4MNGA

Structure of the dp10.7 tcr with cd1d-sulfatide
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
273
structure length
273
Chain Sequence
b'RLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQEKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-2-microglobulin
molecule tags Immune system
source organism Mus musculus
publication title Crystal Structure of V delta 1 T Cell Receptor in Complex with CD1d-Sulfatide Shows MHC-like Recognition of a Self-Lipid by Human gamma delta T Cells.
pubmed doi rcsb
total genus 67
structure length 273
sequence length 273
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mngA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4mngA01
4XWGL 2X4UB 3HPJB 5DEGB 4PR5A 4MA3B 3HE6D 5C0JA 3RZCD 1RZIA 3MRLA 1Z3GL 1V05A 2MMXA 5JPMB 5HXMA 3LD8C 4M5YH 1T4KA 5DHVB 1HSBB 5FYJU 3BDYH 1XGUB 1L7IL 5CP3H 3CK0L 3WS3A 1KIPA 4HX1B 1DLFH 4PRPD 2Q3ZA 5JO5A 3AS2A 1UWXK 3GSWA 1QYGL 2WWKO 4HV8B 4H0HB 1IM9B 4XBEL 3ZDXE 5GJTL 4U1NA 1I1FA 1QEWA 1TQCB 3G9AB 5MP6L 2E9BA 3QWOA 3EBAA 1JZ5A 2EIZA 5BVPH 3U79A 2C5DC 3HZKA 5EIIA 1WTGT 2DQCL 5EC1B 4RFEB 3G6AB 1MELA 3V8CA 4EIGB 3S35H 1JPTH 4IMLB 2EIZB 4JREC 4WENB 5DS8A 5LXGH 1PYWB 4XWGH 1ZHLB 5JHLL 5ID1B 4NKIH 4NRYA 1YNKL 5EC2A 1XR8A 4AEIH 2KL6A 3GMPA 2OTWB 1MJJB 1CI5A 5E8OA 4P3CL 2BVTA 2VDLL 5JA9A 3DETD 3BESR 3K74B 1I9EA 4K7PY 4S0UC 2PO6B 4GW1B 1A6UH 4XPFL 4BQ9A 1C12A 2WNGA 1YMHB 1EVUA 1YMMB 3N1PC 4R26L 1NH6A 1Q9OA 4MJID 5IB3A 4JZJC 2X4UA 1FVEA 4KROB 1YECH 2VABB 4QXTB 2CJUL 1GGTA 4NGHH 3KPSD 4ODVL 4RMWA 3G6JA 5ICXB 1OB1A 1JNJA 4XNMA 4XP1L 2C26A 4Q0XL 3PWNB 3U36B 1TZGL 2HTLD 3RTQC 3GMNB 4OZ4A 4DKEL 5CEZD 3VXSD 1VACA 5EUOB 5BZDB 5EU5B 1YQ2A 3O2DL 4NKIL 1PFCA 2YUXA 4KK6D 5I76B 1ND0B 3QCUH 1NAMA 1CXIA 5DJYA 4WFHD 2NZIA 3TPKA 1D6EA 5HI5D 4LCWB 1QQDA 4X9FA 2Z91A 4DGVH 4P4RA 1T20A 4MXVF 2Y7QA 2AV7B 3HI5L 1S7UA 1DFBH 2F5AH 4D8PB 1PG7H 3L3KA 1S9WB 1KEML 5EIQA 2CDFB 4KQ4L 2X4TB 5DS8B 1LO4L 4X80L 5D6DA 4Y2DC 1Z9LA 2CUIA 4DW2H 3G6AA 3ROOA 4H0GA 4F9LC 1SQ2N 2EDYA 5I1IL 1FVCA 2CRMA 4PY8I 3V4VH 4PJ8A 2BXZA 1KJ2L 4JR9L 5KZCB 3BZEB 4EDWH 5E8EA 4FQXD 5E1AB 2VDML 4C56A 3WS3B 4M9PA 3BP7B 1X6LA 3ZE2E 2KZWA 3FTGA 4FRWA 4HH9A 2VUYA 5EUKB 1V8HA 4HG4J 1MCHA 2R1YB 3WN5B 4X6DE 3HI1B 5AWNH 3RWIB 4S2SB 3WFBH 5DUML 1BBJA 1YN7A 1BX2B 3R0MA 1DLHA 1ZE3C 4LEOA 4AEHH 1TQBC 5E8NA 4X6CA 4PGCA 1AQKL 4R2GB 4X99A 4PD4J 3RHWK 1R24A 3IDMA 1CFSB 5D1ZB 2GJ6A 5H35B 5F7YC 4G6AD 3LDBB 2GEEA 1F4XL 5H94B 4MLIA 2Z4QB 1YEHH 3F58L 3M8OH 3B83A 3FB6B 1MFAH 5JPNB 4PB0H 4U1IA 3IXAB 3ZKSD 3CFCL 4R2GC 5C08D 1FZKA 1U91B 3PL6B 1G7PA 3QQ9C 1LD9A 4ENEC 3BUYA 4MJIA 4FP8H 5FCUL 4QYOB 4NN7C 3WLBA 4YHZH 1CGSL 3MNZA 2F19H 1FFRA 4XPBH 1UWGL 5C0GA 2NY1C 3IDYC 4HZAA 1YZZA 2R2BA 3IGAB 1SJEB 3U30B 3ALXA 4ALAH 4X7DC 4L4JA 4R7DB 1QRKA 4LDOB 3RGVB 1RAMA 2G60L 3QIUA 5DFWH 4FNLL 5TH2A 4JVPA 5CUSH 2UY6A 1MJUH 5L6YL 4K8RL 1VEPA 3FZUC 4ODWA 4RMTA 4D0BA 3VXQA 3QNXA 1NMAL 1AH1A 2BVOA 2XICA 3IFPA 1L9MA 1RPQA 4H1LH 2EDFA 4WI5A 5AZ2L 3E2HB 1G7QA 3GFUA 5CEYB 1KTKE 3HRPA 1UWXH 4K7PH 4LCCB 1XIWB 3O9WC 3D9AL 4XGZA 3MACH 4OZGF 4ZOBA 5ISZE 3QO1A 3P77A 2ZCLL 3D69B 3FT4B 4Q6IC 3WFCH 2W9DL 1UXSB 4JPWL 5CGMA 5JW4R 3BKYL 1U8NA 3GSXB 1ADQL 3MCKA 1M7DA 4Z95H 3O81A 4Y5YA 4QLRA 4OZHA 2P5WB 2EDQA 4X0KA 2LABA 1XZ0A 4YHKH 4OCSL 3V7AE 5TQ2L 3FT4A 2EDJA 4GAGH 2HRLA 1FP5A 5TF1H 1QVOA 2G5BB 1LEKA 5DEFB 5I1AB 3VGGA 4P46B 3IJHA 4F33B 5IB1B 4CNIB 1D9KA 3DHJA 4GMTL 3L7EB 5DJCA 2B4CL 4XCNB 2RFXA 2HN7B 4R3SB 3ARBA 4AG4L 4K7PL 1JGVL 2CR3A 3MJ6A 2OCFD 1CZ8H 1IGML 1NAKH 4PP8C 1S7VB 2NY4C 3H42L 4PYGA 5JW4M 2F9BT 3QUYD 3QDGA 2AK4A 2B1AL 4YXHL 3RPIA 2H32A 1IILE 1W8OA 1NFDE 4JRYE 5DRZA 4PJ7A 5JNYB 2H32B 2ICWB 4OAWB 3K2UL 2GJ6D 4Z0XB 4FQXB 4K71B 1E4KA 1NUNB 1FGNL 4TSAH 5I1GL 4QHLA 5E99L 1H3TA 1S7VA 5EO0A 5HPMA 3O6FD 1IC4H 5HBBA 2M26A 5FM4A 4QHLB 5D2LB 3THML 3VI3E 1YNTA 3F7QA 3UYOD 2R2CA 4R7DA 4N9GB 1PG7W 3K4ZA 1IAIL 3T0ED 3TC9A 3RA7L 1M05B 5JNYA 1MRFH 1P4BH 1UB6A 3S4SB 5JLZA 1IL1B 3I84A 5I9QB 5I2IB 3TBWB 2FECI 4LCIL 1UA6H 3EFDL 3CH8A 3T2PA 1J05A 3JZ7A 1KELH 5DMIL 3UPAA 4ZFFB 1AFVH 3RVTC 1FO0B 5K9KA 1S9XA 3MXVL 4JKLA 3D2UB 3SE8L 2P5EB 3LKSA 2C3VB 2AJVH 2YD8A 4FFWC 5DC9B 1GHFL 1U41A 1GH7A 3WDIA 2X70A 3CMOL 3TN0A 2XG4A 1J8HB 4FZ8H 5IKCA 5ITFA 3BHBB 2NTFA 1FIEA 3T0AA 4JFFE 4FQHA 3TN0C 2YOCA 3P73B 4MB4A 2GAZB 3VD5A 3EOYG 5DK0A 3UYRH 2GYSA 5T33H 1SJVA 1HILA 5ALBH 1AO7D 1BIIA 4OBRA 4KVCL 1OTUC 3PUCA 5CSZB 5MENA 1PVHA 3L5WA 4UOW0 3C6LA 4ZDHA 4K3JH 4K94C 4YHML 4FFYH 4NNXB 4OKVA 2NY0C 4V1DB 3SHSA 3NFPA 4FXKB 5T3ZL 4JFFA 1TIUA 5FO7B 1Q9LA 1INDL 5DMIH 2Q8AH 3M1BB 4LASL 1RIUL 2DLFL 3BMVA 5IFJA 1DQLL 1K5NB 2H2PC 3A6BH 1ZGLM 3U1SH 5FOBA 2D03L 3X12B 5T3ZD 3SKUD 4Y1AA 3E8UH 1GGUA 1NFDA 1NGYB 4I9WE 1X5LA 5SWQA 3BXNB 2WAHA 4IS6B 3RL2A 2Q76A 1T1XA 3WHXA 2O61A 1FLRH 1EDQA 4JHAH 4KXZI 1U91A 2YSSA 1R3LA 3TA3C 5CCKL 5INDB 3TH4T 1IEHA 3IT8D 2IQAA 3MGOB 3MGTB 4HEPG 5D72L 2WBJD 1NUFA 3WNMA 3TNNB 4PJAE 4X4YA 3EOTL 2VUOA 5L2JB 2X9WA 2DQHL 5E00A 1M6OA 4F7MA 1D9KC 1HQ4B 1X9QA 5E08H 3QFJA 3T2NL 1D6EB 1BFTA 3MNWB 4JRYA 1T80A 3H0TA 4U6VH 4XMKH 1QFWH 3DUUA 1A6AB 4I3GA 4FABL 4YHNB 1D5BA 3UYPA 3W9EA 2JELH 1X5IA 3QXUA 4PP1C 5CIPA 4MLSA 2N56A 3TBYA 4MXVE 1A6ZB 3N06B 4D9LH 2P48B 4FQJL 2QV2A 4IJ3B 2KKQA 3BH9B 3T3ME 4MDIA 4OCRL 5FGRA 3T77A 2AVGA 4TPRH 1MCDA 3OV6A 1F8TH 1XR8B 1VHPA 4YUEH 4NO0B 1CFTB 1DP0A 4UV7H 4RMRA 4Y88A 1J0ZA 2LTQB 3DMMA 1J88A 1HH9A 4QEGA 5D7KE 1FYTD 1AQDA 4HAFA 4KK8C 5C1MB 3O4OC 1GC1H 2YXMA 3O6FC 4LOUC 5EC1A 4MD4A 5KSBE 2ILLA 5HI3C 4QHKI 3V5DA 5GPRA 3NCMA 2ITDB 3QPQD 2BVEA 3V0AC 4U1LA 1OGAA 4PRID 4HV8A 5F96H 2CD0A 4JN1H 1NBZA 5KOMC 4JFEA 1JPTL 1MLCB 4NQCE 2VXUH 1HHIA 3ZE0F 1ZT1A 3QIWB 3OJDB 4LSSH 2F8VA 5AAWA 3TNMA 2A6DB 3N1FC 4ELKA 3QSKB 1OLZA 5GGUB 3NN8A 4DK6A 1TMCB 5IB5A 4PRHE 4PB9H 2CDFA 5KSBF 3EO0B 5HSFA 2J5LC 2PTTB 5C0AD 4ERSL 3MBXH 2FX7H 3LS5L 4X99B 2ZUQB 5ILTL 1CGXA 1G7JA 1OARL 3KPNA 4ZPVA 5IEKA 2ITCA 1PW3A 3ABZA 1U93B 4Y2DD 4DOHB 4LPXA 2UUDH 4M62L 2PKDA 5DRWA 4DJMA 2VABA 4NKMB 2A6JB 4L8SB 5EOCL 3F8UB 2OZ4A 4EUPH 5ID0A 3WFDL 1XF4A 3CSBA 2YPKB 3GI9L 2JKXA 4OZGE 1VACB 5HGGS 4E41E 4XVTH 1QR1B 5FGBA 2EH8L 2VLMD 4OF6A 5DRWB 3V5HB 4GH7B 1S5HB 3DVFA 1XT5A 2RCSL 2ZCHL 1H0DB 3RJDA 4XVUD 4A2MA 4OV5A 1N2RB 4NWUH 2WV3A 2G75A 4BQ6A 3FQTB 5B4MD 1JHLH 3V5HA 4E9LA 2BNRD 3K7UA 1T21A 1IAMA 2EE2A 4JCLA 3GUTA 2GT9B 5F89A 4LLWA 4ZYKB 2DQUH 3NVQA 2FX7L 2OXHA 3RL1B 4M8VA 3SCMC 3ZT5A 1WZ1L 3UTZB 3GRWA 1J8HE 2VKWA 2P5WE 3DI3B 3C2SA 3CCHB 4MVBD 4HKBB 3QIWC 3IDGA 5D7IA 1CFBA 2P8MA 4R0LB 1ZHNB 3HZKB 5EIIB 5HD8C 1QEWB 1EO5A 4Q9QH 2UWEB 5F7LB 1DQTA 3ZDZE 3P0YL 4GT7A 3VWJD 5EUOF 5BXFB 1MIEL 3CAFA 2VQUA 1UJTA 4K71C 4F7EA 1KIQB 5DUPH 4HKBA 2V9QA 1SY6L 3QIWA 1T03H 2CKBL 4ODSL 1NCDH 1UACL 1H3WM 1KJ2H 2MOVA 4JFFB 4JR9H 2VDRH 3N85L 3ILPA 5C6PB 4LVOC 5KANG 1RUAL 3VG0H 2A6KB 4UQ3B 5I18H 3FRUB 1U8KA 4JANB 1X5GA 2YPLD 5BVPL 4N0UB 4I1NB 4O4YH 5F7NC 3BP4A 1GSMA 3MJ9H 4FHBD 5J6HA 2B1HH 5HVWA 1GL4B 3LEXA 4OI9A 3INUL 1S5HA 2F8XC 5CEZE 4FXGB 1U92A 5LXGL 3MLXH 2P47B 2ZPKL 4J1UA 1JGDB 4L8SC 4MXWH 3FRPA 3MFFA 2BNQB 3EYSH 5C0ND 4P2OD 3VG9B 5HYSG 4HDIB 1OHQA 2FSEA 4NIKB 5DI8A 3MLTA 1FFOB 1DBAH 2LVCA 4QRQA 3L3DB 2DQJL 3S36H 2ITCB 1LO3H 4N1HB 4WI2A 3OXSB 2CKBH 2CR6A 5DVNA 5EWIH 3GSQB 2EDNA 4R26H 3QNYA 4E41B 2F53E 2JJUA 1CE1H 4HIHA 2VJXA 1K8IA 3BQUC 3MRCA 4LIQL 1OAXL 1S7WB 3MLSL 2X4NB 3G5YB 5EBMA 3VFNB 3CSYB 2DTMH 2NY5L 3V4UL 1UWGH 1U3HD 1GOGA 4BFBD 3RZCB 4EI5B 4NQSA 3U0TB 3DECA 4MSWA 3D85A 4G9DB 2F54B 1OTUD 1TZGH 4DKEH 3QCVH 2ZOKA 4GRWH 3FB8B 4YNYA 4L4VA 4P46D 4K23H 3QG7H 1AP2B 4L5FL 4LCWD 2KH2B 4LU5H 4HPOL 1RZKH 4BZ1H 4PJIF 2EYSB 4KKLC 4G42A 4NM4L 5GS2D 3S37H 4POUB 4LPWA 1MRCH 2X4OA 2YUWA 1LILA 1AQDB 4XC1H 2H1PH 3IB4A 3W0WD 4XBPB 3QIBA 3V6ZB 3HE6A 4NN6B 4KWUA 5L7XH 2W1NA 2GFBB 4C55A 3CSYA 4JKPH 3T4AA 1KF9B 4M48L 1BQHB 4TVPD 4LSDA 3DI2B 1I8MA 1KN4L 1KCSH 5JQHC 5LWYL 1HILB 5DRNB 4Z77B 4X9BA 4KPHL 1UCBH 5BS0B 3HZYB 3MV7E 4LEXL 4M03A 4OLZL 4BK5A 4UAOC 5BZWB 1JZ7A 5JIKA 4OIIH 3MXWH 5GS3A 1S7RB 4L4TA 3GMLA 4ZUTA 4OLVL 3QUZA 3L7FA 5KN5B 1MCPH 1X4XA 1EH9A 5I1KH 1ZTXH 1R3IH 2IH3B 4Y19D 5DD5H 4IRZL 2GJ6E 1I9JL 1EHXA 4IMKC 2E7LE 5IB1A 1BOGA 2FR4B 4PJXF 4MXQD 2YPLA 3U4AA 1HXYB 1B6UA 1NQBA 3MLUH 2BHUA 3SEPA 4ODUB 2DI9A 1AY1H 1JNLH 5AUMA 3EYFA 3RVTD 1ES0A 3NIGF 3Q3GB 1LO5B 4KU1A 4OZFH 3OB0K 2BY0A 5IVXE 4L4VB 4BJLA 2NY3D 5E4EB 1I1YB 4DCQB 1C7SA 1Q9KB 4S1RH 4Z7QE 1KCVH 3KVQA 1N64H 1PLGL 2AJYH 3VFMB 3D0LA 4KUCD 1EA9C 5EU3A 3T3PE 1JK8A 5T5FH 2JJTA 2HT2D 3O4OB 3RWCA 4XH2A 4CU7A 2J88H 1IM3A 2FECL 2FJFB 1S78D 5KANI 4NJAL 2OSLA 5EORH 1A7RH 1FE8L 5HYSA 1FAKT 1R5WA 5DD6B 1G7QB 5CEYA 3RAJH 1M05A 4C57C 5DK2A 1FCCA 4MS8A 1RSFA 3N0PB 4MD0A 3AM8C 3MFGB 1VEOA 4N9GA 5C07D 4NQTA 3ULUF 2I9LB 2PNDA 3HC4H 1NGQH 5DO2C 4DZ8A 4Z8FL 1T2JA 3HNSH 1IGJA 1F42A 1YPZA 3VXRB 4KKCC 4OLUH 4Z7WA 4NSKA 4Z78A 1JFQL 2IG2L 3BP5B 2VOTA 3BPCB 5DMGC 5IBLC 3GMLB 4ZUTB 1I3GL 3CFBB 5EO9B 3SPVA 3TEUA 5DVOA 4AJ0A 3BPLB 4P46A 2FJGA 4PRAB 4E42B 4HCRL 5DK0B 5C07E 1OAZH 4BFEA 3W39B 2L0DA 2HT4D 5I16B 5A2IH 3MX0A 3FOMA 1NKRA 4YDIH 3IXAA 1LO0H 2P42B 5IMOB 3O2WH 5D93B 3OPZL 1ZEAH 4U7MA 4OZIA 2R0WH 3EJYD 1NBYB 1FDLH 2XZCH 2EICA 2VN7A 3QUML 5HYIA 5KSBB 1LNUB 1WIPA 4ZSOB 3S88L 5E94B 4IRSB 5D7IE 4YO0A 2JCCA 2WP3T 1KJMA 4RZCA 4X6DF 3JWOH 1EEZB 3PV6B 5CSGA 5E2UH 1ADQH 3V5KB 4R4ND 3QISA 1IT9H 1I8IA 1KG0A 2QQLH 3IDJB 1A4JA 3G5ZB 1Z5LB 3RKDD 2NW3A 4NNPH 1ZLVK 4PP1D 2ICWJ 2OK0H 4NC2B 5C0AB 5HVHB 3VWKD 1ITBB 3MLYL 2NPLX 3GEWB 2VDPH 3QRGH 1F2XK 5C0FB 2Z31A 4MNGB 4OF5A 1MI5D 4PJHF 4U4BA 4U1SA 2Q6WA 1NC4B 2B4CH 2ZG1A 3PGFH 1DQDL 4UTAL 4FQ1H 5T3XD 2B2XL 4E41A 3X3FL 2VL4A 3TCLB 5EOTB 5JMRA 2NY0D 1NAKL 3BYTA 3S7GA 5GHWL 4HGWB 5F7KC 1U95B 2QLVB 4KROC 5FA3B 4XVJL 3IVKA 1VPOH 1NEZA 4GG8A 2H2PD 4QHNB 2CSPA 2AJ3B 1QBMH 1P4LB 4WU7B 2D0HA 5IMMB 4UAOB 3AXLA 3BGMA 3UBXB 3RBGA 3R8QA 5GGQH 3AS0A 2FNBA 2RB8A 1DBBH 3FQTA 3BDXA 3STZB 4LDEB 1GXEA 5T5NG 4O58H 4J4PD 1PQZB 1T20B 4PJDB 5BVJA 3CDCA 5BOPA 3VXUB 3CDFA 1WISA 4Y5YC 4LHUA 2Z93B 1INQB 4LNRA 4PJIB 2QR0A 1KJ3H 3GSXA 4TNWF 5FA4A 4C58B 4L3AA 1CWVA 4M1GL 4JFDA 1A2YA 4M7KL 1S8DA 2R1YA 1U8JB 4F7CB 4AIXA 4MQ7A 4YHNA 2WSKA 1N5AA 5ERWB 3FT3B 1W0VA 3N1MC 5D1XC 5JIPA 2DWDA 2VDLH 3D5OF 5BVJB 4N5EA 5E8NB 5E4EC 4UMGA 1H3VA 5B3NA 2AGJH 3QFDA 3U0WL 5L2KB 4G5ZH 1C5BL 1UKTA 5ESAA 4WY7H 2JLLA 3WKNA 2DLIA 5CZKA 4S2SA 3FAWA 4L8CA 1GPOH 4RFNB 3BZ4A 4YGAB 4CMHB 5E7BA 1KCUH 1XGTA 2ZNXA 4HWBL 5GGUA 1JYNA 1U58A 3CMGA 1KJVA 5IG7A 1N7MH 1ED3A 4KH2A 5K59F 1MAML 4K2UH 5B8CC 3TO2A 4JDVB 1JF6A 4LVNB 4Y8DC 2QHRH 4L1HA 4BM7A 2Z31C 2X1XR 4MQSB 1U8PA 2XNAB 2CIIB 2N7AA 4XAWH 1K8DA 1I8LC 4P23C 1G0DA 4K9EL 2E7CA 3CVIH 3ARPA 4M6AA 4WI3A 3LKNB 3LEVH 3SO5A 4FA8A 4JDVA 4BZ2H 1JF1A 2A83B 3G08B 5C0IA 3BPLC 3V6OA 1RV6X 4JFYA 2I5YL 1NAMB 4OFDA 3VFRB 5IW6A 3N9GL 1XGTB 4ZTPL 1BWWA 1AI1L 2QQQA 4UT9L 5C7XH 3EKCA 3W9EB 5ID0B 3QQ4B 3SQBA 1MI5A 2JIXB 4EOWH 3H2WA 3H0TB 4MCZB 1S7UB 4HWBH 3BVNA 3GSNL 2HVJA 3EOAA 2AQ1A 4HWNA 5JO5B 4AIZA 1CFQA 1BM3H 1KIPB 2HVJB 2E7MA 3EOAB 4TYUA 2BXYA 1ZXQA 2O5XL 5HYEA 1MSPA 3PWLB 2EECA 1JI1A 3AROA 3AREB 3DJ9A 2W65A 4HS8L 2AI0L 4RGMC 1KIRB 2W9EH 1J8HA 4GKNB 5C0JB 1A8JH 5CLTA 4G6MH 4Y16A 1DBKH 4YBLB 4RQQB 4MXQC 1DUZA 4PGEA 1BD2B 2QBWA 3BWUC 3BKCL 3T0EA 4QXGL 1U36A 2KPNA 1FV1A 5E8OB 1SEBA 2NLJB 3VH8B 4PJHA 1BIHA 3IAGC 5A1AA 4JLRA 2WY3A 3V5DB 3DRTA 4LKXA 5H37H 1MCOL 5IQ9B 3OBAA 3IXTA 3KNBA 3KPSE 1JMXA 5MHSD 2Z35A 3ROOB 4X7TB 4U2ZA 3C60B 1YJDH 4GG6F 1B90A 4IIQA 4GFTB 5LGHL 1U42A 1A3LH 1MIEH 5B39A 4ZDHB 3DARA 4KKAC 2AEPL 3H9HB 4WUUA 1N4XH 2XNAA 4F3FB 3GSUB 2XN9A 2NX5E 3O3EA 9CGTA 3ELAT 1VFUA 1FV1B 1EEZA 3PV6A 3PWJB 3E1F1 2IGFL 5IFJB 1T7VA 1DR9A 2ESVA 43CAA 4TOYL 3U2SB 1RUAH 2VLKB 3DO7B 5DJYB 1AO7B 3FOLB 4O2CB 5ITBL 1C5CL 4Q7DA 4MWFB 1F4YL 5MEND 1MNUH 3AY4C 3MV8B 3K80A 4NC0B 1MVUB 2B0SH 5IVOA 2G9HA 5D2LF 5SWSA 2R1WB 4KI5D 3L1OH 3LKPA 3RTQA 4KRMB 2FATL 4O5LH 2OJZL 3NTCH 4HUVA 5E00B 1QRND 1MJ8L 1RK0A 1T3FA 3HC3H 3D2UD 5ECJE 2MCPL 4KHTL 2P45B 3QUZC 1JGUL 1XGPA 2P5ED 1Q8MA 5J6GA 2UUDK 3H3PH 3S4SA 5JLZB 4R90L 1FCGA 4E0RA 4KQ3H 4BSVB 3HE7D 4GRWE 1DFBL 2NW2A 6FABH 1IGCL 1VGKB 3STLA 2CRZA 3V7MA 4W81A 5TE6H 4CL7A 2R15A 3ZKQD 3MMEA 4XCCH 4RBPK 4D9QD 3BEWA 3NZHL 1RZJL 1YUHA 1DANU 2ARJQ 4YHLL 5C0EA 2HH0L 3UAJC 3U6RA 3MGAA 4YGVA 1RUKL 3FKUS 4U2YA 4Y2DB 3MTRA 3AS1A 1J7VR 3QIBC 1VADB 4NQXA 2PXYD 4LFHG 2EDOA 2V2WA 3HN3A 3VGBA 2AEIT 4RDQF 3O3UN 3P11L 4NSKB 3O6FB 3SGDH 3BO8B 1CFNB 4NQVA 1II4E 3D48R 2CGRL 1PZUB 1UM4H 3UTTB 4JQVA 4ODWB 4X8XA 5JOFB 3EUUA 1QUNA 4JE4B 5IR1B 4ZUVB 2XG5A 3UJJL 2A2QT 3UTTA 1RZKL 4Y19E 5J8OA 2I9LA 3IRZA 4PRPB 2DDQL 2CDEB 3MODH 2VLRD 1CXEA 3H3PL 2ENYA 4KZEH 4XP4L 1F11B 4RBPH 5C2BL 3GK8L 4FQLL 1SYSB 2BC4A 1NCCH 3EJZC 1AP2A 3DX8B 3P9WB 4PJEB 2NZ9C 1JGVH 3OAYK 4WFED 2JB6A 1YMMD 1FNGA 4HIXH 3P73A 3BJ91 1WCBB 3QUXA 5GJSL 3IF1B 1N6UA 2BSTA 3NA9H 2YD2A 4UIKL 1IAKB 4Z0BH 3QDHA 5EDXA 2NW3B 4Y4HD 3B5HA 1NGPH 4JO1H 1L7TH 4K3HA 1BZ7B 1FZKB 4YC2C 3MCKB 3IFLL 3MRPA 5DJCB 5FHBL 3S6CA 2MHAA 4HZLB 3O4LB 4JDTL 1FN4B 1HKLL 1CICA 5DD0H 4LMQI 3IF1A 1PZ5B 4ODUA 4NP4H 5D7LA 1HIML 5DQJA 4YLQT 2XTLA 2ESVD 5H2BB 4LCCA 5DHYA 5ANMA 3B3IA 3GBNH 3DO3A 4OB5H 1AIFB 4RAVB 1L9NA 4Z7VA 4KDVA 2WBJC 4KTEL 5JZ7D 3CVHL 4LLQB 1HHJA 3SDDC 5JDSA 3L7FB 4XX1E 5KN5A 4JHWL 4MQXD 5HHQB 3GIVB 3V0VB 3MBEC 3K8KA 3TJHD 1KOAA 1AXTL 1TJHH 1KELL 3BSZL 4PREA 5DJ0B 3VXUE 1IEAB 2NMSA 3Q1SH 1XCTA 1OP9A 2QADB 1X5AA 1MOEA 5JUEH 3R1GH 4XCFH 4ZNCD 1KB9J 1L7TL 5DRZB 5F21B 5IESH 2VC2L 2OL3H 4YPGB 3E2HA 2YD6A 2NX5D 3PF2A 4Z7NF 4UTBH 2ATPA 3QNXB 1IM3B 3O8XC 4WHTA 2A0LC 2ZUWA 5GGRB 3TO4A 3MRKB 5CGTA 5TH2B 5GGRA 4BSWA 5GIRB 4UT6L 2X7LB 2IPUG 3GKWH 2XRAL 3MACL 4TVSa 3R0NA 3O45B 3ALPA 1MCFA 4XBGB 3DVNA 1NCWH 4NCC1 5GRZA 1NAML 4P5TC 3RWJB 3T1FA 5ELIA 1FAIL 3KPSA 4OLXL 3WIHA 5B38A 2OX5A 3PXHA 1MCBA 5E6ID 2CK0H 2QQKL 5T3ZH 5T1LB 4OQTH 1M1SA 4JFQB 2AEQL 4JB9H 3NBNA 3RWDA 4YAQB 1A1NA 5F9WC 4P5MB 3QQNA 2C7UA 2DMCA 5IFAL 1FFOA 3QEHA 4YXLH 1IGTA 1A6WH 2Q86B 4Z7OF 4EI6B 4OFIA 4L4TB 1FJ1A 4R7NA 5E2WH 5FK9B 1FNHA 3D69A 2BFVH 2XKNA 5IBUG 5IHZA 1KUMA 1YEDA 1LP9F 2Y72A 4YDIL 2D0FA 1IC1A 3LD8B 1K6QL 1GGIL 1G7MA 35C8L 3MV8D 4U1JA 2IH3A 4WO4D 1NLDL 3QUXD 1D5ZB 3AU1B 2GTZB 5DI8B 3KPPA 4Q9RL 3S88H 4OI7A 2MQ0A 1MFEH 5BJTA 1OP3K 4XNXL 2PYEA 1ZSDA 3LQAL 4YXKH 3HMXA 4JZJB 5IW6B 2CK0L 3P30H 1AHWB 4Q6YA 4NO2A 2QKIB 2X89D 4EQ3A 1BQHG 1WBXA 4U0RB 5GS0H 5E08L 2FIKA 4PJ5A 4NDMA 2Y07L 3GMOA 4G6FB 1K4DA 3KJ4B 4KK6C 2IAMA 2FH8A 3NIDF 5T3XL 3V7AG 1IAIH 4LLMB 5IROA 5KS9F 3TA3D 1JK8B 3UDWA 4Y4FD 2AABL 3MRBB 1NANI 1UZ6F 3HFMH 3LQMA 5I15H 3VFWA 1UA6L 3EFDH 3G5YA 3TPUB 5HY9B 5DR5H 4QRRD 1R0AL 3QWOB 3WYRA 3GMRA 4HBCL 4GBXB 2CLRA 2VLLA 4YUEL 4CKVX 1MFBH 4S1RL 4QHKJ 3MNVB 3X13B 5J9PA 5E9DE 3RWGA 2CXGA 3CJJA 4I5BA 1MHHB 3NCEB 4ZO9A 3L9RA 2XZQL 4PG9A 3E3QA 3I2CH 1ZHNA 1F58H 5FECA 2H6PA 3T65A 4LPVA 1TJIL 2F53D 5A2KH 4ZUUB 4NJAH 5EORL 1A7RL 5FYKD 5IB2B 4U6XB 5C92A 2AJXH 2PUQT 4QNPF 3A6OA 4UT7L 3QEQE 1MHEA 5HPOA 3MJ8B 1W72H 3WO4C 3EZ8A 3RWFB 1JTPA 1NLBL 4JFDE 4PJAF 1SEBB 1KJ3L 2R2EA 4JY5H 4XXCA 1IC7H 1KN2L 4XHJC 1OWWA 3CDGA 1TVBB 5E70A 3CFJA 3QCUL 1INDH 4G59A 2YZ1A 5CZXD 1I7ZB 4PRPE 1UG9A 2X09A 1MCQA 3MFFB 4MX7B 2MCG1 4UIMB 5F1SA 2FO4B 4IMLA 5GGTH 2CKBA 4BH7B 3ARZA 3I2CL 4IOSD 5TE4L 1HWGB 1KCRH 2XN9E 4CVXA 2JB5L 3ZZ1A 2FD6H 4U6HA 1V3JA 3MRMA 5EZJB 1EHLL 3O2WL 2NR6C 3DSFH 3QUMA 3UO1L 4HLZH 3F7VB 3FO2B 3TNNA 5ESAB 1JHTB 4XP9L 5DD1H 2PCPB 4PLKD 2BCKA 1AGEB 2AJZA 3HHRB 4P5TD 5C0IB 4OJFH 5DWUH 5GGSB 1YEEH 4NWTH 4M8QB 4WEBH 2VSDA 4W4OA 4JFDB 5CBAA 2VLJD 3F7VA 2MKWA 1TETL 5BO1L 1KB5B 1OTTC 2DAVA 2CIKA 2AQ2A 3DVIA 3D18B 2HFFB 5I8KH 1G9NL 2GSGB 1IVLA 4OV5B 1OAKL 3WD5L 2XQBL 4YHIB 1WBXB 2VSCA 3PQYE 3BPOC 4JAMB 4JKWA 3I9GH 4KFZC 3STZA 2CXKA 1UZ8A 4ZQKA 2GCYA 4S0TD 5J13B 5I1CL 5A3ID 3GSOA 2Y4SA 4OUUA 2F54E 2SEBA 4F80A 3GHBH 4NN6C 4LLWB 1RU9L 2YPKA 4W4NA 4OZIB 4Q9QL 3NH7L 4QXUL 3BZ4B 1T89A 2DJSA 1SJHB 1RIHH 2FEDD 2IH1A 5LJYH 2R23A 2P7TA 4P3CH 5DSCB 5HDBE 4OSUL 4APQB 5JHDB 3WJJA 3HC0B 1IGFH 1IBGL 2EH7H 1AGCB 3FJTA 5EZIH 1UXWB 5F7MC 4RGND 2C4XA 1E6JL 1MFCH 2GJZB 4NFBA 1I85C 3R4DA 4NQDD 3HCVB 4MQ7B 5EBWA 5CIPB 5E6ZA 5DJ8A 5C07A 4YR6B 5DQDH 1Y0LA 2G5RA 2OQJA 3DTXB 3MRFB 4Z5RA 5IP4A 4Y4FB 3P9MB 1YY8B 5I73C 1JF1B 2A83A 2OBGA 4LPCA 1G7JB 3KPNB 4RWHA 5IEKB 4W4OC 2XV6B 2GUOA 3NACH 5L2JA 3BXNA 5T1MB 1G6RB 3F7RA 2QADC 3H7BB 4HXAL 4LSSL 4RX4A 3REWA 1FRGH 1UM5L 3DLQR 4GRLA 4NDMB 3HZVA 3MGTA 3MRQA 2ATKB 3MRRA 3NN8B 1H15B 5GS1C 1FO0L 4G9FD 2JCCB 3FT2A 4P48A 5INDA 2YS4A 1MWAL 3JTSB 2RAMA 3FFCA 3K4DA 4BUHA 1D5IL 1T0MB 1LO3L 1X3DA 1A6VH 4ZPTB 4O02L 4ZS6C 2F5AL 5CJQH 2XWBA 2ED7A 3GIVA 3JBG7 3OZ9L 1QSZA 5DJ2A 3RBSA 1NDMB 1W0WB 3ARFB 2MWCA 3PWVB 3TV3H 4G3YL 4EXPX 43C9B 4PJ5B 1MFNA 3RQ3A 3TIDB 2DQTL 1QNZL 3ARBC 5HDLA 2Q6WB 5CJXA 3GI9H 4L1DA 5C0DB 4XP5H 5ETUA 1TVHB 1WIUA 4I18A 5HGBB 1DSFL 1HH9B 5SWZB 4Z95L 4M6NH 1D3CA 1QFUH 5KJRH 4HK0B 2PR4H 3EDEA 2C1PB 5JR1H 2W0LA 1GOFA 3VXMB 2V6HA 1RI8A 4E0RB 3ZDXF 3ARWA 5K9KB 3EYQD 1BREA 2FL5A 1QFOA 3SKOA 1MHHA 2BSTB 5I1HL 3N9GH 4NUJB 4PJDF 3OAUL 4NO5A 2IBZY 3D3VB 5IK3A 3O2DH 3BE1L 1SYSA 2BC4B 4Q6IA 2CRIA 1B0WA 1CZ8L 1QLRB 4ELKB 4HK3N 3E3QC 4S10A 4S1DC 2QEJA 1RJYB 4J3UA 1QNZH 4IJ3C 2X7LA 1HNFA 4GMSH 4WEMB 4O9HL 4ZXBA 4EN3A 2X4OB 2R0ZH 4TUOA 1NFIB 3GGWB 4PTUB 4OLZH 4KQ4H 2XY2A 4XGZB 1T03L 4LF3B 4OGYH 4EVNB 4QY8A 1I9IL 3C2AL 3U9PL 3UTSE 5L2KD 4HT1H 4PJ9A 5IEHA 32C2B 1ZWIA 1BD2E 3BWAA 1FL3B 4XNUL 4I0PA 4F3FA 1U3HC 1QSFE 2HRPL 1F2QA 4QT5A 5ADOH 3QFJD 5K9QG 2IAMC 4L9LB 4LHUD 3LH2L 4U1GC 4XNQB 3S5LG 3MLPA 4X4XA 4JM2B 4QHUA 5F7DB 3A6CL 4IS6A 5F1OB 1CTNA 4F8TA 1CXLA 3PG2A 4FQLH 1F4WL 4X7TA 3MOQA 2YHGA 5IGXL 1MCCA 2EDLA 2EO9A 1RVFL 2HN7A 4P9HC 7CGTA 3W5NA 3WL9A 3QCTL 2VXSL 3QNZA 5KVDL 3QUZB 4AM0A 3KWWB 2NY3B 2OSLB 4G7VH 1P69B 4N5ED 3IJHB 5JDJA 4RX4D 2YK1H 2CUMA 3UTPD 2HLAB 2IANA 4KKAD 1CDYA 1A3LL 1QA9B 1TCMA 4ORGB 4TULL 5EU3B 4G43A 3C87A 4ZFZB 1KCGC 3SO3C 2AEPH 5TF0A 3T0VA 3V0VA 5BS0E 1SY6A 2DM4A 4WI9A 3RDTD 5EWIL 4HAGA 4U1MA 1OAUH 3T04D 5JOPE 4Y16B 2R9HD 4BSVA 2DQEH 4XTRC 1C1EL 4N0CD 4M43L 4X5XA 2P5EE 4M5ZH 3QPXH 3VGAC 4FXGA 2KZ1B 4Z7OE 1RURL 5D7SH 5BMFL 4PPTA 4DFIA 2DTML 2NY5H 3D0VA 4UU9B 4Z7WE 4Y89A 3KWWA 2VL5B 5BS0D 1F11A 1A1OA 1M7DB 5GZOD 3TVMA 4OZGB 1ETZA 5KSUA 4MB5A 3ZYJA 4CW1A 3S97C 1UVQA 1F97A 1S7RA 2MCPH 1AO7E 4JO3L 2ZG3A 1EO8L 2O5ZL 4V2BA 1U3JA 2VLRE 2JK5B 1I75A 4YFLI 4OQTA 5FF6B 4Y4FC 2H26A 5DVKA 3L5IA 2LVEA 1RUPH 2A1WL 3QG6A 5FOBB 5HYSB 2IPKA 3LIZH 3DRTB 2EDRA 2WIIB 4I8DA 4IHOA 3V52L 4GQ9L 3WEXB 2CDEA 4XCCL 4XMLH 4Y2DA 2JK5A 5EZOH 1PY4A 3O8XA 4KMTH 1RZJH 5FDWA 3BAEL 4YHOL 2NLJA 3VH8A 5F7UA 1RMFH 1KB5L 4LARL 5HHXL 4YHPA 3NCYS 3SDXB 3VFPB 3WBDA 2C4FT 3OJMB 4IIQB 4JM2A 4QTIH 3VRLE 1GIGL 1CGVA 3C6LB 2HJKB 5DQ9B 1NSNH 1J1OH 2B1AH 4YXHH 1ETZB 4P3DB 4H20H 4KC3B 4LSTL 5AYUH 1MHCB 2EDXA 5JPNA 1Q1JL 5IHUH 3PDOA 2EYSA 4JFPB 3WFEL 3P11H 5HJ3B 1H3PL 2BNQA 5DT1H 5J3HC 1FFQA 4ONOA 3T2NH 3VJ6A 4RMVA 2X9XA 1PZ5A 1S9KC 2P8LA 2WBJA 3EO1B 4ZODA 4I0PD 4Y0GA 5ACLA 4TVPH 1OTTD 3MODL 5J1SC 5GRVK 3U9UB 4LCCC 4RISH 1O0VA 5EA0H 3UTSA 1RUPL 2A1WH 2NW2B 5SWSB 3VWKB 3FB6A 4UI2A 1AD9A 1WC7B 3MV7A 4NRZA 3WHE0 1A14L 1JNNL 3SJVA 1W72B 2HA1A 5D1XD 4JRWA 5T1DH 1CICC 3U4BL 4F33A 5EUOA 3CSGA 4MWFA 3QNYB 4HJ0D 4KHXH 4PLJD 3QUKA 1NLDH 4HUXB 2DQGL 3NPSB 5F7HA 2OLDA 1KPUA 3B9KB 2IPTL 2H3NB 2YMXH 1NSNL 3ES6A 4OT1H 1IQWL 2LQRA 1PAMA 1FNSL 3MJGX 1GZQA 1QBML 2VZOA 2CIIA 3KJ6L 4RIRB 4JY6B 4YWGH 1VENA 3CZFA 1A7PH 1S5IH 4PJEF 2BVUA 3ZTNH 2VZSA 4RMQA 5F9OL 1FYTA 3L3HA 3LMJH 4NBYB 4L4VE 2JJSC 4NZJA 1A7BA 3ORJA 5IIEA 4LLVA 4KJWC 2GSGA 3M45A 1B2WL 2BHYA 4KK9D 1M71B 3MV9A 3U4EB 1KT2A 4JQVC 4U1LB 5C0CB 1K9TA 4OLUL 4K3DL 4XVUC 1ACYH 1T66C 2BVPA 3ZT6A 2QQNH 1S3KH 2W9LA 1WSST 4JFXA 3OX8B 1P2CB 2BX5A 2F74B 2NY2D 1PY9A 1FZOA 2PXYB 1DQLH 5J1AA 4X7SH 4AH2B 5HD8D 3U0WH 1MVFA 3L3JB 1MQKL 4LHJB 3GO1L 1C5BH 1GC1C 1KPRB 2XTJB 2ZOLA 2F58L 1QFWM 4RNRA 1A7OL 3EO9L 3RIAF 1KG0B 2VQ1B 3E3QE 1I1RA 2Z8VC 3EYVA 3AAZB 2HT3D 1CFVH 1JHKH 5EZJA 3UX9B 1N7ML 2FHBA 1E28B 1P1ZB 2GITB 4CU6A 2X4RB 1W72L 3B6SB 4XXDB 3GBMH 5IMKB 2PTTA 4JHZA 5T3XE 2W59A 2BY3A 1PGRB 5J0BA 4A6YL 5E56A 3SO3B 4DGYH 4UV4H 1JGDA 4HPYL 3MJ7A 4GW1A 1WEJH 4JG1H 1T1WB 3CFJB 4PRHB 5FCSH 5GJTH 2GY7B 4L4VD 1DEEB 3V6FA 3TIDA 4EBQL 1RUML 1ZLVH 2OJEB 4N0RA 3BN3B 5J12B 5C08E 5MEOB 1LO2L 4NQCB 5KSVB 4S0SD 2XI9A 2FO1A 4YHMH 5FKPA 4KJQC 3QDMD 4UDUB 1YMMA 1FG9C 1YEKL 5TDPB 2P43B 2Z92A 4Z78B 4HKZA 3HNTH 3U7YL 4QHNA 5E9DD 5GGSA 4N8VA 5HGDA 3LN9A 2J8HA 4GAJL 5FA3A 1XF3A 4FMKA 4IRSC 5IVXB 5DVMA 4QRRE 1YN6A 1PJ9A 4RSVA 1X7QB 1IEBA 1YC7A 4MVBA 4IIQC 3VXNB 3DV6B 5T5NF 4JZNA 2V9TA 5T3ZE 1KV3A 4OJFL 5DWUL 3VXNA 3MROA 5IIEB 4NWTL 5B21A 3RI5F 4IDJL 1Y18A 4NHUA 4QNPE 1IAIM 3KLDA 4PGEB 4L9LC 5GS0L 2EKJA 2LE9A 5C0AE 2DYPA 2CJUH 1UM6L 1BQUA 2DMBA 5DHVA 1E4XI 4YR6A 4XPGL 4JFZH 3HNVL 3QDJB 5EU7C 1IGYA 4PY7B 4FMFA 1BAFH 4LLDB 2K1MA 4WGVB 3TVMC 2ADIB 2YA1A 4P2CG 1C7TA 1PKOA 2QR0B 3CSPA 3MNWA 4JRYB 4XPHH 5I1CH 4S1QH 4MXQA 2AABH 3V5KA 3ZDYF 1SHMA 5HHMA 1IJ9A 3LPWA 4XBEH 3QFDB 5F88A 1OB1B 1MEXL 3CH1A 1DL7H 4KJWD 1U8HA 2P8LB 3MREB 4K7FB 4D0CB 5E94A 3BIBX 2IH1B 1HXMA 4ZOEA 5DYOA 4RWYH 4LVHC 5EU4A 3HRZB 1IGFL 1AD9B 1WC7A 4PG2C 1G1CA 1Y6MR 5JIHA 1QPPA 1IGIL 5L88L 3OSKA 1GPOL 4GW5A 2A0LD 5BRZA 3TYFB 1RUQL 3QEQD 3TT3H 2L7UA 1GZPA 1S7XA 5F6IB 5GRUL 5EOCH 3VJ6B 2NY1B 3W11D 1FVEB 4G8GE 4KRLB 3TF7A 4OF3A 2IPUK 5I74C 1IL1A 1BAFL 4MNQE 1MCLA 3A67H 3SDCC 3L1OL 3MLVH 1A5FL 3ARYA 3BISA 4O5LL 4PJBE 1KN2H 4FFZL 5HHVL 5K9JH 4OCWH 1KJVB 1GGBL 3GI8L 3W9DA 5GS1B 4UBDD 1KIUA 4BSJA 5EO0B 5I17A 4LVNC 3CVIL 1NEUA 3KYNA 4GBXD 1W0YT 1U3HA 4I0PC 3ULSB 2H9GB 3S5LA 1XCQA 1ZGLA 2NY2C 1T7WA 4MA1B 5B8CA 3UJTL 5KS9B 1Q94A 4OD3H 4CMHC 4I77H 5ESQA 1BFOA 3C08H 5A2JH 2R0LH 3VW3H 4LCWA 4PJ7E 4KAQH 4GKSA 1KTLB 5L7XL 1D5MA 1FH5H 1A6TA 5I1JL 3RWEB 2AK4E 5ERWA 3G9VA 4NKDA 5JPMA 3MA7A 1UVQB 1RUKH 3RZCA 2AJSL 1I1FB 4GKZB 1LMKA 1P5UA 3FO0L 4DN3H 2X44D 3PP3H 5KSAD 1B9ZA 2D2OA 3VFNA 3K3QA 2C3VA 15C8L 4X6EA 5BV7C 1WFTA 3QT2A 5F3BB 3MLVL 3TFKA 1BLNB 3QH3A 3OKOB 1UJ3C 3D0VB 3D25B 1MY7A 2HTKD 3GJEA 5DFTA 5SV4A 4U1HA 3CFCH 3VXRE 4JPKH 5DURD 3SKOB 5I1KL 1BJMA 3BUTA 4X0KB 1Q9OB 3H3BC 3HI6L 4MDJB 4IRZH 5C71A 1XR9A 3MLWH 5IMLA 3UTTE 2F19L 3QEHB 1BP3B 4GXUN 4HDIA 3GRWL 4OD3L 2WP3O 3NCYP 4WI8A 4WNQB 1YPZB 3VXRA 1MCWW 4PBWD 1GRWA 2VXVH 5BZWA 1F90H 3REVA 1MCOH 4HIXL 5IVZA 2PETA 1U92B 3OAYH 4QRRB 2YBRA 3F12A 1OCWL 4QXUH 3FMGL 2PYEE 4G42B 4KUCF 2WIMA 3GMMB 3W0WE 2QSCH 1Q0XH 5ISZA 1CDGA 3BQUB 2B5IC 3P2TA 4MA7H 5GSRB 4M6OH 1VFMA 4N0UA 1HE7A 1MCWM 5EZLA 2VXQH 4LQ1A 2A6KA 5JXED 3UJIH 4JDTH 1N26A 1G7LA 1T1YA 2YKLH 2Q76B 1MIMH 4AMKH 5F8QC 4AZ8A 1WCBA 3VFGL 1KPVA 2HFGH 3BWAB 1AQKH 3VXSB 2ZCLH 3OXRA 2DKSA 3CVHH 4LF3A 2OTUB 1INEL 5H8DA 1R3HA 3SDCA 1HQRA 1J0IA 2VXVL 3B2UD 3TBVB 3VRIA 5GRXG 1VFAB 4ZMAT 3OXSA 1T22A 1CK0L 5SWSE 3VRJB 2VISA 3FO9A 5C9JB 3TJEL 1RZIB 5IWLA 2EXYD 1WWBX 5L8JB 4FP8L 3RIFK 2YUZA 1SM3L 1SMAA 4MNQA 1QLRA 2C1PA 1YEJH 2UZXB 4RAVA 1NCBL 2GT9A 5KTEH 1AGDA 3RPKA 1XCTB 1MPAH 3BDBA 1OP5H 5E1HB 2DKMA 5HGBA 1OT2A 5DJ0A 4PG2A 3QAZC 4J3XA 4X8JA 3BH8A 4N8VG 3U6RB 3JWOC 3DGGB 1CR9H 5FYKH 1I7TA 2D31B 1C1EH 1AGDB 1CT8A 2NY4D 2EEDA 3OKDA 2PW1B 3QDJD 3QPXL 1RHHB 1DLHB 5D8JL 4HC1H 3ZSSA 2IQ9L 1FSKC 3DBXA 4LLQA 2BNQE 2L7JA 1F4HA 1KJ2A 3VCLA 3WXWH 4UUJB 2VISB 3ET9F 2X40A 5IW1A 3NCCB 4M02A 2WZPD 4DVRH 1IMHC 5E2UL 4HH9B 3D3VE 3HZYA 4YZFE 5CHNA 3QIUB 4LEXH 1IT9L 4G80B 4TSBL 4WTZA 1YQVL 5EO1B 1X4YA 4Y2OA 4OFYD 4FS0A 4G6JH 4Y5YB 3MRRB 4HQQH 5C70A 2W9DH 4DW2L 4JM4H 4C56E 1J9CT 2VDPL 3BKYH 2GFBA 3FFDA 3MOAL 4UDTB 4YNYB 3QA3A 4PGDA 4A6YB 4YHYC 4C59B 2PTUA 1BZQK 1ZLUH 3SKMB 4XP4H 3V6ZA 3OWEA 2D7TL 4X4XB 1H5BC 5CJOL 3DO7A 5EN2A 4RAHA 3LZFH 2ENSA 5DJXA 2BSRA 5C0RL 4GAGL 2Z4QA 3ARVA 4KMLB 4P49A 5D8JH 4BQ8A 4ETQA 3MRQB 5DA0B 5HHOB 3HPLA 4TUJA 1ES0B 2I26N 1T5XA 1JPSL 3GSUA 4XNXH 4GMSL 5EG6C 3LEYL 1XGRA 2AJVL 4JQXA 4OUOA 5FUOH 4P9MH 1BWMA 2R0ZL 5IHUL 4Z18A 1YEIH 4AG4H 5HI4D 5C6TH 4WWKC 2VKXA 5HI3D 1J8HD 5JDSB 3UPCA 5GSRA 3WMSA 4R96B 2QSVA 2Y07H 5C08A 3V6OE 4XVSL 1B88A 1HHKB 4PD4K 3ARGA 3GBNL 4OB5L 5I1DA 2DIAA 1K2DA 1S7TA 4NJ9L 5E2TH 5IVXF 3C8DA 1A64A 4DKAA 4Q2ZA 1M4KA 5IT2H 2DM3A 1E0OB 3F58H 3M8OL 4EXKA 4BFGA 1C08B 4PB0L 1A6ZA 4PUBH 1T2QH 4PP2B 1R3IL 4JN2B 1OSPL 3ESVF 3G6JE 3VXMA 2GKIA 4JDZB 1EEYB 2JJWA 3OKYA 1X5HA 3L3OA 3RA7H 3LQAC 3RKPA 4LK4A 3DUUB 3PP3K 4PS4H 5C0BD 5TQ0L 1J87A 2ZJSH 3QO1B 4QGTA 4KK5C 4P5KA 1FYTE 4ODXB 3D25A 2X4RA 3DX8A 3ULVC 3HUJF 1QSFA 2OL3B 2HG5A 4LEOB 5HHMB 4N1EA 5LCVH 1IRAY 5C0BE 1ZANH 4NRYB 1FYHB 4CN4A 1SBSL 3KGRA 4FNLH 1WFUA 3EZJB 3MLZH 1LDSA 3QDJA 4D3CH 5L6YH 2ITDA 2EE6A 1T04A 1NKOA 1DANT 1XF2A 1NLBH 2HVKA 1CVSC 5E8DL 1DUYB 3DVGA 1RFDH 2X6MA 1EFQA 1Y18B 1I7UB 2JJSA 3KPQB 3UDWC 4M7LH 3FQNA 2ZP0T 3D9AH 3EGSA 5IROC 4YBQC 3QR2A 3FO1A 2O26U 1X5ZA 4UINL 3I02B 1D5XB 2IF7A 5IJVB 2FIKB 3FQRB 1DEEA 1TVBA 3EFFB 1QFPA 2HFEB 5JHDA 1UB5A 4L8DA 1BZ9B 1LQSR 1XF3B 4HUNB 4L3CA 4LP4A 4FFYL 2DF3A 2R2EB 4KXZH 4WWKB 1RIVH 3C5JA 3VI3F 2QKIA 1JFQH 2IG2H 1IQDA 3AS3A 4G8EA 4UTAH 3G04B 3KDMA 4LSPH 2VAAA 1XGYL 3X3FH 4FQJH 4N8CL 3DSFL 3E6FA 3UO1H 2PYEB 2VAAB 4RMSA 4KMTL 5K9QI 2GJ6B 5H35A 4JN2A 4OCRH 4PTTB 2PYFB 1CIUA 2ZSVA 4LSVL 1D5ZA 3AU1A 4HJGA 1YYMH 4XXDA 4GRMB 4QTIL 3SGKC 3MRJB 5K33A 4L8DB 1NEZG 3CDGB 5TFSL 4GAYA 3ARRA 1XF5A 3OKEB 2E5EA 5KSAC 3RX5A 1G6VK 4WO4B 3RTQB 4HUXA 4WEBL 4KUZH 4WFFD 4OZFB 4PJ9D 1ND0A 4FN0A 3EIFA 1EMTH 1BHGA 4P0DA 4PJHE 1TMCA 1MHPL 4H8WH 5FAAA 3S34H 4UINH 1D5BB 3TPUE 5ADPL 3MOBH 1CG9B 1OGTB 3KR3L 1NCAL 1RZ8B 3Q5YA 4HMCA 2BOCA 2ICWI 1OAKH 3JWDC 3WD5H 3ARGD 3HMWL 3ZHKA 5KAQG 2VLRA 4Y16D 5SX5H 3PWUB 3CLFH 4WUKL 1DBML 3LY6A 3QI9D 4KTDH 1KT2B 2VYRE 5CBAB 1HCVA 4KHXL 3EGSB 3BRFA 4LLVB 3U0PB 3CD4A 1UB6B 3VFRA 4JY4A 5B3JF 4J6RL 2F74A 1ED3B 3D39D 2V9RA 2AK1H 1MRFL 1P4BL 2DQFA 1E27B 3ALWA 5I30H 1PDKA 2EIEA 1SVCP 5HDQL 4XC3H 5A43C 1AD0A 1A7NH 4HC1A 4LLMA 5SX4I 5EC2B 3PWPA 1KEGH 1AE6H 3QXAB 4TOYH 1KXTB 4YEFA 1O7SA 3RJQB 5KVEH 1BBDH 2P24A 3T0XA 3T2OA 3SCMA 3VGHA 1CLZH 3GJFB 3RPIB 3QQ3A 2XN9D 1PSKH 3PJSA 3EYOA 3B5TA 3LMJL 1KBGL 3PXJA 3QHTC 3DHMA 1YDPB 1EK3A 5FO8B 4GW4B 3FB7A 3I50L 1T1ZA 1YJDC 4M93C 5C09B 5FKPB 4YDLC 3SDDA 3C6LD 4I13B 1I7ZA 2VNCA 5EU6D 1NMBH 1FRGL 3OGCA 1UM5H 5IMKA 8CGTA 5E5RB 2FYYB 4MAUL 5GRJL 3L7EA 3V6FB 4U6YA 5FGBC 3H9YA 2NNAB 3H9SA 1EZVX 3O0RL 4NQCD 5CKGA 1G9EA 1A3RH 4RGOL 2FBJH 1TDQA 2DKUA 3RDTB 3SKJH 2AK1L 3WIIL 1KC5L 4O00A 3IDNA 1DQML 3GHEH 3GSVB 3TBWA 4M7JH 3OZ9H 3MYJA 1KCRL 3IAPA 3JXAA 4Z6AT 4K3EH 5TE7L 1ZA3A 3MGOA 2X2YA 5GGTA 3TPUA 1JHKL 5KVEL 2V5RA 4RRPG 2OZ4H 1DQJB 1D9KD 1ZK9A 1LDPL 4I4WA 4R6UA 1RK1B 5D1ZD 3BP6B 3BEVB 5D5MF 1DSFH 2F5BH 4HSQA 5C0CA 1U8LB 4I3RL 2IADB 1FQ9C 3VD4A 1C16A 1OQXA 5EO9A 5MERB 3GMRB 1G7IA 3PABB 3SDYH 4X4ZA 5F1NB 1F3DH 5CIPH 4NCDA 2PXYA 5JQ6L 4WW2B 2EDHA 5C09D 2B4CC 4RFEA 4HJJH 1T6WA 5AEAA 3TBTA 1H5BB 4RFNC 3DMMB 1UH2A 1I9RH 5I8OL 4J8RB 1ROWA 3OF6A 1LO2H 4OF7A 4B53A 3CXHJ 1J0JA 4LQFL 1Q72L 3K1KC 2V5MA 3O6FA 1QYGH 4GLRH 5GISH 3BD3A 5L9DH 3DYPA 1JPGA 3P0GB 4LPUA 4XCEB 3MLXL 5DUBA 1VCAA 2J1KA 2Q3AA 5BV7L 1YJDL 2IBZX 1BFSA 12E8H 4OD1L 2XIDA 2OP4L 4QWWC 2ADFL 5DF0A 2GW5A 2R2HB 3B9AA 3IU3B 3ULUC 4LGSB 2PYED 4N0CC 3K2MC 5ACZB 3D39A 3IDJA 2M2DA 4KJYA 3MRPB 4HUUB 1HYRC 2NXYC 3RWHA 4P5MA 5H94A 4XNZB 1ZA3B 3HI6H 3I6LE 1LEIA 4YC2B 3L95B 3R06B 3TBSA 1G6RL 5D7LB 5DDHB 3SBWA 1DLFL 3SDAC 5CMAA 4H5SB 5EULV 1NBVL 1TFHA 4LAJH 3HUJE 4PJEA 2FR4A 1CICD 5FK9A 1RZGB 2Y6SD 1WBYB 3ARGC 4I18C 2GK2A 5DLML 4JPVH 1OSZB 4OLYL 4HWEH 3LKPB 4NQED 1BX2A 1GC1L 3MRNA 1KPVB 3AY4A 2A9NH 2GIYA 4M7ZC 5D96B 2HAZA 3F62A 3WE6A 4D9RE 4WW2C 3ILQD 4Z76B 2R2HA 4U7SA 4KKLD 3SQOH 1EXUB 1TJGL 3KYOB 3VFPA 4OD1H 3FOLA 4O2CA 3RZWA 5SWQB 2X4PA 2OI9A 3VGDA 2ICES 2BHZA 1ZS8A 1B4RA 5ESQB 1FVDA 1CL7H 1JCKA 4BQCA 1QBAA 2NY5C 1QP1A 3WFHB 3RNQB 1G7IB 3HMXH 3UBXI 2FB4L 4BQBA 4MXWL 2W60B 1F02I 4UT6H 1DDHA 4U1GB 4PREB 4P59H 4DZBB 1P7KB 4AIOA 5CUSL 3V95A 2A73B 8FABA 3VRJA 3MRKA 1H5BA 5AZEL 8FABB 1VFAA 3S4SG 1G7LB 4F57H 3WUWG 4EUPB 5CAYB 1Q9KA 3O6MH 1XIWC 3AVEA 3STLB 4W6XB 5FGSA 4G6KL 1A1OB 1A5FH 2D4FA 4OQTL 4BZYA 5MERA 4FFZH 2ZKHL 5JXEC 4HWUA 4NGHL 3C6LC 4NO5B 3RUGE 1MFDH 2C3HA 5ITBH 1K3IA 5I8EA 3GJEB 5C0EB 2F54A 3T0EC 3D0LB 3SN6N 4N0YH 2AKRA 5D1QA 5E5UB 5HHQA 4Y16C 1DTUA 1RJYA 1Q9WB 5DFVC 2V2XA 3QZWB 3TJHC 2FATH 1JI2A 3GK8H 3RWIA 4JRXD 1BD2D 5I16A 3CC5A 1HEZA 1MJ8H 5B4MC 3V6BR 3AREA 1MREL 4HC1L 1J0KA 5DDHA 1T89C 1YEGH 4KZDH 1AGCA 1KCVL 4M1DL 3RRQA 1JPGB 4XCEA 1P7HL 2R9HC 6FABL 1QSVA 3LS4H 5FHBH 4IRJA 3O3AB 2HTKC 3LDBC 1BZ7A 1FL5A 3SDDB 1G7HA 4OGYL 4ZUVA 4ZD3H 5CEZH 4ZNEA 4RCAA 4D9QE 5HHPA 5FYLD 3VWJC 1VDGA 2KQMA 3BO8A 5DRNA 2WANA 3G5XA 2YPVH 5E1AA 1R5WB 3V4VL 4PJ7B 2NY6C 4XAKE 1WLHA 4G7YL 4OIIL 3H7BA 3KXFA 2EE9A 4UQ3A 4PRPA 4C83A 3FN0H 5B39B 3I85A 5F97E 1R0AH 4PJFA 2E9JA 3BUYB 2UZIL 5HGDB 5TDOB 1ITCA 3LEYH 3QUYB 3KPRA 4U05A 3MLUL 5C3TA 4GKNA 5I0DA 3CUPA 1K8IB 3MRCB 1EEQA 1KGCD 1P4IL 2WINB 1TCRA 4HLJA 1NL0L 4NO3A 2PO6C 3QEQA 4P4KD 1B0GB 1PX4A 3CX5J 1H3GA 1LO0L 1U3HB 1J86A 4RGMB 2BRQA 4Y19B 3O6KH 1VESA 2HG5B 3KYKL 3GKWL 4Y4HC 5D7LE 5JA8B 2APVA 3U0TA 4AIZB 4HWZA 5KG9B 3VXSE 4HFUH 3MCLH 4YJZL 2AP2A 4K8RH 3SGJA 2ZUQC 1AXIB 3BD5A 1GHFH 2VO5A 5T5FL 3UTOA 4CVZB 1LK3L 1KLUB 1RZKC 3VXPA 4I2XE 4XXCC 4HIHB 1HKLH 4Z7WF 5CD5D 2O5YH 1DN0B 1HSAB 2LAAA 4JFEE 4LFHD 4FQIH 2VDKH 3DURB 3B2VH 1CD1A 2NXYB 4TNWK 5ALBL 2BOBA 4PRNB 1N3NA 3BP4B 4OD2A 4Z8FH 3KYMA 1WZKA 3FONA 4GKOA 5IQ7L 1P53A 1ORSB 3O2DA 2ZJSL 2A6IB 1NMCB 2VH5L 4TTDD 3QEUB 1NUDA 2FEEL 3KG5A 3O9WA 4PGJA 5I71B 3TZVD 5I19L 4AK1A 1T5WA 4ZO6A 5DJDB 5HTSA 2VIRA 2Q8AL 4JRXA 2D4DA 5HGHB 2DLFH 2FLRT 4D0CA 3OL2A 3WNOA 4K23L 4IM8A 3GJFK 4L5FH 1K6QH 3GJFA 4XCFL 4JY4B 2BVQA 2H8PB 4HKJA 1T04B 5EFIB 4DGIH 4F2MA 5GHWH 4Q9RH 4IOFC 4FFWD 5KW9L 1NC2A 1CBVH 3GMQA 3I02A 3MBEB 3WXWL 4NRXB 1SYVB 4WUUB 1T5XB 4KK8D 5T1LD 2GUOB 1HHGB 2DLEA 5HHOA 2O5YL 5HVFB 2C1OA 2H8PA 4HKJB 5EFIA 1QFWI 4QYOA 1LP9A 3OGOE 1L4IA 5T1KD 5D9SB 2XFXB 4ZUSA 4JPWH 5EBMB 5D2NA 2D7NA 3L3GB 3KLHC 2MKLC 3CU1A 5IHLB 4PRDB 3RY4A 5D70H 3V0WH 1JV5B 4RAUB 4TTDC 1N5YL 4NUGH 2VE6A 25C8H 1SVZA 1C08A 4FQQA 4M1GH 3OKEA 4OCSH 4CVXB 3TYFA 4Q2ZB 4JPIB 4C4KO 5J56B 1KENL 3QUKB 1G9MH 4NO2B 2DQCH 3MLYH 4HG4K 4Z7UA 4HKZB 1T4KB 3I6GA 5I1EH 5TPWL 5DVLA 2V7NA 5F6HI 3ARSA 3GUTB 2P1YA 3DX7B 5I75C 3JV4B 4J4PC 3KDMB 2FLBT 2WWMC 5DEGA 3KPRD 3HE7B 4OCMC 3WJLA 5KAQF 5KSVA 4KMQA 1M7IA 2Z93A 1NEZB 4GG8B 1Q38A 3WUZA 2H6PB 4J3WA 3T65B 3WSQH 1CLOH 4AEIL 1JGEB 3MRJA 3L9RB 4PG9B 3VI4F 5F72S 4WTXA 2AAVA 1M7IB 4I5BB 2FEDC 1KB5A 3B9DA 4P4KC 3FO1B 3MV9B 1TCRB 3U4EA 1VPOL 4PY7A 1UKQA 3HMWH 5SX4H 5HYJB 1KPRA 1MHCA 5D71L 3SDAD 4PY8J 3N50A 1V5JA 3TO2B 4TNVF 4P2RD 2ORBL 4L3CB 4PDCE 5DJ6A 3VWJB 4HGWA 1HHIB 1ZOXA 4OM1H 1U8MA 3DXAD 3AM8A 5E6YA 3MCG1 3EYUH 3MRHA 3AMKA 4X7SL 1PYWA 2RHEA 1HOCA 5D6DC 1WT5A 4MD4B 4Z7VE 4XC3L 5D7IB 5GRVL 5EH1A 2FX9H 3OJDA 2JJTC 1YEFH 1EEUA 3E2HC 4NT6A 5IG7B 1FFPB 4PJFB 3TT3L 1I3GH 5CEXA 5C0AA 1OQOA 1T1YB 3MXVH 4MA1C 5TDPA 5HYJA 1IC5L 4JFEB 3PV7A 2UYLB 1SBSH 3FO2A 2GI7A 2FGWH 4MA3A 5DEZA 5FA4B 4XP9H 5DD1L 5EPMB 3VFVB 4D3CL 4D94A 1CU4L 1K4DB 3MBEA 2OJEA 2D0GA 3GBML 4GAFB 4KI5F 1KTRL 5D71H 2N1KA 4UOJA 5A2FA 2DIBA 3LB6C 4UV4L 1WFNA 1X44A 1XGUA 1WK0A 4OCWL 5EOQH 2VRAA 1GGBH 3GI8H 3NCBB 1ZGLP 3OPZH 4WFFE 4BH7A 3TBYB 4QHMA 3MSPA 2D3VA 3AXLB 2R69H 2FEEI 4UIMA 2J8UB 4CADA 3ARDD 1HHKA 2V7NB 1ZSDB 4MAYD 4GJTB 3UJTH 3VWKA 4NZTH 3WKMH 4KVNH 5CD3A 5L2KE 1G1YA 1G7MB 5EBLB 1HQ4A 1UKSA 3C08L 5TGBB 2UZYB 4PIRF 4K3EL 5DMKA 1REIA 1YEFL 1YEKH 1ZT7A 4Y19A 4X8JB 3HG1D 2BMKB 4HUWB 3OB0H 2HP4A 4MD0B 3OJVC 3PL6C 3BGMB 3FN3A 3UBXA 3Q2CA 1RJZA 3RWJA 1QFWL 1ORQB 4OGXL 5D7JA 1NMCC 4WU7A 3P4OB 1M7XA 3QRGL 3L3JA 1NCTA 1LE5A 1U2CA 2E7HA 5A40E 2JF1A 3S35L 2F5BL 5FDYA 3WFBL 1ULVA 3UTQB 1PEZA 2V5YA 4YAQA 1UADC 1FLTX 1IAOA 1T22B 1MLCA 4JQIL 4ZOCA 1A6TB 4MB3A 4YDJA 3AFLA 1TPXC 1S7QA 1YC8A 1HH6B 3ROLA 4MCYA 5IOPB 1Q94B 3X12A 5I0ZA 1HWHB 1I8KB 4FG6D 2DJ4A 3I6KB 4KV5E 4JFZL 3ROLB 4LBEB 4JO2L 2AXGB 3ZYOA 2B0SL 1NCDL 1NFIA 3M1BA 3VD7A 4G80A 4MMZC 1E6OL 3RVVC 4CRPA 1RVFH 4G6ML 5GZNC 3VE0B 3NTCL 5MP6H 3VXMD 5I9QC 1CD8A 5DJZA 5GSVB 1LK2A 3LN5A 4P2RA 5LVEA 4WFGD 5FDWB 3V4PH 4NO0A 4CW1B 1JNHA 4Y1AB 5HHNB 5CSZA 4K07A 1Q0XL 1ZVSB 3F5WA 4Q97A 5FUZH 3BQUA 3MJ9L 2ADFH 3EW3B 5DGRA 5ENWB 2VITB 1WBYA 3OAZK 1KJMB 4X83A 1A9BB 3T4YB 3O11A 2OI9B 1WF5A 5CMAB 5CBEA 2VXUL 3CFEB 1EFXD 4ALAL 1NDGA 2KDGA 4I2XA 3LRHA 2IMNA 1A47A 1NBYA 4OI8A 4G8GA 4OTXH 1OAYH 4Z76A 4ODBD 1G7HB 1JWMA 1I8MB 2ESVE 3JV6A 3VXOB 4W6YB 3KPPB 4P23D 3MRNB 3CFIC 4PB9L 1U8QA 4R4BA 5HYJD 1KCKA 5BMFH 5ACZA 1AIFA 5F8RC 1XGPB 1RZGA 5LGJA 4M1CC 1NDGB 4I2XB 5BQ7A 3FRPG 3WN5C 1FNGB 4PGBA 3RDTC 4GKSB 3PNWA 4ZOAA 5BQ7B 3MV9D 4BKLB 3ECBA 3OKOA 2MSPA 4Y5XB 3SGEI 3DV4B 1UEMA 3BW9B 3WFDH 1MAMH 4K2UL 5DFVD 3KPRB 3C09C 5F96L 1YEJL 1S7QB 3F7YB 2YZ8A 4MAYA 5I1IH 4G9DA 5JW3H 4CU8A 4XPAL 4CJ0A 4JM2C 4J3TA 4WEUD 4BFIB 3V52H 4NWUL 2R56L 1WT5C 5F9AC 3B9KD 4JFFD 1J10A 3BGFC 3FL7A 1IE5A 5IOPA 5FV2A 5BXFA 4OZHF 2VDQL 1MWAH 4XBGA 1WAAA 3PIQB 4X6CE 5HHNA 3OHXB 4YGVB 3EYQC 4H20L 4XH2B 4ZXBB 1AI1H 4UT9H 5C7XL 3W5MA 4MSWB 2KBGA 3IAQA 4XNQA 3SE9H 3NIDE 1A02N 5T1KB 5DD0L 5KS9E 4F9PC 4NM8H 4G3YH 4B0MM 1JPFA 1Y0LB 1P7QB 4MJ6B 5IQ9A 3WNLA 5C07B 4JLRB 3ZKMD 3QWRD 5JQ6H 2YC1B 1UYWL 2A9MH 2WMPA 4L4TD 1JGLH 4XB8A 1OW0C 3IDNB 2D7TH 3WLBB 3QZWG 4PJBB 3QI9A 4Q9BA 2Y25A 3CH1B 1RY7B 1UACH 5J6HB 4TSAL 4IRSD 1FL6A 3QDMA 3TIEB 3NCJH 1HHJB 3QCTH 4WRLA 3WJLC 5FO9B 1W0WA 4J4PA 2DQUL 5ESVA 1D9KB 2QTEA 1WUNT 2DL2A 2IPTH 2Z0BA 4JRYD 5J1TC 4XBPA 4MZ3A 3FB7B 3EDFA 2DBJA 1YPZE 3MV7D 1QA9A 4ORGA 1R24B 5F3HB 5FUOL 5SWZE 2JJVA 2BSSA 2D7OA 5CBEB 2VLKA 5KOVC 4XMPL 3ZT7A 3VFSA 4CBPA 3WNKA 2HLFC 3L5XH 2J3SA 3BVNB 4OLWL 5GXBB 4Z0BL 3WL9B 2CIKB 3FQXA 3VDAA 2XRAH 4GG6A 5GRYA 2APFA 1VFOA 3O6LL 4G8GD 2E9IA 4WDIB 1JFMA 1OAQH 4Z7VF 2J8UA 2YPVL 4P23A 4F7PB 2XKUA 3T09A 4CGTA 1DBJH 4NN5B 3CZJA 1J1PH 1TVHA 4QOKD 3U2SA 1A3QA 2E6JA 5DTFB 3CVHB 1FBIH 2ZUSA 2IANE 3HG1B 5D6CB 1MUJB 4RFOL 1U8IB 2R2BB 1Z6JT 1CQYA 2AK4B 1TXKA 2Z8SA 4XTRD 1T21B 2CLVA 5ADOL 1MCSA 3WCYA 3QXDA 4MD5B 5DJAB 4F15C 2UV3A 4KVCH 1X7QA 2BDNH 3DX6A 2VDNL 4IBLT 5CINH 5EIVA 4EN3C 4ZXBC 1GGCL 4JHWH 4P2YA 2D7QA 4N8PA 4C54A 1VGKA 2NXZD 2IFGA 4X6BB 5DZNA 3LIZL 5D7KD 3HE7A 4UQ2A 5ICZB 3UC0L 4DUVA 4N5EC 4RIRA 3ZE0E 1MF2L 3OKMB 3VD9A 3FQWA 1IKFL 2W65B 4HPOH 4WCYH 3JSSA 1S9WA 4JCMA 1N6VA 1R5VA 2PF6A 1XZ0B 4OZFG 2I60H 3LQAH 1P1ZA 1IZKA 3BEWB 4R90H 5M95B 1IZJA 5F88B 2H1PL 2ADGB 4HFWB 4HPYH 5BV7B 5I66A 4K94L 1HSAA 2AV1A 4BH8B 2UWEF 4JKKA 5DRXB 4AQOA 3T0DA 4RAUA 2ZUXA 4JKPL 5MI0C 3JWNC 3B2VL 5LBSH 5C09A 2R0WL 3DX9A 3NZ8A 3CFDA 3LKOB 3R8BB 4F8QA 1KCSL 1KN4H 2XFXA 4ZUSB 2FCBA 3UBXG 5J1AB 3OG6B 5T3XH 3MOAH 3OKNB 3QWRA 4QCIA 4GO6B 4HUVB 3DXAB 3SKNA 1A4KA 1NGWB 2AEQH 4JB9L 1JWUB 1FGNH 2OXGA 2WINA 1TZHB 5IB3B 4GAJH 2AXHA 1MCPL 3RVXD 1E4XL 4KK9C 1L6ZA 3VD3A 4NM4H 4CDGC 1FGVH 2GHWB 3PHQA 4J3VA 4YQXH 4OCYL 1YYML 4H1LB 3S96B 5CEXB 5HYQA 5JORB 5KW9H 3FFCB 2VIRB 3QHFL 4NZUH 3JWDH 5MEQB 3QUYC 2XA8H 1JNLL 1VFBA 1J11A 3LPGA 4C83B 4XMLL 2BSED 3OJ2C 5GJSH 1GGIH 1GJIA 1IAII 2DLGA 2J6EH 3ZKMC 1AFVL 5D7LD 3SY0A 5IBLD 1NC4A 4WUUD 1MFEL 1RJLA 1TNNA 2NY7L 4UV7L 5DJ6B 3VWJA 4R4FL 3TH3T 1OGTA 3MPCA 4MGXA 4ONGL 4HS6B 3DROA 3LB6D 5CKAA 4UDUA 4LKCA 5AG8A 3QUMB 2AV1B 4PUBL 1E4XH 4QWWD 1QTYT 5IB2A 3UTSB 1WQVT 1FGVL 2JCCE 1S7SB 3C5SA 1JGEA 3VG9C 3RUGA 4KDTC 2DWDB 4MA8H 1LEGB 2XTJD 1LNUA 4PRIE 3NIGE 2XA8L 2JIXA 1JYXA 4DQOH 2FO4A 1AJ7L 1RZ7L 1Y6KR 4BUGA 3C6SA 1MAKA 3O6KL 1H3XA 4NHCH 1IQDB 4P46C 1BBDL 1JPFB 5GRUH 2P5EA 3LKSB 2NXZC 4KTYA 3BP7A 1N3NB 2YMXL 3QQ3B 4AENB 2ERJB 4OF8A 4JFQA 4S1SH 1J05B 4R4FH 5DA4A 4UTBL 1OARH 3ULUD 4I0CC 3IKCB 4HJGB 4HGMA 1D5XA 3KXFB 4TNVK 4LSUL 3C60D 5F70A 1T83A 4XT1C 5K9OB 4KV5F 2CLRB 4AM0B 3VFTB 3N1GC 1ZA6B 1WEJL 5HJ3A 4YWGL 3GBLA 1MWAA 1ZHBB 3O41A 1A7PL 3WFCL 1QZ1A 4MS8C 3O0RH 5GQBA 1U58B 2QHRL 2RQ8A 4ZFGL 3FQRA 3JV0A 4NNXA 3C5ZC 4V1DA 1E4KC 3GSRB 2WWKT 5BJTB 1Z5LA 4Z9KB 3VW3L 3OR7B 4XAWL 4K3DH 2W0FA 4XAKD 5TE7H 1U8IA 3WXVL 2HKFL 4U6HB 1FG2A 3G5XB 1KXVC 2X1PA 4DKDC 5JW5B 3VFWB 3QDGB 3U46A 3U7WL 1RZ8A 4FABH 2BJML 5EOCJ 4GLRI 5EBGA 2JELL 1WZ1H 4LCUA 5KBNC 1I4FB 3TP4A 2FDBP 4P23B 4YDLB 3TLRA 1TNMA 4N1CA 4OZGA 5KSUB 5SX5K 3B5GA 3MC0A 4ONFH 2GTZA 4U1MB 1N59B 1T0NB 2VWEE 3DV4A 1S9XB 3C8HA 5FYJL 1V3MA 4P4KB 4F7MB 2EIDA 4L29A 5CJ8A 4BKLA 3MLWL 4ZO7A 3NABH 3WS6A 2XWJA 3SBWC 5I8EB 5J06A 3RKDC 5B38B 4NZTL 3HNVH 4X5WB 3WKML 3IFNL 2RJMA 2NCMA 2AJUH 3FHQA 3K2UH 5E5MB 3L5JA 4V2CB 1QD0A 4PR5B 2LTQC 4UQ2B 4C4KT 5A16A 1KNOB 3WXVH 4L4TE 4Z7WB 3LQZA 1XH3A 3BIKA 1GOHA 5D2LE 1FO0A 4PJDA 3QUZD 1U95A 2DN7A 2YD3A 5BO1H 4NKOB 4P2RB 1UXSA 1IKNA 1OF2A 4EI5C 1URLA 3FCTB 4ZFOA 4MA7L 5I8CB 3QULB 1HZHL 4OGZA 3HE6C 4XP1H 3UXFA 5SV3A 3TWCH 3PGCA 3CC5B 3RVUD 4S11A 5CJQL 4W70A 3RUGF 2YKLL 4FQCH 3HFML 1RU9H 4AYFA 3ZYZA 5FB8B 1MAJA 1JN6B 3QDJE 2F53A 3IJYB 5DR5L 2DWEA 4K3GA 3E6HB 1LK2B 3NABL 1IM9D 4GXVH 4Z7NE 3F7PC 3QIUC 2C3WA 5F1IA 1I1AD 3RY5A 1U8OA 4HULB 3G6JF 3S3JA 3ZE1E 4XPFH 4XP5L 2AXGA 3MRDA 5EZIL 2A77L 3GIZL 3RGVC 3V79C 3I50H 3WUWB 1FVDB 5LKNA 1HH6A 3I3EA 2J12B 3BT2H 1XGQA 3CU7A 4X80H 1BOYA 4ZSOA 3MZGB 4HIJB 1EPFA 4R8WH 4X7FC 2VLKE 2VTFA 4DEPC 3ULVH 2A73A 3CIQA 3QA3B 3HR5A 2CMRH 3KPOB 2R39A 1CL7L 5FB8A 5EZLB 3B9KC 4I77L 4ZFFA 4G8GB 3QFJE 3K46A 4WWID 2Z8RA 4PV9B 3GDBA 3D6GA 2WUBL 2Y5EA 1IC5H 3U1SL 4ZS6D 1JGUH 3ARGB 1GCFA 4G5ZL 2Q20A 4XZUB 1LDPH 3O2VL 5ALCH 2B20A 1XF1A 2XPGA 3LV3B 1KEMH 2R1WA 2OMNA 3BOVA 2NYYD 1OW0A 3D1MC 3BZFA 1FZJB 1RUQH 4I3RH 3SE4C 5EOQL 4CADB 1BQLL 5SWZA 3KHQA 3QIBB 3VE0A 3TBTB 2DQTH 1T0MA 4HT1L 5JOEA 3HG1E 1NCNA 5MI0B 1UZ8B 5I6XB 3G6DL 5C0DA 3WDJA 4F9PA 3T8XA 3AB0C 4HJJL 1LEIB 1RZFH 2BY2A 2RCSH 2OS7A 4HS8H 4WU5B 1I9RL 1WAAE 2BRRH 4X6EB 3ZDZF 1S9YB 1F4WH 4K9EH 4PJ8C 1QLEH 4KJYB 3GGWA 3S5LB 3FB8A 2VERN 5F7DA 3IU3A 5C0RH 4GBXC 5DD5L 4CMMA 3QUXB 4H88H 3LOWA 3GSNB 1JN6A 1EJ6A 1FL3A 1CFNA 4NQVB 4OGXH 4LBEA 2DQIH 5MENE 5AWNL 4EOWL 4P9ML 1HOCB 2R0KL 3EDKA 2YRZA 3OXRB 3CXHK 4EVNA 2DB8A 2EDDA 3D3VA 4JG0H 2FJHA 1JJUA 3MRDB 4D9LL 5MHSE 1ZS8B 2GJZA 3EJYC 5C0NC 4HF5L 4TVPE 1OD7A 3NA9L 4ZFOB 3T2QA 2NQCA 4M4PA 4NQEE 4J8RA 5IVZB 5IR1A 1L0QA 2P5WA 3BFOA 1SEQL 2YD1A 1QHPA 1Z0MA 4FG6C 1KCLA 3P9MA 5DUPL 3T3PF 4OKDA 4ORZC 15C8H 1WIOA 3WN5A 4CN1A 1DQQB 4JO2H 4CNIA 3GMMA 3ZHDA 2XQYK 3EYFB 2V7HA 3ZSTA 4WTWA 1I1AC 4NP4L 5J12C 5DQJB 3IYLW 3RAJL 4ZAKD 2G2RB 1CE1L 3KLAB 4PGCB 4XNUH 1CFQB 2DTSA 5M94B 3O4LA 2ZSWB 4JO3H 1HI6A 1DQJA 1FHGA 4HMDA 5C09E 4KI5E 1ERNA 3CLEH 4DWHA 1JYWA 5DD3H 4P2QA 4JG0L 1FVCB 3FO9B 4HUMB 5C9JA 5I73B 5J6GB 2H2SC 2SEBB 7FABL 4I18B 1N8ZB 2XWTB 1F3JB 4G7VL 1KTLA 1XFPA 3QUXC 4C56B 3MBED 3MLZL 4HFUL 2IQ9H 1FFNA 5C0BA 1EFXB 4ERSH 4NQDE 3N1QC 1AKJB 4N68A 4JZNB 1FNEA 3MNVA 2VE6B 3X13A 1QSFD 4KRPB 1JIBA 3PWUA 4D0BB 1ZHLA 4PJIE 4EDXB 2EEAA 4AMKL 2WUCL 3RWEA 5HY9A 3IS1X 1NJ9A 3NZHH 4ELMB 1MRDH 1BMGA 2EZ0D 2Q7YA 4KKNA 4NZRH 3ZTJG 4DN4H 5DC0A 2AXFA 5EU6A 4JREB 3X3GL 1OGAE 3HS0A 2VMFA 4NQXB 1TZHA 2A6IA 2OJZH 3ZO0A 2ZCHH 3LRSB 1FZMA 5CLWA 1ZT4B 5AAMA 5TQ2H 1IKNC 4EI5A 4YDKL 1BGXH 1FPTH 3DURA 3PL6A 4MYWB 4YXLL 2J8UE 1TZIB 2X1WL 3KYAA 1EVTC 1NCBH 3K8MA 2YD4A 3NZ8B 3PHQB 3H3KA 1JF5A 4M1DH 1ORSA 2VZVA 3PGFL 5D1ZA 3WIHL 4LRNH 4EN3D 1J1XL 4PV8B 1EAJA 3SE9L 1NUGA 2BOBB 2YWZA 2ID5A 3BAEH 4WW1A 1MHPH 4H8WL 1C5DA 3OKLB 5IJVA 5HHXH 3AAZA 2XKNB 2P5WD 2CLZB 4BK4A 4LKCB 4FZEL 1NANH 2V2TB 2X89A 3NGBC 3RFZC 1DQQA 1Q1JH 4QRPD 3BN9C 1I4FA 3SDAB 3QDME 2NY6B 4NQDA 1YDPA 4TSBH 3BRGC 1MFAL 2I24N 3A0OA 4WWKA 3FAXA 2WK2A 3UCRA 1ZTXL 4NO0D 1DN2A 1I9IH 3RVVD 3LKNA 4JQXC 1I3UA 3SY0B 3T0WA 2PTVA 3BQUD 1S3KL 1KLFA 3TA3A 4MD5A 3RU8H 1SYVA 4X4YB 4O2EB 2H9GA 1ZGLB 3FQWB 4CAGA 4PRDA 4KTEH 3GSRA 2IAND 1L8JA 3C5ZA 4U1SB 3G04A 5CP7A 1JRHI 4JZOB 1ZLUK 4G6FD 5FYLL 4AH2A 2D7PA 1BF8A 4ZS7H 1PEWA 4L3EA 3L5XL 5HYQB 4CMMB 3MRBA 4NHUB 5JORA 4G9FA 2IBBA 2Z92B 4PLKC 2J6EL 3NIFF 2BVPB 1KFAL 5F89B 4Y1AE 3CFKA 3O6LH 5DJAA 5EU7E 2XYCA 5JIIA 4ZTOH 4TULH 3FONB 3NA4A 4PP2A 1M71A 1IEBB 2VB5A 1MUJA 4ONGH 4W6WB 4OIAA 1UWEL 3MR9A 5IFHH 2VLRB 1JWSA 3IDGB 4P2OB 3RVWC 3UYRL 4N8VB 5HGHA 1YEDB 4WFHE 4NQEA 3WIFB 2AJXL 1DEDA 3L3OB 2CPCA 5F9WB 1KJ2B 3HNSL 4PLNC 3V4UH 3VXPB 1NCWL 1HXMB 4I3SL 4XHQA 1T7ZA 3B6SA 4APQC 3WLWD 3BKJL 1VEMA 3U9UA 4Z7UE 2OL3A 3QI9B 4XPTH 3MRGA 3H7LA 1CD1B 1RIUH 2G2RA 4POZC 1CGYA 4YHKL 5FYLE 5IHZB 5TF1L 3FT3A 1P5VA 4YK4C 2YWYA 4BZ1L 4EI5D 1U2HA 4RNRB 1HDMB 2FGWL 1D6VL 2GY5A 4ETQB 2I5YH 4XP6L 4ZUUA 3G08A 2CDGB 3TIEA 4D2NA 3QJHB 1BZ9A 3OX8A 4NYLB 3B8YA 5GS0C 2AS5M 4ONHA 1QBBA 4N0UE 4LCYB 4QRUA 4PBVC 3TGXA 1GAFL 1PG7X 2NY2B 3DGCR 5L8LB 2EYRA 2MPAL 2CLVB 5HHOE 1XGQB 5IMMA 1F8TL 3W2DH 3MOBL 3CUPB 2VZTA 1OWRM 4YPGA 2W92A 1MI5E 3HLAA 5I8OH 3QUYA 2BSRB 3LN4A 2YSSB 1RFDL 1ZT1B 4NFDA 5IBUB 3RWCB 4JG1L 1H3PH 4KY1H 3MV01 1R3KB