOL 1RZIA 2A73B 4P4RA 2VLRA 4AQOA 3G5XA 2W92A 1BJMA 4XX1G 4JANB 3T65A 4TUKH 4MJIB 3THMH 2DI7A 1R3KB 2UY7A 1RJZB 3CUPB 2WSKA 2WZPD 3JV5A 4G6MH 4XMPL 4NQEB 4QHKJ 1K4CA 3QEUA 5I8EA 1S7QA 5TE4L 3CSPA 4IMLA 3TBVA 4LVHC 3GMNB 3WKML 5EBGA 1BECA 1OL0A 5EB9A 1PKOA 2H6PB 3FQTA 1MJJA 3CPLA 3S9DB 5IM7A 3RWHA 4DN4L 4NN6B 1TJGL 3D5OF 1ZGLM 4HKXB 4X9GA 4HJJH 5MEPA 1T3FB 5IBUG 5DTFA 3P11L 2Q76B 5D70H 3FONA 1B0RA 4ZFFB 2H9GB 1QRNA 3F12B 2HKHH 4BFBD 1U3HA 1HXMA 4X6DB 4LMQI 4DKFL 2NY0B 2ZJSH 4QXUL 1SJXA 12E8L 2H1PH 5IK3A 2PXYB 25C8H 1ZLSH 5DEZA 4N0YL 1FNGA 1OCWH 4RGNE 3OJDA 4HJGA 1TZHB 2XQYK 4TPRL 3SPVB 4Y4KD 1HHGB 3AU1B 3O8XD 1S7WB 1UWEH 1ZK9A 3QAZC 3HUJA 4HT1H 5K59F 3BQUB 4P2OB 4M8VA 2VB5A 1J8KA 1JN6A 2NZIA 3MRMB 2R2BB 4APQD 5FYJU 1NEZA 1FNFA 5JIHA 3IDXL 4Y1AE 5E0QA 4ZOCA 1EH9A 2AKRA 3KNBB 3QH3A 1L7IL 1JWSA 1OT1A 3HS0A 1S7XB 2AJVH 4JZJA 3O2WL 3GI9L 1KENH 2WW8A 1NKRA 3FQWA 5C92A 2FNBA 1IGYB 4NM8H 1JIBA 4Q6YA 1S5HA 4G59A 4GRLA 4L9DA 4V2BA 5KSBE 4UT6H 5FM5O 1NEZG 1HWGB 1S9VA 2YRPA 4ZUWB 1HQRA 2VDQH 3TF7C 2LAAA 2VXVL 3GRWH 5HY9A 3GMLA 4XX1E 1QEWA 4XNMB 5B8CC 5T5FL 5AAWA 4U3XA 1JGLL 4KQ3L 3RWEB 2BRQA 2BVOA 1J0KA 1A7QH 5INDA 4Q97A 1NCNA 3EFDL 1BFOB 4PREA 4HUWA 5JHDB 4HC1L 2WV3A 5T1LA 4Y19E 3NGBC 4ONHA 2AV7B 2Y06L 2Q7YB 2JB6B 5C07B 3GGWA 2JCCA 4TN9A 1GOFA 2VLRE 4AM0B 1OM3L 4Z7QE 2YUXA 2IALA 4JVUA 5HVGB 2AI0H 4P5KB 4TQEH 3B3IB 1VEMA 3W0WE 3OKEA 3KPOB 3QEGL 3ARPA 4JFED 1KB5A 1J10A 2YPLE 3PWUB 4M1CC 1CE6B 4HWZB 4JRXB 1VERA 4WFGD 5JMOC 1NGQH 4HV8A 3RJQB 5L88L 4Y8AA 3QNZA 1OAQL 5JIKA 5HI4C 3BDBA 4BUGA 1S8DA 1MFDL 2HWZL 1A7NL 5EO0A 4JFOB 1RIUH 3OKLA 1JZ7A 3RAJH 5KVDL 1HIMH 3BKCL 4XPFH 4I2XB 3FHAA 1D5MB 3O4LA 2YRLA 1IEAA 4TUOB 3VFSB 1AGDB 4QHLB 4U1NB 1T0MA 4K7PL 1KC5L 2VE6A 5FGCE 3HC4H 3IJYA 5DQJA 4EUPA 4XNYL 1QRNE 5EPMB 3PWVB 4NBYB 3ULSA 1T89A 2WBKA 1CXIA 3QRFM 2WLYA 4L4VD 1TETH 4RGMC 4KROD 5IBTL 3S34L 4HWEL 4JE4B 5J4MA 2PTVA 1FFQA 2BVTA 2EIDA 2V17H 3ULUE 2PNDA 1BIIB 2V2WB 4PJ5A 3JWOL 4KZEH 4MHHG 3TYFA 1N4XL 3CJJA 5FCUL 1JNLH 3U30B 1A3LL 4MNHB 5SV4A 2WUBH 3RVWD 1XR9B 5IKCA 4RMVA 4CKVX 5CD3B 4WU7A 5FGRA 1KJ2A 4XVUD 1E27B 5EZLA 1NCWH 3FJTA 5D1ZB 4NKOA 2R1XA 5HHPA 2BVYA 2DD8L 5JUEL 4U6XB 1L9NA 5MEOA 2R4RL 1W0YT 4I48B 4ZUTB 3RQ3A 2DQCL 5FYKL 3OB0K 4E42B 1K6QL 1DDHB 3RVXC 4S1QH 1P4BH 3MRBA 4ENEC 3L5WB 1IFHL 1N7MH 5F6IB 2E7HA 1GCFA 1NGZA 4N0UA 1UKSA 1EEYA 4PGZA 4LNRB 1X5GA 1PVHA 1DL7L 2YUVA 3K2MC 3OKMB 1FCGA 3CD4A 2F54D 1KXVC 2GW5A 4GG8B 3QXDB 1Q72H 5L2JB 3REVB 3HN3A 3EOTH 1AKJB 1IAIM 3U0WH 1KCKA 5IFJB 2V7NA 3BYTA 4OZHA 3S4SA 1SY6H 5GGVH 4AMKL 3VFUA 1M05A 4JN2B 5DD6A 4ELKA 1DLFH 1SVZA 2JB5H 1QLFA 1P7QD 3CK0L 3I6KB 1KBGL 1JL8A 2IQ9H 2X4PB 5BXFA 4GAYB 3IJSB 3DSFH 3HC0A 1JYVA 1NUNB 2P8MA 4ODUA 4Z0XA 1T2QL 2CIKA 2UZXB 3EYFB 3T3ME 3NIDE 5J9PB 3FTGA 3BZEA 1ZLVK 4I0KA 4JB9L 4HEME 3MQIA 2ZKHH 4R97B 5FDWA 2JCCE 2QHRH 3QB7C 1WFUA 2VXUL 1UWXK 3FCTB 3S4SG 4CRPA 1H3WM 2YS4A 4FZEL 1W72A 1JVKA 2Q8BL 2OMBA 1XMWA 3QIUB 1YECH 1QLRA 5HDOA 1IGIH 4FXKA 4NQSB 1ROWA 5DA0B 3LZFH 3O6KH 3IDNA 3PL6A 1I7ZB 5D9SB 2DB8A 1DVFB 1A1NB 5ADPH 1INQB 3ARQA 2P5WB 4JQIH 1IAII 3RKDC 1VCAA 2DM2A 3PWPB 4JR9H 5ACMA 1YQVL 4ZPTA 1CLOH 5IESL 3E6FB 3UDWA 1AE6H 2FIKB 5GRWA 3O45A 2FATL 2Y07H 1UM5L 3O4LE 1NDGB 5AZEL 2D4FA 3VU2A 2P8LA 2B4CH 5GGSY 2GITB 3QSKB 5J57B 1ZHKB 4Z76B 3R8BB 4JFZH 2F58L 4QRQB 2QSCH 5IBLC 1MHPL 2FEDC 2C1OA 4KGLA 3K8LA 1W0VB 3CFEB 1TVDA 3L9RB 4EDWH 2FD6H 3UEZA 4MDJB 2B0SH 1KIPB 1KJMB 2C1PB 5DD0H 4HK3N 4Q9QL 3OKOA 4MAYA 4G3YL 8CGTA 5T3XE 3ZTNH 1S7UB 3MBED 3K1DA 4FXGB 4Y19D 2OX5A 2D9QB 1ZLWK 4JO2L 4HBCH 2NY2D 1JK8B 4LVHB 1FAKT 5IJVB 3PV7A 5ID0B 1JPTH 2X05A 1U8NB 1MQKH 4QRSB 2Y6SD 5EUKB 2CDFA 5FUOH 4BH7B 3C5JA 4MXVE 1RK0B 5ICZB 5ENWB 3CDGA 3W0WD 4YZFE 3U7AA 1DJSA 1PBYA 2HJFA 2YPLD 4Z9KB 5EZJB 4A6YL 4N0UE 2X4NA 1YY8A 4V1DD 2F5BL 2WNGA 2AJ3A 2Y7QB 3M07A 2XFXB 3KYMA 3F7YA 4XMPH 3T3PE 2IGFL 4XXDA 1P84J 2CJUL 4PRID 2IPTL 1MY7A 4ZYKB 5TE4H 2I26N 5T1KD 3WKMH 1IEBA 5CEYB 3EIFA 2EO1A 4M7KL 1VDGA 3MYZA 5HD8D 2KZWA 3JXAA 4DN4H 4OZHE 1TJGH 1PKQB 2P8PB 2NY1D 5LJYH 4R4FL 1FPTL 1NGWB 5DUML 3QAZB 4WTWA 3P11H 5BS0A 4EI5D 1OWRM 5AZ2L 4MCYB 5GSRB 4J3UA 3ZL4L 1PZ5A 5GS2D 5DDHB 4GLRI 4DEPC 1M6OB 3QFJA 4QXUH 3MUZ1 4PJIB 1L6XA 2GCYA 4L8DB 4YHNB 1A22B 5KSUB 3BUTA 4E5XB 1VGKA 4TPRH 1I8MA 5I1AB 4EIGB 2UZIL 4I9WE 3WNKA 1DE4A 3ES6B 4BSVA 1HEZB 3QUYD 4OBSA 43CAB 3N1GC 4H25A 2YWYA 3OGCA 5I17B 4Y5XA 5ITBH 2BVPA 4I18A 5E99H 2P43B 3BN3B 3IGAB 5E94A 3IDXH 3QI9C 3MGOA 3TFKD 2VQ1A 4WJ5A 5DA4A 3W11D 3ZDXF 5KS9F 1L7IH 3ZYOA 2ZCLL 5B8CB 1LK2B 4E0RB 4EKXA 1C16A 3O2WH 3GI9H 4HGKC 4KKLD 4XC3H 1RUKH 2EZ0D 4JAMA 5CAYB 4Q6IC 5J89A 3ZE0F 5KJRL 2YD5A 1NGPL 2JTDA 1EGJL 3NGBB 4MA8L 3BP4B 1INEL 4YDLC 1ZA3B 3VDAA 3GSWA 3B9AA 5SWZA 4L3EA 3MRLB 1Q0YH 1MFAL 1G7IA 4LBEA 3HHRB 3MV7D 2VXVH 5C0EA 1DQJA 1ZS8A 1N26A 2BMKA 3OMZA 5T5FH 1BQUA 2XTJC 3QHFH 1AP2B 1JGLH 3EDFA 4KQ3H 1FORL 4R96B 5IVZB 3T4AB 4F58L 5CHNA 5JORB 1PG7L 3ABZA 3WFDH 4LARL 3WDIA 2OSLB 4EVNB 3F8UB 1XEDA 1KCUL 2JIXB 5L6YL 4E41D 1J1OH 4ZO9A 2DLGA 2YBRA 1IAKB 3V6BR 3V9FA 3VMOA 4K3HA 1CI5A 3KDMA 2Y06H 4I8DA 2MPAH 4IRJD 3UPRB 3VXUD 4LHUA 1OTSC 2AJSL 4J4PC 3SQBA 3Q1SL 1OM3H 4GBXC 3VFRB 3EFFB 3V7MA 1YN7B 5FDYA 4AYFA 2K3TA 2Q86A 3QEGH 1XGRB 3PJSB 5JA8B 2BOBA 5EBWA 3OHXB 3TCXA 2H2PD 3B8YA 3K4ZA 1D5IL 5D8JL 5DEFA 2AABH 4U6YB 4RGMB 2ZSWB 2A0LD 1I7UA 2ZNWA 3V4PL 2R2HB 3MFGB 4FXLA 4P46C 4UDUA 1MFDH 2ERJC 2A1WL 1AQKL 4JG0L 4XNXL 5C0ND 3UBXB 2HWZH 1A7NH 3U0PA 1FZOB 1MFBH 2AJZA 4LHUG 4M5YL 3T0ED 3VG0L 3RY5A 5HI3C 2HRLA 4XT1C 3BKCH 2X4UA 3I50L 3DV6B 2YUWA 4AT6B 1QSEA 3WHXB 3MA7B 4TRPL 1A4KA 2ZUTA 5BS0E 1JBJA 4K7PH 1KC5H 4Y0GA 5CZVL 2V2TB 4XNYH 2F8VA 4CJ0A 4O5LL 4YXLL 3QXVA 1I7RB 1EBPA 1PZUB 1SMOA 2P1YA 4Q2ZB 3QFJE 2EDLA 4I5BA 1ZAGA 5IBTH 3S34H 4KY1L 3QJFA 1RJCA 3IU4L 3JWOH 3IETA 3BZ4A 1N4XH 4Q0XH 4ZXBD 1ZA6A 1A3LH 4U1GB 5ISZE 4XAWH 3F5WA 3G5YB 3PDOB 4RFEA 5E70A 3CLEL 4OF0A 3IKCA 3RWFA 2VZVA 5JUEH 2DD8H 1K8DA 3CCHA 5C70A 1DTUA 2F53D 3GJFB 3U6RB 3K8KA 1ZXQA 1QQDB 3O3BA 3BKJL 2DQCH 5FIEA 2APXA 4U1HB 4LCIL 4WI2A 1K6QH 3KPSD 4S1RH 1FL5A 3DX9B 3MMEB 1IFHH 3QDAA 4IMKC 3VFTB 2APVA 5C0CB 3DURA 1MFCL 1NFDA 5GGQL 3GSOA 4Y4FD 4RZCB 3MJ9L 1N0XL 4FQJL 2V9QA 2UZYB 2E7CA 5C86A 1DL7H 4EI6A 2BXYA 4I0PD 1IKFL 1OAYH 4YGVA 1WC7B 1URLA 4L3EE 4QY8B 5DFWH 3MC0A 2DL2A 3HNTL 3TGXA 1YJDC 2OYPA 4NJ9L 4JPWL 1BVLB 3FT3B 1A9EB 4WW2C 3GBNL 4AMKH 2I5YH 1MHCA 4Z7UB 4R0LA 4IS6A 3CK0H 5IB1A 1KBGH 3NIGF 4Z78A 5K9OB 1U92A 4FP8H 3QWOA 5EU6E 3D69A 2ADJA 1Q9KA 1KIRB 5B3NA 1T2QH 1K3ZA 3BW9B 4WI7A 1WFOA 4CMMA 3FQXA 2VLMD 3RWJA 5HGHA 5IJKA 4XXCC 2NYYC 4F7EA 3MO1A 4OCNC 2VXUH 2B20A 2AXFA 3JSSA 3X14B 5I1KL 1N8ZA 4F8QA 5D7JC 1YNTB 1GAFL 1KLUA 4TNVK 4FZEH 5DJXB 2Q8BH 2R0LL 4YHPA 4C54A 5ETUB 5HGBA 4OIBA 3QDGA 4GJTB 6FABH 3GSQB 2AP2A 2R2EB 4LIQL 2YRZA 5DSCA 5J6GB 4PJFA 3SKOB 3FQRA 2E7LC 5IESH 3KVQA 4XNZC 3VFWA 3L7EB 5CWSB 2R56H 4NO5A 1QSEE 1UM5H 4XPBL 3ROLA 3H6JA 5AZEH 3VW3L 5F9JA 4ZG1A 2WBJD 4HXBL 2EE3A 4N8VA 3G04A 1E4KA 5E03A 3EYUL 3FO0L 2GI7A 1AJ7H 3FFCA 5DQ9A 5D5ME 1KPVA 4IM8A 2IMNA 3KPMA 3DWTA 3L3GA 3INUL 3N1FC 4P2QD 5SWSB 1U3ZA 1MHPH 3MNWB 2K7QA 2NY3C 1H3PL 1EPFA 3P0YL 4HKJB 4X9IA 2HT3C 2X70A 3GSNB 5CEZL 2NMSA 5IQ7L 2ZOLA 1Z9LA 4Q9QH 4R2GD 4NKQB 1B0WA 1VFBB 4O2FB 4G3YH 4YWGL 4OKVB 1R24B 5ALBL 3ARFC 4N8VG 1HQ4B 4JO2H 2XA3A 4H20L 1OGAD 4K3EL 4POZD 4NM4L 1TCRB 4HWNA 1SYSB 3RZCA 2HFFB 3NFNB 4J23A 1YEFL 3DXAB 3VXSB 2VLKB 1K5NA 1CQKA 4ZS7L 4A6YH 1M7XA 2IPUK 2HYMA 5IWLC 1NFDE 1ZT4A 3O3AA 1T20B 2F5BH 4Q9RL 4OCYL 4R7DA 4QHNB 1HSAA 2C3VA 3BPNC 2IGFH 2FGZA 2NX5A 1YC8A 4S2SA 1LNUB 2CJUH 4DEPB 1B4RA 4JY6A 3OJVC 2IPTH 3JV6A 1QFPA 5D96C 5KZCB 3ARED 3PXHA 3VD5A 4ZUSA 2OR7A 2DQHL 2KBGA 5IROC 4M7KH 1DQML 5I76A 1G7HA 4R4FH 1FPTH 1FSKC 1XGUB 3EKCA 5DUMH 4LLVB 5EBMA 3VXOB 5TDPA 4OQTL 4X6EA 4BK5A 3LH2L 1D5BA 1HHIB 2WUCL 3U36A 3U4EB 3WFHA 5AZ2H 3W2DL 5LAXA 5DJCB 4G9DB 5A40E 3MYJA 3QI9B 3FAWA 4JFFD 1UH4A 2J8HA 3NA9L 1A1OA 2IQAA 1SEBA 4PGBB 3PQYA 3WO4C 4AEIL 1T22B 4CNIA 3TVMC 3SGDH 2ADGB 1RY7B 3VFVB 4QXWA 9CGTA 5ISZD 2J88L 3N1MC 4H5SA 2OL3A 1WTLA 3OKDB 1OGTA 4JFPA 2M8XA 3MRIB 3D2UB 2UZIH 4L9LA 4I3SL 5D1QA 4OF8A 2OQJA 1VEPA 1PW3A 3LB6D 5CS7A 2IFFL 2R2CA 4KK8D 4JKMA 1OSZB 2CKBA 4YDLB 3LQAH 3QDGE 3BISA 1FZJA 2VNCA 5HDBF 3WJJC 3TBTB 5IHZA 1BGXL 4WI6A 3S35H 1TNMA 3IS1X 2ZCLH 3WIIH 3X3FH 1SYVB 4D0BA 4ODVL 2XTJB 4YX2H 1Y0LB 1WSST 4YHOL 1XF2B 4G8GD 3LS5L 5EZIL 5KJRH 3D0VA 1EGJH 4MA8H 1CE1L 3B8SA 4JFDD 5I15L 1RK1A 3FFCE 3IFPB 1DQQA 1KJ3L 4GBXB 4N5ED 4KK5C 1A6AA 1VKXB 3TJEL 1G6RL 3MRDA 3P9LA 4CW1B 1ORQA 5M95B 4QGTA 5E24E 1FORH 3WLBA 4F58H 1PG7H 1JI1A 3D18B 3HRZB 4LARH 5JDSA 3WL9A 5EU6D 3ARDD 3UJJL 1KCUH 5L6YH 1MCQA 3EYQC 3QIWA 2GFBA 1NBVH 3SDXA 3VFNA 4P46B 2BSTB 2ERJB 2YC1A 4X6CA 3B9DA 4XVJL 2LU4A 4GRWH 3Q48A 5I66B 2WP3T 1QR1A 2AJSH 5D1XD 3Q1SH 1T04A 4J8RB 1MI5B 1GOHA 4GKSB 4I3GA 2CK2A 3SO5A 2H32B 2A38A 2ZUXA 5IB2A 4HHAA 3RX5A 4WI3A 2X10A 4J1UA 4OFYD 1RZFL 5IR1A 1XR8B 1WGOA 5K9QI 1TVBB 5EOCJ 4DW2L 1HHJB 2NX5E 1I8IA 5D8JH 4AIZB 2ARJA 1LEKA 5KSAD 4BELD 3KPRD 4PLKD 5BZWB 2YD3A 2RR3A 1LD9B 2X9XA 2D2OA 2DDQL 3V4PH 4OI9A 2DTML 3ARBD 3H9SA 2A1WH 1AQKH