4MNGA

Structure of the dp10.7 tcr with cd1d-sulfatide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
273
structure length
273
Chain Sequence
RLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of V delta 1 T Cell Receptor in Complex with CD1d-Sulfatide Shows MHC-like Recognition of a Self-Lipid by Human gamma delta T Cells.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Beta-2-microglobulin
total genus 67
structure length 273
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mngA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4mngA01
1BWMA 4KVCH 4OCLC 4DN3L 1JNNH 3GMOA 4XPBH 2HTKD 5CD3B 3H6JA 4ODSL 2G2RA 4FZEL 4IOFD 1U8MA 4K8RC 4F58H 3TCLB 2BMKA 3EYFB 4KV5E 1F13A 3IYLW 3QXTA 5EBLA 1UG9A 1O5DT 4Y4FA 2Q87A 1LQSR 5ACZA 1BZ7A 3IDJA 4M6NL 2IGFH 4QRUB 2PW2A 5ACZB 1C12B 3MRRA 4YXLH 4RSVA 3C60C 1INQB 2X9YA 5SWZB 4HS6B 5I0ZA 2P24A 2NY0D 2H45A 4XNMA 3MV7A 4JPKH 3E3QC 5F7DA 2CUHA 2IAND 3G5XB 2Y6SC 3T04D 1OAYH 1E27B 1DP0A 2G2RB 4CNIA 4YHNB 4X83A 4WTWA 2GK2A 2XZQL 4X4XB 5D7SH 1EAJA 3MRLB 5BV7C 1RURH 4HHAB 4JPWL 4M1DL 1IAIM 5ANME 2YD6A 3MLUL 1MAKA 4L1HA 5BV7H 1N5AA 2C4FU 2QHRH 3I75A 1SYVA 2Y1VA 1HQ4B 4OLWH 3HZVB 4CL7A 2F5BL 5JHLL 3HE6A 3DJ9A 5CEXB 3OKLA 2HTKC 1DVFB 1G7JB 5BQ7A 3QNXA 3OGOE 4OLZL 5KSAC 3S7GA 1BOGA 1WBXB 5TE6H 4ZD3H 2QQLH 4KUCF 3O6KL 4GLRH 1G6RA 4MA1C 3DIFB 1JIBA 2DQUH 4U31A 5T1KB 2FX8L 3AY4A 4PJ9B 4K7PL 1XIWA 1G7LA 4MCZA 5TPWL 2PW1A 5EZLB 4WWKD 2CRYA 5BMFL 1BF8A 3UAJD 3QI9D 3T3PF 4MQXC 4JPVL 3T3ME 3GMQB 3FFCB 3T0EE 4M7LH 1JFMA 1RU9L 1A6TA 3LZFL 1FORL 1KFAL 2ZSWB 1ES0B 2B4CL 4FFVC 5GRWA 4NNYB 1VKXA 2DS4A 1J1OL 1Q1JL 4LSQL 1ZS8B 3V5DA 3CSYA 4L8SC 3IU4L 3CZJA 1Q0XL 2YUZA 1URLA 2BVQB 3QFJB 5DO2D 4R97C 3AS3A 4PV9A 4ETQB 4OCRL 3OV6A 2NTFB 3PF2A 3MJ9L 4YHZH 4H1LA 4XPFH 5T3XE 3SN6N 5D7IA 4XVSL 3STBA 4L4TD 3W11D 4LL9A 9CGTA 3MBEA 1L0QA 2XZCH 4LQ1A 5IMMB 3VD5A 1I1AA 1AJ7L 2IQAB 2W92A 1OCWL 4PRHB 1NFIB 3SO5A 3KPPA 3U4EA 1REIA 2XRAL 3BZFA 4DN4H 1D5IL 2WSKA 4P99A 4WUUD 3ZZ1A 4KJQD 2HJLA 1U3YA 2VLKB 3D85B 4N0CC 3ELAT 3W39B 1MCIA 3MBED 1WWAX 5LKNA 3P4NA 4Q6YA 1AGCA 2P7TB 1IQWL 2C3XA 3VFTA 5DQDH 3V0AC 3Q6GH 4PJHB 3NN8B 3HFML 1A7RL 2IMMA 4OFPA 3VXSA 1CLYH 3VI3E 3F7PC 5CD5C 5JORA 1WJ3A 5TJWK 1F4XH 1ZT1B 1H3VA 4NO3A 5KSBB 5DO2C 4ODXA 5A2FA 4LLYA 1GH7A 3DYPA 4MZ2A 4APQC 4JY6B 3RI5K 2YD9A 3BP6B 2ARJB 2VB5A 5MEOA 4RNRB 4Z77B 2EEAA 1GGBH 3DXAA 4I2XB 4MS8D 4UDTA 5FCUL 3SKNA 3O6MH 4Z78B 5IB5A 3S37L 1DLHB 1D5BA 5FKAA 3FFDA 5IGXH 4J3SA 3BYYA 1T04B 3X3GL 3MOAH 5IUSA 3KG5A 5J06A 4YHPA 3UAJC 2EZ0D 4YUEL 5JIPA 5D72L 1JYVA 1L8JA 5AYQA 1RULL 3HRZA 4JFYB 5KW9L 2XXCB 4FQCH 2ZWLT 5E7BA 3TO4A 4PJ7E 3VFMA 1YY9D 1NLBL 3HAEH 4S11A 3LV3A 4NKQB 3TM6A 4CN6A 5EO0B 2APFA 3MV8A 4K9EH 4NHCH 2FBJH 5IK3A 3G5VA 3I6KB 3SE9L 5DS8A 3W0WE 4KZEL 4PRDA 1F11A 1LO0L 5EORL 4HUUB 4BZ1H 3ESVF 2BNQB 1J1PH 2V5SA 4JFED 3TT1H 3CFKB 4FTVA 2VWEC 3KPQB 2NY2D 4JDZB 4GAGH 3FB7B 3WFHA 4P2RB 4RFNB 1KIPA 1OSPL 5DJ8A 4PD4J 3PL6C 3RWEB 4YHIB 4ZDHA 4F3FB 1TMCA 2OSLA 1S8DB 3GI9L 3NZHL 4LLVB 2JJTA 4N0UA 3AGVA 4BUHA 4JFDB 4Y16D 5FB8B 4MHHI 4MVBC 2FYYA 4DGVL 4O4YH 3WSQL 1KT2B 4QRPE 3C6SB 3HNVL 3K8MA 1DBJH 2Y5TA 1OL0A 1T0MB 2GY7B 2VLMD 1C5CH 2ERJC 3D87B 3CCHB 2WV3A 3U1SH 1CE6A 1H15B 3RFZC 3D39B 1EO8H 4KU1A 4RFOL 4OV6F 3SE4A 4XWGH 1SEBA 4GMSH 3GKWL 3UTZB 2J8OA 2C3VB 1L7IL 4NKOB 3DHMA 4PV8A 4F7EA 4KZDH 4G8EB 1OQXA 3PWNB 4PJEB 2KPNA 2ZP0T 1K2DA 1CFSA 2D03H 3L5IA 4YQXH 5FDYA 1SHMA 3QXDA 2R9HC 4MJ6B 1CZ8L 4KUCD 4HIEA 5E8EB 3X13B 1AIFB 4F80A 1KB5H 1AXTH 1X7QA 2LFGA 2EXWD 1VA9A 3KJ6H 3MRKB 4LLDA 1QYGL 1D5ZA 2P48B 4GW5A 2ITCB 4ELMB 3SKOB 3VRLE 3MRNA 4Z7VE 3G9VA 4U1GC 2BRRL 5FKPB 1A3RL 3WIFB 4B5EA 2RFXB 1WVZA 3HI5L 3CC5A 2LAAA 4G6FB 4LSVL 2FNBA 4AT6B 4NN6C 5I66A 4JQVC 4U1SA 1N7ML 3PWPE 1CICD 2R1WA 4G6FD 2M2DA 5IROA 1A4KB 1UJ3C 3BDXA 3UX9B 4MHHG 4NHCL 4DWHA 4QY8A 3QEQE 1ZVYA 4RISH 5GRUH 5GXBB 1FNLA 1UH2A 2JE8A 4PY8I 3NABH 1MFAL 3JVGA 5TF1H 3CXHK 3GSNA 2EDDA 3O3EB 3S36X 1ORQA 5IF0A 2WY3A 1A0QL 4I3SL 4LAQL 5EU5A 1FZOA 1XZ0B 3DRQB 3P73B 4FP8L 4JDVA 4YR6A 5KSUA 2VZ1A 3C09C 2EEBA 5FCUH 3UJJL 3IS0X 3CZFA 1OSPH 4GBXA 4X4ME 3V95A 1NBVH 1DJSA 4ZFOA 3DMMA 1F4YL 3G6DL 4MNQE 5TDNA 4G8GD 1SVCP 4LLWA 4U1NB 1WCBA 3QI9B 1TTGA 5M94B 2F8VA 5C09E 1U91A 2ERJB 3S9DB 3TO4D 2ESVD 4FQCL 3DYOA 3SE3A 2F58H 2OMBA 3GI8H 4MDIB 2OR8A 4FXKB 1JPGA 3QIUA 4WJ5B 1NSNH 3RDTB 2VIRA 3MRJB 5DUBB 3QDGD 1R5VB 2EDEA 4K9EL 1MFDL 1VESA 3CMGA 1QRNA 3K80A 2XOTA 4L4TE 5AEAA 2FD6H 1Q0YL 1NGQL 4OV5A 4HWZB 5DVKA 2R0KL 3K46A 3VFPB 4YGVA 4MJ4A 4Z7VF 4JFOB 4QHMB 1T1XA 4HDIB 1X5LA 5IW1B 2Z91A 3K8KA 1TQCB 2A2QT 1NCCH 2P1YA 2Y23A 3L7EB 2VDLH 1U91B 3SOBH 2MOVA 1UXSA 1TZIB 3VXME 1P2CB 1YN7A 1NC4A 2X1OA 2YUVA 4NJAL 5HPMB 1CVSC 4MJID 4Y2DB 1CG9B 5LXGL 4YHZL 2DMKA 4WO4A 1BFOA 3HI1A 3RL1A 3QDHA 5D1ZB 5JOPE 2R15A 4NQEB 3RU8H 2HN7A 1ZAGA 1J05B 2DDQH 5EU5B 4W4NA 5J11C 1OWRM 2Q20A 4PJ9D 4IRZH 4R4NC 2VDLL 3WXWH 5JOFB 3LB6C 4HEME 3O8XB 2QQQA 4L9LB 4MJ6A 1OPGH 3DO7A 4ODUA 4HKXA 1FE8H 1B4JL 4GKSB 3PWNA 4TNVF 2JTDA 4YBLB 4HH9A 4EDWL 2VE6B 2HRLA 3SDAD 4G9FD 1UKTA 3TBVA 4FQLL 2HJFB 1K5NB 4IOFC 4ZOEA 3DSFL 4JZNB 4FZ8H 2YBRA 4M5ZL 2VLRE 5D70H 3DO7B 4PFEA 1S7UB 2J1KA 4I0CC 2ICWJ 1CDBA 3VI4F 3BIBX 5HDBF 4XHJD 3TT3L 1F6LL 1DE4B 1I3VA 1PD6A 5L88L 2VERN 1TCRB 1W8OA 3C2AL 1UKSA 1T89C 1B6UA 4G59A 3GSWB 1HWHB 4WHTA 3EHBC 43CAA 5FYLD 4TUOB 1IEAA 3TYGH 2OLDA 5KVDH 1A7RH 3QIWA 4QRTB 4A6YL 1YEDB 3SDCD 1JK8B 1TZIA 1NJ9A 1S3KH 3NCYS 3OG4B 2WWKO 3TV3L 1NANI 2QL1A 4Z5RB 1EERB 3C5ZA 5I2IB 5EBMB 3PWLB 5JUEL 1BIIB 5A2IH 1HHKB 2XT1B 5D71L 2PO6A 5JQHC 4LSPH 3U36B 3C5JA 1KCGC 4DVBB 4XP9L 4I8DA 3E2HC 4ZNCD 4TVSa 3UPAA 1CIDA 4D9RD 3CVHH 3L95A 4PJBA 3CDYA 2B4CC 3F7YB 4JRXB 2G60H 3GJEB 4NJ9L 3WIFA 4PLJC 3PGDA 1YEHL 3HMXL 4M6OL 2X4UA 1GXEA 3CFDA 4IMKC 1HZHH 2VDRH 1XF3B 2V7NB 5C2UB 5FGCE 1YNLH 4EKXA 1C5DB 12E8L 3O9WA 1KT2A 2DQIL 2GTWB 5D1QC 5IJKC 2BCKB 2PYFA 3N0PB 1HXMB 3D3VA 1ZXQA 2P5ED 5D1ZC 4M7KH 3VFWA 1K8IB 3QUZA 1UJ3B 3U6RB 4JDVB 3O2DL 2JCCA 5FM8A 1X7QB 4GS7C 3W81A 1SEQH 3DX9B 2VC2L 3CU7A 3TH2T 2AXGB 4HWBH 2FATL 4ORGB 5E8OB 1C08B 5EOQL 3MOBL 2X44D 4YNYA 4LVOC 4OFYA 1BAFH 3VRIB 1KGCD 3SDYH 3CK0H 4C56D 4XH2B 4M3KB 4NKOA 4HPYH 3SEPA 4DZBA 4NP4H 2NZIA 3G5YA 4AEEA 4OLYL 3N1PC 4MLSA 1BJ1J 1LNUB 1MHEB 4JM2D 3C8HA 2W9DL 3B9KB 4OF3A 4NQDA 3W9DB 4PP8C 2QQNH 4WV1A 4ZXBB 1ND0A 2DKUA 5EIIB 4D3CH 2WAHA 5HYFA 3WLBA 4N0CD 2F15A 1CU4L 5I1IH 2JJSC 3H3KA 1OSZA 1OTTC 2CIKA 2X4NA 4HCRH 4WW2F 5I1CL 3IB4A 4XMPH 4CVZB 5I19H 3AXLB 3IJYB 2V2TB 1TMCB 4U6YB 1KBGL 5EZOL 1FZOB 4X9HA 3UROR 4WW2B 3KXFB 4XVUD 3VWKB 5HYSA 2W9DH 4HC1H 4PV9B 5HI5D 4E5XA 3KPQA 5HYJA 3K1KC 5E8NB 5EOTB 1YPZF 3VFOA 2GTZA 2MHAA 2WP3O 2J8UA 4PJEA 4WWKC 3TV3H 5DHVH 3G6JB 2BRRH 5MI0C 5JXEA 4FFWD 1IGJA 3TNMB 2NXYB 1CN4A 3OR6B 2EEDA 4OLUH 4Y2DC 2P8MA 3TFKA 1SBSH 1UB5A 5IM7B 1AE6H 3DMMC 5HHNA 5EUOA 1P7QB 4WO4D 2FJHB 3VFMB 1UACH 3MNVB 1BJ1H 4YHLH 3CUPB 5CP3H 5F6HI 3H9HB 2DKMA 5IVXF 5IP4A 5T1DL 1QBMH 3L3OA 3NCCB 1EVUA 4NCC1 5E8DH 3ULVF 1MCLA 4N0UB 2QSTA 2ADFH 3DX6A 4WI5A 3L9RA 1Y18B 3VXNB 5E1AA 4JN2B 1KXQE 4WUKH 3S4SA 4YAQA 4Z7QE 1ZA3A 2A9NL 2NY4D 4K3DL 1ED3B 5JIHA 4U3XA 4HBCL 4WFFE 1YQVL 1W2KT 5B38G 3P2TA 4Y5XC 5DR5L 4RFEA 3F7VA 1FNFA 4HHAA 5IJKA 3SCMC 1GGCL 1JHTB 1ZA6A 2P47B 5JOEA 3VFTB 1X4ZA 3RZCB 3CFEA 5EO9B 5I1DA 2X4RB 3LV3B 3B9KC 1X3DA 7FABL 5HGAB 1CTNA 3T09A 5JOPD 5B4MC 1MREL 4KTYA 1NL0H 3D39D 4ZYKB 4NP4L 2PW2B 2E7LA 3O2VL 4PJ8A 3E2HA 5J1SC 4I48A 4PJAF 4WW1A 2WIMA 4NWUL 2ESVE 3HZYA 2OJZL 2XNAB 1N64L 1R3IH 3QIWC 5KSBE 5F1OB 3VMPA 1QFHA 3UDWA 5FB8A 1EFQA 4NSKB 3EHBD 1WF5A 1S7XB 1XGPB 1DTUA 3MLYL 4OCYH 1K4DA 2ZNXA 3CLFL 4LSUL 3EFFA 3SGJA 1CGTA 4NJAH 1B0GB 5F7HA 5CILL 3OKLB 4YC2B 1KIPB 1FNGB 3HN3A 4M8QB 3CPLB 4TNVK 1G9EA 3MYZA 3KS0H 3I75B 4KKAD 4ZMAT 3FOLB 4ODXB 4S1RH 5DJXB 3VFSA 3ARED 3IU3B 1V3KA 5D2NA 5GS1C 4CMHB 2BVEA 4WI4A 4HMEA 3UBXB 3T4AB 1IEHA 1VFMA 3S36L 1CGVA 4WRLA 1B6DA 3HE7C 4AENA 4XI5D 4CVUA 1HINL 5A2JH 3KLSA 4OTXL 3BUYA 3C5SB 3OKNB 4UILH 5B38B 4Q6IA 5IBTH 3VXOA 3RI5F 1OGTB 3MRPA 1QFWI 1K8DB 3QUML 2QKIB 1VPOH 2AQ1A 3RWIA 1TJGH 3PIQA 4U1KA 1PX3A 1A9BB 1RUKH 1E4WH 1MHHB 4S0TD 1F8TL 1PSKH 1HKLH 3FB5B 5BJTB 1IBGL 2AKRA 1KCLA 2VDPH 3DUUB 5EBWA 1HCFX 3DVFA 1H3PH 2GFBB 4LSDA 3WL9B 2FEEL 4NM4L 2ORBL 5CS7A 2GSGA 3OKYA 4NUGH 3QPXH 4XP6L 1OTTD 3TWCH 3NPSC 1A6PA 4G8FA 1M4KA 5GS2D 3WIIL 2LU3A 4OCSL 5IFAL 4NC2B 5GIRB 3Q6FA 1ZGLA 3SKUD 1E4WL 1L4IA 1SMOA 2AV7B 3GSOB 1EFXA 3L3JB 5ICYB 1U58A 1JF1B 1RJLB 1NCDL 2XZQH 2KKQA 2B1HH 4QOKD 5T5FH 4GG6E 1YZZA 4S0UC 3MV7B 4LBEB 2GITB 3KR3H 2Q7NA 1G9ML 5CGYC 1INQA 1MEXH 3SJVB 3UTTD 4F9PA 1QLEL 1WFNA 1MLBA 1K85A 1KCRL 3IT8D 1FZKB 4OQTA 3SGKA 5CAYB 2XA8L 4ONHB 1AO7D 3LD8C 2DN7A 4NWUH 4C54A 3V4UH 1CXEA 1S7VA 4P46B 3KPNA 3N85L 5I1GL 3K7UA 1DVFA 3UTSD 5FYJD 2ZG3A 2FJGB 4FP8H 1EFXB 3L3JA 2MTPA 5ICYA 4OLVL 2WZPD 1YA5A 3B9AA 4G6AC 4UTAL 4PG9B 1EA9C 3GMNB 5GS2H 5I9QC 1QD0A 4LSUH 4JANA 2WWMC 2VSCA 3Q6FB 3P9LA 5GZOD 1MWAB 3KS0J 2EC8A 3VFNB 4DTGH 2MPAL 3CMOL 3IAPA 3MV8D 1S5HA 5IVNA 4IMKA 5DLML 4Y16B 1MHCA 1E27A 2IPTH 4NM8L 4HFWA 3K2MC 2F9BT 4M6AA 2A6KA 2R0WL 3BQUD 3GMQA 1MI5E 3OJMB 1P4IL 1U8HA 5DFVC 3SGEI 4PTTA 4TNWF 1CFTA 1FLRL 5JPNA 3PHSA 4IRSC 2W59A 1YN6A 4Z0BL 2AJYH 4KKCC 4J8RB 5BRZA 3WE6B 1ZT4B 1YNKH 3MRHB 5H35A 5KJRH 2NY0C 4R4BB 1UZ8B 4LBEA 4FQXA 1F3JA 1G7QA 4GG6F 2XFXB 3J7HA 3U4BL 3T3PE 4X6FA 2Q7YA 1CBVH 3WD5H 4S1QH 2EIZA 3GMMB 4UDUA 4PG2C 3JV6B 2LTQC 2X4OA 3AMLA 1SYVB 2HFEA 4P5KB 5C0FA 5E56A 5IT2H 2R9HD 4B0MM 3MRIA 1I3RB 3MV9A 1NKRA 4NQXB 3IFOA 3GNMH 2Q86B 4PJ7B 4QRRA 4R26L 3AVEA 1FNGA 1Q38A 4O2CA 3RVWC 4UNVA 1F42A 2DQCH 2K3TA 2YPLA 4L1DA 1T80A 3KLAA 2VLJB 2YPVL 3ISWA 5DJAA 4QHNA 3HPJB 3I02A 4Z9KB 2G75A 2HTLD 3KPMB 1VADB 2DTML 2CLRB 1CDHA 4X9FA 4G43B 4M1CD 5JPNB 3KPSD 5FDWA 4JAMB 4O2FB 2AJVL 2WBJB 1VFBB 3IDIA 2OR9H 3WFBL 4XCNA 4ZNEA 3PGCB 5C86A 4QYOA 4KHTL 3X3GH 4HLZH 5JXAL 3E6HA 1JGEA 5DQ9A 5D7LB 4PS4L 5A2KH 3HNTL 2H8PB 1N3NA 1DQQA 1GIGH 5BVPH 2K7PA 2I27N 4OZHE 1GOFA 2CH8A 5FV2A 4O9HL 2AK4E 5TQ2L 3WDIA 3BEVA 4R4ND 2VDML 3H9YA 5I17B 2EDYA 3QUYD 4KHXL 4NYLA 2H32B 3PNWB 5JPMB 5DMJB 1CK0L 1FL6B 5DI8A 2XWBB 3TVMB 4QLRA 5BO1H 4PJGA 3AU1B 3C08H 3FO0L 3LCYA 5CJ8A 3G5ZA 2OX5A 4E41B 3U0PA 1U8IA 1NAMH 1ZHLA 5CBEB 4G6AD 2IPTL 4NM8H 2X89A 1A9BA 2DQDL 5KVMC 3X3FL 3MRCA 1G6RH 3TIDA 1TCMA 4M02A 4N9GB 3ZTNH 5E1HB 1MVUA 4Z95L 1S9YB 3RZCA 5EZJB 4MJIE 4Y2OA 3BPNB 5SX4H 1RZIA 2NPLX 4U1HB 3LRSA 3NTCH 2AI0H 1HEZA 1PG7X 2D7NA 3FQTB 3LRGA 5JLZA 4Q58C 1RZKL 1DQMH 3V79C 1HHIB 1F2XK 5L2JB 2ICES 3DURB 4XGZA 3BJLA 1HNGA 4M7KL 2V5RA 4MB4A 1J8HA 3V7AE 3NGBB 5K9JH 5DEGB 3V4VL 1RZ7H 3L3GB 4OIIL 5I73C 4JN2A 3W11C 4DGYH 1DEDA 1PY9A 3ZKXC 4G7YH 2NR6D 5KANG 3SGKC 4XPGH 4XC1L 4RMRA 1WTGT 1ZWIB 3LQMA 4ZPTA 5ICXB 4JFDD 4X6EA 4Z0XA 3D9AH 1PLGH 4UT9L 1F6FB 3OKKB 5K9OA 5J8OA 2V7HA 2C26A 3ZL4H 4AZ8A 4PJ8B 3QJFB 1FAIL 1OGAD 2BJMH 3T1FB 3H7LA 5ID1A 3N9GL 3MMEA 4U6VH 2X1WL 1K8DA 4XTRD 2JJUA 1DBMH 4OFVA 3SPVA 5F70A 2PYED 3TBTB 4XRCA 5DVNA 5F1SA 1CGWA 1RUKL 3RTQC 4DGYL 1NAKL 4NQCD 1V3JA 1OD7A 3RUGE 4TSBH 1YEKH 3G6JA 5D2NB 5F7EL 5C0IB 3PXHA 1BGXH 1PLGL 4UT9H 3MJ9A 4LHQB 2CMRH 1F3RB 1A7QL 5IESL 3BW9A 4AEFA 3QDGE 5MEQB 1MCOL 4P5TC 4X8XA 5I8CA 1IAOA 3ET9F 1G7IB 4ZTOL 1QO3A 4PUBL 4U6YA 4KK6C 3CFJA 1JPSH 1UQSA 2J4WL 1QR1B 3GJFH 4G8IA 2H1PH 4MAYD 1OWWA 2B20A 5L88H 3WYRA 4J6RH 4QWWD 1NCDH 2EXWC 4YH6A 1KTDB 3CDCA 4OI7A 2X4UB 3QH3A 4ZYKA 2W0FB 4DW2H 3KYKH 4I77L 2MMXA 2Y7QB 3GSRB 4JFFB 5HBBA 1T7YA 2R69L 1PAMA 1T66D 4Q74A 4DQOL 3GGWB 2HT4D 1HYSD 1E4XL 2V9RA 1P5VA 3PP3K 5IV2B 5JDSB 5CEZH 4GSDH 4Y5VA 2EO1A 1QLRA 4MAYA 5INCB 3VXRB 4ZFGH 3V9FA 2OK0L 2W65A 4NQEE 3NTCL 1FJ1A 3NGBC 4P59H 2Z31A 4PP2A 3LVEA 1KENH 4ONFL 4JY4A 1YEDA 4A6YB 4KAQH 3GJFB 5EWIH 1JBJA 1R3JB 5JW3H 2XN9A 1X6LA 1Z9MA 1IEAB 2KZWA 2PTUA 2IJ0C 5J9PA 4XBPB 1HCVA 3KPLB 4U1IA 4XBEH 3GSWA 5KN5A 1U92B 3HG1E 4JGMA 4D9QE 2I9LA 3H9ZA 4KDTA 5EFIA 4KQ3H 3CUPA 2D7TL 2GI7A 5CJXA 4JLRB 4M6ML 3OTTA 1IFHH 1WSST 2EIDA 2HJKB 3DVNA 1UM4L 4JKLA 4KJPC 3FO1B 2CJUH 3FN9A 1ZGLM 4NQCA 1RUPH 4NKDA 1FBIH 4OBSA 4DZBB 1EEQA 3FRPG 4OD3L 4N5UA 3TNMA 1A2YA 3OKDA 1MJJB 1T1ZA 5F96H 1IKNA 3BKMH 5EOTA 3VRIA 5HHQA 3PWJA 5GZOC 2HMIC 3BE1L 4ODVH 5DD6A 1EXUA 3TGXA 2Y06H 2AEQL 3DTXB 2AJYL 4LGRB 2XY2A 1HILB 2DQFB 3QIWB 4MA7L 3ALPA 3FFCD 3WKML 1F45A 2YD2A 1T1WA 1HXMA 2P4AB 4OD3H 4U6XA 1PJ9A 1OSZB 2X4NB 1KTKE 2X4PA 3MACH 3OXSA 4GG6B 1ITBB 4OUUA 1ND0B 3I3EA 5A3IC 3I2CH 4NC0B 1NC2D 3QSKB 3QBTB 4NRXB 2NYYC 1S7TA 5C92A 3DNKA 5HYQA 1JYXA 4GW4B 3C2AH 4WGVB 3WLWD 4XXCC 4IOIA 3JTTA 5IB2B 5SWSD 2BY0A 4GAYB 5ENWB 1KJ2L 2FO1A 3O6ML 1M7DB 5FHAL 2PO6B 3NFPB 4NWTL 5L2KD 2DLFH 4UIMA 2F54D 4M61B 5T33H 1BLNA 4LSSH 1JWUA 5BZDA 1VGEL 1RJYA 3HG1A 4D0DB 4ENED 2VDPL 1WEJL 2LE9A 1DBBH 4YDLC 5ELIA 2X70A 5DC4B 5DJCA 4OUOA 1NJ9B 1U41A 4WHYH 3WS6C 1DDHB 3OB8A 2P5WD 1OGAA 2Y5EA 5GGQH 5C0BA 3ZDZF 4RGMB 4CVXA 5C6TH 1BEYL 1L6ZA 1N0LA 1MH5A 35C8H 4TOYL 1QFUL 3TYFB 1KENL 4LCUA 4M1GL 7CGTA 4Q9RL 4FFZL 4NWTH 2BX5A 3HS0B 5E00A 1ZHNA 1OP3K 4KFZC 3DRQA 3E3QE 3P73A 1XF5B 4ZSOE 1QBML 4XCYB 1RD6A 2ZCLH 2ZJSL 3GO1H 3WXVL 3GJEA 4P9ML 3RL2A 4YEEA 2YZ8A 3QUXA 3WLWC 3MLTB 4XMKL 3E6FB 1RIHH 5BZDB 1HQRB 1VFAB 1EJOL 2A73B 3MJGX 5C6WH 1OQOA 4OV5B 2VR9A 1AC6A 5F97E 2V9TA 3C5JB 4LCWB 2VE6A 4Y4HA 5E2VH 3HZMB 3TZVD 3HZKA 5KSAD 3JVGC 4ODSH 3AREC 4OLEA 4J12A 3F62A 3LHPH 1DQDH 1X5JA 4Z5RA 3V4UL 1EMTH 3I6LE 3T77B 3FRUA 4LIQH 5LCVL 1CT8B 1CIUA 4AK1A 5D1ZA 4JQVA 4PR5B 2ZUTA 2F5AH 3B3IB 3QQ9C 2I9TA 1KTRL 3EYQD 1CG9A 4OD2A 1I7RA 3L5WB 1U2CA 3QEHB 3U9PL 5E2WH 1FYTD 1D5ZB 2HKHH 3L3KB 4OT1L 2H6PA 5K59E 2KQMA 5JZ7C 3REWB 5IIEA 3IDNB 5L2KE 1ZVSA 3GRWH 3V6FB 4HZLA 2CIIB 1HHGA 2EXYC 5F88A 4ZUVA 2Z91B 8CGTA 5GRYA 3DUSA 2FIKA 2YPKA 4WHYG 4KJYA 3NFPA 4NN5B 1S7WB 3LEXA 2AJXH 1CDYA 3C6LB 4R4FH 1OAZH 1T4KB 4EI6B 1AGEA 1EAPB 4OLXH 5E08L 4AEHL 4NZRL 1GGIL 1YNTB 4HG4J 1ZV5A 1KACB 3VG9B 1YQ2A 4BQ6A 3ARDC 3O8XA 4L9LA 3GDBA 3SE8H 5I18H 1FIGL 2HLAB 1SJHB 4XVTL 2RFXA 3BE1H 1ADQL 1EJ6A 4OTXH 5GJTH 2DWDA 2FB4H 1FL3A 5BZWA 5EFIB 5IVZA 1UENA 5TFSL 4H1LG 4HEPG 2YSSA 4NO0A 4MA7H 4XBPA 1VPOL 1LP9E 1MUJA 4K94L 4HJ0D 4GLRI 3IJHB 4JFFE 5CJ5A 1RZ8A 2VR5A 2XN9B 5I30L 3B3IA 1WLHA 2J8HA 1HI6B 4JPVH 2MFNA 3MA7B 4YR6B 1T2JA 1P4BH 4PDCE 3QIBB 3WHE1 4TSBL 3NIGF 4CDHA 4TOYH 3SKJL 4MAYC 2IC2A 3HNSL 1TVHA 3M17B 4XPBL 3SDDD 3QEQA 1RIVL 3WFHB 3HPLB 4C59B 2W07A 5D2LE 2FB4L 4FFYL 4AG4H 5BOZG 1MCOH 1C7SA 4APQD 3EFDH 5T1LA 4DW2L 3VXUB 4TNWK 3P40A 3JTSA 4HXBL 4Z7UB 2CXKA 3NAAH 4PRHD 4CU8A 3MV8B 3RDTA 1BVKB 1MCDA 4JJ5B 3CX2A 2XZCL 5E2VL 4JLRA 1IC7L 3INUH 4MMZC 3QUXC 4PBXA 5MENA 5DWUH 2I9LB 4K94C 3EJYD 1JWMA 5TDOB 1NAMB 1LILA 4G9FB 1T5WA 4KGLA 2GJ6D 2IPUK 1PZUB 1RIUL 2FX7L 2WBWB 4NBZB 3HUJA 4MXQA 3OHXB 4RMQA 3CFJB 1IKNC 2QHRL 4JVWA 3ARGB 3U9PH 5GGTA 2R0KH 4WO4C 3NMEA 4GUPA 2APVA 5GGVY 4J23A 1S9KC 3A6BH 4G3YH 3FO0H 4JDZA 2RBLA 5CJOL 2O5ZL 3BSZL 4NZTH 5JNYA 1J12A 4P23C 4HUUA 2NLJA 4MJIB 2VMFA 4E41E 5LQBL 3FFCE 4JQIL 4UTAH 5DHXB 3UTZA 4FFWC 4KI5C 2XWJA 1RK0A 3C60A 4JPIA 4MNQB 5I66B 2CDEA 4WY7L 1CQKA 2E7LC 2N1KA 3GGWA 3GZKA 3TLRA 1QSFD 2ATKA 2VXUL 3UTSA 4CN1A 5FUZL 4JO4L 3IDYB 4XAWH 4A2MA 2YN5A 5BVJB 1R5IA 1JPFB 1YNKL 2VLKA 3EOBA 4UAOB 1QKZH 5FIEA 5BS0E 1ZMYA 2CR3A 5FYLE 4LSTH 4OCMC 3HTLX 4ELMA 1KLGA 5D7LE 5ISZA 3DVIA 5ESQA 4JRXE 5C07E 2BSTA 4OLWL 4YXHL 2OZ4H 1AO7E 5GGSB 3WFDL 5K33A 2J3SA 5I1AB 3O3BB 1CDCA 3CIQA 1XEDA 3RWEA 3RQ3A 3RNKA 3BP6A 3I50L 2XN9E 1TJGL 4BSVB 1ORSA 5KZCD 2VO5A 5C7XL 4XP1H 2EO9A 4HQQH 4TVPH 5D70L 3P9WB 2I26N 4NNXB 3H3BC 3VFRB 3QXDB 15C8H 1MJ7H 1L9NA 3F58L 1CBVL 5D7IF 2EDKA 2VAJA 5HY9A 3BOVA 3S34H 4I9WD 5SWQB 5M95B 1T2QL 4LHJB 1CYGA 1TLKA 2LV4A 3BXNB 2I60H 5IT2L 3QPXL 4ZOBA 4U6VL 3ZKXB 4YBQD 3BDYL 5EZJA 4I0PA 4R3SA 2BFVL 2P46B 4XB7A 5C0CB 1YYML 1CS6A 5EZIL 1QSFA 1X5KA 3MGOB 5D2LB 3TBWB 1UYWH 1DBAL 1ACZA 4X98A 5B39G 5CMAA 3KPPB 3S34L 3QDJA 4WU5A 5JO5A 4QOKE 2D3VA 5HD8D 4BSWB 3BGFC 1FZMA 1JZ6A 4LLVA 2NX5A 4OF0A 3L7FA 2GJ6A 3IFLH 4JY4B 2XWTB 3UO1H 3BIAX 4LARH 35C8L 3RWHA 5KVEH 2R56L 3DROA 1U8NA 1A7OL 2W9EL 4TVPD 5H94B 2CK0H 5HVWA 1JHKH 1UM5H 3I9GL 4NRYB 5ITBL 1RIVH 2J6EL 1ADQA 4KJWC 4JCMA 4MAYB 5BV7B 1NBZA 4P5TB 2AJ3A 5CZXC 1D5IH 1QSEA 3LS5H 4PRDB 4M48H 3Q3GB 1YNLL 1AXTL 3B2UD 2AABL 5FYJE 1JGLH 1VKXB 1BQHB 4XMKH 1BEYH 3PQYE 1JZ8A 3D3VE 5JHDD 1J0KA 1ACYH 2P24B 3NCBB 1Q94A 2DF3A 4V1DE 3W39A 4JB9L 2A1WH 1MRFH 5EZLA 2CDGB 2E8YA 4PY8J 3T0XA 1TTUA 2BZDA 5B39A 3Q1SL 1BFVH 4IMLA 4U2YA 3TFKD 3GIVA 4YO0A 3DBXB 1C5BL 5T3ZE 2VLJA 4KK9D 1BAFL 1G9MC 2DQDH 1EHXA 2IEPA 4LSTL 2EDQA 4QTIH 5I8EA 1BOGB 2YPLB 1KEGL 3AM8C 2FR4A 2CDFB 1IAKA 1J8HE 1DQML 4M7ZC 3PNWA 3IXAA 3UTTE 2O5YH 3HE6B 5D7JA 5F7FA 2GCYA 4KUZH 1H9VA 4P9HL 4QRRB 1XGRB 1JWSA 4KDWA 2R2CA 2VXQH 1AD0B 4P3CL 2O26U 3MOAL 1I3RA 4PGCA 4PJFE 5K9JL 3I6LD 5CZKA 1HH6A 3NZHH 1II4E 2OJEB 2HWZH 3JV6A 3V5DB 3O8XD 1T66C 3STLA 5KANI 4XC1H 4D9LL 1LE5A 3NN8A 4GQ9H 4WI9A 1JNLL 2ZSWA 1GZQA 5F7DB 5E9DB 5JIKA 3B9EA 4POUB 3KPTA 1GPOH 5FYKD 3WCYA 1MCCA 4FQXD 1FNAA 1AD9B 5E6IB 5D1XC 1CDGA 1PKQB 5BXFB 1J0IA 4LRNL 4HW6A 2FZ3B 4X9IA 3TPUA 1CR9L 1JGVL 5CINH 4HIIA 3OKKA 1CGYA 3OF6D 4ODTH 3W0WA 3KNBB 1EGJH 2HLFC 3WNKA 3B6SA 2J2ZA 1IC4L 1QFWH 4RDQF 3L5JA 2CUIA 4GAGL 1P84K 3G5ZB 3S5LB 3U0PB 3SDAB 5TE4H 3MLWH 4G42B 4DCQB 1XIWD 2AJXL 4B7LA 3MNZA 1FAIH 2BJML 3ARFD 5DI8B 3EOTH 4Q9QL 4HFUH 3AROA 1N6VA 5DRZA 3BP4A 3RGVD 2E27H 3D3VD 3F65A 3LN5A 5GGRA 1I1FB 1KCVL 5CD5D 5BMFH 5HHME 3D69A 3VCLA 1MSPA 4RGNC 4PUBH 1U3HB 4UUJB 1P5UA 1JPSL 1ZLWK 1ZLUK 3REVB 1NBYA 1HOCA 4PRPA 5JHDE 1A6ZB 2W9EH 3W82A 1NGYA 5H37G 3E6HB 5JW4Q 2EDNA 3GBMH 4PJCA 3KPNB 1A7QH 1L0YA 5C08A 3EOAB 5DDHA 1A1OB 2CRIA 5I1HH 3A67H 5J3HC 1A6AA 2ZUVA 3BQUB 5FDWB 2ORBH 3D2UD 2W91A 3MLSL 4PRPD 5BRZB 2IANA 5EBGA 3MV7D 4MWFB 4NFBA 4QHKI 2FJFB 2E9JA 4ELKB 1QTYT 1A6AB 3IDGA 4PJAA 4K7PX 5DEZA 1PG7L 4X7EC 4YZFF 1IAII 1D6VL 1XAUA 2ICWI 3Q1SH 1IARB 2W9LA 4EBQL 3QUYA 3UDWC 3VD7A 4JJHA 4R9HA 4EJ1C 5DK0A 2BSSA 4P59L 3C5ZD 5C0BD 3WO4B 1A0QH 5E2TL 4KDVA 5IW6A 4L3ED 4PJ8C 3SQBA 3SGDI 3KPSE 4PJHF 3P4OB 3TH3T 1K3ZA 3F7QA 4P46C 1FSKC 4WV1C 4G8FB 1XGUA 1Z3GL 2VNCA 3HLAA 3KVQA 3KLHC 2E6PA 4HWBA 3HAEA 1CFBA 2CO7B 1R0AL 4P2OA 1HDMB 1ACYL 2BSRB 2CLVA 3PL6B 1E4JA 4UTBL 3QFJD 4OBRA 1T7ZA 1FC1A 4D0BB 4IDJL 4U0QB 4RGOH 1K9TA 3RVUC 1JV5B 1M71B 1QBBA 2ID5A 4P2RE 3LPWA 4E0RA 4LRNH 1OGTA 4U0RB 3M1BB 1Z3GH 3MFFB 1D9KB 2EE3A 4FQJL 4Z7QF 5E9DA 2IH3A 2APWA 2G5BB 1JZ5A 4BK5A 5HI3D 1S9VB 1IC4H 4JFDE 1KXTB 3BPCA 5DXWA 2UZXB 3T0WA 2VLJD 2HYMA 3WO3B 2R0WH 4WDIA 1JF6A 4EOWL 1A5FL 3AREB 5FUCC 3OWEA 4NNPH 5DGRA 3P9LB 5FCSH 5HPOA 3B83A 3AREA 2F5BH 5CZXD 4NT6B 1JMZA 5J1TC 2Y9RT 2VXTL 3QCUH 5D7JB 4PTUA 3BH8A 4RBPK 4OAWA 2YMXH 1HKLL 5FO9B 1K4DB 1T7WA 3T2NH 4P2YA 1GSMA 3IDXL 2PXYA 4LASL 3HE7B 3NIDE 4M8VA 4MNGB 1MCKA 1QSED 1RZFH 4PRNB 4P3DA 4TRPL 4P57A 3DV6B 5IB1A 2ZUYA 5C2BL 4K3GA 4YPGB 4Z6AT 3BQUA 2Q8AL 4JKPL 4HS3B 1QSVA 2A6KB 4X80H 1UYWL 1JP5A 4XVSH 5DF0A 5JZ7D 1P7KB 4QCIB 1KB9J 5MERA 2WQRA 4M7JL 1P69B 2EDTA 4PJDB 1CTOA 1IGYA 3MR9A 3SDAC 4GRLD 1E0OB 1I1CA 5GS0D 3UBXA 4ODWA 4YE4L 5F6HJ 3BDYH 4LVHB 3WUWG 1OY3B 3S3JA 3F12A 4NRYA 1V3MA 5AZ2L 4W68A 1H3GA 4LHUB 4QHUA 4XWGL 4CKVX 1BBDL 1A64A 5GGUA 1KG0B 4LFHG 3GKWH 4X7SH 5EC1B 2PYEE 3MRFA 1A7OH 3ULSA 3CLEH 1IAKB 1WWCA 4KVCL 3PJSB 4KPHH 2HT3D 3QEGL 4NN7C 1INEL 2QQNL 1CXIA 4X5WA 4JHWL 3RVUD 1G0YR 2YRPA 3T4YB 4LLMA 1MJ8L 4QKXB 3UTOA 1JFQL 3FT2A 1UH4A 4YO0B 1NGWA 2OK0H 1NFDA 3FRPA 1WC7B 1D6EA 2QR0A 3NIFE 4I48B 4WW1B 5AZ2H 4RMWA 2IANB 2R56H 4F7TB 4PRID 1AO7B 3BKCL 2F8OA 1GCFA 3TIEA 5J4MA 5C0CA 4C55A 5HHNB 4AIZB 3CFCH 2CKBA 3VJ6B 5CIPB 5ALCH 5F72S 4UMGA 4ZO9A 2ZKHH 2DBLH 3S37H 5DK3A 2YXMA 4HV8B 5D7KE 2XYCA 4OI8A 5IHZB 1IC7H 3KAAA 3BI9X 1KELH 3BKYH 3IS1X 2IG2L 1E6JL 5GSVA 3QO0B 3MBEC 2FECL 3R4DA 4ZO6A 3NCJH 2R1YB 3ZKND 4GAFB 1SYSA 1ZHKA 1OT1A 3FONA 4JZOB 1JRHI 1G9NC 2APXA 2UZIL 3P77B 3RX7A 2FX7H 2CJUL 1H3UA 4M8QA 4YFEA 3MXVH 1MELA 1S78C 5ESAA 1OP3H 3QQ3A 1F97A 3QG7H 4DCQA 3AXLA 5T3XH 1YMHA 1IVLA 4M7LT 1NPUA 5JUEH 4JZJB 5D72H 2IALA 1KN4L 2PO6C 4JRYB 4N0YL 5DMKA 5DC9B 4AJ0A 2Q76A 2V2XB 1F4AA 3WO4C 5CZVL 4PYHA 5DZOA 4P2OD 4G6KH 3ARGC 2ITDB 3CK0L 4S1SH 5GPRA 1GZPB 3MGTA 2NYYD 1FC2D 1MHEA 3MRPB 4O02L 3ARXA 2QQKL 5AAMA 5FUZH 3MRQA 3GBNH 2JB6A 4M43H 4R26H 4HJGA 1R6VA 1GC1H 2VLRA 3HR5A 3MROA 1U95A 3NZ8B 4XX1E 5EIQA 4JKPH 4IM8A 3RVVD 5I0DA 3NIFF 2RR3A 1T3FA 1MCWW 1CFNB 5HYJB 3TNNA 4HFUL 2EIBA 1FFNB 4Z7UE 3D25B 2AEIT 4NZRH 2GCYB 3LOWA 2VZTA 5I19L 1FGNH 1RK1B 2XPGB 4R96A 3S4SB 2IFGA 4R90H 4KK8D 5A1AA 3CNKA 3MCKB 1K8IA 2XG5A 4X6CE 4MA1B 2ZOKA 2IADB 4JFEA 5CP7B 2VSDA 4FXLA 1PEZA 4MXWL 4LNRA 3QI9C 1QRKA 3GM0A 4WEMB 5ISZB 5D1XD 3JWDH 4LFHD 3P9MA 1C5DA 2E27L 2XNAA 1IQDA 4I3RL 1CXKA 2OL3H 4DKFL 4GJTB 3WUZA 2CDGA 3VWJC 3BD3A 1EK3A 1WZ1H 4WFFD 2PF6A 2VXVH 1GIGL 5BVPL 1CFQB 3CFEB 1CGXA 4R3SB 5EO9A 5I1DB 3RAJL 3NOIA 2Y6SD 3QPQD 3W2DL 1T6VN 1I9RH 2PR4H 4Y4KA 2H26B 2ZOLB 4LF3B 2DWEB 2DDQL 2IWGA 4CBPA 2A6IB 3FZUD 4QHLB 1KIQB 1FDLL 5C3LD 1BM3H 5B3NA 2NY6D 4Y89A 4NNXA 3VFRA 4UILL 2AXGA 5FK9A 5D1QB 2GIYA 4BSVA 1EUTA 4KK9C 2CPCA 3VD3A 4P2QD 5IHUL 1T89A 1ZE3C 5GGSA 1S7SB 3W0WD 3IJYA 3HUJB 4GXUM 3MUGA 3W2DH 4LLAA 4NRZB 1RZ8B 4DQOH 4K7FA 4RGMC 3MXVL 1WZLA 4X4YB 5I76A 1UA6H 3ULUL 2IF7A 3QXAA 2HT4C 4D94A 5EIIA 5L2KB 1XF3A 2EKSA 1GHFL 4OZIA 2IFFL 3WFZA 1A7NH 2DYPB 1AGFA 3OB0H 5JQ6H 5EUOB 1CLCA 1N2RA 3HMWH 5DJ6A 5HGDB 1XGYH 4NKIL 3TYGL 4S1SL 4EN3B 2FGZA 5DD5L 4YEFA 4JB9H 3AFLA 3VXMD 1CFVL 4KAQL 3RWGA 4DVBA 2DQGH 3L3DB 4ZQKA 3FCTA 1JPST 4OKVB 1PYWB 3RP1A 3VXUD 4KK8C 1DQJA 3NCJL 2VLME 4XT1C 5I1EL 4ZD3L 4N0FB 3JBG7 2Q3AA 3WHXB 5E94A 1YY9C 3DX9A 1TVHB 4NQVA 2NY5H 3GUTA 2D31B 2CIIA 3QCTL 4HZLB 3ZLQC 4F7PA 1T21B 4OZ4A 4OB5L 5DSCB 3TO2A 1ZKAA 2PYFB 2HVJB 5T3XL 1YY8B 5ESQB 5IFJA 3QP3A 4EUPG 2NY7L 1NGQH 3ULVD 4KRPC 2FHFA 2F74B 2XTJD 4NJ9H 4U2ZA 2HWZL 4UI2A 4BA8A 1NC4B 2OTWB 5F6IC 3T0ED 2B4CH 2QV2A 4G6KL 1AFVL 5BVJA 4TPRL 3KPRA 1FFPA 2UVEA 2D9QB 1LD9B 3V7AG 5LVEA 2PETA 4PGBB 4OCXL 1KPRB 2AGJH 3WJLC 4WW2C 4OB5H 4K94H 1TENA 1MNUH 4HWZA 5I15H 2FH6A 4ODHL 2NR6C 2BHUA 5DJYB 1AQKL 5EUOE 5TH2B 4H25A 2ZCKH 4JRYD 2Z92A 1HHKA 4KJYB 2FGWH 2R23B 4R7DB 3VXSD 2OXHA 1I7ZB 3E6FA 1JPGB 3RU8L 3HPLA 1OTSD 1CICC 4HWEH 5F88B 1QA9B 1BECA 3RKDC 2K7QA 3SKMA 4KI5D 1U8OB 4PJIF 5KSVA 5AZEH 1EO8L 5DJDA 2P5EA 2PUQT 3HS0A 3OHXA 5F89A 4JEGB 2AGJL 3EJYC 1YY8A 2AVGA 3PQYD 3RBGA 5IFJB 4UNUA 4OD2B 3C8DA 4Y5VC 3ZYJA 3O9WB 3WV0A 2AXHA 4V1DD 2P5EB 3MGAA 2J6EH 4ZS7H 4FZEH 3FHQA 5KVFH 4E9LA 1LDPH 3TN0C 2B1AH 4QXGH 1WFUA 5I1CH 3ARQA 3L3IA 3K2UH 2HVKA 3ARFC 2ESVB 4I5BB 4OKDA 1YNTA 1WFTA 4GG8B 5EU4A 3VFGH 5IOPB 3A6CH 3HMWL 4Y4FD 4NBXB 4Y19A 4GW1A 3QA3A 1IGML 5ITBH 3O6FA 5DD0H 3X12A 1WTLA 1BIIA 3HFMH 3RY4A 2EYRA 3SDXB 3QCVL 5EO1B 3EO9H 4CADA 3K3QA 1MFAH 4IS6B 2F53B 4XCEB 2NCMA 1WCBB 3QI9A 1UXWB 2R29L 5MP6H 3P11H 4N68A 4FQHA 4KC3B 4HLJA 2GSIA 3HC0B 2VLRD 2BOBB 3PP3H 2DM4A 1WZMA 4WFED 4TUKH 5B3JE 4NQCE 4KTEH 3RNQA 4JO4H 4LLUA 1D3CA 2AK4B 2Z8VC 3GHBH 2FO4A 3NBNA 2G5RA 4QRPB 1U8OA 1OAQL 2BVPB 2VISB 4OLZH 3GUTB 4GKNB 3NIDF 5ACMA 1U8PB 4YUEH 3FT3A 5F7NC 5D1QA 4CADB 3T8XA 1NDMB 2DD8H 4HDIA 1BD2A 3DI3B 1NFDE 4EQ3A 2CO6B 4MB5A 5LBSH 4MCYA 4TULH 12E8H 2W60A 1PYWA 1OARH 5HSFA 1A4KA 2F19L 4F9LA 4PRBA 2OZ4L 4EI5C 3O4OC 4P0DA 2AJZA 5KSBF 4KHXH 4R2GC 1KPRA 3BPOB 5DD3H 3RJDA 1CFQA 1UZ6E 2YD7A 4Z8FL 1YUHB 3MRMB 5L9DH 2KZ1B 1NCCL 8FABB 4O51B 3UTQB 4YFLF 4LLWB 4U1NA 4WEBL 3ARRA 3SKOA 3RL1B 4KGJA 1EX0A 2E9WA 3BKJL 1I7RB 3L5WA 4W4OC 3RIFF 3NACH 1QZ1A 4KKBC 4OCRH 4Y19E 4EIZC 5DMGC 3EYUH 3ARPA 4PRPE 1AI1L 3L7EA 5EOQH 3BGMB 5FHAH 3GSNB 5TE4L 2EYSA 4L3AA 4HIEB 5E8EA 2AK4D 3BX7C 4WEUD 2XKNB 3HG1B 4G5ZH 4PJ8D 4D2NA 5HHQB 5ICZB 3LMJH 1R3KB 1E6OL 3O6FB 4PPTA 3HZMA 4H25B 4MDJA 1J86A 2IAMC 3IFPA 3U1SL 5TFSH 3S88L 2Z35A 1B4RA 3H3PL 4AM0A 1T5XA 1F4WH 4L8BA 1VGKA 4FZ8L 4GRLA 4X7TA 1MIMH 1DANT 3SY0B 3VE0B 4XPGL 3WD5L 2HG5A 2ITDA 3ZMRA 3NA9H 5F1IB 5FECB 5AYUH 1IGTA 4XMPL 3NH7H 1DL7L 1JGLL 5DFVD 1DSFH 4CMMB 2FL5B 3VFVA 1U8LA 4P2QB 5FOJA 4XZUA 4G8IB 5C0BB 5HHXL 1G7PA 4MJ2A 5F8QC 3CAFA 2P8PA 5DRWA 1S5IH 4RNRA 4Z77A 4KXZH 4F7PB 1G1CA 1X5XA 3G9AB 2R8SL 4MA8H 2X70B 3VMNA 1NEZG 2EICA 1BJMA 3DI2B 1KYOK 4MQSB 1AP2A 5DMYA 5LCVH 3K2UL 5D93C 2GQHA 3QUMB 1F6AA 3OJ2C 2R1WB 1A2YB 3HA0A 1OVZA 3MLUH 1KCSH 5BV7L 2C3HA 1NLBH 5IB2A 1HNFA 3T2PA 1NGZA 1QRNE 4PRIB 2R0ZH 1N2RB 3U48A 5TF0A 5HHOB 3GSUB 1GZPA 4YDVB 5E9DE 4G80B 4RISL 1QLFA 2OZ4A 3ULUD 1HN1A 3U4EB 4HJJH 4XXDA 3EKCA 5EU3B 4ZSOB 4Z7UF 2EIEA 4YHPB 4H1LH 1G1YA 1QVOA 4OF6A 2BY3A 2ZOKB 1EEZB 5CP7A 3ZKNC 4L4TB 5F3HB 5D6CA 4S2SA 4OZ4B 5F9DC 3MTRA 4KTEL 5GS3A 3LN4A 3GMLB 3BZDA 4BSJA 5CWSA 4RDQG 1HH9B 1MFDH 4M62L 2FD6L 5CEZL 1FORH 3LZFH 3QFJA 4XVJH 4OM1H 2FATH 5ITFB 3MRGA 1N64H 2X89D 3FQTA 5JORB 3BD4A 3WSQH 2EDJA 2R2HB 1W8NA 1BHGA 4JHBA 4K9EC 4TTGA 1F11B 3QWOB 3VXSB 3T2OA 2AJSL 1PBYA 4AEIL 4RA0C 3WNPA 4XRCB 1QFOA 2X1XR 4RWYH 3LAFA 1CE6B 1F58H 1H15A 3SHSA 3BT2L 4NO2B 2JCCE 3TIDB 2WINB 5IMLA 1T0MA 2W0FA 2WBJC 2YMXL 3L1OH 5GRVK 4LK4A 2FSEB 5KTEH 5M7QA 3P9MB 4X6EB 3K1DA 15C8L 1MJ7L 1NGWB 1V3LA 2Z31C 4MB3A 4LNRB 4HJ0C 4LU5H 1Q9WB 4I4WB 1FFQA 1KB5L 1R3JA 1XR9A 4UU9B 3QQ3B 1IEBB 3BH8B 5L7XH 1PW3A 4YDKH 2RGSA 5I8CB 2ZCKL 3IF1A 4BQCA 5FOBB 5B8CC 1QYGH 3OSKA 3HUJF 1KF9B 4P2RD 1F3DJ 2DIAA 5MEPA 4JZOA 4FQLH 2AQ3A 3EYSH 2H8PA 4DN3H 2P43B 4LPVA 3ILQD 3B9VA 4ODWB 2DWEA 4ODVL 1ZS8A 3D5OF 4X4XA 1BIHA 2VLRB 5CHNA 5FF6A 2R2EB 1RZIB 3MRQB 2VL5A 2NY5C 4PJ5A 1MVUB 3VFGL 3IDIB 4EVNA 1KJ2A 4QRRD 1E4KA 5KSAB 2C3GA 1LEKA 5SV3A 4LARL 3SE4C 1F8TH 1UACL 1D9KC 3D0VA 4ZAKB 1IGFH 3TN0A 4XNUL 1VADA 5HYJE 1JFQH 5CGTA 1TPXC 3A6BL 1G6RB 2PXYB 4O5LH 1D5BB 1RVFL 2R29H 2BNQE 1L7TH 2PTTB 3B2VL 2AV1B 4K23L 4ISVA 2A38A 2A83B 4NHUE 4H20H 3E8UL 3RRQA 5MEQA 4F15B 1IAIL 3PG2A 4ETQA 4LHUA 3L5XL 2NY1D 2NXYD 2VOTA 3SE9H 3T0EA 4NO3B 1SYSB 1ZHKB 5JW3L 4YWGL 2OMNA 3UBXI 2A0LD 2BRQA 3I6GA 5IFHH 3GSQA 1RUMH 1EPFA 3OAYK 1F2QA 3VD9A 4ZTPH 1PQZA 1TQBB 4AIZA 3U79A 2UWEA 1Q9OA 3RWDB 4XPHH 2DQHL 4JAMA 3FAXA 4O2FA 4HKJA 3QG6A 4P57B 1H3XA 2L4OA 1F58L 4HMDA 3VXPB 2E3VA 4JZJC 4PJ9A 3R06A 4MQ7A 3K4DA 4JM2C 4LRIC 5DJAB 2YD4A 1Q8MA 1JHLH 4PJGB 2KQNA 3HNVH 1FVDA 3EDJA 3IDXH 1OARL 4HFWB 4X8JB 1G7JA 1MIEH 2NY5L 1V5JA 3CH1A 1LK2B 1KGCE 4PJ5E 1TNNA 3UXFA 4XX1G 4KMQA 4QXTA 2J88L 4L29B 4BH8A 4GXVH 1U3HA 4UUJA 1UWGH 5T1MB 4DTGL 3IDMA 2BC4B 3EYUL 4V1DB 2BXYA 5L6YL 4L29A 4Z76B 1L7IH 4KZDL 4YZFE 5DK0B 1LK2A 3Q5TA 3JWOC 4LCYB 5IHZA 5KJRL 1KJMB 1UGNA 1LQVA 3OAZK 1NC4D 5GQBA 3U0TB 4IHOA 1X5FA 4UV7L 1W0YT 4NKMA 4G42A 4HS3A 2Q8BH 1FQ9C 1WIPA 2OL3L 3PGCA 3MFFA 3QR2A 5JR1L 2N56A 1NCAL 4YPGA 4MQTB 3ULUE 3S88H 4RX4A 2NX5E 1C12A 1LO4H 1ZLSH 3U2SA 1YEFH 3OPZH 4FMFA 2NY2B 1D5XA 1RZ7L 2EDLA 3EGSA 4OIIH 1Q9KB 4B41A 5AD0A 5E6IA 3GMPA 4K7PY 2WIIA 3DIFA 2WLZA 5KOVC 1K3IA 1LWRA 2NW3A 1RZJC 4JO1L 4PJDE 4ONGL 1I1YB 4IHOB 3V5KA 2AEQH 3TT3H 4DKDC 3KXFE 3ZYOA 1QSEE 4EDXA 5BS0B 3KYNB 3D0LB 3FN3A 5E5MB 2AV7A 2C5DC 3ETBF 1O0VA 4RFNC 3QRFM 4EN3D 3MV9B 4NQXA 2Z9TA 3N1GC 1OP5K 3SJVE 4PGCB 4LPUA 5C71A 3GKZA 1K4CB 3BAEL 4A6YH 4XNZC 2R4RL 4X9GA 1ADQH 1KCKA 3CVHB 4KKAC 2JJSA 5IGXL 1DL7H 5GJSH 1NFKA 1F3JB 3VDBA 4ORZC 4IJ3B 2DAVA 5SWZA 4LIQE 2R39A 1A7NL 4I3SH 1T03L 4Z7OF 1KYOJ 3HRPA 3R06B 1MY5A 4P4RB 3M8OH 5DA0B 5IB1B 2DQEL 3AB0B 4QRUA 5LWYH 4F7MB 4IRJD 1AE6L 2XI9A 2Z8WC 1ULVA 3ARBD 2R0ZL 3RWIB 1LEKB 2OL3A 5HDQH 1IRAY 4KROC 4PJFA 1LMKA 1QEWB 1TZGH 1PQZB 4HBCH 4YBHA 3IFNL 1BQHA 2XXMB 1IM3B 2H41A 4HSQA 1T1YB 3I6GB 3DECA 2Q86A 2FX8H 2IGFL 3REVA 1S9WA 4I77H 3JWDC 2YEZA 2VLKD 2RB8A 1GGTA 1S9WB 4FXGB 4NCDA 4PJ9C 3HC4L 3WNMA 3H9SE 4JR9H 3IXAB 3KHQA 4M43L 3QUYB 4PGEB 4YXKL 3DWTA 4X0KB 1G7MA 1XR9B 5D71H 4JPWH 4X99B 4JRYE 3B9KD 3SQOH 4RBPH 4H88H 3PDGA 3MLWL 4EI5D 1E28A 3QCTH 3FB5A 4E0RB 1R3LB 1Q9KA 3ORJA 1CE1L 4HD9A 4Y0GA 3T0DA 4H26A 4WVRA 4P4RA 2CLVB 2EXYD 4AEHH 4JFXB 2HFFA 4QT5A 4MXQD 4Y1AE 2WBJD 5C08B 2EYTB 2JELH 5FYKU 3Q5YA 1GRWA 1ZA6B 4Y16A 4LCYA 4WIQA 4WEBH 5IG7B 1J0JA 3MRBA 4HGMA 1XCTB 2R2BA 3R1GL 1WZKA 1FH5H 3QHFH 5HGBA 4GS7B 4P5TA 3IAQA 1OM3H 1FYTB 4YQXL 4Z76A 3VFNA 3S37X 4KKLC 1A4JB 4LCIH 4BH8B 1X5AA 2VABA 3NACL 4PJXE 4D9RE 4YPJA 2BSSB 2IANE 1XGQA 4X6DF 1Z6JT 3QDMA 3EOYG 1A02N 5ILTH 2FR4B 1IQWH 1U3HC 3EFFB 5E0QA 1S7VB 4P46A 1UB6A 3SDYL 3QFJE 3VXUE 5TGBB 4F2MA 3VXTB 1S7XA 1XGPA 4S1QL 2JCCF 5GGTH 1XFPA 3C6LD 5FEBA 4X6DB 5IHLB 4WUUA 3WFCH 3IDYC 1LDPL 4XMLL 2Y72A 4KJQC 1MRDL 4U1KB 3JZ7A 5BCAA 3UCRA 3WFDH 3BQUC 5BW7C 1QSFB 1P7HL 4PB9H 3VWJB 3GM8A 4NO2A 5JMRA 2ZG2A 4PLKC 3CJJA 4PJ5B 3D48R 2N7BA 1IGMH 3F8UB 3U7YH 3B43A 3CX5K 3FQNA 4L5FL 5E99L 4R6UA 5AWNL 4D3CL 3O41B 3OR6A 2YPVH 4AENB 3ECBB 4JGUA 4L8DB 3EYVA 1A6ZA 2AK1L 2NLJB 4LLQB 3WJJC 1KPVA 3MRGB 5I8OL 5KS9A 3DXAD 2APTA 4NOFA 1B90A 2VDNL 4G6MH 4FG6D 1ED3A 1FFRA 1DANU 4FQ2L 1PX4A 2WM0A 1V8HA 2UWEF 4XNXH 5DD5H 4DUWA 3NCYP 5H8DA 4YAQB 4YX2L 2P8PB 5DRZB 2PTTA 3VXMB 2NX5B 5D6CB 1FVDB 5E99H 3UYRH 3BZEB 3ZE1F 4P2QA 1Q72H 2XV6B 5EU3A 2K9UA 3B6SB 1IILE 1WAAE 3ZE0F 1T03H 5EC2B 3UZVB 1RHFA 4LVNB 2P8LA 4IJ3C 3BIKB 3OAZH 2M1KA 3NAAL 4XPAL 3OAUL 3S5LG 4LOUD 3GSUA 4OZHA 4XP5H 4BKLB 1AHWB 1E4XH 3P30H 2OI9A 3BUYB 2C3WA 3C5SA 4I9WE 4D8PB 3DGCR 3BXNA 3IJSA 5T1DH 5FGRA 3VXUA 4XBEL 4LGPB 2J8UB 3V0WL 5ICZA 4X6BA 3BP7A 1J5OL 4U1LA 1FCCA 1MI5A 4JFQA 4TPRH 3U30B 2IMNA 1VEOA 2QEJA 4W81A 3T3MF 1ORSB 1OM3L 1UVQA 2FBJL 3HE7D 1HIML 4G7VH 3QIBA 1LP9A 1HWGB 5SWSB 1P6AB 4KMTH 2FX9H 4F37F 1MFBH 4Q97A 1SY6A 4Y16C 4TSAL 3EZ8A 2C4XA 2X1PA 3QUYC 1U36A 2MKWA 3FQXA 3H8NA 1I9IL 4AMKL 4KKBD 1KLGB 4KRPB 2V7NA 4Q6IC 5IVZB 5IQ7H 2C4FT 4UV7H 4JQXA 1HINH 4WY7H 1ROWA 2UWEE 2F54E 2E9IA 4RZCB 1J8KA 4GRLB 1FE8L 2UY7A 4PB0L 5INDB 4JJ5A 3V4VH 3ARTA 2IH1B 5FO8B 1UB5B 3M45A 3H0TA 5DMIH 1OW0A 4QF1A 3CU1A 1W0VB 5ACLA 4O58L 3DOSA 5DRXB 2B8OT 4Z7VB 5HY9B 3FOMA 3OR7A 3VFOB 1AP2B 4WFHE 1IKFH 4DFHA 4J3WA 2I5YH 3QRGH 4UIKL 1U8KB 1XGTA 2L0DA 2EYSB 2A6DA 1EH9A 2WBKA 3V2AR 3SCMD 4NZUL 4HIHB 4QRTA 3QAZC 3REWA 4CU7A 3BJ91 3PXJA 5HHXH 5C0AA 4HGWA 1P53A 2QADB 3D39E 4R0LA 4AQ1B 3CXHJ 1MY7A 5F3BB 3MZGB 3ZHLA 2AEWA 4G9FA 2DOCA 4ONGH 4NO0B 5B4MD 5CMAB 4Z18A 3QFDB 4ZXBA 5MENB 3NABL 2XQBL 1AKJD 1LDSA 4G80A 4ZPVA 1JPFA 2OS7A 3STZB 3FJTA 4N1EA 43C9B 3O81A 2HLAA 1QP1A 1DQLL 3TVMD 3G5YB 1ZANH 4NDMB 5D2LF 1VACB 4XPFL 3WNNA 1RK0B 3C60B 4OM0L 1I8LA 2FWOB 4QRSB 5L8JB 2VQUA 1FV1A 4MJIA 3GHBL 4LSRL 5FYKE 1F4YH 4XC3L 1B3JA 4MS8C 4HKXB 4YNYB 5GGRY 3T08A 4OQTL 3VU2A 4ZFGL 3KYKL 2D7PA 4XTRC 3KXFA 3VWKA 4OZGE 5BO1L 4HJJL 2EDOA 4JDTH 1N59B 1KPUB 1T2XA 5CWSB 1ZVSB 3V6FA 1J5OH 2JB5H 1NSNL 4BQ8A 3ZTJH 2ZZUT 2F53D 2WUBH 4O9HH 4S2SB 3S96B 3PWVB 1BFOB 3HI1B 5ADPL 5K93A 3P4MA 1NL0L 4Z7OE 1HIMH 3O4LB 1M7XA 4D0CA 3WLBB 2DQGL 2Z4QA 4HKBB 5TF1L 4M9OA 4G9DB 5TE7L 8FABA 2ZPKH 4KRMB 3KWWB 3S35L 1LNUA 1UM6L 4LIQL 1EJOH 2KL6A 1JN6A 4MA3B 5E2UH 2A1WL 2QSCH 4WCYL 2IPUG 1OTSC 4F8TA 1FAKT 1ZVHA 2D2OA 4C83A 4PB0H 5JW5B 3C6LA 3ULVH 1R3KA 4KRPD 2BVOB 4FFVD 4MAUH 4NPYB 3S3PA 3LEVL 3QUXB 1LD9A 4HUVA 3QEQB 2B39A 3T8XB 1CE1H 5A40E 4H5SB 4EEEA 5DJZA 5GRXG 3U4BH 5E70A 2VN4A 3MNWA 4NO5A 5SWSE 2J8UF 3V7MA 3DMMB 3VFWB 4OQ1A 2ATPB 1C1EL 1MPAL 2YKLH 4KMTL 1U8LB 3RUGF 2FECI 5CEZE 1DN2A 1UADC 2HVJA 1Y6NR 2I9TB 5J12B 1OGAB 1VSCA 1U3HD 1I9IH 1F5WA 2ZUWA 3BN3B 1J1PL 3TT1L 3PGDB 3F5WB 4RMSA 4TTDC 4JN1L 3T0VA 2HRPH 1OOAA 3TVMC 4HWEL 1HSAB 5DA4A 3QDGA 1CD1B 2YR3A 4Y19B 4R0LC 4IIQC 1YECH 4QGYA 1AH1A 3PDDA 1SBSL 4JFPA 2ESVA 2CD0A 2H2SD 3EJJX 2ENYA 3MRJA 4L8CA 4HX1B 4AQOA 3JXAA 3BH9B 3RL2B 5HDOA 2A6JA 3JUYA 3N50A 1XH3B 5HYQB 3M17A 1U8PA 1DBBL 4LPWA 4XWOD 5LGJB 1QQDA 4JN1H 1BREA 1XF5A 2CKBL 3U7AA 5HHOD 2EKSB 1CVRA 4LMQE 3CDFA 1Z9LA 4X4YA 3IJHA 4RFOH 5I76B 43CAB 3OB0K 3BN9C 1XF2B 4YC2C 3OKEB 1NEZB 4XNXL 1QFUH 2Q1EA 2ATPA 3I85A 3TCXA 4M4RA 4AH2A 4XNUH 1TITA 4HIHA 4QOKB 3Q2CA 3VFUA 4JM4H 4JKWA 2PXYC 4TYUA 4NQVB 1EXUB 3RVTD 1XH3A 1ZK9A 5HVGB 2IQ9H 3PL6D 1AGDA 4JO2L 1B0WA 4HX1A 3ARBA 3ARSA 1MCNA 1NH6A 1K2DB 1NLDH 2DQIH 2HJFA 1TIUA 3V6ZB 3C8KA 4BFGA 3VWJD 1U42A 4OFYD 1GGYA 5ID0A 4LF3A 1MAJA 5IV2A 1DUZB 1RHHA 3QUKB 2OR9L 3WFBH 2FWOA 2FEEI 4X7SL 5E03A 5LGKA 2HVKB 5ISZD 4N9OB 1HQRA 2A73A 2QSCL 4LVHC 1CICB 4TUKL 3IETB 1BD2B 3TBSA 4JY5H 4HIJB 3UTPD 3Q0HA 1S7TB 2N7AA 5HHVL 5FKPA 2DYPA 4GOSA 1U8QA 1LEGB 4DUVA 4G3YL 3KPRE 4AH2B 5C0EB 3O9WD 4KDTC 4BZ2H 2DKSA 2AJSH 1P4LB 4Y4HC 5H37H 4LVOB 3O3UN 3KPSB 5ADPH 3KYAA 1IC5L 3OZ9H 5HI4D 3OG6B 5HHMA 1DDHA 4UBDD 1XZ0A 1SJXA 3T77A 5TE7H 2AP2A 2MQCA 3SCMA 3LKSA 3S35H 5F6IB 3D6GA 4IRJC 4H88L 1I7ZA 1K6QL 5GRJL 1MIEL 4M61A 1JE6A 1UCBL 2X05A 4CN4A 5HHOE 2P5EE 4QHLA 2DLGA 5C3TA 3L3DA 4QF1B 4WCYH 1QPXA 5IOPA 1WBZA 4QXWA 3CDGA 4PYGA 3RWCA 3D1MC 4NKDB 4X4MA 4E42B 1JPTL 5DVOA 2B2XL 4K07A 3IRZA 2C1OA 4KH2A 4Y7MA 1F02I 4O4YL 1GVIA 2Y7QA 3GSRA 3HC3H 2JJWA 3CSBA 4OZHB 5EPMA 5ID1B 1X44A 3V6OA 3VMOA 5IB4B 2VZUA 3MLYH 2WWMD 3O6FD 1DEEB 3U46A 1IBGH 1WIOA 4R4FL 2FYYB 3O4LA 2IALB 4JFZH 2IBZX 3QQ4A 4U6XB 5SX5K 2IADA 3QWRA 3MLXH 3G04A 2EKJA 4M5YH 4A6YA 1D5MB 1FRGL 1QG3A 2D31A 1FSKB 1RY7B 3PWPD 1IGFL 1U3JA 2I5YL 3CSPA 1MAMH 1MI5B 4UIKH 4YK4B 4XPTL 2HRPL 2ENSA 5KS9B 1ZT1A 3UZQA 5GJSL 4N0RA 1EDQA 5I74C 2RJMA 4XMLH 2GJZB 3EYVB 4TN9A 4N5EA 2BNQD 4DOHE 3LRSB 5C0ND 3I3DA 1XIWC 1VACA 2JIXB 2XQYG 3KDMA 3PWPA 3RGVA 4HK3N 2B0SL 5IVOA 4X5LA 3LQZA 1PSKL 3OGCB 1IGIL 3MJ7A 3OL2A 5H2BB 3ZYIA 1KCRH 4GBXC 3QJFA 1B9ZA 1AC0A 4RGND 4YDIH 1IQDB 2W0LA 4HUWB 2Z4QB 3WXWL 4I3RH 4Z0XB 1NFDB 2X4PB 4QXUH 1EO7A 3FQXB 3KPLA 4LHUD 3P4MB 1LEIA 2EH7H 4W6YB 1T04A 4ZTPL 4R0LB 3T4YA 4NRZA 1XMWA 4WTZA 1N4XH 2LTQB 3CVIH 3T0EC 3NCMA 4M6NH 4F33B 3LKQA 4QRRE 1D7FA 1F3DH 5DC0A 3UJJH 1A1MB 5D5MF 2A6DB 3JV4A 5GGUB 5FK9B 4NFDA 1FJ1B 1Z2KA 1EV2E 3DUHA 4MQXD 3LDBB 3MLVL 1N3NB 1CFSB 1DCLA 4HULB 3LS5L 3FKUS 1FNHA 1HEZB 5HGBB 2ADFL 3RPKA 4ZFFA 3QIUD 1ZGLP 5JDSA 3NZ8A 5DS8B 2R0LL 2VQTA 1I3UA 4HV8A 5F9JA 3CLFH 5MERB 3LRHA 1T83A 4PJ5D 4NDMA 4NIKB 3CVIL 3MREA 4PY7A 3HUJE 4QT5B 3FO1A 5DHVB 5INDA 2Y4SA 5BOPA 2HMID 1MLCB 3DSNA 4Y4KC 3BFOA 3MODH 3UEZA 3B9DA 4PLJD 4R2GB 3UJIH 2Y5TB 3BESR 3ULVL 2DRUA 2NXYC 2V7HB 3OJDB 3SDXF 1G7LB 2AW2A 5F96L 4H8WC 1JCKA 4WUUB 5D8JL 4CGTA 1KEGH 5C0AB 3LKOB 4GQ9L 4X0KA 1S8DA 5E5UB 5JA8B 1BMGA 2IBGA 4Y8DC 5DEGA 5ANMA 4R7NB 4PTUB 4P3CH 3BO8A 3OKOB 4B7IA 3OJVC 4YK4C 2BHZA 2GEEA 3RVXD 1XF4A 3U30C 6FABH 4PJGE 5CFHA 2QADD 1QLRB 4FN0A 4HAFA 5GSVB 1XCTA 1W0VA 1VFUA 1I8KB 1UWXK 5D7LA 5ISZE 4NQUA 3QHTC 4HKZA 2MQ3A 1OPGL 4LCWE 1NDGB 2IH3B 2QQKH 4BFIB 1YMMA 2XTLA 4JFXA 1W0WA 2WBJA 4YIQA 4N8CL 5EOCJ 2V17L 3MGTB 4XHJC 5F7KC 4HT1L 4J3OC 2YD8A 5K9OB 4JE4B 2DQJH 4Z7NF 3PE9A 3HPJA 2DLFL 3I02B 3RIAF 2BSRA 5CSGA 4JG0L 1LGVA 5F9OH 5KS9E 5JXAH 4PJ7F 3HAEB 1QR1A 1UB6B 5B21A 5SWSA 5BQ7B 1QO3B 5IWLA 5MEOB 3K8LA 2DQEH 3MRFB 3ULSB 4XWOC 4CUCA 1K4CA 4MNHB 2EZ0C 3P77A 3V4PL 1C8PA 1DBAH 2UUDK 3LN9A 3LQAC 1RUQL 4LCCB 2VH5H 5D1XA 5GSRA 3ILPB 5LAXB 3LS4L 5C8JA 4M7JH 5IB3A 1A9EA 3MCG1 5J7CC 3IJSB 3FB8B 1FVCB 4NOBA 3V5KB 3FQNB 1HHHA 2VKXA 3TC9A 2EYTA 5D93B 4W4OA 3FFCA 2ZCLL 2ZJSH 3WXVH 4NC1C 3IDGB 5IFAH 4ONHA 4MSWA 4BQBA 3EO0A 3RKDD 3D18B 3MRRB 4HUKB 1CF8H 4ODBD 5KBNC 5SWZD 4PJGF 4F7MA 3CVHL 2VH5L 4YDIL 4PRHA 1TVBA 4IRJA 1FFOB 2GT9B 4G8GE 5DD1L 3MO1B 5HHVH 3PDOB 2PNDA 4HPOL 3BZ4B 2HA1A 4APQA 4JFHE 3V0WH 3BPLC 4LPCA 3KJ4C 4FG6C 4U6HA 5FA4B 1RMFH 1DN0A 4UINL 2ZSVB 5C07A 4DKEH 3FMGL 3EDEA 1VHPA 3FQWA 1UM4H 5MHSE 3AY4C 2JJTC 3QZWB 4QNPE 3P30L 4ZFOL 3O6LH 4V1DA 4Z0BH 1SY6L 2D7OA 2BVQA 2YEZB 3CFCL 1KLUB 5KOMC 4JG1L 1KPVB 3MFGB 3HR6A 4QXTB 5GGRB 4HS8H 4X6CA 3T65B 3ERYA 3MRLA 4EDXB 5BS0A 3ECBA 4ZUTB 1F00I 3SE3C 3T0BA 3FT4B 2X40A 4NQSA 3BP4B 3GHEL 4NNYA 2V9QA 5K9KA 4CU6A 4APQB 5KW9H 1H8OA 5LQBH 3BP5A 2AXFA 1GL4B 1XT5A 4W6WB 4HS6A 4FOMA 3D9AL 1I75A 2VQ1B 3PHOB 2OL3B 3MODL 3MV01 4OCWH 4QO1A 4H8WL 5D7IE 1MOEA 2IAMB 3TJEL 3TPUB 4P3DB 1OTUC 2WK2A 3MLRH 4UT7L 4NQDE 3TJHD 3E0GA 1AD9A 1OAQH 4UAOC 1A1NB 1H5BB 1IE5A 3VXTA 3ZT6A 2YOCA 3VWKC 1P4IH 1G7MB 5DTFA 3D85D 5DUPH 1FVCA 5LBSL 4MX7A 3QXUA 3GSQB 3GSNH 3MBXL 4F15C 1HYRC 5F7EH 4Q9BA 2ZCHL 1XGUB 3HCVA 1BFTA 1NBYB 1S5HB 5FYKL 1MQ8A 3IU3A 3MRIB 5AUMB 2RAMA 3O0RL 3QHZL 4LVEA 5FYLH 5J1AB 5FV1L 2VUOA 4BELD 5A43C 4M5YL 1AD0A 2ICEA 1CD9B 2DM2A 2R2BB 3AAZA 3K74B 1YC8A 1BQUA 2E7LE 4PRHE 3QO1B 4MGXA 4KXZI 4WFGE 1EBPA 1DN0B 4X8JA 1OW0C 4OF7A 1G9NH 3BZ4A 3MC0A 4KKLD 1G6VK 3GBML 3BPOC 4JO1H 4XB8A 5EBWB 1A1NA 4ALAH 1UC6A 3GMPB 2FJFA 4NQTA 2RCSL 3MZTA 3HZYB 3MLSH 3VXRD 3TH4T 4JHAH 2FZ3A 4RWHA 1YDPB 3VGAB 1EZVX 1TJHH 5I1KL 2VQ1A 3TFKC 4RIRA 5F9WC 5KSAA 3SE8L 1JJUA 4MSWB 5FUOL 3R0MA 1Q9OB 2ICWA 4ZS6D 3HI6L 1I8MB 4J7RA 5HI4C 1YYLL 2AEPH 4G6JL 1JHTA 5FGBC 1MHCB 1ZT7A 1MHPL 1S7RA 4DUXA 1NGPH 4ZFZB 1A3RH 1JRHH 1ZGLB 4ZTOH 5J1AA 4Y1AB 4GH7B 4X9BA 5T1MA 4WUKL 5HI3C 4JANB 2CSPA 4A2LA 4MD0A 3SKJH 5IR1B 3DROB 2PXYD 4UDUB 1FIEA 2OYPA 4MVBD 4AYFA 1T1YA 4V3EB 5ANMB 1D6VH 1OAKL 1LO3H 4QXGL 4O2EB 1D9KA 1C16A 1RZGB 5GRUL 4BSWA 4PJAB 1IJ9A 4Y19D 3V6OC 1ERNA 5I1JL 3QUZD 3DYMA 4OGAC 5D7SL 5C0RH 2NY2C 1WISA 2NZ9D 4QEGA 4M6MH 5IHUH 1BQLL 4LCCC 3VGDA 1CK0H 1HDMA 2V5MA 5HGAA 3CH8A 1YQVH 1M6OA 3EO9L 5B38A 3WDJA 1UWEH 1HYSC 5I16A 1RSFA 4XNYL 3ZKMD 5KZCB 3CX5J 3ARBC 4ZUTA 3QWOA 5D5ME 1YJDC 1PVHA 4KY1L 4HUXB 5IQ7L 2XG4A 1H3TA 4Q2ZB 4P4KC 4Y2DD 4L4VD 1G6RL 1A7PL 2HFGL 5GIRA 4UT6L 1TDQA 2C7UB 2V2WA 3FOLA 4URTB 4PG9A 1KXVC 4P9HH 4HIXH 5C0DB 1I1FA 3BGFB 1XGRA 2PO6D 1CLOL 3KYNA 3MA9L 4L9DA 4OGXL 1MCPH 1NGXA 5IQ9B 4KK5D 3RA7L 4J1UA 3L9RB 4CMHC 3MO1A 4YLQT 4GQPH 3GI8L 4M3JA 2DL9A 2X9XA 5T3ZD 3MCLH 3FO2B 3TPKA 1E6OH 3QEUB 1T2QH 1TJIL 5DURB 3T1WA 3D18A 5CP3A 4HIXL 2AJUH 4YIQB 3U0WH 4EVNB 3N06B 2V17H 1UCTA 2X4RA 3ZT7A 4NQED 5JA9A 4BFIA 2VRAA 2VL5B 3CXDH 1IGCL 4GKOA 4PJIE 3RJQB 2XWJB 4LASH 3STLB 1QSEB 3ZKQD 4RFEB 3ZYZA 4U7SA 5LAXA 4EQ2A 5ITFA 2BC4A 3FB6A 1M1SA 4GT7A 3TF7A 4ORGA 5E8OA 3B4NA 2J12B 4B53A 1I7UB 2WNGA 4OD1L 2H2PD 4M7LL 2W1NA 5I8EB 5F7MC 3QUZB 4UU9A 5J13B 1EEZA 4JG0H 2NXZC 1INEH 1JF5A 3SDAA 1IZJA 4CVZA 1QBLH 1KUMA 5IJVA 2OBGA 4OZHF 1IGTB 2BDNL 5B39B 4DFIA 4PJHE 1CQYA 3S3SA 5LG1A 4FQQB 2JB5L 1NUDA 4NUJA 2EDRA 5I1JH 1W0WB 1AKJB 3C6LC 1RUQH 2DI9A 1FO0A 4U49A 4FQ2H 3QEGH 1OAXL 2VDQH 4I0PB 5EU6D 3ZKMC 1WT5C 5E6ZA 3V6BR 5IEHB 1A9EB 2VITB 3H9SA 1NCWH 3FN0H 1BWWA 3EZJB 4PGZA 4JY5L 4POZC 5ERWB 3UYRL 3U36A 1OAUL 4YXKH 1FVEB 1M7IB 3TJHA 1T22B 3H42H 4I0KA 4LQFL 2QHLA 1UM6H 5I1GH 2DQTL 3VGHA 1RURL 5E2UL 3UO1L 1U8NB 3JV4B 4Q7DA 1R3HA 1VEMA 5I6XC 3ARGA 1B0GA 2MCPL 4OIAA 4ZNEE 4MA8L 1A3LL 3GIZL 4EZMA 1KELL 4JCLA 1CFVH 1NCWL 1UA6L 2QLVB 4FQ1L 3O3DB 3K81A 2CIKB 3S35X 1CLYL 5L0QB 5SV4A 3N85H 4KZEH 4NFCA 3OJDA 1N5YL 1KSRA 3NFSH 2VDRL 4MLIA 1KJ2B 3B9KA 1U8JA 5CIPH 5CGMA 2CQVA 4WENB 4IDJH 32C2A 5DHVA 4AEIH 1GGBL 2JIXA 1Z5LA 4JZNA 2P8MB 4K8RD 4HKZB 4AM0B 5DLMH 2DBJA 2D9CA 3W9EB 3IFPB 3AMKA 3QCUL 2P44B 2ZUSA 3F58H 1SEQL 4KY1H 3SGDH 3DX7A 2FBOJ 4FQPA 4LSQH 3EYQC 4FQIL 2HT2D 1GYAA 3OKOA 1NCBH 2XKUA 3BGMA 2Y36L 1A1MA 1A5FH 3IF1B 4LNVA 1HH9A 1HHGB 3RNKB 2D4DA 1J05A 1X9QA 4X7CC 1H0DA 1IEBA 2NY6C 3LKNB 2Q6WA 4EI5B 5IBUB 1RQ5A 3BHBB 5EN2A 3OKEA 5KG9A 5CUSH 3MV7E 3FL7A 5DK2A 3QDAA 5MI0B 1J8HD 3BEWB 2GTWA 4OCNC 4WV1B 1LEGA 1UH3A 3CFDB 2JLLA 4XCEA 4YDVA 2FJHA 5ALBH 4LOUC 3X11B 1T7XA 3QRGL 3OKMA 3B8YA 3O0RH 3QHZH 1CGSL 3SDXA 2ATKB 3UTSB 4JFOA 1DUYB 1WGOA 4POZD 1MWAL 1T4KA 4EI6A 3WFEH 5C9KA 2NY3C 3QUMA 2DLEA 1LO5B 4MDJB 5DEFA 3V6ZA 4G7YL 1TFHA 1HSAA 5GJTL 4KK6D 2CUMA 1EZVY 1WAAA 3QIUB 1C08A 4N90E 4ALAL 3NA4A 4G5ZL 5SX5H 1BX2A 3FTGB 4ZUVB 2NY0B 3ZL4L 1INDL 1NMCC 3WS3B 1NCAH 4KVNH 4GAJL 3H42L 3GMLA 1D5MA 4TUJA 1JI1A 1WK0A 2WUCH 3MUHL 5TDPA 5I1AA 2H32H 1JRHL 4MYWB 1LO4L 5E00B 5I1KH 5TDNB 4FRWA 3QXVA 4HUMB 2AJVH 2VXSL 4K3JH 4RQQB 4GBXB 1P1ZA 3EYSL 5DQJB 4ZXBC 5B22A 1FO0L 4CVXB 4JVUA 4AL8L 3ROLB 2EE9A 4HUWA 5J57B 1A3LH 3GIZH 1TCRA 1KULA 5IB4A 1P2CA 2ED7A 1MHPH 1J10A 1U8QB 1C5BH 4J3TA 5LGJA 1ONQB 4ZUUB 3KPRD 4IRSA 1QA9A 2CMRL 3F7YA 4JRXA 5CBAB 4PRIA 4U3CA 1RI8A 2R23A 4R7DA 4L8BB 3EJZD 4MXVE 2UUDH 4KUZL 3MPCA 1WBZB 4OGYL 3DPBA 4GAYA 5ENWA 1S5IL 4LKCA 4PRBB 5DJ2A 1A3QA 2FX9L 4GG8A 1LO3L 4O00A 5JNYB 1MQKL 5F8RC 4XBGB 3JTTB 3C08L 4AT6A 1CD8A 4O5LL 4EBQH 1JN6B 2BK8A 3L6FB 1DLFL 4MDIA 3SDDB 5JDJA 2DQTH 1MCRA 5CGYD 3ROOB 5A16B 4Y8AA 2NY6B 4UB0H 1MI5D 3S8WA 1KN4H 4H20L 2FO4B 3MRNB 4GKZA 4HXAL 1KV3A 4PJFF 1YEJH 2H3NA 5JW4M 4OUUB 4TUOA 1P1ZB 2FL5A 5DQJA 3VFVB 1JYWA 2IPKA 2BY1A 4NC1E 3SBWC 1UWGL 5C0EA 2HT3C 2NTSP 1TZGL 4KK5C 1NCUA 5IFHL 1FL3B 5BZWB 1RJCA 2A9MH 3MNWB 1CT8A 1XR8B 3RGHA 3PP4L 1SJHA 4HF5H 1H3WM 2J5LC 3VRJA 3TBSB 4M1DH 4CW1A 2YBRB 1NUGA 2HKHL 3O9WC 3LKPA 3IAGC 3PHQB 3UC0H 5JR1H 4GRLC 4LKCB 3ZDXE 4K8RH 4HZAA 5ID0B 3PHQA 2DI7A 4IEFB 1DQTA 4JGJA 1QKZL 4F9PC 1VFAA 1DUYA 4ZODA 4DOHB 5DJ6B 4UBDC 3NCFB 4X80L 3SCMB 4DZ8B 1KOAA 2RIKA 4J2XA 2YS4A 3DV4A 3DRTA 3A0OA 1NCBL 1NMBL 2Z0BA 4MXVF 2YD3A 4LLUB 1IM9D 3V0VB 2LU7A 5DUMH