4MNGA

Structure of the dp10.7 tcr with cd1d-sulfatide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
273
structure length
273
Chain Sequence
RLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of V delta 1 T Cell Receptor in Complex with CD1d-Sulfatide Shows MHC-like Recognition of a Self-Lipid by Human gamma delta T Cells.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Beta-2-microglobulin
total genus 67
structure length 273
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mngA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4mngA01
1HH6A 4E41A 5HGHA 4RX4A 2IALA 3HE6A 5DD0L 1ADQH 4V1DE 2FHFA 1EXUA 3R4DA 4WI3A 4N0YL 5F1OB 4IOIA 3HNVH 1QG3A 2DQEL 3M45A 1PG7L 3G9VA 4ZOCA 3BH9B 4OCMC 1I3GL 1K4CA 1WEJL 4LCCB 2YUWA 4MVBD 2M1KA 3H3PH 4U1JA 1DLFH 5E2VL 3QH3B 2J4WH 3BH8A 2R0KL 1A7QL 2EDEA 5BW7C 5C0BB 4K9EC 1IGCL 3S5LB 5I1KL 1CQYA 3HE7B 4KMTH 2NXZD 4KQ3H 5BRZB 2EXWD 2WUBH 5IB5A 1CXIA 1DVFB 2MNUA 5GGSY 1ZLVH 3FO1B 4Z77B 1P7HL 1BEYH 1A3LH 5F89B 3CCHA 4R3SA 1U91A 4U1GC 1X6LA 4J8RB 5I1CL 1UGNA 4LCCC 3EFFA 1A1NB 3VRJA 5KSBF 2GKIA 4X8JB 1A7RL 4R4BB 1DEEA 1PZ5B 1T1YB 3U9PL 4Y5YC 4NO5B 4HWEH 1FFPA 4TNVF 4OD3H 1V7MH 1JPGB 2GAZB 5IK3B 3ECBA 1RU9H 3TEUA 5BZDB 1T6VN 1ZT4B 3ULVE 3MNZA 5E8EA 2F9BT 5D1ZD 1JZ3A 1BWWA 4OGZA 4UDUB 2AJXL 1K2DB 3UJTL 1AO7A 1H15A 4KC3B 2K7QA 3IAGC 2J2ZA 3NTCH 3OB8A 4PR5B 4YAQA 2HKHL 4LHUA 3CUPA 4POUB 5GJSH 1GGCL 3BJ91 4GKSA 1MFBH 5DRNB 4QTIL 2AJVH 3PWPD 3QI9D 3IJYA 4HFWA 2GUOB 3NA9L 3O6MH 4LIQE 4K71B 2W0FA 4OZGE 1IQDA 3ARGD 1CI5A 2Z35B 1JGLH 5HVWA 3SE8L 1NUGA 3QISA 3DV4B 5C0AD 5D7LE 4LLVA 2ADIB 3P9MB 3NCJH 2FO1A 5EFIA 1QP1A 5T3XH 3SGEI 4MNGB 4JHWL 3TN0A 4ERSL 4K9EH 2UWEE 4DAGH 5DF0A 2BVOA 4DAGL 4NOBA 3RVXC 1CVSC 1PEWA 2ZNXA 5FYKE 1JGVH 4POYA 3TWCH 1L6ZA 4NO3A 1MI5A 5HGDA 5KG9B 1DBBH 1WWCA 4FOMA 4F80A 2AJYH 3F12A 2Q86A 1YPZF 3TPKA 1T2QL 4YEFA 4YXKL 1CGSH 4KTEL 4OM0H 1H8OA 2Q8BL 5FUZH 5CEZL 4G6KH 1BECA 1J1XL 1XZ0B 5C0FA 2XY1A 2W59A 3P9LB 1E4JA 4KKAD 4IS6A 5B39A 2APTA 5K9JL 2HTLC 1FFPB 4RGMC 2NTFA 3VD9A 1J8HE 3I3BA 3CXHJ 2V2TA 1QPXA 1ZAGA 4TVPL 4MA8H 2X4OA 1CDIA 2ZJSL 1FZMB 3OJVC 3OKNB 4XXDB 1DJSA 4PUBL 2QHLA 5A1AA 1I7TA 5F7WC 1YEKH 1KTDA 4DK6A 5J3HC 4NNPH 3EDFA 2WMPA 1JGUL 3S35H 2JK5B 2BY2A 4JM2B 3UP1A 4FQCL 4M5ZH 4XMPL 3QDGE 3QFJD 1N6QL 2MQ3A 2ZCLH 3O9WA 3TO4A 4WDIB 1J18A 3ZZ1A 9CGTA 4WNQB 2W0LA 3I50L 1JI2A 4HK0A 1UVQA 3TA3C 2A77H 3T0VA 2D9QB 5KZCD 5HJ3A 1LO4L 2AQ1A 3QXAA 2ZP0T 3KLHC 3PUCA 3LEYH 3SDCC 1NSNL 4F9PC 2OM5A 4XC3H 3UJJL 3VMOA 3MGTA 1FFQA 2X7LB 2A73A 2VE6B 1OTSD 4GMSL 4A6YA 5J1SC 2GYSA 1LE5B 3QWQB 4MNQD 1X5KA 2Q7NA 5ITBL 4KUCF 4O4YL 4TQEH 4PJIF 4ZS6C 2GTZA 5H8DA 4QWWD 3U30B 3ZE2E 1UM4H 4YHIB 3HG1D 1BQHG 3RVWD 4U2YA 3HTLX 4UT6H 3V4VH 2JCCF 2DM4A 4G8IB 3QDMA 4OSUH 4ZTOL 4GAFB 2VABA 5HSFA 3BISA 3BFOA 4ZS7H 1J0IA 3QO1A 3L7EA 4ZTPL 4PGEB 5FCSH 1EEUA 1EO7A 3NZ8B 4BH8A 4AEIH 4TPRL 1C1EH 1JUFB 4X7CC 1QBML 4GXVL 1ZS8B 5HYIA 3Q5YA 2NY6C 4GW4A 5DHYA 1MELA 4YE4H 3BZFB 3SGKC 3KDMA 1EHXA 2VLJE 1P53A 1CD1A 1KIRA 1YYLH 2CJUH 1XF4A 2OQJB 2V9TA 2VDPL 1RIHH 3TO4C 2EDKA 4XPHH 3U46A 3PHSA 3PWVA 5F7MC 3FT3A 5HDBF 2APXA 5KSUB 4LLWB 1I8LA 4ALAL 1BJMA 5I15L 1DBAH 2Y07L 1YPZB 1N3NB 1JPTH 3H0TA 3AS0A 4FA8A 1AO7E 5AYUL 5CJ8A 4GG6A 2Z4QB 5TQ0H 3HZVA 2AEIT 5SV4A 3ULSA 1IGFH 4P2RD 1J10A 2FATL 5HHVL 4DGVH 1AKJD 4Y2DB 2AS5M 1ZA6A 4QRSA 3U2SA 4NO0B 1F6LL 1DBBL 3RIAK 3H9YA 3UTTD 3HFMH 1A6UH 3VCLA 3D0VB 1J05B 5FCUH 4S0UC 1GZQA 1S9XA 4U4BA 4UAOB 3CXDH 1URLA 5DC9B 1BAFL 3RGVD 3MJ7A 3V4PH 5E56A 2ED9A 3MYJA 3C5SB 4KUZL 4LGRB 1NC2B 4ZSOB 1TJGH 1N4XL 3QIBB 3LMJL 2O5ZL 3FRUB 1H8SA 3VJ6A 4ZPTB 3GM0A 4K7FB 5JLZA 1F4WL 4H1LA 3MFFB 1BQLH 1JGDA 3OBAA 2GIYA 4XWGL 2KZ1B 5DUML 4MCYB 3FOLA 1Z9OA 1J88A 4KPHH 3DX9B 2AEPL 1K3ZA 3AREB 4EN3A 5LVEA 5FB8A 3GBLA 1JN6B 5T1DL 5ITFB 3C5SA 1FIGL 3UJJH 4JRYE 2FDBP 2ADJB 4MCZB 5D71L 8FABA 1AXSB 1MCOL 3AVEA 4NO5A 5I1IL 2C3XA 2EC9U 2VB5A 5FCUL 5I71B 4D0BA 5J89A 5B38A 4L9LB 2DQFA 2Q3AA 5HYQA 5B4MC 1WGOA 1F3RB 3UPCA 5ADOL 3CC5A 4FN0A 1U8OA 5IUSA 1GGIL 3SDXA 2CLVA 4OIIH 3P30L 1C16B 4PLOB 1RUPH 1UM5H 4HUVB 4XZUB 2EC8A 2K9UA 3C5ZD 4H8WL 1ITBB 2VMFA 1JTPA 5HHPB 5GGRA 3C09B 1RZFH 4OFPA 1EFXB 4K94C 5FYKL 3HR5B 3V5DA 2CIIA 4OLWH 4QRTB 4YFDB 2AJYL 4LLDB 2WNGA 4TVSa 4YR6B 1NGZB 1YJDL 3CFJB 1H5BB 3WFHA 4ELME 3ZE1F 1MFEH 1KPRA 1MIML 5E5MA 5DXWA 2GJZB 4GBXC 5HVHB 4N68A 3QG6A 1TITA 4JFPA 3NOIA 3H9ZA 4I2XA 3LQAC 3DGGB 2R1XB 4ZQKB 2BC4B 3IDGB 3KXFD 3G6JF 3UZEA 1A6AB 4YK4C 3WD5L 3O4LE 1W72H 2YR3A 5CIPB 1I3VA 4I9WE 5JO5B 1X6NA 3U0TB 4QHLB 5MEPA 1NGQL 4PRDB 5CILH 4YDIH 4O9HH 5ESVB 5DS8B 1BFVH 3KPSB 1C7SA 4NZTL 1NDGA 4M7KH 3RIFF 3LS5L 1HHHA 2FGWH 4JFPB 1E4XL 3EOAB 5ETUA 4LP5A 3VFOA 3W0WB 5KSAC 5KW9L 4N9GA 4X8XA 4PJ5A 2XN9E 3DSFL 1LO3L 3KGRA 2EDHA 1S9WA 4M7JL 5FGBC 5FYLD 1I1RA 2E7MA 2HTKD 5EU5A 4ALAH 3QFDB 3QXVA 1AXIB 4EIZC 4WFGD 2A9ML 3X3FL 1GAFH 1R5WA 1KCSH 1A4JB 4P9ML 1CD9B 4H0GA 3SDDD 4OGYL 3D48R 1HSAB 4HS3A 1I1YB 1D5BB 2CDFA 1BZ9B 1KT2A 2RR3A 4UINH 1PAMA 1EJOH 1XF5A 4R7DB 5IBUB 2W9EH 1MCLA 1WZMA 1TJIL 5HI4C 1I9IH 4ZFFA 3GB7B 3MV8D 5J13B 3WJLA 1GVIA 5IIEA 3EKCA 1RZGA 3VA6A 2ZWLT 2C4XA 1FFNA 4X9HA 3BZ4A 2A6IA 3FFDA 5HHNA 4PP1D 2AV7B 4JO1H 2O26U 1T83A 5I16A 3QSKB 4H1LH 5ID0B 3L7FB 3QDME 2QBWA 4AM0B 3U6RA 3UCRA 1DFBH 1PDKA 1LD9A 3VWJA 3CZFB 4X6DB 3MLYH 4BELD 1G0YR 4HZAA 3AM8A 4Z7UB 4FQLH 4H8WC 3MX0A 5FKPB 5GQBA 5HHMD 1MFCL 4MJIA 1UWEH 2UWEB 5JNYA 4HK3J 4UQ2A 4ZFOB 1GOHA 5A3IC 4HS3B 3ARWA 4JGJA 4NP4L 4HC1A 5T1MB 5ANMA 1FLRH 4NKDA 2J5LB 4DCQB 4HWZA 1UH2A 4G9DA 3WFCL 2JIXA 5EU5B 1QRNA 3WXVH 1IAOA 3EOYG 4NQTA 1MCHA 2QR0A 1KYOJ 4P4RB 5F7KC 3FN9A 4N1HB 4LPWA 5I1LB 4PGBB 5FECB 3TT1H 3FCTA 5F7DA 2AXFB 1T22A 5DS8A 1CWVA 4LVOB 5JXEA 2CR3A 2QEJA 1Q0YH 3V4UL 4R7NA 2WQ8A 4M1CD 3CU7A 2QQKH 3LKSB 1DSFL 5D2LF 4U1HA 3WLWD 4PJ9A 4ZQKA 1RQ5A 1UXWA 4M1GH 4K3EH 5IROA 5SWSE 2R0ZL 1BVLB 4X7EC 3VMPA 2AK1H 5E8EB 3LPWA 1T2QH 2F53B 4KRMB 1QLRA 5ICZB 1HN1A 5GGSA 3SE4C 1LNUA 2XKUA 3P0YH 5IW6B 4XNXH 4U3XA 2X4NB 3L3DA 4PY7B 4K94L 3VRJB 5FDWA 2QADC 4BZ2H 4K9EL 2QSTA 4Y0GA 4BH8B 3P11L 4NJ9H 1YQVL 4X4XB 1BFOA 1K8IA 3O8XA 5JORB 1OAYH 4XVTH 1GPOH 2Z31B 3RWIB 3IJSB 4FFEX 3DUSA 4I18A 3BPCA 4M8QB 5HD8D 3PWNA 2P7TB 4K7PY 1VGKA 1X5FA 3VMNA 3BEWB 2AJVL 4LSUL 2RIKA 3RDTB 2DD8H 1G9NL 2G5RA 3PGDB 3BIKA 3EYQD 5CJQH 5IHUL 3B8YA 1OARL 3BXNB 1MSPA 3SDXE 5CHNA 1BVLA 2NTSP 2XXCB 2AJXH 4OLVH 1HNGA 4NJAH 1UXWB 1EJ6A 4O58H 2IAND 4HCRH 3P4NB 5C9KA 4YXLL 2DQJL 1ZT7A 1T5XA 2Z9TA 4JHWH 1INQB 4ERSH 1TIUA 4HIJA 3RY6C 3F62A 4OF5A 3QXDA 2AW2A 5E2WH 1KCRH 5E2UH 4HUXB 4UUJA 5D71H 4NO2A 1OGTA 3QEHB 5DHVA 5E00A 2XG4A 4NQCE 4RBPK 1VACB 4HAFA 4MD4B 4DFHA 2FD6H 1BEYL 4TOYL 4BH7B 3HE7C 4ETQB 4L4TA 5D7JC 3ZYOA 3WYRA 3SQOH 1IAOB 4XWGH 2GJ6B 4N9OB 4YBQD 1HHJB 4ZAKC 4U1MB 1H3GA 1MEXL 4G6FD 4YC2B 4HFUH 4QOKA 4GQPH 4NNYB 1MWAL 1WIUA 5DJ2B 1KBGH 4O2CB 1TDQA 3HNTH 1FLTX 2YRPA 2AP2A 4LSSL 1ZWIB 2VDQL 1A7QH 1I1AD 4Y5XA 3MJGX 2RB8A 1VFUA 2JJUA 4HPOL 4CL7A 2EDNA 5EN2B 4Q9CA 4IMLB 1QBMH 5AAMA 1U8MA 2GY7B 3FRUA 2VDRL 5FO9B 4HGWA 5AAWA 5BV7C 2CKBB 1HILB 1JZ5A 5K9KA 3HUJF 1ONQB 1RUAH 2HVJA 5EO1A 4LSQH 3AUVA 4M43H 4X7SH 3SDCD 5CUSL 3VWKC 3C9NA 2FSEA 1NCBL 3L7FA 4EEEA 2Q76A 4MB3A 1V8HA 4MNHA 1MRCL 1OF2A 3UZQA 4DQOH 5CD5C 3TIDB 4MJIE 4LP4A 1N5YL 2VDNH 4D9QE 3OKYA 1WZ1H 3ZE1E 1C12A 3QUMA 4JFEA 3DO7B 3PIQB 1H3WM 4JO4L 4LLQB 1LDPH 2E6QA 1IAIL 3BOVA 4ODVL 2E6JA 1RHHB 1S8DA 3JV4B 3KPMB 1J0KA 1MWAB 1V3KA 4XMLH 4PGEA 4TUOB 3QZWA 3DECA 4CVXB 1MCSA 2XTJD 4BFGA 1F3JA 3QWRA 2V5TA 4MQ7B 1E28B 3VXTA 4HDIA 4W6WB 1YNTA 4G7YL 3ARFC 3RTQB 2Q8AH 1LO4H 3BUTA 4NFCA 1YEIL 3MJ6A 3SO3C 2IPKB 5D7KD 4DN3L 4FZ8H 1BX2A 4GRWE 5EOTA 2C4FT 1MQKH 2PTTA 3HRZB 3T4YB 4I0PD 1YQVH 3GHBH 3C5JB 2O5XL 4HSQA 2R1WA 3C9NB 1A0QL 3GO1L 4NUGH 4R2GC 5EULV 3CVHH 2W60A 1DR9A 3ARGB 4YHMH 4MQXC 3EFFB 5I8EA 4PY8J 2OK0L 4OI8A 5DFVC 2X10A 5GJTL 1MLCB 1QFWM 4QXWA 2QSCL 4TUKL 3FO1A 5TE7H 5D4QA 1SEQL 4X7FC 3RQ3A 4P4KC 5GS2H 4POZC 1DN0B 2YXFA 4U1NA 3ULUH 1U8QA 1ZEAL 2NY0D 1S7WA 4NKOB 5I9QB 1ORSA 4AYFA 5KTEL 4OZFB 5EOCJ 4D9LH 5E99L 2OI9B 3GSRA 2GY5A 2NY5L 4PJXB 1U8PA 4J3WA 4ODSH 2CK2A 4YDLC 1KCLA 3L6FB 3MRQB 3IDUA 4KRNA 3RI5F 4QHMA 2B8OT 2FX7H 5IVXA 1JPST 2ZZUT 5TH2A 2AEQH 5E8PA 2Z8RA 3VXUD 1UM6H 3CLFL 2OTUB 3KPOA 3RZWA 2YD1A 4NN5C 2V5SA 1FCCA 3EHBD 5SWSA 2Y07H 1JNHA 4HKZB 2ZSWA 1MCPL 5LCVH 1FNEA 3OAZH 1VERA 3W2DH 2W60B 4UOW0 4XVJL 1D9KC 2X40A 3PHOA 4PRPA 3DRTB 4ETYA 3S98A 3FN3A 5D2LB 3RVVC 4OZHE 3BN9D 3OKNA 2M2DA 3MCKA 2GT9B 4A6YH 2XTLA 3GBNL 1G7PA 4FFVD 4PYHA 1YEJH 1G9ML 3BAEL 5GS1B 5MEND 3EYOA 4YEEA 4J3OC 1MY7A 2VDOL 4TSCL 4XGZA 1NLBL 3L5HA 2Y1VA 1TJGL 1NL0H 4P2QA 1MHCA 3RWEB 2PYFB 3QAZB 3CFCL 3B5GA 3QIBD 1EUTA 5C0IA 3U36A 1ZMYA 3STBA 5C0JB 4APQC 3HNSL 4O00A 3MGAA 2W1NA 4PS4H 4RX4D 5J8OA 1VKXA 3TBSB 4LCWA 4JRWA 3EJYD 1ZKAA 5MEQA 1KFAH 2FX9L 4NT6A 4U7MA 1T04A 1GIGH 4NN7B 4AEEA 1FPTL 1S7QA 1FYTE 2C3VB 1KG0A 1P7KA 4FFVC 2KL6A 2J1KA 4KVNL 1MY5A 1JPTL 4O2EA 5FM5M 4P99A 4PJAE 4G3YH 1NDMA 1ZGLP 1EEYA 3H9HA 1T22B 4F37F 3UX9B 3RVVD 1DBML 4XWOD 3W11D 1I9EA 4UV4H 1GGCH 3O3AB 4I1NB 1LO2L 2LU3A 3GHEH 3O4OC 1RIHL 1P1ZB 1QRND 3MRLA 4JRXA 2ZKHL 4JKWA 5L88L 2XWBB 4PJ9C 4QCIB 2HVJB 1RZ7H 1HWGB 2FNBA 2XY2A 3HZKB 1FHGA 1UENA 4YUEH 3NCMA 2WBJB 1KSRA 1D6EA 5KSAD 4F3FA 5MERB 3U0PB 2ZOLA 4J23A 3CUPB 12E8L 5IB4B 1QFUH 1BZ7A 5JQHC 1R0AL 1QSEE 3GJFH 4F57H 4HWBH 2J8UB 4ONOA 5TDNB 1ZHLA 2YPLE 3PDDA 5C0JA 1K8DA 4JZOA 1PSKL 1DBKL 4XAKD 1AGCA 4HLZG 2RCSH 1TZIB 3HUJA 3EO0A 3BP6B 3MOBL 1ZT4A 3OKEB 3HC0A 4MLIA 5J57B 5DHYB 3WFBH 4L8CA 4KTDL 4MVBA 2OMBA 2RQ8A 4NC2B 1G84A 1XH3B 5L2KA 4FQLL 4OFYD 5C0ND 3LRSA 4CJ0A 4HS8L 4EUPA 1NGXB 4XP4L 4U6HB 2WBJD 3LKQB 3MRDB 4QWWC 4ZNEA 1ORQB 3QUYB 3TFKA 4XAKE 4RGOH 2R2HB 3WFDL 4UTBL 1MI5D 5A16A 1MF2L 4QT5B 2IWGA 4JKPL 2HH0H 2WY3A 1FVCA 1G6RL 4NCDA 3S5LA 4NKMB 5D2NB 1VESA 2YN3A 3MACH 3WS3B 1T3FB 2BOBB 3MXVL 5EZLB 3QWOB 5GRUH 4M7KL 5IB4A 1Y18B 1A4JA 3W9EB 1I4FA 3MRGB 5D5ME 4R8WL 3BPOC 4X98B 1O7VA 3LKPB 1Q0XH 4LCUB 3WUWA 5FDYA 5CSBA 3GSWA 3VXUE 5FO8B 1B4JH 1EUUA 4PJDB 5IW1A 1OGAA 2VDKL 1A9BA 3ARXA 3WE6A 5JR1H 3F8UB 3SJVB 3CVHB 3G5YB 2F5AL 1NCWH 4NKOA 4NM8H 2R0ZH 3F6LA 3OAYK 4S0TD 1CFQA 1ZA3A 2FJGB 5IMMB 4NRYB 1MCJA 1YEEL 5E6ID 2LAAA 2X4TB 2W38A 4HFUL 4HF5H 3EDKA 5IQ7H 5I1JL 5IVXE 2VC2H 1AC0A 2APFA 5DK0B 4IJ3C 4RGNB 5C0CB 4YC2C 2XACC 5FYLE 4JVPA 4EN3D 1ZVSB 3HMXA 5F70A 4FTVE 4DKEL 4QEGA 4F9LC 4OBRA 3UTOA 4XXDA 1C5CH 4OCRH 1XR9B 3BWAA 1NAMB 4FRWA 1J1PL 3DVIA 4XNUL 1ZOXA 1GXEA 2XWJA 1ND0B 4M03A 3O6LL 2X1OA 1A9EB 4S1DC 1EFXD 3DUUA 1FZOB 2MCG1 3VFGL 5I76A 4UTAL 3T0EA 5JDJA 4KKLD 1FV1A 2N4IA 2DJSA 3CAFA 2H9GB 1MFCH 3CVHA 3G5YA 5J11B 5HYSG 1V3MA 2VKWA 3LV3B 3PV6A 4XC1L 4DGIH 5LGJB 1YC8A 1FFOB 2V5MA 4PP2B 5TF1H 1MWAA 3VXUB 1IQWH 3NIFF 5EO0A 3F58H 5IKCB 3IU3B 4HLZH 1N59A 1T7YA 1M71A 3S36L 3WNOA 4C57C 3GSVA 1KJVB 3H8NA 4MNGA 2ERJC 5EBWB 1JYXA 2X4NA 4U3HA 3K2MC 3KNBB 4OAWA 1MHEA 1MJ8H 3S8WA 5GGUB 4HWZB 4F7EB 2B5IC 1BJ1J 2GHWB 5CJOL 2W65B 3UMTA 3T1FA 5B38B 3SDDB 1WK0A 4XVJH 3GI8L 2Z31C 3ZE0F 1KEGH 1T5WB 4XAWL 4JVUA 4CGTA 4XNMB 2PYEA 3DURA 4XPBH 1S7WB 2FLRT 2BVQA 5HI5C 4GXVH 3TVMB 3O41A 1G7MB 2DS4A 3MUHL 2NY5H 3BKJL 1CK0L 3DX9A 4L3ED 4Y5VC 1LD9B 3VWJB 1I1AB 3O2VL 5IB3B 5CZXD 1HOCB 1R3IL 4PRHB 1D7FA 1CXKA 3QA3B 5DQDH 5DMKA 5DO2D 4IRJD 3LDBB 1JRHL 3TYFB 1D5MA 2OTPA 5D7LB 5ENWB 2YUXA 1IRAY 3EIFA 4DZBB 4U0RB 4NNYA 4Y16D 3ZKXB 5M94B 1YPZE 5IQ9A 2LTQB 2O5ZH 1HEZA 2X70A 2X4SA 4KPHL 4Z7OF 1FE8L 1AGCB 2FEEL 4CNIB 1QBLL 3S34L 1BD2E 3PQYD 2VWEE 3U82B 4X7DC 2YD9A 5JHDD 1FYTA 3H3PL 1PLGH 1ZLVK 3GK8L 3X3GL 3QUKB 2G60L 4FZEL 2CRMA 5I0ZA 3E8UL 2NY0B 3H0TB 3D69B 4X9GA 2VDNL 5DSCB 5FYJH 2F54B 3SKNB 2E7CA 4TPRH 5EO0B 5HVGB 4I8DA 3C87A 4K3GA 2EDJA 3E3QA 3VG9C 2YMXL 4W6YB 1ZT7B 1Q1JL 4JRXD 2EIBA 5GRXG 1CGVA 4OUOA 5SX5K 5HYJE 2Y6SD 2C7UA 3MXWL 4X7SL 5JW4N 4XB8A 1J05A 1I3RA 1YMHB 4LCCA 1GGBH 4P5TB 4ZTOH 1S7VB 3I2CH 1A7PL 3MOAH 4PD4J 1C12B 3DVGA 4M4RA 5F7LB 2V17L 4ZUTA 3PDOB 3TZVA 3MRMA 4KZDL 5GXBB 4XRCB 1OTTC 5J4MA 4S2SB 2M26A 2IAMA 4RISH 1WZLA 3FMGH 4OLWL 3BPNC 4NQEB 4YWGL 5CIPA 4U3CA 1XEDA 4GAYB 4LF3A 5INCB 1PEZA 1RZJC 1FVEB 3ZHKA 1IGIL 4XMLL 1BZ9A 4LARH 1JNNL 3QDMD 2CJUL 1B6DA 3EO1A 5H94B 1B0WA 2DYPD 3QDJD 3O3BB 3DARA 2JJSC 3WIHL 5L6YH 1JYVA 2EYTB 1RPQA 3SGDH 5CGYD 1U3HD 2A1WL 5DC0A 4LLYA 4C4KO 2IG2H 4HC1L 2D7QA 3UBXG 4JFDE 5CZVH 2YSSA 3PWJA 3MV11 1W72L 3WEXB 1XAUA 4LHUG 4JQXC 5FYKD 5EU4B 3F7YA 4G3YL 1Q72H 3PGFL 3ROLB 5EBLA 4KDTC 4NJ9L 1OARH 4IIQA 3ISWA 1FPTH 2R4RL 3GSRB 5DMIH 5F93C 1NC2D 4FTVA 3B83A 4JZNB 3FL7A 1GC1H 1JK8B 1LK3H 4WHYH 2DLGA 4EUPH 2XTJC 1KELH 4XZUA 3TZVD 3R0NA 4KK5C 4PJEF 1WBZB 1CGXA 4PRIB 2VLKB 1VEMA 2JB6A 2DQDL 3O6FA 1QYGL 3RVTD 4OF6A 5E00B 1MJUH 3BI9X 3STZA 3CFDA 3LCYA 1F45A 1N6VA 5ADPL 1B2WL 4XNYH 3L3KB 1BOGB 2X1QA 5CMAA 3V5KA 3M17B 1L7TL 3IU4L 3QCVH 3WFHB 5FM8A 4OZFA 2XQYK 1NGPL 1BM3H 2CIKB 1T1WA 3SE9H 2CKNA 5DQJB 1W8OA 1AQDA 3CFDB 3V0AC 2NY5C 3OJ2C 1YEHH 2J6EH 5IBLD 1UB5A 5BVPH 1QSFE 5I18H 2J6EL 5LWYH 2I25N 4QRRE 1XH3A 1BF2A 2CLZB 2Y7QB 4WHTB 3E6HB 4KKNA 3U83A 1UZ6F 3A0OA 1XZ0A 4UT7H 1AY1H 1S7SA 3QDGD 3QFJE 1QBBA 4L29A 3S35L 5AUMA 4DUVA 5KVMC 1E28A 3VXTB 3F7QA 3GUTA 1F6AB 3VRLF 2P24A 2PKDA 3D0LB 5FO7B 2E8ZA 4IRJA 5IT2H 3P40A 4JN1H 4JZJA 2GK0A 1V5JA 2JELH 2P1YA 2ZUUA 2DDQH 3GMOB 4UU9A 1MI5B 1X5ZA 4C56B 2NYYC 5SX5H 4EI6A 4FXLA 4X4ZA 1BIIB 4KK9D 5AD0B 1VA9A 3L3IB 1JHTA 5KTEH 4ISVB 4KZDH 1OP5H 4K8RH 4GAGH 1N5YH 3SJVD 4OUUA 1M7DA 3UTTE 3BT2L 2WQRA 4M9OA 1YMHA 2QKIB 3HAEH 2IPUG 3PG2A 5DJCB 3CZJA 4R7DA 4JQXA 5A2KH 5I75B 3BP4A 3BUYA 4V2BA 4MQ7A 3CH1A 1B4JL 3DWTA 3PWLB 4RCAA 4PJFA 3MRHA 4WW2B 2W0FB 3LKSA 3MGOA 1FRGL 1FC1A 3OMZA 4LSQL 4M43L 5FGSA 4MNGE 5DI8B 4OSUL 4HGWB 5FYLH 1A5FL 3QUZD 3FQUB 1CD1B 4NT6B 4HT1L 5IJKA 3G04B 2BY3A 4X83A 4EQ2A 1U58B 3RKDC 4FFWC 4ZNCD 1TNMA 2P5EA 2E27L 1HCVA 1YMMD 5F71A 4MNHB 2PYFA 3SGEH 3VGAC 1IGIH 1TVHA 4FQIH 4IRJB 4PRAA 2DWEA 2DLFL 2UYLA 3MLSH 3S4SG 2GAZA 4CU7A 4P3CL 3ARUA 1KJ2B 5ENWA 1BWMA 1WF5A 3ULUC 1UYWH 4M1DH 3ZTNL 2X5PA 1QD0A 4HHAA 5JNYB 1A2YA 1MI5E 4PG9B 4DTGH 1ZWIA 1LVEA 4DUWA 3MV8A 4UAOC 1F4YH 4ONHA 4OF3A 4KROB 1F6AA 4F8QA 1FCGA 1NCCL 1T20A 3QIUA 3WN5A 2BSRB 2YK1L 3I9GH 4LLUB 4Q58C 4ELMA 1TMCA 1C1EL 1ERNA 1F8TL 1HE7A 4RWHA 5C07B 2NZ9D 2J12B 2PXYD 2QHRL 4QHMB 3L3KA 4G6AC 3W39A 5E1AA 1D5IL 4FQIL 5D1QD 1IM9D 5BOPA 3EO9H 2HFEB 3TJEH 2YMXH 4WWKC 2JJWA 4PJXA 2VUYA 5FA3B 5CKAA 1DE4A 2E9BA 5GGTH 1OP3K 1KJVA 5EBWA 3JVGC 2ADFL 3HE6B 4E42A 4H88H 2DQHL 5LGKA 2P8MA 1QFHA 3IJHA 1FDLH 2F19L 2ESVA 3MBEA 1CICA 4CADB 3PDGA 4ELMF 4OFIA 1XCQB 2WAHA 4LLMB 1DVFD 2DDQL 1KB5H 2W91A 4PG9A 2ORBL 4Z0XB 2NY6D 1IGYA 2VLKA 2YA1A 5DWUH 1U2CA 2EIZA 1F8TH 4X99B 2I60L 5GIRB 2OCFD 4BSWA 1MCEA 4QHUA 3WIFB 4J3TA 1KGCD 8FABB 2AKRA 3ES6A 2P5ED 4ZO8A 2F53A 5ICZA 4PRAB 3SHSA 4AH2B 4L3EB 4AJ0A 4Q0XL 3LSOA 3BPCB 4M8QA 5GGQH 5T3ZD 3WEXA 2EDTA 1K5NA 5LBSL 1N6QH 4OB5H 4GAYA 3FOLB 2Y06H 5DK3A 5DURD 4HS6A 4OFYA 4JDTH 2R8SH 1EHAA 5E8OA 1DANU 2ITCA 3WCYA 4HDIB 2BSTA 3KPPB 3A6CL 4KMLB 5I1DA 4ONGL 3SDCB 2ICWA 2IFFL 4L4VA 1CGUA 4ELKB 4DEPC 1I8IA 3QHZH 3TCLB 2ATKA 3MUZ1 3B9VA 3PF2A 5GRYA 3UTZB 4WFFD 3CIQA 1X9QA 3CFJA 4NZUH 5DT1H 2NX5D 1BHGA 3MV9A 1BIHA 1RIVH 3VFNA 1X5HA 4KRPB 1INDL 3G5XB 3RHWF 3RU8H 1DQJA 4G9FD 3PABB 4X9BA 1S7VA 1QPPA 2GCYB 4WY7H 2VLJA 1JNJA 4PIRF 3SEPA 5KS9E 3EGSB 3DYMA 1AIFB 1G7HB 4BZ2L 3WE6B 3MLWH 1KLUB 3OAUH 1KXVC 3UO1H 2CDGB 2MFNA 5CP3A 4OLXL 1LE9A 1RIUH 2RJMA 2JIXD 2VH5L 2Z8VC 3IFOB 1A6PA 5IEHB 1NCAH 1G7JA 1DEEB 1PZ5A 5HD8C 2P5WD 5I66B 4CVWA 1ODAA 4Y88A 3CVIH 1CGWA 3Q6FA 3GKWL 1YY9C 3RP1A 5DQJA 4XPTL 4KKAC 4EUPB 3ARVA 1IQDB 3MNVB 4YHOL 4H88L 4JM4L 4BFIB 4ZFZA 1MQKL 1X5JA 5JIHA 4LVNC 3DYOA 5DMGD 4HUUA 5H2BB 3M17A 4EKXA 3GHBL 4OZGA 4P2RA 4ODBD 2A74B 3QEGL 1CYGA 2OZ4A 3S6CA 3FZUD 3HZYB 4Y4FC 4Y8DC 4Z76A 1MFNA 1HSAA 5LAXB 1D5ZA 2EECA 5I1HL 3VJ6B 1HINH 3MV7D 2LABA 5FFLA 2E7LC 5I1IH 5JW3H 3NCEB 1S7TA 3M1BA 4NKIH 4Y4KA 5C09B 4R2GD 4V3DB 1RZGB 1RUQH 4KJWC 2WWMD 3ARSA 2X9YA 4XCFL 4XNMA 3MLXL 3OXSB 2P47B 1LO3H 2DQTH 1A22B 2CDGA 3ALPA 2OSLB 3U0WH 1A1OA 4D0DA 2YA2A 3OZ9L 4KJYA 4JY5H 4RFNB 4GW1A 1I1YA 4ZUVB 3V6FA 5GGUA 1R3KB 1SEBB 1KBGL 4OCNC 1UWXK 3ZE2F 4KZEL 1I3GH 1ZV5A 4EI5B 1N8ZB 3OGOE 5E9DD 3SDAC 4GKOA 3HAEA 4EJ1C 1MRCH 3PWNB 2JTDA 5I73B 4WIQA 5L2JA 1P84K 3T0BA 4D8PA 4RMSA 1K5NB 2IGFL 2AXGA 4BQ6A 3MRRB 4MA1B 3Q6GH 1U8JB 4HJ0D 4NQSA 5DUPH 2YHGA 1YNKL 4TQEL 3VI4F 2BRRL 3NZHH 2X4UB 1JL8A 4LAQL 3RX5A 2ZPKH 3L5XH 5E94A 4TNVK 1KN4L 3MV8E 4GKNA 2XRAL 4M6NH 3BEVA 3MFGB 1VCAA 4YGVA 1FE8H 4NRYA 3S37L 1U8JA 5HYJD 1UQSA 3S37H 5IHZB 2FHBA 5JXEC 2F53E 2VLRD 2EE3A 2E7LE 1BMGA 1M7IB 2B0SL 4JFHE 3LS5H 3ES6B 5IWLC 2GJZA 1SJEA 2DM3A 2NY4B 1CQKA 3ZLQC 1C5DB 1G7IA 1F4HA 1U95A 1SY6L 4HWBA 4ZUTB 4M93C 2DQCL 1G7PB 3KPSD 4NPYB 2A83A 4CJ1A 3ROOA 3UYRH 3LAFA 5JUEL 1YNKH 3KPRB 5BXFB 4V1DD 2WBWB 3I6LE 2C26A 2PCPA 5BVJB 2X6MA 2OX5A 1DN2A 3H42L 4OJFH 4ZS7L 1FAIH 4ZUSA 4KVNH 4PV8A 4PJ8B 2CO7B 5EZLA 4HG4K 3B9AA 3DO3A 3HC3L 2XQBH 3GJEB 3IDNB 1T20B 3QCVL 1KEGL 5ICYA 4PRPD 4N8CL 2YXMA 1FVCB 1U8NA 3VGBA 1QBAA 3LRHA 3D69A 2VQUA 3F58L 1H3TA 5TH2B 6CGTA 4GW5B 1WC7A 1N26A 1SBSH 4PB0L 4XC1H 1SBSL 4Y8AA 4K7FA 2ZCHL 1VFAA 1S9VA 3BO8A 3CFBA 5CSZB 5I74B 2EYRA 3L5IA 4QXUH 5E6IB 2NY2B 3DXAE 3NA9H 3DUHA 1S7XA 3PL6D 3WO3B 4X5XA 2X4RB 5DD6B 3ERYA 5ESQB 4RA3A 4JG1L 1FQ9C 3OKMA 4P48A 4L8DA 4OD2B 2NY4D 1ZHKA 5EG6C 1M6OB 2BMKB 4LIQH 1U9KA 2L7UA 5JDSA 1CZ8H 1S9VB 3BO8B 1IGFL 4RRPA 4R3SB 5BRZD 5BW7A 3I3DA 2DB8A 4AEHH 1XF2B 4B5EA 3UTSB 4Z77A 2DKSA 4KKBC 3D9AL 1SJVA 4NZUL 3G5VA 5DT1L 3RWHB 5JIPA 5KVFL 2AEQL 4GKZB 2XPGB 4UV7L 1K8DB 3OF6A 1U8HA 4HMEA 3T0ED 5SWQB 4OCXH 4AIXA 3MREA 2HFFB 5F3HB 3NCBB 2CSPA 2QQQA 4Y2OA 5EO9B 2Q6WA 3P2TA 1MAKA 3QCUH 3KDMB 2JJVA 1RZJH 4LVEA 2QSCH 3VE0B 2YEZB 5TGBB 2ZNWA 5EOQH 4P3DA 3K46A 4LU5L 5AD0A 3JZ7A 2CUIA 3ILQC 2P48B 1RJCA 2DBLL 4MAYA 3ZDXF 3WNKA 3TT1L 4WWKB 1ND0A 2G5BB 3C6SB 2Z91A 4NBXB 5C0RL 3NZ8A 1UEYA 3CX2A 4NHUB 4MLSA 3KYKH 3RVUD 3WLBB 3MRCB 2GSIB 1AJ7H 2H9GA 5FUCC 1Q1JH 4OIAA 3LQMA 1UWEL 5HVFB 3BZFA 5D96B 4A2MA 4JFFB 1BVKA 3BESR 2HN7B 5GRVK 4K3EL 4XBPB 2XKNA 4JKKA 4AIOA 1I8KA 2ADGB 3VG0L 1DFBL 1NAML 1MHPH 1SM3L 4Z95H 3GSUB 3OR6A 2VSDA 2B1AH 1VFOA 2FWOB 1H3XA 4R0LC 5IW1B 5I8OL 5CBEA 5GPRA 4P2RE 3MLRH 4KXZH 3OX8A 5I1DB 1SJHA 4NYLB 4L1DA 2AXGB 4MDIB 5E8NB 3FMGL 3WL9B 3QBTB 4PRDA 3P73A 1GC1L 1VFAB 5C07D 2XZCL 3KHQA 2DLEA 3NTCL 5KW9H 1DVFA 3CFEA 3QCTL 1HZHL 4ZO6A 5E2TL 5DA0B 3S4SA 5F88A 3OL2A 4X80H 1GHFH 2GTZB 3BKCH 3O9WB 1CICD 4R4FH 1HDMB 2IG2L 4WW1A 3WO4B 2XNAB 1NKOA 2IANE 1MAJA 1V7NL 3CDCA 4M48H 3IRPX 1KCSL 4LK4A 4DQOL 2Q8AL 3L95A 3GGWA 2F5BL 3FFCB 4K8RC 5DGQA 4I2XE 2R9HC 1TETL 1MJJB 3MLPA 3G6DL 1U8QB 3QUXC 5AZEL 5E9DA 4P57A 4HUNB 1Y0LA 3MCLH 3RIAF 2IGFH 1CCZA 3RZCC 1CVRA 1AXSA 4TNWK 5TF0A 3X13A 1RK0B 3O3BA 5CZXC 2IH1A 3EDEA 2BSRA 3F7VA 2EDOA 4P49A 2Q8BH 3IJSA 2LAGB 3HI1B 4I13B 2JB5H 2A77L 2BCKB 4M61B 4M7LL 3V7AG 2DIBA 3IDYB 3RDTA 4LRNL 1UCBH 4PY7A 1A6VH 2O5YH 3PGCA 3G6JB 5EFIB 3WD5H 4IBLT 5JA9A 2BVEA 3DXAA 2WP3T 4LLUA 1BZQK 2IEPA 4YXLH 2F74A 3MLUL 4XBEL 1T66C 5D1QC 2YPLA 2NQCA 4FQHB 3ORJA 4QRSB 3U2SB 3D2UB 3FQNA 1MVFA 3GMNB 5D7IA 3HI5L 5DD3L 5E2UL 4MJ4A 5DEFA 1WWAX 3TH2T 4NM4L 4JN1L 4TN9A 4LBEB 4XTRC 5F7FA 1JHLH 4KK6D 2OYPA 4GQ9H 1N64L 3UBXA 3BGAA 4GKSB 1DUYB 2OTWB 3QT2A 5CIPH 4Y16C 1W72B 2VXSL 5HHOA 3RGHA 3SQOL 2YWZA 4MJ5A 3V6FB 1PGRB 1CE1H 1VPOL 5BMFH 3OSKA 1I75A 2HTKC 3WNLA 3AROA 1OD9A 3MRLB 3GIVA 4NQXB 1GH7A 4KK6C 2RHEA 4XVSH 3RWJB 5KVGH 5HHQB 3FQWA 1Z3GL 1R3IH 3TA3B 5EUKA 2ATKB 2VDLL 2NCMA 1SHMA 4KK5D 4GAJH 3QULA 2QQLL 5EC1A 1F3DH 1WISA 4R7NB 2OTWA 3DX7B 4X8JA 5D6DA 3LHPL 5EDXA 2NZ9C 2PXYC 4C55A 3LHPH 3LQAH 1IEAA 1JNLL 4PJAB 1F6FB 3EDJA 4Q2ZB 2B39A 4PREB 3E2HB 3TBSA 2NY7L 5F1IB 1MRFL 4TSAH 2CR6A 4NCC1 5E7BA 2YPLB 3QRGH 2XI9A 4XPFH 2AK1L 4G7VH 2VO5A 4WFHE 4FQHA 1X5IA 2BY1A 5GRVL 5HDBE 3UTSA 1RZFL 4L4VD 3VXRA 2B1HL 1U3JA 4BQ8A 5T1LA 3B9KB 1T7ZA 3BAEH 3V2AR 5ID0A 3E6HA 5IFJB 5C2BH 4NRZB 2XA3A 4WUUB 4X99A 4F7EA 5JPNB 3OJDB 4LASL 1T1WB 1MOEA 4LVHB 5DMKB 2QHRH 2IPUK 1KJMA 2BK8A 5J56B 1FVDA 3GGWB 3PNWA 1WQVT 2EDLA 5BO1L 4K55A 2NXYB 5GGVL 3EYQC 5JW5A 5IB5B 4CMHC 4MXQA 2B4CH 1RULL 4K3JH 3ULUE 2ZUQC 4M9PA 4FFZL 3U9PH 4P9HL 3P77B 2Y5TB 4QXGL 4RA0C 4N1CA 3X13B 3CFEB 3CXHK 3K0WA 1M05B 3O4LD 4I77H 4JFXB 4F7PB 5I73C 1HHKB 3RUGE 3UXFA 3ULVF 3C08H 3ZDZE 4KKCD 4PRBB 2XV6B 4BJLA 3C5ZA 3C2AL 3OKLA 4X6CA 4FTVD 5C70A 3MGTB 3L95B 2P7TA 3FQTB 4IIQB 4LCWD 5BVJA 5DD1L 4WFEE 4PP2A 3FT2A 4OQ1A 3GRWA 4PTUB 4E41D 4Y4FA 1YYLL 3DX8B 3VXME 2CRZA 1KLGB 3O4LB 4OI7A 3FFCE 3MXWH 3LS4H 5D70H 5CWSA 2NY2D 1RZKL 2DI9A 1BP3B 2G75A 2WK2A 3RX8A 3GSNL 4EI5A 3VXNB 1IGJA 2DI7A 4JFFA 4NBYB 5M7QA 4N5EA 1A6AA 1NBVH 1FNSH 1LILA 3P73B 2YN5A 3V5HA 1TJHL 4G6JL 1DLFL 1A0QH 1V3LA 1YECL 3GO1H 4XH2A 5LQBL 1OCWH 2XQYG 2OR7A 1QLRB 1ED3A 3WNNA 3KYMA 3QHFL 3ROLA 1OCWL 1WVZA 2FATH 4U6YB 5HHVH 1L9MA 2Y36H 4BQ9A 2PYEE 4P5KA 3F65A 4PJ5D 4WWKA 1JF1B 4M7ZC 3RWCA 1MIEL 5SWSD 3MRFA 3PWUA 5DJ0A 3HNSH 3MLXH 1I7ZB 1Z2KA 2RFXA 2XN9D 1OP5K 5I1AB 2UVEA 1HYSD 4K23L 5HXMA 1T3FA 1S3KH 1EH9A 2R39A 1NCDL 1BD2B 4GLRH 3HE7D 3GSQB 1UWGH 4LCWE 4OCWL 4MB4A 3C6SA 1RMFH 1YEFH 3MRCA 2VZOA 5C3TA 5C0NC 3FRPA 1YN6B 5C07E 1DE4B 3LPFA 4S1RH 4Z5RB 5JHLH 1WZ1L 2R1YA 5F3BB 3GJFA 4IMLA 1QQDB 4L5FL 4EDWH 3V5DB 4F7CA 3VD5A 4UDUA 2DQIL 5H37H 3MA7A 2YD6A 4ODTH 4GXUN 2X4SB 4KI5E 4X9IA 1RK1B 3BX7C 4DW2H 1S7RB 2LVCA 5J12B 3B9KA 2XN9A 4CAGA 4Z7UE 5C0EB 3T3PE 1INDH 1A5FH 2HLAB 4L3CB 2GUOA 4JDVB 3CZFA 1EVUA 3SKNA 2B1HH 3MLRL 2FJHB 4JO3L 3K2UH 1TCRA 1ZHNA 2B2XL 3G9AB 5LAXA 5GRJH 1CLYH 2I5YL 2B1AL 3LEYL 2H3NA 2P8PA 3SKJL 2CLZA 2Y7QA 1HIML 5IESL 3CX5K 3LKRA 4F3FB 3WSQL 4ZUWB 4ZFOL 4YFEA 1JWMB 1G0DA 3MRBB 2BNQB 4XHJD 4YGAB 3TVMA 4AT6B 4X6DE 5H37G 2JJTA 3BE1H 3CVHL 2NY3B 5D7IE 5GJSL 2QV2A 2AJSH 3T1FB 3T0AA 1EEZA 1IT9H 1EAPB 4WEBH 2ZUTA 5BCAA 3SE8H 4KDWA 3W9DA 3GBML 2ICWI 1SYVB 3KS0H 4WTZA 3SE9L 1SYSA 3VXOB 1R5WB 3RL2B 5C7XL 1D6EB 3MMEB 2O5XH 3WHE0 4OCSH 1N59B 4PJXF 4GAJL 4L1HA 4ZAKD 2R0LL 4JFDA 2XN9B 5E99H 2VQTA 3S3PA 4PUBH 5BQ7A 4NP4H 5C0AE 4QRRD 5FUOH 2Z31A 4ODSL 1INEL 3EOAA 2Z8WC 2JLLA 1IL1B 4XMKH 1MCOH 2HT3C 3IXAB 4X4ME 3OKKA 1K4CB 2R15A 5BXFA 1F4WH 1AKJA 2MCPL 1BLNA 4MQXD 4GOSA 5H35A 2WIIB 1FL5A 1YEDB 2XIDA 3RVWC 1P2CA 4YZFE 3B3IB 5MP6L 4TUJA 3VFOB 1KPVA 3FT3B 4R96A 4X6CE 1TQCC 5IHZA 2AABL 4RZCB 4XCNB 3TO2A 3D0LA 3MUGB 1MQ8A 3V6OC 1KCGC 4E0RA 4HJGA 3VXRE 4QRRB 2ESVB 2I9LA 3DIFA 3MBEB 4JZJC 2VZVA 1G0XA 4LDLB 4NN6C 1L7IL 4DGVL 4QOKD 4WO4D 2BP3A 3C60A 3VXMA 5CLWA 4XGZB 1PX3A 2WIIA 5FYJL 3RNQB 3ZO0A 5IB2A 2CD0A 3ARBA 3EYUL 4Y89A 1T66D 4PLKC 4LSDA 3CSGA 2PETA 1RHFA 4H0HB 1ED3B 3T4AB 1A9BB 2OBGA 4ODXA 2VR5A 3GSWB 2ZSVB 4PJ9B 3A6CH 5HHPA 3UEZA 5HGAA 2X4QA 5GZNC 4G8IA 4OF0A 4IHOB 4WEMB 4GUPA 2LU7A 5JPMB 2XRAH 5AWNH 3VGAB 4U1NB 1S7TB 4Y4KB 5C09A 4D9QD 3ET9F 5E5RB 2CIIB 3T1WA 3NIDF 4PBXA 3IKKA 3ARRA 5ESAA 1NLDL 5FYKU 2FJFA 5GZND 3TNMB 1CG9B 5DFTA 4JREB 1R3KA 1SEBA 2P8LB 1A1OB 4D0DB 1KULA 4HUVA 4XP6L 1EO8H 5I17A 4GH7B 1EEZB 2LE9A 2H1PH 2H41A 4JJHA 2P8MB 3TP4A 1RJZB 4N0UB 1PKQB 4QKXB 3EOTL 5CBEB 2JIXB 5FXCH 3S96A 4NHUE 3AGVA 3WXWH 1I7TB 5DHVH 4IOFD 4M6AA 3MNVA 4CRPA 1RAMA 5EU4A 1KJMB 3MRJA 1R3HA 4UT6L 5DVMA 2D4FA 2UZIH 3QEQB 5TQ2H 1S5HA 3HRZA 1RULH 4K3JL 4PRNB 3QIWB 1Q9WB 2UVFA 1I4FB 3FFDB 4KDTA 5HHNB 5L8JB 1NKRA 1I8KB 4MMXC 4JFFE 2XZAL 4UV4L 4NZRL 5D1XC 3ZHDA 5GS1C 1A14H 2JCCE 3FHQA 5IGXL 3QIUB 4P4KA 5J6GA 4JRYB 2OJZL 5CBAA 3JUYA 5HHXH 4Z9KB 3E3QC 3GKWH 1QA9B 1JE6A 4LASH 3QQ4B 3IFPB 3T65A 4NWUH 4RWYH 4OLZL 4KTEH 4OM0L 3EOBB 1A6TB 3LN9A 2MQCA 1NCAL 3HI6L 3IFLH 3TV3L 3S88L 2AI0L 3TBYA 3DNKA 3D0VA 3BZ4B 1M7DB 1KIPB 1DQJB 3WIIH 5F9JB 1ZTXH 4MAYB 3L5JA 4LGSB 2J88H 4FQQB 1S78D 4OV5B 1MHEB 3CFKB 5MP6H 3ILPB 4K8RD 4N0UA 5I6XB 1YPZA 2E7HA 3MOBH 4EXKA 5DDHB 1EPFA 3QNYB 2A38A 1QEWA 4FZEH 5C71A 3CSPA 2BNQE 4XP9H 4F33B 3DTXA 4O58L 5KAQG 2WZPD 5D1ZB 4GG6F 3QZWB 2CKBA 2H2SD 1CG9A 4LQ1A 1K85A 5IHLB 2GSGB 4PJEA 2D31A 2X4PA 4P5MB 4LHQB 3U4EA 5DVOA 5T3XE 1P7KB 3D85D 5E7FA 1LP9B 1N64H 3DYPA 3KYNA 4LLWA 5EU6B 4WUKH 5I76B 4IDJL 3PWUB 5T3ZE 3PWLA 1ZSDB 3TIDA 3U36B 3IT8D 4LCWB 4TOYH 1U6AL 1JF1A 1FNHA 4BFBD 1X7QB 2NX5B 3FONA 5I1JH 1J12A 3BKJH 2XTJB 2DI8A 4HW6A 4S1SH 4LOUC 2WUCH 4P2OB 5DJAA 1JHTB 3P3YA 1OM3L 1UXSB 3FJTA 1CGYA 4JFEE 4CUCA 2W0PA 4PRHD 5E8OB 4QY8A 3MLUH 3KLAB 5BOZG 4LPXA 3J8F7 1WC7B 2QTEA 4MXQD 4NNXB 4NQUA 4XCEA 1OB1B 1KENL 2A9NH 4OCRL 1R24B 3VXSD 1AXTH 1A3RL 4UILL 1E0OB 3DOSA 1I1FB 2CRIA 2QL1A 4FQPA 1P4BL 1VSCA 2WBKA 5FHAH 1JHKL 2VXSH 1OL0A 1CU4L 1KB9K 3DXAD 5AG8A 5KAQF 3I02A 2VLKD 4R4ND 3NCCB 4NFBA 1XGYH 3MRNB 2IC2A 5K93A 2HLFC 4OAWB 4JQVA 1C08B 2E6PA 2HJKB 1CICB 2KBGA 4I0CC 4ODTL 1A14L 4QTIH 2BDNH 1VADB 3WMSA 4FABH 2P4AB 1EHLH 1HKFA 1AE6H 4JJ5B 3VXSA 1KV3A 5IBUG 4D9RD 3ULUF 3MMEA 3SDXB 2Z0BA 4JFZH 4G43A 3FB8B 5DVLA 5JZ7D 4K7PH 5C92A 2CDEB 3D1MC 4XVSL 3GSNA 5JPNA 4PRIA 2V2TB 3KPLA 2IADA 4IMKA 2UWEF 1NCCH 4MDIA 4HJJH 5E8NA 3DV6A 3TA3D 5EU6E 1IAIH 4HH8A 3T0WA 4ELMB 5IW6A 3E6FA 1BJ1H 2OJZH 3RVXD 4Q9QL 4Z7UF 3MJ7B 4RGNE 1DBJL 3LN4B 4IRSB 5KS9A 3AS1A 3MRBA 1DBJH 2ARWA 4IRSC 4YDJA 3RKPA 4OFVA 2X44D 1WFOA 5HGBB 5B8CC 4M3JA 4DKFL 4B7LA 1QSFA 5T33L 5ID1B 3MFFA 4U6VH 4Q2ZA 2ZCKH 2IBZY 5DYOA 5JOFA 1DCLA 2YD5A 2FJHA 1J7VR 3RGVB 5FYJD 3MBEC 3NZHL 2PO6B 1Q9LA 3O8XC 2WBJA 3MZTA 1IBGH 3KPRD 4I48A 5B3NA 2ATPB 1PQZB 1AD9A 4CW1A 2ILLA 4FQ2H 4FFZH 4RBPH 4WI2A 1GZQB 2G60H 1MLBA 1EJOL 1IFHH 2QQNH 2EDQA 4N1EA 5J0BA 5C09E 4YNYB 5F8QC 3GIVB 2IF7A 3NCFB 4P46D 5E2WL 1MCWM 4CVUA 1MH5A 4ZDHB 4NDMB 5A40E 3DO7A 4LSTH 3KR3L 3S35X 4NNPL 3DRQB 3RGVC 4RRPG 4C56A 1NPUA 3WDIA 1PJ9A 2UWEA 3H3KA 2C7UB 1YY9D 4YDVA 2DTML 2BNRD 4XX1G 3O3UN 5L2KD 1A6ZA 4APQA 3CU1A 4CVXA 5TQ2L 4HXAL 2DYPB 2LVEA 6FABH 3IJYB 4E5XB 1SQ2N 4RISL 3FB7B 1P4BH 1I7ZA 5ID1A 4G9DB 4RFOL 3IDMA 3QUMB 1BIIA 1EVTC 2W65A 3D85B 1EV2E 2D03H 1T1ZB 3LRSB 3NFNB 4R97B 4P2CG 4ZD3L 3U7AA 3E6FB 3NBNA 3JVGA 3ZTNH 2XPGA 2F54D 2VQ1A 2J8HA 4Q6YA 4FABL 3D3VD 3RWHA 4PJHB 1NBZB 3R06B 4NUJA 4UB0H 4G59A 3JTSA 1JNHB 4HZLA 5FHAL 5HJ3B 3IDJB 4S10A 1R5VA 1Z9LA 3BGFC 3BZEA 4PJAF 4Z7VE 3UO1L 5K9OA 4MJ2A 1F2QA 2V7NB 4RGNC 3QPXH 1WFNA 4JFQA 2IFFH 5DR5H 2N56A 2ARJB 5BRZA 3QFDA 2MKWA 4HX1A 1PBYA 3LN4A 4YHYC 1R3HB 2QQKL 5J12C 5T5FH 3VFNB 2MMXA 1LMKA 2CLRB 3LKNB 2WINA 4V2CB 1Y6MR 1MVUA 3U79A 4PJ5B 1LK3L 1HKLH 5CMAB 4FG6C 3V5KB 4G8EA 3PXHA 5KANI 5ACZB 1WSST 4XNZB 1QKZH 2X89A 4HPYH 1KPUB 4KJQD 1MFAL 3VFGH 3NH7H 4GRMA 5D2LE 3IGAA 3QQ3B 4ESKA 5BV7H 4OZIE 2L7JA 1CDCA 3F5WB 3WNPA 4XHJC 5ISZB 3V95A 5FOJA 4PJ8A 5FAAA 3SY0A 4PJHA 1FGNH 4ZXBD 4N9GB 4U05A 4P9HC 1HHIA 2X4OB 4MAYD 5KG9A 2X9WA 4K7PX 3WSQH 1RVFL 3BSZH 4ODVH 3HMWH 1UZ8A 4HIXH 1I7UA 1JWSA 25C8L 2PTTB 5MEOA 2OK0H 4QTHB 5T1LB 4XBPA 3HMXH 5FF6B 3LB6D 1IGYB 5C0FB 3CSBA 4RAUA 3CLFH 4MXQC 5GS3A 4TTDD 5AEAA 3CH8A 4J3SA 1J86A 2F5BH 1G7LA 5IJKC 2YD3A 5E2VH 3KJ4C 5DRZA 1ITCA 3MUGA 4M7LH 1MCBA 1NFDA 4AG4L 3E2HA 3TF7C 2APWA 1X4YA 5L2JB 1Q9KB 5HDOA 3HLAB 2AJZA 3D39D 2H8PB 2R29L 4J3XA 4KQ3L 3DPBA 2D31B 1T03H 2O93L 2NNAA 4JREC 3Q6GL 4YHKH 5DGRA 3OR7A 1JZ8A 4MYWB 2HFEA 1CIDA 4WU7A 4EVNA 3RL1A 4L4VE 1PZUB 1I3RB 5JQ6H 3W0WD 1P4LA 1JIBA 3VXSE 3H7LA 4HMDA 5GGRB 3GRWL 5J6HA 3QFJA 1U8HB 4JFDD 4F58H 3CPLB 5BZDA 1ZSDA 2IBBA 1W2KT 4XT1C 1PW3A 2DRUA 1ETZA 3HNVL 1J0HA 3S34H 3O6FC 3QIUC 3MV9D 3HB3C 1PG7W 2V17H 3T3MF 2JJSA 3JSSA 2GSGA 4PJEB 2FO4A 1BPVA 1HOCA 4TULL 1KC5L 5B3JF 1JWUA 2H6PA 4HGMA 3K4AA 2VDMH 4MSWA 5J6GB 2NXYC 5E8DL 4KROD 4LNRB 4L8DB 3U7YL 4FQCH 4M5ZL 3P9WB 1BBDL 4BFIA 3B9KD 1WBXB 2W92A 3V6OA 4OLUL 3D3VB 1QLEH 3HZMA 5GHWL 2JCCB 5GSRB 2QJDA 1IKFL 3SGJA 2EYRB 4GBXB 3HS0A 1AR1D 3IDXL 2BHYA 3CCHB 2A6JB 3SDAD 5F9AC 1G7MA 4P46A 4I3RH 4PJIB 4NHCH 2V9QA 3K8MA 3V0WL 1K4DB 4UOJA 1YNTB 3QUXD 4N0CA 3V7MA 3C8KA 3QPQC 1NGQH 1XF5B 2Z8SA 5I8OH 4QF1B 3IDIB 1NFDB 2D7OA 4LHJB 5E6ZA 2EICA 1AIFA 1MNUH 5FKAB 5FYJU 2PYEB 3C09C 4HWNA 4YDVB 1UACH 5FK9A 4Y1AA 4ZFGL 2BSSA 4O9HL 2PCPB 1YNLH 5BJTA 1G7JB 3QUZC 3NPSC 1R5IA 3BIKB 3CFCH 3NH7L 1T21B 3QXUA 1ZLWK 4M5YL 1OF2B 5FYLL 4Z5RA 4HKBB 3ZDZF 3ZKSD 1A8JH 1SJEB 2EEDA 2MCPH 4Z7QF 3QQNA 3UPRB 5FA4B 1K9TA 2YD7A 2NLJA 1AHWA 3SKMB 3KPTA 1BGXH 1N0XH 2CK0L 4QRQA 3T08A 1B0RA 4H1LG 1BD2A 3MODH 5DURB 1OQXA 3PP3H 3QUMH 1FC2D 2NNAB 3RY5A 1MJ7L 4CDHA 1S7QB 1JF6A 2J8OA 3PP4L 4MZ3A 4S1SL 1JGUH 3VFWB 5AYQA 4QY8B 2VR9A 4N5UA 4W81A 3EYSL 3DIFB 4P3CH 4NCC2 1T0MB 5HGBA 2R1XA 3NMEA 4G9FA 3VFRA 3S36H 1JRHH 3QUYD 5C08A 1HI6B 4OB5L 4HKXB 1UM6L 4GT7A 3AU1A 5T5NF 4OCXL 1OSZB 3IKCB 5IOPA 1QOKA 5I6XC 4DVBB 5DO2C 1B4RA 5GS0C 2ICWB 2YPKA 2R8SL 1H5BA 4LIQL 5JMOC 3HA0A 4OZFG 2DJ4A 1BLNB 5H35B 1NFIA 4M7LT 2FL5B 4AQ1B 5IMOA 4YBQC 3UZVB 4H0IA 3K81A 4YR6A 3LKPA 5ACLA 1A6VL 4QLRA 4J2XA 4C58B 5I18L 4JKLA 5LWYL 5ILTL 3OAYH 1W0VB 5IMKA 2VLLB 3G08A 3TBVB 4UDTB 4WDIA 1IC5H 5CJXC 4FQXA 1AHWB 3SKMA 3A67L 3X17A 3UPRA 1B0RB 2GQHA 3NIGF 3P4NA 2A73B 3WIIL 5K33A 3QQ3A 4DK3A 3CC5B 1RY7B 4NQVB 5ICXB 1KNOB 3P0VH 1OAXL 1YEDA 1SYVA 1NFDE 4NGHH 2R1WB 5TE6H 5FHBH 1R5IB 5CEXA 2AXHA 4GSDL 2AQ3A 3DROB 3I02B 3JWDC 2NTFB 3KWWA 5IVZA 2HFFA 4OZFH 3IDMB 2C1OA 2D03L 1VENA 3V0WH 2FIRT 1LDPL 4L8SA 4NKMA 3V4UH 4P23A 4HJJL 3JTTB 1F2XK 4HX1B 2R4SH 4PV9B 2CH8A 1UCTA 4S1RL 5JHLL 2RBLA 4PGCB 3I75B 5DK2B 1ZHLB 1JYNA 4LEOB 3T2NL 1L0YA 1UACL 3RVTC 2F54E 4BSJA 1MCFA 3FN0H 1FN4A 2DQCH 3O2WH 4FXGB 5FDWB 4F7MB 2DQFB 2YC1A 5D6CB 1NCDH 1YEIH 3IAPA 1KXTB 3X12A 2EH7H 1NGXA 4JB9L 4MJID 3FONB 4ZSOE 1WBXA 4MA3A 1NUNB 4UI2A 4P2OD 4P5TA 5DA4A 4M62L 5GZOD 5SWZB 2CK0H 4JN2A 1TZHA 3VXQB 1OAZL 1MUJA 2FGWL 4YWGH 1OTSC 4X6EB 3BRGC 5F1IA 4JHAL 3TPUB 3V52H 4NO3B 5HGDB 1XF1A 4BQCA 4DN4L 4YDIL 2DN7A 5DJ6B 1OHQA 2DQTL 3DSFH 2FR4B 1NCNA 4XP4H 5BZWB 4XPAH 2OL3A 1AP2A 4F15C 1IEBB 4BZYA 4PGBA 4BYHA 3GMNA 3MV9B 1QFWL 4IHOA 1CE6B 3TM6A 1B0GB 1RFDH 4IRSA 5KS9B 3OKDB 4QXGH 5INDB 3CK0H 2N7AA 4F57L 4WJ5B 2ENYA 1F4AA 4NDMA 3O6FD 4UBDD 2CUHA 4DCQA 2W9EL 2YC1B 5D6CA 1C5DA 1KN2L 4ONFH 4AMKH 3FQUA 2W9LA 1TQBC 1Z0MA 1ZS8A 4HIXL 1T7WA 4NQED 2H8PA 1IM9B 2VDQH 5C9JB 3THMH 4HAGA 1YA5A 3MCKB 3VD7A 1EX0A 4QNPF 5F1KC 1K2DA 5FUOL 3SGDI 5DD1H 3U0WL 2B7DT 3FO0H 4QHKI 4K7PL 1PKOA 1QLFA 1YY8B 4X4YB 3DLQR 4M6OL 1NAMH 3OHXB 3QG6B 5K9JH 1EEQA 2A9NL 35C8L 3U4BH 1Q9OB 1OAXH 1AR2A 5C7XH 2ZG3A 1TXKA 3MOAL 3WJLC 4HQQH 1YEGL 3SDDA 1AGBA 5CFHA 1OP9A 5GISL 3VD3A 4N0CC 3SDYH 5HGGS 3MCG1 4AG4H 1N5AA 1T0NA 4JPVH 5I1EL 5E2JA 1Y6NR 5ICXA 1LE5A 4Z7OE 3RFZC 2WUCL 4WVRA 2COQA 5D72L 1RJYB 1ZGLA 4W4OA 4PJGB 3OGCA 1S7SB 2FX7L 4E41B 3MNWB 1ZXQA 3KJ6L 2PW2B 4TSBH 4F7PA 1CGTA 2UV3A 3DSNA 4I9WD 3AM8C 5EOQL 1C5BL 3QDGA 1EHNA 4BSVA 3STZB 1IAMA 2EE2A 1YQ2A 3V6ZB 3OZ9H 3VU2A 5HYQB 2A6DA 3VG0H 2JELL 4JM2A 4NQCA 2HJFA 3DUUB 1N7MH 2Z31D 1MVUB 1QFPA 1H9VA 4JZNA 2XQBL 2VQ1B 1A4KB 1KB5A 2DLIA 5CHNB 5EUOE 1F90L 1J5OH 5AZ2L 3QQ9D 3ETBF 2WV3A 3PGDA 4RMUA 1NANH 4Q7DA 4PPTA 2EIDA 4WV1B 5HBBA 2P5WE 4WO4B 3RU8L 4HK3N 4PJXE 3RNQA 2IMNA 3D5OF 4G8GE 5C9JA 5FM5O 3AMKA 1XGPB 4M00A 4Y16A 4DW2L 4HWEL 2ZUYA 3VFSB 3OHXA 2R2EB 4OF8A 4BM7A 2IH3B 3I6GB 3LH2L 3EO1B 2AV1B 5H94A 3ARDD 4JM4H 4PJDE 1MCCA 2YD8A 1NBZA 1KOAA 1UCBL 1JVKA 3NAAL 3QNZA 5C0EA 1ZEAH 4DN3H 4GRWH 4ZXBA 4MHHI 3UJTH 1WWWX 3L3JA 5DDHA 4TRPL 3ZSTA 4WUUD 4PB0H 5JIKA 2C3GA 5J1TC 4NBZB 1MCNA 3BW9B 1JZ6A 1KN2H 4ONFL 4IS6B 4DGYH 5EZJA 2HT3D 5BS0E 5T1MA 3X14B 1T4KB 1U3HA 2CMRL 5LBSH 3MREB 4JCMA 3C60D 3VXMD 3OTTA 2DWDB 4EDXB 1U3YA 1ZTXL 1TVBA 5CGTA 2DYPA 3CH1B 4HFWB 3EGSA 2Y9RT 5MI0C 3MQIA 2W9DL 1HILA 2DTSA 1XGRB 1FO0B 2Q1EA 4TVPE 4WU5A 4JY4B 1QHOA 2VXTL 4Q9RL 3WO4C 1LK2B 3FTGA 4R0LA 3O9WC 3FB6B 4ZTPH 2UZYB 1FP5A 4HV8A 1IGCH 3P9MA 2ADIA 2AV7A 3FT4B 3D3VE 3LOWA 1OLZA 4CNIA 5GGTL 3B9EA 4TULH 3HI6H 5C6TH 3WKML 2GK0B 4WFHD 2H32H 3SDCA 4PLKD 3TF7A 1KIQA 3LRGA 5FO9A 3PL6A 1NMBH 5D7JA 2F54A 2ADFH 2BOCB 3HC4H 1RUML 2Q3ZA 4Z95L 5GRWA 4U2ZA 3ZMRA 5IWLA 4GLRI 1YEEH 1KCVL 1HK6A 5CD3A 4JR9H 4FHBD 5SWZA 3VXQA 1A7OL 1ZLSL 4LEOA 3SDYL 3ARZA 1CS6A 2UZIL 4YHLH 1SM3H 5T3ZH 4KAQL 1ZLSH 1X4ZA 1KC5H 2VXTH 3JWDH 3T2QA 4I0PC 4KTDH 5CBAB 2EXYC 1NC2A 4ZSOA 3QUXB 3IDNA 1NLDH 2CQVA 2VXVH 3OAZK 3OKOA 1ETZB 3DXAB 3UTSE 2XWBA 4F37K 4L8SB 3QFJB 4QHUB 4DN4H 4OKVA 4PGZA 2I60H 1FG9C 4OFKA 1I3UA 5IVZB 3J7HA 2V2XB 4ETQA 3DV6B 1GHFL 5TDPA 3Q5TA 4Y2DA 4LARL 5E6IA 3UJIH 2D7NA 4Y4HB 4MXWH 1X5GA 3FB6A 4LKCA 4GJTB 3QEHA 1EBAA 2NXZC 3B9KC 1E6JL 3MR9B 5I8CB 4O2EB 5KZCB 1VACA 3EYVA 4N90D 1D5XA 3HC4L 3RJDA 3MV7B 1BQUA 4NGHL 5HYSB 2YZ8A 3HE6D 1G7QB 3MLYL 3ZYJA 5D93C 4LU5H 5HDLA 3CPLA 1CLOH 5CJQL 1PYWB 4IDLA 5DJZA 4I3SL 2I5YH 3T77A 4KJWD 2Q7YA 1G1YA 2HP4A 2I24N 4P2QB 4OZHA 3O0RL 5CSGA 5HYFA 5DMYA 1E27B 4LNVA 3W5MA 3Q48A 5DMGC 1KCRL 1JMZA 5DMJB 1CFTB 1X4XA 3S36X 1RIVL 2FWOA 4YHNB 1J1PH 3FB5B 3LS4L 3DX6B 1PY4A 4DVBA 3GBMH 4M3KB 1ZHBA 4XH2B 1BFOB 1K8IB 4GMTL 2NY3C 1YEGH 4YPJA 3MC0A 4LEXL 4M62H 5I75C 1NCUA 5E4EC 1A2YB 1CR9H 1F11A 1GAFL 3B3IA 4HHAB 1S7UB 2NY2C 2LFGA 3PQYA 5JHDA 3MLTB 3L3GA 4QRPA 1KLGA 3O4LA 4YHZL 3D18A 4G8GA 3ELAT 1RIUL 2C3WA 3DVGB 4FP8L 4LCYB 4XMKL 5KJRL 3IS0X 5D1QB 5MHSD 5CP7B 3L6FA 3MRQA 5TDPB 3KJ6H 4TSBL 2BVPA 4WWKD 1AHWC 3BZDA 4WI7A 1X7QA 3N50A 1SVZA 1TFHA 3MV7E 1CDGA 4P3DB 1YDPA 3LMJH 5DZNA 2A0LC 2GITA 3BDBA 3I84A 3IDYC 4PJBE 7FABL 3VW3H 4HULB 4MJ5B 2DQUH 4JFFD 1M05A 1UB6A 3MOQA 3PWPB 4YBLC 1AGFA 4Z76B 3TPUA 4HZLB 5T1LD 4LAJH 4NQDA 3UYOD 5JLZB 3ZTJH 4ENEC 1IAKA 1IGML 1YECH 2C4FU 2OR8A 5ACZA 4EDWL 2E7LA 4ZYKA 5JOPE 4UBDC 4FG6D 4LDOB 2FRGP 5I1KH 2APBA 1FBIH 3BP7B 4OUUB 5GS0D 4FMFA 3W81A 4Z7NE 3NFNA 1QTYT 3HUJE 2NXZB 4YQXH 5B38G 2OXGA 4QT5A 3KHOA 3CFKA 4Y4KD 1YJDC 5ANMB 4DJMA 4Z8FL 1QSFD 1JP5A 3F7PC 4R4BA 4JO1L 2D4DA 4Z7NF 2VZ1A 1FDLL 3TN0D 2NY7H 2ZPKL 4ZNEE 5ALBH 3HZVB 4WY7L 3GJFB 1NMCC 4M6NL 4Z7UA 1YMMB 3RNKB 2PNDA 1RUPL 4PJ7B 1S7XB 4ZXBC 3N9GH 3U7YH 4PJIA 1J0ZA 5IJVB 2P8LA 1MRDH 1JFQH 1TPXB 2O61B 1OTUC 5A16B 3QUZB 3PWPA 2VLJB 1IKNC 2FJFB 1P4LB 3IETA 4M1GL 3RTQD 2BVOB 1HNFA 2FEDC 2KQMA 4S1QL 5B39G 4B41A 2L0DA 3UC0L 5L8LB 4B0MM 2H26A 3SDAB 3VH8A 1QFOA 4OD2A 3ARPA 3WDJA 1EO8L 2MPAH 4LMQI 3KG5A 4DKFH 4IRJC 5D7SL 3QDHA 2FBJL 4OT1L 5EUKB 3NCYS 3BP7A 3VCLB 3VXUA 5F8RC 1OWWA 1UFUA 1HQRB 4Z7WE 3DBXA 1HH6B 3FRPG 1JTOA 2D7MA 3JV0A 1KF9B 1DUYA 5JOFB 2V2WA 1UEMA 3HPLA 1G1CA 3HLAA 3JBG7 5E08H 1YZZA 1TQBB 3QDJE 3CFIC 2X4QB 3VRIB 5E08L 2K1MA 5DEFB 5EOCL 1UQSB 1ADQL 1GGBL 1DEDA 5C0BE 1OPGH 4Y4FB 3UTZA 5JZ7C 2D9CA 3SBWC 2YPKB 1MLBB 4J7RA 5D1XA 4P23D 3RL1B 4A6YB 2NPLX 3MJ9L 1KPRB 3WFZA 4X6FA 4P9HH 1GIGL 3V4VL 4BSWB 1HI6A 1CD0A 4MA1C 4HIEA 1G6RA 3PGCB 3KPRE 4RNRA 1IGJB 2CDEA 4LSPH 4J4PA 4JLRA 3OKKB 2CGRL 3GMQB 1A3QA 1U2HA 1QBLH 4U6TA 1JNNH 5CAYB 3RIFK 5JIIA 1T83C 3GMPB 1M1SA 2NXYD 2VH5H 4PV9A 1R3LA 3LEXB 3MO1B 3T0EE 4KTYA 2YBRA 3RA7L 5T3XD 4WUKL 1RZKC 2ZSWB 4HS8H 4UV7H 1OW0A 4YE4L 1SVCP 3TBTA 2W07A 5CS7A 2DM7A 4WFED 4NWTH 5JTWA 4WO4C 3K4DA 4XMPH 4WHDA 2HG5B 4ORGB 3JV6A 1MREL 2FD6L 2F58L 4QRTA 2I9TA 2VLME 4L9LA 3FO9B 1CLZL 1Z5LB 4Z0XA 2FB4H 3FFCA 5ALBL 1DDHB 2ZJSH 1CD8A 4JANA 3F5WA 3I3EA 1C16A 5HGHB 3SE4A 3R06A 4NUJB 1NLBH 2VDRH 5C08D 2DKMA 4LVNB 3VH8G 5C1MB 1K4DA 1HYSC 4HMCA 1OB1A 1B2WH 3B2VH 3SKOB 2NW3B 5JORA 4PJBA 1XF2A 5K9OB 1IM9A 1FL6B 1C5BH 5DTFA 1CFNA 1T1ZA 5FHBL 1A1MB 3BQUA 1JBJA 4PB9L 4XCYB 3RBGA 1VPOH 1I7RB 3P0VL 5IT2L 1FJ1A 2ARJQ 3ZL4L 5DJAB 2CLRA 3LKNA 1BVZA 1I1FA 3EJJX 4YXHL 5DUBA 1FZMA 5F7EH 5T3XL 5C08B 4JPIA 1Q72L 3PGFH 3QUXA 4N0CD 3GFUA 3PHQB 4LGPB 4H25A 2MTPA 4Z0BH 4EXPX 3S9DB 3CDYA 4JPVL 5I1EH 3AS3A 4ZUWA 3KYKL 3QPQD 2DBJA 2Y72A 1S5IL 3SCMD 1KELL 2EDDA 3BE1L 2QADD 5ALCH 2D0FA 1QKZL 4YPGB 3U0PA 4WW2F 1BVKB 3LVEA 2DOCA 2VXUH 3DX7A 3O6LH 4I0KA 3WFCH 2SEBB 2BVQB 5C6WH 1RZ8B 5IV2B 4KJQC 4XP6H 2FZ3B 1KUMA 3QIBA 2E9WA 2OR9H 3GSQA 1ULVA 2HLAA 2R9HD 4YHYB 32C2A 5DJCA 4EQ3A 1VB9A 2ZG2A 4HQQL 4I5BB 1NANI 1CXFA 1WT5A 2GCYA 2B2XH 3MNZB 3Q6FB 3RZCD 2VAAA 4JGUA 2R23A 4JKMA 5CINL 3V9FA 1HIMH 3VFMA 3LZFH 3BGFB 3MA7B 4ISVA 4XP9L 3T2OA 1K6QH 1ZE3C 1JMXA 3HE6C 1UWGL 5D72H 1G9EA 4EI6B 5IR1A 2DQDH 1KIPA 1M71B 1FNAA 3RHWK 2WWKO 2EH8H 4N8VG 1FNGB 3HI5H 2OL3H 4W4NA 2HT4D 1QSFB 5TJWK 4TTGA 3L7EB 5E4EB 1M7IA 1QVOA 4NIKB 3BDXA 4PJFB 5BRZE 1CF8H 1F97A 3KPPA 3IFPA 3MLZL 3T65B 5HHOB 4OQTH 2BNQD 4PJEE 3QDMB 2AI0H 4FXKB 2RFXB 2BSED 4X6DA 4P23B 2MKLC 4GG8A 2BZDA 4JFHD 2BERA 4JQIH 2EO1A 1E6OH 3ZYIA 4H26B 4WTWA 5F9JA 3BW9A 2HFTA 4WGWB 4HUMB 3T8XA 4H20H 1HXYA 5D7LD 5B8CA 4U1KA 4ZMAT 4JPIB 2X4UA 4LOUD 4KI5F 3NPZB 1FNSL 1MNUL 1P9MA 2AVGA 2J4WL 2CXGA 1G6VK 4O2CA 3S3SA 4U6YA 3SKJH 4WHCA 3U9UB 5CP3H 5D2LA 3U7WL 8CGTA 5JOPD 4OZIA 3L1OH 3KR3H 5L88H 5I19H 3SY0B 3ARDA 3AXLB 5IBTL 1Q9LB 5TFSH 2UUDK 4YUEL 2IH1B 2XT1B 3RGVA 4D8PB 4F7TA 1CFVL 2J8UF 1CTOA 5A3ID 1ZT1A 1CFNB 1IAKB 4U49A 5GS0H 4JY6B 5IF0A 1D5BA 3EYUH 4JO2H 4OI9A 1PG7H 4Y5VA 2VLRE 2YWYA 3NAAH 4KKCC 4MD0B 1UZ6E 4UNTA 3WNMA 4NO2B 5HHME 3SCMB 3RWGA 1AGDA 2EE9A 1DTUA 2IBGA 4FZ8L 5EBGA 4X9FA 7FABH 3H3BC 2OZ4H 1S9WB 5IB1B 3OX8B 4Y19D 3IFNL 3REVB 4M8VA 3NFPB 3C5ZB 4JG0L 5FOBB 1MCKA 3GIZL 5I30L 1UA6H 2R2CA 4WHYG 4EUPG 4Z0BL 4P2YA 1HHHB 3O81A 5B8CB 4HPOH 1J5OL 3FB8A 3WKMH 5C6TL 2VDPH 4JFXA 5IFJA 5GGVH 3U48A 1W0VA 2E9IA 5E70A 2Y5TA 4YQXL 4EIGB 4U1SB 5TPWL 3WN5B 2PW2A 1W0WA 4GG8B 4HJGB 1KTRL 5HGAB 2X2YA 2YRLA 1A3RH 4UILH 3TH4T 1VEOA 1A7PH 4YIQB 3CGTA 2VLRB 1GGUA 3C08L 2XXMB 2YPVH 4U1KB 4AL8H 3K2UL 2ADGA 3WJJA 3S7GA 2EEBA 5E1AB 4LMQE 5D7IF 2HWZL 1IQWL 3N9GL 4QHKJ 2BFVL 2AAVA 3BEWA 5EORH 1DP0A 1FL3B 3KYNB 3ARTA 5EU6A 4D94A 3O3EB 4F8TA 3GMLA 1QFWI 2QQLH 3EAKA 2HYMA 3NFSH 4NN7C 5C0BD 3GMRA 1PFCA 3ESUF 4U6VL 4W6XB 1ZLUH 4JM2F 1P69B 1YN7A 4RFEA 3Q5OA 3SE3C 3MTRA 3LKOB 4QRQB 5LGHL 2F58H 1J1OH 2H32B 4GG6E 3H7BA 2EDFA 2ZOLB 4X7TB 3MBXL 1FL5B 3HRPA 1OT1A 5E6IC 2M8XA 4OFDA 4WTZG 2P44B 5C2BL 1T1XB 1OWRM 2PO6D 1MPAH 3MJ8B 4UZGA 2X41A 4ZDHA 1VDGA 3MRHB 1JJUA 2IQ9L 2BNRE 3PP4H 4GW1B 3BUYB 2Q6WB 1F58H 2OP4H 1T89C 4XHQA 5KJRH 2ZCHH 4D0BB 4JPKL 1ZHKB 1E4XH 1QO3A 2NR6C 4K3HA 3TA3A 2P5EE 1UJTA 5C6PB 5IHBA 4APQD 2BJML 4OM1L 4U6XA 4CW1B 5DD6A 5KANG 2VN4A 3G5VB 2ARJA 1YMME 2EXWC 1FJ1B 1Q94B 2Y25A 4W70A 4C56D 5ADOH 3MRKA 1HXMB 3C8KB 4BZ1H 3C2SA 2HKFL 1ADQA 3UDWA 3VW3L 3QI9B 3V7AE 3QJHB 4OV6F 3O3DB 1MREH 1WLHA 1OP3H 4LRIA 2HA1A 1WBYB 3EFDH 3LN5B 5DUMH 1I8MA 1NBVL 1NEZA 4UIMA 1C8PA 1MPAL 4MJ6B 1HEZB 2X70B 4R8WH 4Y5XC 2X09A 1QYGH 4N0UE 5IBTH 2PYED 1H0DA 2YUVA 2BNQA 5T33H 2IPTL 2FEDD 2VLJD 4MMZC 3THML 5GJTH 3H9SB 3VD4A 3MPCA 3GSNB 1XGQB 3KPSE 3SKOA 2OLDA 4XPGH 4L8SC 4N0RA 1EXUB 1XCQA 4WU5B 1ACYL 4RAVB 1Q9KA 2PW1B 4I0PB 2R0KH 1KLUA 1MCRA 4OIBA 1CL7H 1N2RA 4YBHA 2VXQH 1HINL 2RGSA 3QG7H 2Y4SA 4WHTA 4Y19B 3RWFB 4EDXA 3EJYC 1UA6L 5FGCE 1RMFL 1V05A 1TJHH 1YEFL 1WZKA 4YHLL 2A6IB 3VWJD 3RI5K 1GZPB 5GSVA 4PRID 1S9YA 2EC9T 4YO0B 5F6IB 5HHOD 3VFPA 1BJ8A 4DOHE 5ICYB 1QQDA 5DQ9B 5L6YL 1NFIB 1I85C 4NYLA 2BDNL 4LHUD 2VLKE 4PV8B 2P45B 4ZO9A 4FQJH 4NM4H 3KAAA 5L8KB 1VHPA 2BNUB 4LSVH 4XPHL 2EKSA 3OR6B 1QR1A 4XXCA 1FO0H 4NHCL 3QO1B 5K9QI 2CDFB 3CLEL 3GZKA 1RSFA 4RMRA 4PLNC 3MJ9H 4ONHB 1MEXH 4GXUM 4ODWB 3ZDYE 5IG7A 5A2JH 4R96B 1FV1B 1IZKA 3KLAA 3PQYB 5JHDB 5CWSB 1PY9A 4OLXH 2DLFH 5E94B 5SX4H 1AKJB 1MCWW 5DRXA 1ZANL 3BQUD 5DRWA 3ZYZA 4LPUA 1JFQL 2BNUA 1HQ4B 1HQRA 3BWAB 3VWJC 2NX5A 3KYMB 4P5TC 4G8EB 4G6MH 3F7YB 3MRRA 4P0DA 4U1LB 1A7NH 4HKBA 4X4MA 5ESVA 4J6RH 3ZKQD 1K3IA 3VI4E 3BPLC 3KPNA 4Y4KC 1JYWA 3C60B 3VXMB 2G75B 2EYTA 5BV7B 3HPLB 1K6QL 4AK1A 1G9NH 5TDOA 3KXFE 4TRPH 2NY0C 2B5IB 1PYWA 1CU4H 5FKAA 5F7HA 4KMQA 3AMLA 4OZIF 4H20L 1B6UA 5SX4I 2ERJB 3G6DH 1FGNL 4WWID 5INCA 1FNGA 4WI9A 2OSLA 4JFYA 4ZUUA 4MS8C 4TUJB 5F96H 1BREA 2WW8A 1YYMH 2AK4B 3C6LD 4AY0A 4NQEE 1RVFH 3BSZL 1B88A 4G5ZL 5I8KL 4QXTB 4HEME 5J11C 1AE6L 2YEZA 3SDAA 3VH8B 3MRNA 1R6VA 3G6AA 1HHKA 1E4KC 4DUXA 4KV5F 4XNZC 5JDSB 1T2XA 2VAAB 4HWBL 3GSXA 1E4XI 2J8UE 1ROWA 3P4MB 5MENB 3BKMH 3TYGL 4PP8C 4KRPC 2A74A 2MWCA 5EC2A 4FQ1L 3Q1SH 1TTUA 2ADJA 2X4RA 5FO7A 4X4YA 5ITFA 3ILQD 4D9LL 3GSOA 1SBBA 4YXHH 4UNUA 5F97E 5D5MB 3B2UD 3MRPA 1N7ML 1JF5A 3VDCA 3W9DB 5F1NB 1X3DA 5KOVC 4U0QB 2EYSA 3P4MA 4H1LB 2CKBL 5BS0B 4X0KB 4YX2H 1KACB 1UB5B 1Q94A 3NN8B 1QRKA 3T0EC 4DZ8B 4GQ9L 1INEH 5CLTA 1HXMA 3BD3A 3QEQA 43CAA 1RD6A 3TN0B 1DQQB 5I1GL 3BN9C 1JNLH 4WJ5A 4HT1H 1LE9B 5EC1B 4PJ7E 2C1PB 3TH3T 3V6OE 3EO0B 4UT9L 5DHXB 4CVZB 1Z9SA 3TNNA 4JPWH 4TVPD 5KVDL 5HHQA 1U92A 3G5ZB 3MROB 2VAJA 4AEHL 2HT2D 4JPWL 4OTXL 5KVDH 3K4ZA 4F9PA 2P8PB 1IVLA 2YRZA 4JPKH 3VI3E 1A47A 4OCYL 1P7QA 5I1AA 4PY8I 4PRHE 4HUXA 4P5MA 4UUJB 3ZTJG 5EIIA 1BF8A 3Q2CA 2Z92A 4AQOA 4LBEA 4NWTL 4YAQB 3RWDB 4KHTH 2CKBH 2PN5A 3BP4B 2AGJL 5ERWA 1QEWB 4P5KB 4HIIB 3WKNA 1XCTA 3E3QE 4ZOEA 1YN7B 5MENE 4ZOAA 4PBVC 1KIRB 4F7CB 5GGVY 3LY6A 5TPWH 2I9TB 4XVUD 1AI1H 3G6AB 3O9WD 4G7YH 3EDDA 5AWNL 1AD9B 1X5LA 4HF5L 4I48B 1TTFA 2IFGA 3U0TA 3V0VB 2GFBB 3WV0A 1FAKT 1MJ7H 2MHAA 1OAQH 3DMMA 4O02L 4JFYB 4XVUC 4ZUUB