4MNXA

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk811
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
245
structure length
245
Chain Sequence
b'IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator chain B
publication title Peptide ligands stabilized by small molecules.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mnxA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mnxA01
1ELAA 4YZUA 1OX1A 1QL8A 2P59A 3DT0H 1EOLA 4NSYA 4ZROA 2PKSC 4K8BA 2GTBA 1SQTA 2C8YB 1ETTH 5K7RA 3GCHC 1BCUH 1WQSA 3N7OA 4JZDH 4B74A 4OS4A 1GBCA 3L3TA 1ZJDA 1WAYB 2FYRA 4ZUHA 1MTNB 3RM0H 4GLYA 2BQ7B 3GY4A 4GHQA 2QXHA 1C1TA 1O2WA 3UY9A 1C5QA 2ZDLA 2ZG0H 4AX9H 1JIRA 4ESTE 1NTPA 1AFQB 1C2MA 1CT2E 1RJXB 3RU4E 2BQWB 2ZHQH 3BTQE 1O0DH 2XWBI 4FUDA 3T2NA 1GDNA 1BDAA 2FOAA 1IQEA 2FLBH 2ZDAH 3M36A 1H8DH 1CHOG 1THPB 1AN1E 5G4BA 1SBWA 1Y3VA 1G3EA 3ZVDA 4OGYA 3PWCA 1MUEB 3UPEA 2FYQA 1L1NA 1VCPA 2OC8A 1RD3B 1O3MA 2QCYA 4MNXA 2BZ6H 1J16A 3MYWA 1D3QB 1GDQA 1RIWC 2G5VA 1RRKA 3TIUA 4Y7BA 3KF2A 5JBAS 1MAYA 5E2OA 3KIDU 1KDQA 1GG6C 4AFUA 1A46H 3BTKE 3GCTG 1HLTH 1ZHRA 2BY6X 4VGCC 2BHGA 4ZKOU 4B2CA 2G51A 2OC7A 2ZHFH 2BVXH 1AO5A 1PYTC 2V3HH 1OS8A 2HVXA 1GI7B 1O3KA 3L33A 3ZVCA 5EW2H 2B9LA 3WY8A 2GZ7A 5T6FA 2DUCA 2A4GA 1BB0B 3T27A 4CHAB 1V2OT 1S5SA 1TGNA 3P70B 3SI3H 1ZR0A 1A0HB 1ELBA 1TALA 3PO1B 2BDBA 2PW8H 3ODDA 5EW1H 1XVMA 2BVSH 3ZYEA 1WV7H 1QCPA 1HUTH 2Y81A 4GPGA 4I32A 2ZGHA 1GWAA 1LHEH 2H9TH 3MFJA 2Q6FA 4BTTB 2ZPQA 3QLPH 1MTSA 2HGTH 1K28D 3A85A 1C2EA 2BLOA 6CHAC 4NZQA 3SJ8A 1RS0A 1J15A 1GHVH 1G32B 3MMGA 4X6NA 1TQ0B 3QGNB 4JZIA 2CV3A 3RXDA 4WH8A 2GT8A 2XWAA 2ZTXA 1O2TA 3SW2B 1V2ST 3HKIB 5JYIA 4BAHB 2BY5X 4YO9A 1CE5A 1AZZA 1DY8A 2BD5A 3PMAB 1FLEE 1SSXA 4CRAA 1FNIA 1F0TA 2Q6GA 2ZC9H 2UUYA 4CRFA 3OTJE 1IQHA 1MAXA 1O3OA 2NU3E 1BTYA 3VB3A 1XUJA 2QF0A 3E91A 4GHTA 1KYNA 1PJPA 2F91A 4E7RG 1O5FH 2Y6TA 1DSTA 1GI0A 1FXYA 1TABE 1W12U 1UTQA 3OYPA 3VXEH 1HJ9A 1SOTA 1BTZA 3HK6B 1V2RT 1IQIA 3RMMH 3U98H 1UK3A 5L30H 3K6YA 3SOSA 1C5MD 1CHOF 1IQLA 2H2ZA 4O3UA 4D9RA 4B75A 1SR5C 1T32A 3KEEA 1ACBE 4TYDA 3TJOA 1NU7B 4MLFB 3RXHA 3AVZA 3BTTE 1HAIH 3B23B 1O2QA 5LH8A 1W8BH 2PKAB 1SQAA 4CRGA 5BRRE 1HFDA 4LZ1H 1NRPH 1K9OE 3RXKA 5A09A 3TNSA 1H9LB 3A89A 3VGCC 3GCTF 3M7QA 1G2MA 1ZLRA 1ELDE 2VIDA 1OYTH 2H5DA 1C9TA 2H6MA 2Z3DA 2W26A 1GI8B 2J38A 3O8DA 5JDUB 4AB8A 1LHFH 2R2WU 3PROA 3MHWU 4X0WU 5A8XA 2VNTA 3BN9A 3UREA 1HIAB 1KTSB 1HXEH 4JMYA 1OSSA 2B7DH 3AAUA 1Y3UA 1S0QA 2O8TA 2DE9A 2VIVA 2BD4A 3VPKA 5FPSA 4MNYA 1TPPA 4HFPB 4UDWH 2BDGA 3STJA 1CA0B 1C1WH 3U9AH 3TJNA 1LVMA 5FPTA 2VWLA 3MI4A 3T28A 5LGOA 4OS2A 1FY8E 3ZZ4A 1ZPZA 3EAJA 4E05H 1MKWH 1TX8A 1HB0B 5E0GA 2PSYA 1TWXB 3A87A 1ANDA 1BITA 2D1JA 4B2BA 1AVGH 4K2YA 1G37A 4YOGA 3M7TA 3TK9A 2WPLS 3QK1A 4Z0KA 3ZVBA 1QRWA 5DKMA 3A83A 6ESTA 2AS9A 1JRTA 2GDDA 3U1IB 1O32A 1NFXA 1OKXA 4Y0YE 3SUEA 1O3NA 3TH2H 1P9UA 3OX7U 4CH2B 3MNCA 5DJ7A 4X1SU 3RU4T 3LGVA 3MU8A 2G4TA 2O8WA 1O3CA 5L2ZH 5JBBS 3A84A 2ZFFH 1MKWK 2BXTH 4TWWA 1C5ZB 1GBFA 8ESTE 2AIQA 1BMLA 3MH6A 2GKVE 2GMTB 3E90B 1O3JA 1A7SA 3QDZB 2ZHDA 5C1UA 1GGDB 1SVPA 3TH4H 1K1PA 2R0LA 4OGXA 1CBWC 2NWNA 2ZHWH 1EPTC 1CT4E 2QIQA 4H6TA 4J1YA 1TNLA 1VCQA 5E0HA 1C5SA 3RXAA 1Z71A 7GCHG 1H9HE 4IMQA 2Y7ZA 4XBCA 5DO4H 2NU0E 1AE5A 2SGQE 1ABJH 1HAHH 4FXGH 1HGTH 2BY9X 3M5OA 4BANB 3SU4A 5IDKA 4U30A 2KAIB 3PMHB 1DSUA 1C1RA 3UQOA 3LH1A 1Z6EA 1NESE 1OWDA 1C4Y2 1O5DH 2TBSA 4JYUH 3GY3A 4CR9A 5GXPA 5F8TA 7ESTE 5PTPA 1UTOA 1UVTH 1O5CB 2BD9A 3ENSB 3VXFH 4X2VA 3GY6A 3SU1A 3Q3KA 1X7AC 4X2XA 1SGNE 1EJNA 1DLKB 4NIVA 1FONA 3UNSA 3RMOH 1MTNC 1QA0A 1GI2A 4I8KA 5J4QA 1C5RA 1DXPA 3BIVH 1PQAA 1QJ7B 1KDQB 1O36A 4WWYA 3RXVA 1YYY1 3MU0A 1DT2A 3ZZ5A 2ANYA 2FEQH 3BTDE 1P11E 4YOJA 5C2ZA 1K22H 1NRQH 3MOCA 4ZHAA 3GOVB 3LJJA 1GCDA 4D76A 3H5CB 3P8FA 1FZZA 1O3AA 2IPHA 2IJOB 1K1MA 2RG3A 1CA8B 4M7GA 3M61U 1C1UH 3QZQA 3NXPA 1LVOA 1MD8A 3A7ZA 1ZPCA 1HAGE 1FIZA 1GBKA 3NKKA 3O8RA 2P3FH 4Y8XA 1GJBB 3MNBA 1ZTJA 2ZP0H 3IWMA 2VWNA 2A7HA 3GY8A 1GBLA 3QGJA 1TOMH 2QF3A 2F9UA 2HPQH 4D9QA 2P94A 1Z1JA 3DFLA 1EZSC 1QY6A 3BTWE 2PGQB 3A7YA 1PPGE 5K0HA 2ZZUH 3PTNA 1LKAA 4JZ1A 5LPFA 1W2KH 2FX4A 1LHGH 1V2UT 2AYWA 3C27B 2H9EH 1C5WB 3F68H 5GWZA 2UUKB 3PO1C 1O2UA 1F5RA 4DIHH 2OUAA 3PLKA 4JYVH 2PWXA 7GCHF 1KXFA 2C93B 1BRUP 1V2VT 1F5KU 3AW1A 3PTBA 1ZTKA 3OSYA 2GV6A 1Q3XA 1WCZA 3FFGA 1GHBG 1MMJN 1O2HA 2PUXB 5GDSH 4AYYB 4NFEA 1XUKA 3E0NB 4MVNA 4ZXYH 1P12E 1OP8A 1XVOA 2HNTF 1ARCA 3BSQA 1SOZA 1UJ1A 3TK5A 4UONA 2HPPH 1P04A 1MBQA 3E6PH 1T7CA 1NROH 2ZFPH 2SFAA 1NM6A 1ZSKA 1ELCA 2ZFSA 1GVKB 1DFPA 1Y3YA 1DWBH 5DGJA 1C2KA 1TFXA 2BQ6B 3TGIE 1OYQA 5T6DA 1GI6A 2I6SA 4NA8A 1P03A 1U6QA 1XKBC 3F9GA 2PTNA 4Y76A 2C8ZB 1SLVB 2PV9B 1WUNH 4WJG2 1V2QT 3MNXA 2G5NA 2ZU1A 3A86A 4IW4E 1C1MA 1IAUA 1GJCB 3RXTA 3VB4A 1QL7A 2FO9A 1AFEH 2D26C 3A88A 1MTWA 5C1YA 3SUDA 3ZYDA 2TGTA 4RSPA 4HGCA 3U8OH 1GVZA 1ZOMA 3SU0A 3GY5A 2P93A 3CENA 1P2NA 1MTUA 4A7IB 5ESBA 4Y10E 1DXWA 5GPIB 1PPEE 4A5TS 4BTUB 3AAVA 2FLRH 1O35A 2F83A 2GT7A 5BPEA 2F9OA 3UOPA 1ORFA 3HK3B 2NU4E 2G4UA 3BG4B 5FBEA 1ZSLA 2FOFA 1O37A 1P02A 1C5TA 2RA0A 3STIA 3A80A 1P9SA 1UMAH 3M5MA 2VIWA 3SQEE 2ZU4A 3IITA 1W11U 1O3BA 2FZZA 1LMWB 1QJ1B 3E8LA 2O8UA 3A8AA 4QT8C 1UCYH 1DICA 5EU8A 3KL6A 4KP0A 1DWEH 4CR5A 2BD7A 4ISOA 4U32A 1CGIE 1GHAG 1HJAB 1C5VA 2ZA5A 2F9NA 1A0LA 4FVBA 4BXSA 1KXEA 1HRTH 3TGKE 4IN2A 4D7FA 4GCHG 3VFEA 1SB1H 1FY5A 1PPZA 1HBTH 2TRMA 1O2YA 1SLUB 3SGBE 1N6XA 1BIOA 1IQNA 4DGJA 2CN0H 4ABEA 3NUMA 1GJ4H 1RFNA 4K60A 3URCA 4AFSA 2EC9H 1GHBF 2XXLA 4DVAU 2A1DB 1IQGA 1EUFA 2WPJS 1TMTH 1OWJA 1V2PT 4LK4A 1O2VA 2IN2A 1N6YA 2GCTB 3CP7A 5F6MA 1UCYK 1Y59T 1DPOA 1N8OC 4GVUA 4ZH8A 5AF9H 2CHAB 1Y5AT 1Z7KA 4E06H 9LPRA 1QHRB 3SNDA 4K5ZA 1AZ8A 4MTBA 1RGQA 1ZPBA 3VB5A 5DP4A 1CQQA 2KAIA 3ZVEA 2VB0A 2NU1E 1GL1A 1EJAA 1SHYA 1TPOA 2W3KA 1ANCA 2QN5T 2ODQA 2ILNA 1L0ZA 1HAZB 4MPVA 1GBAA 1A2CH 2HLCA 2AMQA 1ELGA 3SZNA 2GMTC 2Y82A 1C2GA 3RXRA 3RLYH 5EPNA 1EASA 3A8BA 3M5NA 4IMZA 3UTUH 3FP6E 1NN6A 2J2UA 3RM2H 1XXDA 1GI5A 1BTWA 1DY9A 1ZHMA 1YLDA 2NU2E 3T5FH 2R2MB 2VGCB 1Z8JB 3P17H 5F8XA 5SGAE 2R3YA 1ELEE 2BDAA 3RXMA 4OS5A 5AVDA 4WMFA 2A5KA 1T8LA 1TONA 4MG3A 4MDSA 1S84A 1BHXF 2WUBA 1EOJA 1K21H 1MU8B 2SGPE 4NA7A 1OXGA 2ZTZA 4Y71A 4ISLA 1HYLA 5DPAA 3RXSA 5FCKA 1XUHA 1O2LA 7LPRA 3G01A 1BMNH 1G3CA 1GHAF 3KQCA 1PQ8A 3GCNA 3P8OA 1IOEA 1LCYA 4JCNA 3ESTA 4IS5A 3FZDA 1GBDA 1PQ5A 2OXSA 2ANWA 5H4IB 5A8YA 1NFWA 2BOHB 1EQ9A 3MO6A 1P2KA 2ZGCA 5GCHG 4GCHF 1MCTA 1P10A 3BEIB 3T29A 1CU1A 1W7GH 1WQVH 2FIRH 1TA2A 3EA7A 4E7NA 3NWUA 1BHXB 5FPYA 4YTAA 4HI3A 5B6OA 1MQ6A 1EXFA 3D23A 1NU9A 3KGPA 2FX6A 4FUJA 5T3HA 3RXOA 5EQRA 4ZMAH 2AIPA 1XX9A 1O39A 3EA9A 1UHBA 4Z6AH 3EGKH 4CRCA 1AMHA 1K1NA 4H6SB 2AGGX 4X6PA 1GMHF 1H9IE 1TBQH 1Z8IB 2EI8A 1LPZB 1A3EH 1BT7A 1GMCG 1O2NA 1QJ6B 4TWYA 3S69A 1FMGA 1TRNA 1ZGVA 1ELVA 5CMXH 3T25A 1MZAA 2FP7B 2AH4X 2FXRA 5CHAB 1LO6A 3LPRA 4YESB 1D6WA 5I46H 2THFB 2A2QH 2ZDKA 3O8CA 4I8JA 2XC4A 1P06A 1C2LA 1BJUA 1C1VH 4Q7XA 2GV7A 3SJKA 2GP9B 3SI4H 2VIQA 2P8OB 3DA9B 5L6NH 3PB1E 2PTCE 1UTLM 2Y80A 3V13A 2BDHA 3TLOA 1VJ9U 1FY1A 1MU6B 1O2JA 4WY3A 1TNKA 1MBMA 3PMJA 2BLWA 2SGEE 1SLWB 1ZMJA 4NZLA 1PPHE 2PFEA 2A0QB 3TH3H 1V3XA 4I8GA 1S0RA 1DANH 3ATIA 3LC5A 5HMAA 1O2SA 5EQSA 1IQMA 1YCPM 1AHTH 4XBDA 3ZZ8A 1QRZA 2BB4A 3RXFA 2BDCA 1FY3A 2BXUH 1AVWA 2FOEA 5DP7A 3SU2A 1NC6A 1SGQE 3QUMP 1DOJA 2D8WA 4U01A 1GCTB 1YF4A 3RP2A 1DWCH 4X2WA 1LHDH 1WOFA 3HPTB 6LPRA 3EA8A 2GDEH 3T26A 2B5TB 1NFUA 1YCPH 1TGCA 1SPJA 2ZU5A 1EZXC 1HXFH 1P09A 1O31A 1EP5A 4JK5A 1EAXA 1J9CH 5E0JA 1C1NA 2GZ8A 1GJ7B 3RMLH 5GCHF 4X1PU 5A0CA 1KXCA 1ELTA 3UUZA 1ZMLA 3MH7A 1ID5H 3IG6B 1O5EH 4DIIH 4DCDA 3SV9A 3RXUA 2ZGJA 1AVXA 1C5LH 1SC8U 3L6PA 2HNTC 2AERH 4WMDA 2FM2A 1J17T 3KCGH 4JZEH 3RC4A 1XUGA 2G8TA 2A7JA 3PLPA 4LOYH 1D4PB 1Y8TA 3RXGA 3MH4A 2QA9E 4A1TA 1NRNH 1YCPK 4NSVA 1FAKH 2VVCA 2BM2A 2XC0A 3SU6A 4OS6A 1GMCF 3BG4C 1XM1A 1VR1H 4ISIH 5HXFA 6GCHG 1SGIB 1GBBA 2PKSB 2SGFE 2V3OH 1RTLA 2WUCA 1UK4A 1FUJA 4I7YH 2ZFRH 3GISB 3K2UA 4YLUA 4UE7H 5F03A 2K1QA 3EDXB 3GCHB 2G81E 1UO6A 2FS9A 3SJIA 4DURA 4IC5A 5EXNA 3U8TH 2ALPA 1OOKB 3V0XA 1AB9C 3LOXA 4MQAA 2WINI 4FUBA 2EI7A 1P3EA 2OTVA 2ZCKP 1B0EA 1IHSH 2ZWLH 2BYAX 1HJAC 3A7WA 1ZTLA 1GJ6A 1RXPA 3PMBB 1FPCH 3TPIZ 2O8MA 1KXDA 2VWMA 4FUCA 3SNBA 3TNTA 3RC6A 1C5XB 3PYHA 3S7KB 2G52A 2C3SA 3UWJH 1C2DA 2Q1JA 1O2PA 3LJOA 2AGIX 2C90B 3U69H 1TIOA 3D65E 4NCYA 3SU5A 2ZFTA 2A2XH 1SLXB 1FI8A 1HAVA 2V35A 1THSH 3BIUH 1RIWB 4UD9H 5E8EH 4F4OC 3V12A 2H9HA 4R8TB 2W7SA 5JB9S 4VGCB 1O3HA 3RXBA 1CHGA 1LDTT 1T31A 4R0IA 5C67A 2Y5HA 1XUIA 2ZHEH 1KTTB 1CVWH 1TQ7B 2BD8A 1DE7H 1AUTC 1ESAA 2GCHG 1VGCB 3SQHE 3RMNH 1TA6A 4WXVA 3ZV9A 1O2RA 3QWCH 2WYGA 2EEKA 3OY6U 1ZJKA 1C5PA 1EZQA 1OP2A 4ABAA 1AFQC 1G2LA 1P05A 3GY7A 1ETSH 5TJXA 3SNAA 3SO3A 3UQVA 1GI3A 1OWHA 1L2EA 1XKAC 1ESTA 5GIBA 2VU8E 3OY5U 3MO3A 4UFDH 1BOQA 1G3BA 1AQ7A 3R0FA 1PYTD 2RA3A 5FCRA 4Q2KA 1YLCA 4JYTA 1DLEA 4ABIA 4KTSA 3UR9A 4PROA 4D7GA 4NIXA 4MPUA 3TK6A 4LZ4B 3P6ZB 1WBGB 5TCAA 2F3CE 1V2MT 1KSNA 1S83A 1E37B 3S9CA 2B0FA 4FU9A 3RXLA 5C1XA 3DD2H 1BRBE 3MH5A 4H42U 1G9IE 1N1LA 1AWHB 3UIRA 2C8XB 5EQQA 3SUGA 2FI4E 1A5HA 6GCHF 2P3UB 2BTCE 1LVBA 4WVPE 3PWBA 3KQEA 4H4FA 1Y3XA 1C5OH 1HNEE 4O9VA 4O3TA 1EX3A 5FBIA 3NZIA 2C4FH 4AFZA 3MU1A 4CHAC 1A5IA 3KN2A 1JRSA 4YM9A 1UHBB 1YPGH 1DS2E 1SFQB 4A6LA 1SHHB 1FQ3A 2Y5FA 1SGCA 1NS3A 2XTTB 1AD8H 3B9FH 4NGAH 1EB1H 1HPGA 1O30A 1W0YH 3ZZ7A 2P3TB 3MTYA 3E1XB 1PPCE 1W0ZU 2VIOA 3RXJA 4FU8A 1FAXA 1L4ZA 1SQOA 2Z9LA 3S7HB 4K1SA 4ZXXH 1A5GH 4B76A 2WPIS 1BZXE 1EJMA 1HCGA 1OWIA 3ZZAA 1AE8H 4JK6A 2H5CA 4X8VH 4Y8YA 2R3UA 3BEFB 2EA3A 3FP8E 1QNJA 4GSOA 5GJ4B 2J92A 2FODA 2GCHF 1CGJE 1TBZH 3SN8A 1SG8B 3M7UA 1SGTA 1KXAA 1S6HA 2ZF0H 3F9FA 3M3TA 2C8WB 3SU3A 4A1XA 4ISNA 5AFZH 4Q80A 1JIMA 3A8CA 2ODYB 1D9IA 1LTOA 2STBE 2QYIA 4ASHA 3SV7A 4ZKRU 4WMEA 1NY22 1CT0E 1P2QA 4FUGA 1JWTA 2VH6A 1GHWH 1WTGH 1TYNA 3DUXH 2XBVA 2ZPRA 1F2SE 1UTJA 1SGPE 4NG9H 3AASA 3U8RH 4X8TH 4ABHA 3DFJA 2VIPA 3GDUA 4RKOB 2VINA 2QV1A 2OLGA 1TPSA 1W3CA 1VITG 4RKJB 4K1EA 3RXQA 1QIXB 2SGDE 1EZUC 5ESTE 3K6ZA 3Q77A 5DP6A 2WV5A 4AG2A 4K8YA 7KMEH 3V7TA 4B71A 3SORA 1J8AA 2ULLA 3VEQB 2Z6BD 1AWFH 3FVFB 2FI3E 4Y79A 5A2MH 1Q2WA 2J94A 5I25A 1C1SA 1BBRE 1GCTC 3UR6A 3ZZ9A 3LU9B 1WYKA 2J9NA 2BZAA 1O5AB 4YT6H 2GVFA 2HOBA 2CMYA 3A7VA 1DVAH 2QGRA 1B5GH 1S81A 1O2IA 3H7TA 1CA0C 3E16B 4IC6A 4MNVA 3BV9B 1K1IA 4ISHH 1E36B 1FJSA 1BUIA 2R0KA 2TGPZ 3CS7A 2PLXA 2VH0A 1EAWA 1O3IA 1QGFA 1GL0E 3HGNA 2BDYA 5ETXA 1O3PB 1C4U2 1UVOA 1Z1IA 4Q7YA 2R9PA 5JBTA 3PM3A 1Z8RA 4K1TA 1O38A 4X6OA 2OBQA 1BBRH 5AFYH 3RUOA 2V0BA 1JBUH 2BD3A 1O5BB 3TU7H 2YNAA 5FAHA 3ITIA 1L1JA 2Z9JA 1GMHG 2GX4A 1A61H 2A4QA 2OINA 3VB6A 2ZU3A 2I6QA 1O3DA 1SL3A 4X1NU 3A81A 1JMOH 3LDXH 1F7ZA 4TY6A 4NFFA 1C5UA 2SNWA 2HALA 1GI4A 1OWEA 3GDVA 1UTMA 2ZIQH 4MNWA 2EI6A 1YM0A 2A5IA 2GD4B 1YPEH 5EPYA 1K1JA 1JXPA 1YPHE 1C4V2 1DX5M 1AKSB 4WF8A 3RC5A 1C5NH 2Y7XA 1GGDC 5HM2A 1YPJH 1BBRK 2VWOA 2P95A 4MPWA 3TGJE 1FN8A 1HAVB 1W10U 2XBXA 2O9QA 1KIGH 5EXLA 1BA8B 1SGFA 3BTFE 2BY8X 2UWPA 1YP9A 1GMDG 2ZQ1A 3TVJB 4KGAA 3LH3A 1TNGA 3M3VA 3SNCA 5FHTA 3I78A 1A0JA 2AMDA 2BLVA 2V6NA 1TRMA 1MH0A 1S85A 1VITF 2QXIA 5L2YH 1EB2A 1VITH 4DJZB 3MWIU 2ZPSA 1XXFA 3ATKA 1G3DA 3MO9A 3TITA 4XDEA 2XCFA 1VJAU 4FUEA 1DWDH 4INLA 1H4WA 4U2WA 1B7XB 1YC0A 4I8HA 3FAOA 1O34A 5DP9A 2Z3CA 2W7UA 1YBWA 1TGBA 3MNSA 8GCHG 3ATMA 3LC3A 4KTCA 5A0BA 2FESH 1EP6A 5DK1A 1MCVA 4YLQH 1UTNA 1VGCC 1QR3E 2UWLA 1O2MA 1VZQH 1T8MA 1VCWA 1W7XH 1V2NT 4XE4A 5AHGH 5CE1A 4K3JA 2A32A 3BEUA 2H1UA 4HTCH 4BXWA 1P8VC 2ALVA 1AIXH 3SJ9A 3ATLA 4IBLH 3SV8A 4DOQA 3JZ1B 1GJ9B 3GYLB 1XUFA 3S9AA 5HGGA 5FX6A 1C1QA 2XRCA 4HZHA 1NZQH 1DDJA 4Y8ZA 1INCA 1F0SA 2SGAA 1EKBB 1SI5H 1MZDA 2BOKA 1NRRH 5TCCA 1FY4A 1WTHD 3EE0B 1DM4B 1P3CA 1T8OA 2GGVB 4XSKU 2FTLE 5C5NA 5HYOA 3P8GA 5DP3A 1W13U 1THRH 2JH0D 1QFKH 1O3GA 4CBOA 1Z6JH 1Y3WA 1QB6A 4AOQA 1ESBA 2TGAA 3KHVA 3SGAE 3UNRA 4IN1A 3VB7A 3RDZA 3PLBA 3ZVGA 1QQ4A 3ODFA 1L1GA 3RXCA 3NPSA 3RU4D 2BX4A 3S0NA 5FX5A 1HDTH 3LIWA 3ZZDA 3ZV8A 1D3DB 1IHTH 1H1BA 1SGFG 1P57B 3HATH 3W94A 3QN7A 2JETB 2CGAA 1Y5UT 3Q3YA 2OP9A 2FOCA 4TPIZ 2BVRH 3ZZ3A 1GMDF 3RXEA 2PR3A 4ABJA 1YGCH 4A1VA 4INKA 2YOLA 2ZEBA 1OWKA 3FANA 2BD2A 2F9PA 3H7OA 4NWLA 4ABFA 4AGJA 2ZFQH 2FOBA 4XBBA 2OCVB 2ZKSA 4AB9A 4B1TA 3SHAH 4B2AA 2RCEA 4FUHA 5LPRA 1GI1A 4A92A 4CREA 2BY7X 1HV7A 4ABGA 2FS8A 2OC1A 4KTUA 4Y7AA 2ZCLP 1Z8GA 2Z3EA 1NRSH 8GCHF 3B8JA 1T4UH 3Q76A 2BLQA 1K1OA 2XNIA 1GBTA 3ZVFA 3TJVA 3M35A 1T8NA 3LGIA 5JB8S 1TX7A 4AGKA 2FI5E 4WXIA 1NT1A 2WPKS 1TMBH 2JH6D 3M5LA 4YT7H 3LONA 1KY9A 2QXJA 2JKHA 3UWIA 4OS1A 2ZNKH 1P0SH 1GBJA 1TNIA 3SNEA 1BJVA 1DUEA 2FDAA 3SUFA 4UFGH 2ZDNA 1BTUA 1C2IA 1ZMNA 1BTXA 1O2XA 2CXVA 1IQJA 4ABDA 2FTMA 4FVDA 3GYMA 3ELAH 5DP8A 4BAOB 3F9EA 3FZZA 4B73A 2QXGA 1O2ZA 4LXBH 4GUXA 4ZKNU 3I29A 4NWKA 5HM9A 1GHYH 1V2LT 1M9UA 1GPZA 3BTHE 1QBNA 3BG8A 9ESTA 1ZZZA 4O03A 1C1PA 3LGTA 4BAMB 4K69A 1EPTA 1PFXC 1G30B 3C1KA 2ZQ2A 2PHBA 1YKTA 2A45B 2Z7FE 1GBIA 1O2KA 1TMUH 1GBHA 2BX3A 2J4IA 2OD3B 1HAPH 4X2YA 2ZDMA 1GVLA 1N8OB 4KELA 1SFIA 3T62A 4ZKSU 3KQDA 1LQEA 3QZRA 1QRXA 1ELFA 1UVSH 2FMJA 3K9XB 1ANEA 1TB6H 4I31A 2Z9GA 1CGHA 1O33A 1KLJH 1YPKH 1ZRKA 3ZZCA 1AU8A 4Q7ZA 4DY7B 2B8OH 4AG1A 8LPRA 1OPHB 1P2JA 2A31A 4BAKB 2AEIH 2TIOA 1QL9A 1TNHA 2FOGA 4IGDA 2OQ5A 3GCOA 2OBOA 2OQUA 1LPKB 3QX5H 3MU4A 1BRCE 2PSXA 4WH6A 3SV6A 2ASUB 3EYDA 1QB9A 1GJ5H 1PQ7A 2HRVA 1TE0A 1AKSA 1YPLH 2LNCA 1ARBA 3KQBA 3SGQE 2ZTYA 1P01A 1ABIH 4NIWA 3LT3A 1EAIA 1D6RA 2ODPA 1FN6A 1CSOE 1GG6B 1QURH 2GCTC 3S9BA 1TGSZ 2ZGXH 3LKWA 5C3NA 1QQUA 1K2I1 1RTFB 2CHAC 2SNVA 2WPHS 3GICB 1P2IA 1E38B 3BTEE 3HKJB 1F92A 4DW2U 1G36A 2Y5GA 1MQ5A 2QY0B 1OP0A 4I8LA 4RN6A 1KLIH 3RLWH 1RTKA 1E34B 1O3LA 3ZZBA 1TAWA 2P16A 3QTOH 1HAXB 1V2TT 3R3GB 1DITH 1UVPA 2F9VA 3F9HA 1TNJA 2CF9H 1TPAE 1V2KT 4TY7A 3BTGE 3GDSA 1T4VH 4XFQA 1LQDB 2G00A 2ZU2A 2OC0A 4AFQA 1J14A 1YPMH 4ABBA 1AUJA 1P2MA 3A8DA 2LPRA 4Y6DA 2J95A 4UEHH 2WV4A 2JH5D 1SMFE 2VGCC 3U1JB 5ABWA 3K65B 3A82A 4BTIB 1S6FA 1TBRH 1ZSJA 6CHAB 1AY6H 2AGEX 2D2DA 1F0RA 2ANKH 3QO6A 1UTKA 4UFEH 3URDA 3A7TA 1D3PB 3O8BA 1FV9A 1WU1A 2FOHA 2ANMH 4JZFH 3LGUA 1NO9H 2G55A 4J2YB 4F49A 1O2GH 1GJDB 1C2FA 1QA7A 2ZCHP 2O8LA 2A4RA 4CBNA 2ZO3H 1TOCB 1D3TB 3RXIA 1O5GH 2UUJB 3F6UH 1L4DA 3D62A 1GBEA 2J34A 2ZI2H 1TGTA 1GJAB 1TX6A 3PV4A 1BRAA 1ZHPA 5C5OA 2FPZA 2Z94A 5EODA 2HNTE 5DG6A 1C2JA 3I77A 3LGYA 4X8SH 5LPEA 3V3MA 1ZRBA 3TJUA 1PPBH 1MTVA 3NK8A 4X6MA 4BOHA 2ZGBH 1LHCH 4THNH 2ESTE 4O97A 1YPHC 3LGWA 1C1OA 2QAAA 2GZ9A 2XYAA 3P8NA 1C2HA 2FOMB 1A1RA 2PGBB 5EOKA 2CF8H 2XBYA 1MD7A 1E0FD 2VVVA 4AYVB 3EQ0H 1SGDE 3M3SA 3VGCB 3GY2A 3ATWA 3HGPA 4SGAE 2Q6DA 3JZ2B 2F9BH 2FWWA 4X1QU 5E2PA 4CRBA 4I33A 4SGBE 4FUFA 1Q31A 1UTPA 2W5EA 5J4SA 2M5TA 3P92A 1IQKA 1FIWA 4TPYA 4ZHLU 1B0FA 2VJ1A 2BMGB 5CHAC 1H8IH 1ZYOA 3ZVAA 4CRDA 2PKAA 4AN7A 1FPHH 4D8NA 2Z9IA 2ZDVH 4OS7A 4AZ2B 1EATA 4BNRA 2WYJA 3E3TA 1SGRE 1QB1A 3SV2H 2A7CA 2P8OC 2PUQH 5C20A 1XMNB 1BTHH 4NA9H 2CJIA 2QC2A 1HAOH 1UK2A 3QTVH 3Q3XA 4DG4A 3E0PB 2TPIZ 3W95A 3UNQA 2JETC 3SHCH 3NCLA 1HIAA 4BAQB 2XCNA 3CS0A 4AORA 4MPXA 5IYTA 2TGDA 1O3FA 5A0AE 1KXBA 2XW9A 5FXLA 2XC5A 4NIYA 2DE8A 3UFAA 1SGYE 1KLTA 1O2OA 3Q00A 1UCYE 4FUIA 1GJ8B 1LPGB 1O3EA 1MKXH 1PPFE 1GHZA 1QTFA 3P95A 2VVUA 3FP7E 5EG4A 1E35B 1V6DA 5A8ZA 3D49H 3BF6H 1K1LA 5JPMH 3RXPA 4Y0ZE 2UWOA 1TLDA 2RDLA 1F5LA 1P2OA 1UVUH 1V2JT 2XBWA 1C5YB 1ANBA 1JOUB 4ZAEA 4CH8B 1WSSH 2A5AA 4KKDA 2ZECA 2A4OA 1GDUA 1BMMH 3BTME 3KNXA 3SBKA 4Y11E 4X8UH 2AMPA 1S82A 1LKBA 1DUAA 1V2WT 1BQYA 5F8ZA 3MU5A 2BDIA 2AFQB 2HWLB 1A4WH 1CO7E 2UUFB 1EAUA 1AB9B 1HAYB 2WPMS 3OU0A 2STAE 1QBOA 5T6GA 1GHXH 1ZGIA 1CBWB 4X1RU 4UFFH 5EXMA 1EPTB 4FU7A 1NFYA 1ETRH 1MKXK 2Z9KA 1FDPA 1W14U 1GBMA 3UOUA 4XOJA 1AGJA 4INHA 3AW0A 1BTPA 2YNBA 1BMAA 1AI8H 1NPMA 5DP5A 8KME2 1F0UA 3ZZ6A 1TRYA 5EGMA 4GAWA 2IOTA 1SGEE 3F1SB 5JBCS 3DHKH 1QBVH 3SJOA 1C9PA 3A7XA 1LVYA 3M37A 4ZHMU 1HJ8A 1GI9B 1Y5BT 1A3BH 2W3IA 4YOIA 4DT7B 1IQFA
chains in the Genus database with same CATH superfamily
1ELAA 4YZUA 1OX1A 1QL8A 2P59A 3DT0H 1EOLA 4NSYA 4ZROA 2PKSC 4K8BA 2GTBA 1SQTA 2C8YB 1ETTH 5K7RA 3GCHC 1EFRD 1BCUH 1WQSA 3N7OA 4JZDH 4B74A 2CK3D 4OS4A 1GBCA 3L3TA 1ZJDA 1WAYB 2FYRA 4ZUHA 1MTNB 3RM0H 4GLYA 2BQ7B 3GY4A 4GHQA 2QXHA 1C1TA 1O2WA 3UY9A 1C5QA 2ZDLA 2ZG0H 4AX9H 1JIRA 4ESTE 1NTPA 1AFQB 1C2MA 1CT2E 1RJXB 3RU4E 2BQWB 2ZHQH 3BTQE 1O0DH 2XWBI 4FUDA 3T2NA 1GDNA 1BDAA 2FOAA 1IQEA 2FLBH 2ZDAH 3M36A 1H8DH 1CHOG 1THPB 1AN1E 2JJ1D 5EJ1A 5G4BA 1SBWA 1Y3VA 3F3BA 1G3EA 3ZVDA 4OGYA 3PWCA 1MUEB 3UPEA 2FYQA 1L1NA 1VCPA 4Q63A 2OC8A 1RD3B 1O3MA 2QCYA 4MNXA 2BZ6H 1J16A 3MYWA 1D3QB 1GDQA 1RIWC 2G5VA 1RRKA 3TIUA 4Y7BA 3KF2A 5KEDA 5JBAS 1MAYA 5E2OA 3KIDU 1KDQA 1GG6C 4AFUA 2WZQA 1A46H 3BTKE 3GCTG 1HLTH 1ZHRA 2BY6X 4VGCC 2BHGA 4ZKOU 4B2CA 2G51A 2OC7A 2ZHFH 2BVXH 1AO5A 1PYTC 2V3HH 1OS8A 2HVXA 3SZEA 1GI7B 1O3KA 3L33A 3ZVCA 5EW2H 2B9LA 3WY8A 2GZ7A 5T6FA 2DUCA 2A4GA 1BB0B 3T27A 4CHAB 1V2OT 1S5SA 1TGNA 3P70B 3SI3H 1ZR0A 1A0HB 1ELBA 1TALA 3PO1B 1H8ED 2BDBA 2PW8H 3ODDA 5EW1H 1XVMA 3KQ5A 2BVSH 3ZYEA 1WV7H 1QCPA 2LP6A 4RT0A 1HUTH 2Y81A 4GPGA 4I32A 2KZ4A 2ZGHA 1GWAA 1LHEH 2H9TH 3MFJA 2Q6FA 4BTTB 2ZPQA 3QLPH 1MTSA 2HGTH 1K28D 3A85A 1C2EA 2BLOA 6CHAC 4NZQA 3SJ8A 1RS0A 1J15A 1GHVH 1G32B 3MMGA 4X6NA 1TQ0B 3QGNB 4JZIA 4DT4A 2CV3A 3RXDA 4WH8A 2GT8A 2K8IA 2XWAA 2ZTXA 1O2TA 3SW2B 1V2ST 3HKIB 5JYIA 4BAHB 2BY5X 4YO9A 1CE5A 1AZZA 1DY8A 2BD5A 3PMAB 1FLEE 1SSXA 4CRAA 1FNIA 1F0TA 2Q6GA 2ZC9H 2UUYA 3PV2A 4CRFA 3OTJE 1IQHA 1MAXA 1O3OA 2NU3E 1BTYA 3VB3A 4F55A 1XUJA 4RI0A 2QF0A 3E91A 4GHTA 1KYNA 1PJPA 2F91A 4E7RG 1O5FH 2Y6TA 1DSTA 1GI0A 1FXYA 1TABE 1W12U 2WSSD 1UTQA 3OYPA 3VXEH 1HJ9A 1SOTA 1BTZA 3HK6B 5GNDA 1V2RT 1IQIA 3RMMH 3U98H 1UK3A 5L30H 3K6YA 3SOSA 1C5MD 1CHOF 1IQLA 2H2ZA 4O3UA 4D9RA 4B75A 1SR5C 1T32A 3KEEA 1ACBE 4TYDA 4FOUC 3TJOA 1NU7B 4MLFB 3RXHA 3AVZA 3BTTE 1HAIH 3B23B 1O2QA 5LH8A 1W8BH 2PKAB 1SQAA 4CRGA 5BRRE 1HFDA 4LZ1H 1NRPH 1K9OE 3RXKA 5A09A 3TNSA 1H9LB 3A89A 3VGCC 3GCTF 3M7QA 3OE7D 1G2MA 1ZLRA 1ELDE 2VIDA 1OYTH 2H5DA 1C9TA 2H6MA 2Z3DA 2W26A 1GI8B 2J38A 3O8DA 5JDUB 4AB8A 1LHFH 5HIYA 2R2WU 3PROA 3MHWU 4X0WU 5A8XA 2VNTA 3BN9A 3UREA 1HIAB 2OK5A 1KTSB 1HXEH 4JMYA 1OSSA 2B7DH 3AAUA 1Y3UA 1S0QA 2O8TA 2DE9A 2VIVA 2BD4A 3VPKA 5FPSA 4MNYA 1TPPA 4HFPB 4UDWH 2QF4A 2BDGA 3STJA 1CA0B 1C1WH 5DN6D 3U9AH 3TJNA 1LVMA 5C94A 5FPTA 2VWLA 3MI4A 3T28A 5LGOA 4OS2A 1FY8E 3ZZ4A 1ZPZA 3EAJA 4E05H 1MKWH 1TX8A 1HB0B 5E0GA 2PSYA 1TWXB 3A87A 2WV9A 1ANDA 1BITA 2D1JA 4B2BA 1AVGH 4K2YA 1G37A 4YOGA 3M7TA 3TK9A 2WPLS 3QK1A 4Z0KA 3ZVBA 1QRWA 5DKMA 3A83A 6ESTA 2AS9A 1JRTA 2GDDA 3U1IB 1O32A 1NFXA 1OKXA 4Y0YE 3SUEA 1O3NA 3TH2H 1P9UA 5CDFE 3OX7U 4CH2B 3MNCA 5DJ7A 2XNDD 4X1SU 3RU4T 2GJGA 3LGVA 3MU8A 2G4TA 2O8WA 1O3CA 4P00A 5L2ZH 5JBBS 4ZCNA 3A84A 2ZFFH 1MKWK 2BXTH 4TWWA 1C5ZB 1GBFA 8ESTE 2AIQA 1BMLA 3MH6A 2GKVE 2GMTB 3E90B 1O3JA 1A7SA 3QDZB 2ZHDA 5C1UA 1GGDB 1SVPA 3TH4H 1K1PA 2R0LA 4OGXA 1CBWC 2NWNA 2ZHWH 1EPTC 1CT4E 2QIQA 4H6TA 4J1YA 1TNLA 1VCQA 5E0HA 1C5SA 3RXAA 1Z71A 3OEED 7GCHG 1H9HE 4IMQA 2Y7ZA 4XBCA 5DO4H 2NU0E 1AE5A 2SGQE 1ABJH 1HAHH 4FXGH 1HGTH 2BY9X 3M5OA 4BANB 3SU4A 5IDKA 4U30A 2KAIB 3PMHB 1DSUA 1C1RA 3UQOA 3LH1A 1Z6EA 1NESE 1OWDA 1C4Y2 1O5DH 2TBSA 4JYUH 3GY3A 4CR9A 5GXPA 5F8TA 7ESTE 5PTPA 1UTOA 1UVTH 1O5CB 2BD9A 3ENSB 3KYFA 3VXFH 4X2VA 3GY6A 3SU1A 3Q3KA 1X7AC 4X2XA 1SGNE 1EJNA 1DLKB 4NIVA 1FONA 3UNSA 3RMOH 1MTNC 1QA0A 1GI2A 4I8KA 5J4QA 1C5RA 1DXPA 3BIVH 1PQAA 4YXWD 1QJ7B 1KDQB 1O36A 4WWYA 3RXVA 1YYY1 3MU0A 1DT2A 3ZZ5A 2ANYA 2FEQH 3BTDE 1P11E 4YOJA 5C2ZA 1K22H 1NRQH 3MOCA 4ZHAA 3GOVB 3LJJA 1GCDA 4D76A 3H5CB 3P8FA 1FZZA 1O3AA 2IPHA 2IJOB 1K1MA 2RG3A 1CA8B 4M7GA 2KX4A 3M61U 1C1UH 3QZQA 2KCOA 1LVOA 1MD8A 3A7ZA 3NXPA 1ZPCA 1HAGE 1FIZA 1GBKA 3NKKA 3O8RA 2P3FH 4Y8XA 1GJBB 3MNBA 1ZTJA 2ZP0H 3IWMA 2VWNA 2A7HA 3GY8A 1GBLA 3QGJA 1TOMH 2QF3A 2F9UA 2HPQH 4D9QA 2P94A 1Z1JA 3DFLA 2EQNA 1EZSC 1QY6A 3BTWE 2PGQB 3DSOA 3A7YA 1PPGE 5K0HA 2ZZUH 3PTNA 1LKAA 4JZ1A 5LPFA 1W2KH 2FX4A 1LHGH 1V2UT 2AYWA 3C27B 2H9EH 1C5WB 3F68H 5GWZA 2UUKB 3PO1C 1O2UA 1F5RA 4DIHH 2OUAA 3PLKA 4JYVH 2PWXA 7GCHF 1KXFA 2C93B 1BRUP 1V2VT 1F5KU 3UB0A 3AW1A 3PTBA 1ZTKA 3OSYA 2GV6A 1Q3XA 1MABB 1WCZA 3FFGA 1GHBG 1MMJN 1O2HA 2PUXB 5GDSH 4AYYB 4NFEA 1XUKA 3E0NB 4MVNA 4ZXYH 1P12E 1OP8A 1XVOA 2HNTF 1ARCA 3BSQA 1SOZA 1UJ1A 3TK5A 2KCPA 4UONA 2HPPH 1P04A 1MBQA 3E6PH 1T7CA 1NROH 2ZFPH 2SFAA 1NM6A 1ZSKA 1ELCA 2ZFSA 1GVKB 1DFPA 1Y3YA 1DWBH 5DGJA 1C2KA 1TFXA 2BQ6B 3TGIE 1OYQA 5T6DA 1GI6A 2I6SA 4NA8A 1P03A 1U6QA 1XKBC 3F9GA 2PTNA 4Y76A 2C8ZB 1SLVB 2PV9B 1WUNH 4WJG2 1V2QT 3MNXA 2G5NA 2ZU1A 3A86A 4IW4E 1C1MA 1IAUA 1GJCB 3RXTA 3VB4A 1QL7A 2FO9A 5B6LA 1AFEH 2D26C 3A88A 1MTWA 5C1YA 3SUDA 3ZYDA 2TGTA 4RSPA 4HGCA 3U8OH 1GVZA 1ZOMA 3SU0A 3GY5A 2P93A 3CENA 1P2NA 1MTUA 4A7IB 5ESBA 4Y10E 1DXWA 5GPIB 1PPEE 4A5TS 4BTUB 3AAVA 2FLRH 1O35A 2F83A 2GT7A 5BPEA 2F9OA 3UOPA 1ORFA 3HK3B 2NU4E 2G4UA 3BG4B 5FBEA 1ZSLA 2FOFA 1O37A 1P02A 1C5TA 2RA0A 3STIA 3A80A 1P9SA 1UMAH 3M5MA 2VIWA 3SQEE 2ZU4A 3IITA 1W11U 1O3BA 2FZZA 1LMWB 1QJ1B 3E8LA 2O8UA 3A8AA 4QT8C 1UCYH 1DICA 5EU8A 3KL6A 4KP0A 1DWEH 4CR5A 2BD7A 4ISOA 4U32A 1CGIE 1GHAG 1HJAB 1C5VA 2IJD1 2ZA5A 2F9NA 1A0LA 4FVBA 4BXSA 1KXEA 1HRTH 3TGKE 4IN2A 4D7FA 4GCHG 3VFEA 1SB1H 1FY5A 1PPZA 1HBTH 2TRMA 1O2YA 1SLUB 3SGBE 1N6XA 1BIOA 1IQNA 4DGJA 2CN0H 4ABEA 3NUMA 1GJ4H 3MQKC 1RFNA 4K60A 3URCA 4AFSA 2EC9H 1GHBF 2XXLA 3PRBA 4DVAU 2A1DB 1VKYA 1IQGA 1EUFA 2WPJS 2V3MA 1TMTH 1OWJA 1V2PT 4LK4A 1O2VA 2WHXA 2IN2A 1NBMD 1N6YA 2GCTB 3CP7A 3CNRA 5F6MA 1UCYK 1Y59T 1DPOA 1N8OC 4GVUA 4ZH8A 5AF9H 1YWUA 2CHAB 1Y5AT 1Z7KA 4E06H 9LPRA 1QHRB 3SNDA 4K5ZA 1AZ8A 4MTBA 1RGQA 1ZPBA 3VB5A 5DP4A 1CQQA 2KAIA 3ZVEA 2IPQX 2VB0A 2NU1E 1GL1A 1EJAA 1SHYA 1TPOA 2W3KA 1ANCA 2QN5T 2ODQA 2ILNA 1L0ZA 1HAZB 4MPVA 1GBAA 1A2CH 2HLCA 2AMQA 1ELGA 3SZNA 1H8HD 2GMTC 2Y82A 1C2GA 3RXRA 3RLYH 2KM0A 5EPNA 1EASA 3A8BA 3M5NA 4IMZA 3N99A 3UTUH 3FP6E 1NN6A 2J2UA 3RM2H 1XXDA 1GI5A 1BTWA 1DY9A 1ZHMA 1YLDA 2NU2E 3T5FH 2R2MB 2VGCB 1COWD 1Z8JB 3P17H 5F8XA 5SGAE 2R3YA 1ELEE 2BDAA 3RXMA 4OS5A 5AVDA 4WMFA 2A5KA 1T8LA 1TONA 4MG3A 4MDSA 1S84A 1BHXF 2WUBA 1EOJA 1K21H 1MU8B 2SGPE 4NA7A 1OXGA 2ZTZA 4Y71A 4ISLA 1HYLA 5DPAA 3RXSA 5FCKA 2RFKC 1E1QD 1XUHA 1O2LA 7LPRA 3G01A 1S6LA 1BMNH 1G3CA 1GHAF 3KQCA 1PQ8A 3GCNA 3P8OA 1IOEA 1LCYA 4JCNA 3ESTA 4IS5A 3FZDA 1GBDA 1PQ5A 3KYGA 2OXSA 2ANWA 5H4IB 5A8YA 1NFWA 2BOHB 1EQ9A 3MO6A 1P2KA 2ZGCA 5GCHG 4GCHF 2F4LA 1MCTA 1P10A 3BEIB 3T29A 1CU1A 1W7GH 1WQVH 2FIRH 1TA2A 3EA7A 4E7NA 3NWUA 1BHXB 5FPYA 4YTAA 4HI3A 5B6OA 1MQ6A 1EXFA 3D23A 1NU9A 3KGPA 2FX6A 4FUJA 5T3HA 3RXOA 5EQRA 4ZMAH 2AIPA 1XX9A 1O39A 3EA9A 1UHBA 4Z6AH 3EGKH 4CRCA 1AMHA 1E1RD 1K1NA 4H6SB 4HG6A 2AGGX 4X6PA 1GMHF 1H9IE 1TBQH 1Z8IB 2EI8A 1LPZB 1A3EH 1BT7A 4AC9A 1GMCG 1O2NA 1QJ6B 4TWYA 3S69A 1FMGA 1TRNA 1ZGVA 1ELVA 5CMXH 3T25A 1MZAA 5HKKD 2FP7B 2AH4X 2FXRA 5CHAB 1LO6A 3LPRA 4YESB 1D6WA 5I46H 2THFB 2A2QH 2ZDKA 3O8CA 4I8JA 1K0HA 2XC4A 1P06A 3WWFA 1C2LA 1BJUA 1C1VH 4Q7XA 2GV7A 3SJKA 2GP9B 3SI4H 2VIQA 2P8OB 3DA9B 5L6NH 3EE7A 3PB1E 2PTCE 1UTLM 2Y80A 3V13A 2BDHA 3TLOA 1VJ9U 1FY1A 1MU6B 1O2JA 4WY3A 1TNKA 1MBMA 3PMJA 2BLWA 2SGEE 1SLWB 1ZMJA 4NZLA 1PPHE 2PFEA 2A0QB 4M9FA 3TH3H 1V3XA 4I8GA 1S0RA 1DANH 3ATIA 3LC5A 5HMAA 1O2SA 5EQSA 1IQMA 1YCPM 1AHTH 4XBDA 3ZZ8A 1QRZA 2BB4A 3RXFA 2BDCA 1FY3A 2BXUH 1AVWA 2FOEA 2L6OA 5DP7A 3SU2A 4B6EA 1NC6A 1SKYE 1SGQE 3QUMP 1DOJA 2D8WA 4U01A 1GCTB 1YF4A 3RP2A 1DWCH 4X2WA 1LHDH 1WOFA 3HPTB 6LPRA 3EA8A 2GDEH 3T26A 5CHBA 2B5TB 1NFUA 1YCPH 1TGCA 1SPJA 2ZU5A 1EZXC 1HXFH 2WPDD 1BMFD 1P09A 1O31A 1EP5A 4JK5A 1EAXA 1J9CH 5E0JA 1C1NA 2GZ8A 1GJ7B 3RMLH 5GCHF 4X1PU 5A0CA 1KXCA 1ELTA 3UUZA 1ZMLA 3MH7A 1ID5H 3IG6B 1O5EH 4DIIH 4DCDA 3SV9A 3RXUA 2ZGJA 1AVXA 1C5LH 1SC8U 3L6PA 2HNTC 2AERH 4WMDA 2FM2A 1J17T 3KCGH 4JZEH 3RC4A 1XUGA 2G8TA 2A7JA 3PLPA 5KECA 4LOYH 1D4PB 1Y8TA 3RXGA 3MH4A 2QA9E 4A1TA 1NRNH 1YCPK 4NSVA 1FAKH 2VVCA 2BM2A 2XC0A 3SU6A 4OS6A 1GMCF 3BG4C 3DSGA 1XM1A 1VR1H 4ISIH 5HXFA 6GCHG 1SGIB 1GBBA 2PKSB 2SGFE 2V3OH 1RTLA 2WUCA 1UK4A 3F2FA 1FUJA 4I7YH 2ZFRH 3GISB 3K2UA 4YLUA 4UE7H 5F03A 2K1QA 3EDXB 3GCHB 2G81E 1UO6A 2FS9A 3SJIA 3OTPA 4DURA 4IC5A 5EXNA 5IK2D 3U8TH 2ALPA 1OOKB 3V0XA 1AB9C 3LOXA 4MQAA 2WINI 4FUBA 2EI7A 1P3EA 2OTVA 2ZCKP 1B0EA 1IHSH 2ZWLH 2BYAX 1HJAC 3A7WA 1ZTLA 1GJ6A 1RXPA 3PMBB 1FPCH 3TPIZ 2O8MA 1KXDA 2VWMA 4FUCA 3SNBA 3TNTA 3RC6A 1C5XB 3PYHA 3S7KB 2G52A 2C3SA 2KCAA 3UWJH 1C2DA 2Q1JA 1O2PA 3LJOA 2AGIX 2C90B 3U69H 4XD7D 1TIOA 3D65E 4NCYA 3SU5A 2ZFTA 2A2XH 1SLXB 1FI8A 1HAVA 2V35A 1THSH 3BIUH 1RIWB 4UD9H 5E8EH 4F4OC 3V12A 2H9HA 4R8TB 2W7SA 5JB9S 4VGCB 1O3HA 3RXBA 1CHGA 1LDTT 1T31A 5C0UA 4R0IA 5C67A 2Y5HA 1XUIA 2ZHEH 1KTTB 1CVWH 1TQ7B 2BD8A 1DE7H 1AUTC 1ESAA 2GCHG 5KGOA 1VGCB 3SQHE 3RMNH 1TA6A 4WXVA 3ZV9A 1O2RA 3QWCH 2WYGA 2EEKA 3OY6U 1ZJKA 1C5PA 1EZQA 1OP2A 4ABAA 4TT3D 1AFQC 1G2LA 1P05A 3GY7A 1ETSH 5TJXA 3SNAA 3SO3A 3UQVA 1GI3A 1OWHA 1L2EA 1XKAC 1ESTA 5GIBA 2VU8E 3OY5U 1E79D 3MO3A 4UFDH 1BOQA 1G3BA 1AQ7A 3R0FA 1PYTD 2RA3A 5FCRA 4Q2KA 2PP6A 1YLCA 4JYTA 1DLEA 4ABIA 4KTSA 3UR9A 4PROA 4D7GA 4NIXA 4MPUA 3TK6A 4LZ4B 3P6ZB 1WBGB 5TCAA 2F3CE 1V2MT 3FN8A 1KSNA 1S83A 1E37B 3S9CA 2B0FA 4FU9A 3RXLA 5C1XA 3DD2H 1BRBE 3MH5A 4H42U 1G9IE 1N1LA 1AWHB 3UIRA 2C8XB 5EQQA 3SUGA 2FI4E 1A5HA 6GCHF 2P3UB 2W6ID 2BTCE 1LVBA 4ASUD 4WVPE 3PWBA 3KQEA 4H4FA 1Y3XA 1C5OH 1HNEE 1W0KD 4O9VA 4O3TA 1EX3A 5FBIA 3NZIA 2C4FH 4AFZA 3MU1A 4CHAC 1A5IA 3KN2A 1JRSA 4YM9A 1UHBB 1YPGH 1DS2E 1SFQB 4A6LA 1SHHB 1FQ3A 2Y5FA 1SGCA 1NS3A 2XTTB 1AD8H 3B9FH 4NGAH 1EB1H 1HPGA 1O30A 1W0YH 3ZZ7A 2P3TB 2J5UA 3MTYA 3E1XB 1PPCE 1W0ZU 2VIOA 3RXJA 2HVYB 4FU8A 1FAXA 1L4ZA 1FX0B 1SQOA 2Z9LA 3S7HB 3N7DA 2K0QA 4K1SA 4ZXXH 1A5GH 4B76A 2WPIS 1BZXE 1EJMA 1HCGA 1OWIA 3ZZAA 1AE8H 4JK6A 2H5CA 4X8VH 4Y8YA 2R3UA 3BEFB 2EA3A 3FP8E 1QNJA 4GSOA 5GJ4B 2J92A 2FODA 2GCHF 1CGJE 1TBZH 1NBME 3SN8A 1SG8B 3M7UA 1SGTA 1KXAA 1S6HA 2ZF0H 3F9FA 3M3TA 2C8WB 3SU3A 4A1XA 4ISNA 5AFZH 4Q80A 1JIMA 3A8CA 2ODYB 1D9IA 1LTOA 2STBE 2QYIA 4ASHA 3SV7A 4ZKRU 4WMEA 1NY22 1CT0E 1P2QA 4FUGA 1JWTA 2VH6A 1GHWH 1WTGH 1TYNA 3DUXH 2XBVA 2ZPRA 1F2SE 1UTJA 1SGPE 3FO8D 4NG9H 3AASA 3U8RH 4X8TH 4ABHA 3DFJA 2QE7D 2VIPA 3GDUA 4RKOB 2VINA 2QV1A 2OLGA 1TPSA 1W3CA 1VITG 2QF5A 4RKJB 4K1EA 3RXQA 1QIXB 2SGDE 1EZUC 3F2GA 3PRDA 5ESTE 3K6ZA 3Q77A 5DP6A 2WV5A 4AG2A 4K8YA 7KMEH 3V7TA 4B71A 3SORA 2F43B 1J8AA 2ULLA 3VEQB 2Z6BD 1AWFH 3FVFB 2FI3E 4Y79A 5A2MH 1Q2WA 2J94A 5I25A 1C1SA 1BBRE 1GCTC 3UR6A 3ZZ9A 3LU9B 1OHHD 1WYKA 2J9NA 2BZAA 2KFWA 1O5AB 4YT6H 2GVFA 2HOBA 2CMYA 3A7VA 1DVAH 2QGRA 1B5GH 1S81A 1O2IA 3H7TA 1CA0C 3E16B 4IC6A 4MNVA 3BV9B 1K1IA 4ISHH 1E36B 1FJSA 1BUIA 2R0KA 2TGPZ 3CS7A 2PLXA 2VH0A 1EAWA 1O3IA 1QGFA 1GL0E 3HGNA 3FKSD 2BDYA 5ETXA 1O3PB 1C4U2 1UVOA 1Z1IA 4Q7YA 4F48B 2R9PA 5JBTA 3PM3A 1Z8RA 4K1TA 1O38A 4X6OA 2OBQA 1BBRH 5AFYH 3RUOA 2V0BA 1JBUH 2BD3A 1O5BB 3TU7H 2YNAA 5FAHA 3ITIA 1L1JA 2Z9JA 1GMHG 2GX4A 1A61H 2A4QA 2OINA 3VB6A 2ZU3A 2I6QA 1O3DA 1SL3A 4X1NU 3A81A 1JMOH 3LDXH 1F7ZA 4TY6A 4NFFA 1C5UA 2SNWA 2HALA 1GI4A 3U28C 1OWEA 3DSPA 4P02A 3GDVA 1UTMA 2ZIQH 4MNWA 2EI6A 1YM0A 2A5IA 2GD4B 1YPEH 5EPYA 1K1JA 1JXPA 1YPHE 1C4V2 1DX5M 1AKSB 4WF8A 3RC5A 1C5NH 2Y7XA 1GGDC 5HM2A 1YY3A 1YPJH 1BBRK 2VWOA 2P95A 4MPWA 3TGJE 1FN8A 1HAVB 1W10U 2XBXA 2O9QA 1KIGH 5EXLA 1BA8B 1SGFA 3BTFE 1W0JD 2BY8X 2UWPA 1YP9A 1GMDG 2ZQ1A 3TVJB 4KGAA 3LH3A 1TNGA 2HLDD 3M3VA 3SNCA 5FHTA 3I78A 1A0JA 2AMDA 2BLVA 2V6NA 1TRMA 3GS9A 1MH0A 1S85A 1VITF 2QXIA 5L2YH 1EB2A 1VITH 4DJZB 3MWIU 2ZPSA 1XXFA 3ATKA 1G3DA 3MO9A 3TITA 4XDEA 2XCFA 1VJAU 4FUEA 1DWDH 4INLA 1H4WA 4U2WA 1B7XB 1YC0A 4I8HA 3FAOA 1O34A 5DP9A 2Z3CA 2W7UA 1YBWA 1TGBA 3MNSA 8GCHG 3ATMA 3NRLA 3LC3A 4KTCA 5A0BA 2FESH 1EP6A 2YMSB 5DK1A 1MCVA 4YLQH 1UTNA 1VGCC 1QR3E 2UWLA 1O2MA 1VZQH 5F53A 1T8MA 1VCWA 1W7XH 1V2NT 4XE4A 4ACAA 5AHGH 5CE1A 4K3JA 2A32A 3BEUA 2H1UA 4HTCH 4BXWA 1P8VC 2ALVA 1AIXH 3SJ9A 5DSFA 3ATLA 4TSFD 4IBLH 3SV8A 4DOQA 3JZ1B 1GJ9B 2YMSD 3GYLB 1XUFA 3S9AA 5HGGA 5FX6A 1C1QA 2XRCA 4HZHA 1NZQH 1DDJA 4Y8ZA 1INCA 1F0SA 2SGAA 1EKBB 1SI5H 1MZDA 2BOKA 1NRRH 5TCCA 1FY4A 1WTHD 3EE0B 1DM4B 1P3CA 1T8OA 2GGVB 4XSKU 2FTLE 5C5NA 5HYOA 3P8GA 5DP3A 1W13U 1THRH 2JH0D 1QFKH 1O3GA 4CBOA 1Z6JH 1Y3WA 1QB6A 4AOQA 1ESBA 2TGAA 3KHVA 3SGAE 3UNRA 4IN1A 3VB7A 3RDZA 3PLBA 3ZVGA 1QQ4A 3ODFA 1L1GA 3RXCA 5EJLA 3NPSA 3RU4D 2BX4A 3S0NA 5FX5A 1HDTH 3LIWA 3ZZDA 3ZV8A 1D3DB 1IHTH 1H1BA 1SGFG 1P57B 3HATH 3W94A 3QN7A 2JETB 2CGAA 1Y5UT 3Q3YA 2OP9A 2FOCA 4TPIZ 2BVRH 3UAIC 3ZZ3A 1GMDF 3RXEA 2PR3A 4ABJA 1YGCH 4A1VA 4INKA 2YOLA 2ZEBA 1OWKA 3FANA 2BD2A 2F9PA 3H7OA 4NWLA 4ABFA 4AGJA 2ZFQH 2FOBA 4XBBA 2OCVB 2ZKSA 3F2HA 4AB9A 4B1TA 3SHAH 4B2AA 2RCEA 4FUHA 5LPRA 1GI1A 4A92A 4CREA 2BY7X 1HV7A 4ABGA 2FS8A 2OC1A 4KTUA 4Y7AA 3F0PA 2ZCLP 1Z8GA 2Z3EA 1NRSH 1WXRA 8GCHF 3B8JA 1T4UH 3Q76A 2BLQA 1K1OA 2XNIA 3AK5A 1GBTA 3ZVFA 3TJVA 3M35A 1T8NA 3LGIA 5JB8S 1TX7A 4AGKA 2FI5E 4WXIA 1NT1A 2WPKS 1TMBH 3SYJA 2JH6D 3M5LA 4YT7H 1SQRA 3LONA 1KY9A 2QXJA 2JKHA 3UWIA 2J98A 4OS1A 2ZNKH 1P0SH 1GBJA 1TNIA 3SNEA 5C0TA 1BJVA 1DUEA 2FDAA 3SUFA 4UFGH 2ZDNA 1BTUA 1C2IA 1ZMNA 1BTXA 1O2XA 1YLNA 2CXVA 1IQJA 4ABDA 2FTMA 4FVDA 3GYMA 4I86A 3ELAH 5DP8A 4BAOB 3F9EA 3FZZA 4B73A 2QXGA 1O2ZA 4LXBH 4GUXA 4ZKNU 3I29A 4NWKA 5HM9A 1GHYH 1V2LT 1M9UA 1GPZA 3BTHE 1QBNA 3BG8A 9ESTA 1ZZZA 4O03A 1C1PA 3LGTA 4BAMB 4K69A 4Z1MD 1EPTA 1PFXC 2LELA 1G30B 3C1KA 2ZQ2A 2PHBA 1YKTA 2A45B 2Z7FE 1GBIA 1O2KA 1TMUH 1GBHA 2BX3A 2J4IA 2OD3B 5EJZA 1HAPH 4X2YA 2ZDMA 3N7EA 1GVLA 1N8OB 4KELA 1SFIA 4RT1A 3T62A 4ZKSU 3KQDA 1LQEA 3QZRA 1QRXA 1ELFA 1UVSH 2FMJA 3K9XB 1ANEA 1TB6H 4I31A 2Z9GA 1CGHA 1O33A 1KLJH 1YPKH 1ZRKA 3ZZCA 1AU8A 4Q7ZA 4DY7B 2B8OH 4AG1A 8LPRA 1OPHB 2XOKD 1P2JA 2A31A 4BAKB 2AEIH 2TIOA 1QL9A 1TNHA 4B6FA 2FOGA 4IGDA 2OQ5A 3OEHD 3GCOA 2OBOA 2OQUA 4OM9A 1LPKB 3QX5H 3MU4A 1BRCE 2JDID 2V7QD 2PSXA 4WH6A 3SV6A 2ASUB 3EYDA 1QB9A 1GJ5H 1PQ7A 2HRVA 1TE0A 1AKSA 1YPLH 2LNCA 1ARBA 3KQBA 3H09A 2ZTYA 3SGQE 1P01A 1ABIH 4NIWA 4XRNA 3LT3A 1EAIA 1D6RA 2ODPA 1FN6A 1CSOE 1GG6B 1QURH 2GCTC 3S9BA 1TGSZ 2ZGXH 3LKWA 5C3NA 1QQUA 1K2I1 1RTFB 2CHAC 2SNVA 2WPHS 3GICB 1P2IA 1E38B 3BTEE 3HKJB 3PV5A 1F92A 4DW2U 1G36A 2Y5GA 1MQ5A 2QY0B 1OP0A 4I8LA 4RN6A 1KLIH 3FOAA 3RLWH 1RTKA 1E34B 1O3LA 3ZZBA 1TAWA 2P16A 3QTOH 1HAXB 1V2TT 3R3GB 1DITH 1UVPA 2F9VA 3F9HA 1TNJA 2CF9H 1TPAE 1V2KT 4TY7A 3BTGE 3GDSA 5HIZA 1T4VH 4XFQA 1LQDB 2G00A 2AHME 2ZU2A 2OC0A 4AFQA 1J14A 1YPMH 4ABBA 1AUJA 1P2MA 3A8DA 2LPRA 4Y6DA 2J95A 2W6JD 4UEHH 1QZ8A 2WV4A 2JH5D 1SMFE 2VGCC 3U1JB 5ABWA 3K65B 3A82A 4BTIB 1S6FA 1TBRH 1ZSJA 6CHAB 1AY6H 2AGEX 2D2DA 1F0RA 2ANKH 3QO6A 1UTKA 4UFEH 3URDA 3A7TA 3OFND 1D3PB 3O8BA 1FV9A 1WU1A 2FOHA 2ANMH 4JZFH 3LGUA 1NO9H 2G55A 2JIZD 4J2YB 4F49A 5FL7D 1O2GH 1GJDB 1C2FA 1QA7A 2ZCHP 3WW7A 2YMSC 2O8LA 2A4RA 4CBNA 2ZO3H 1TOCB 1D3TB 3RXIA 1O5GH 2UUJB 3F6UH 4FETA 1L4DA 3D62A 1GBEA 2J34A 2ZI2H 1TGTA 1GJAB 1TX6A 3PV4A 1BRAA 3WWBA 1ZHPA 5C5OA 2FPZA 2Z94A 5EODA 2HNTE 5DG6A 1C2JA 3I77A 3LGYA 4X8SH 5LPEA 3V3MA 1ZRBA 3TJUA 1PPBH 1MTVA 3F0OA 1KMHB 3NK8A 4X6MA 4BOHA 2ZGBH 1LHCH 4THNH 2ESTE 4O97A 1YPHC 3LGWA 1C1OA 2QAAA 2GZ9A 2XYAA 3P8NA 1C2HA 2FOMB 1A1RA 2PGBB 5EOKA 2CF8H 2XBYA 1MD7A 1E0FD 1UW7A 2VVVA 4AYVB 2VBCA 3EQ0H 3W1EA 1SGDE 3M3SA 3VGCB 3GY2A 3ATWA 3HGPA 4SGAE 2Q6DA 3JZ2B 2F9BH 2FWWA 4X1QU 5E2PA 4CRBA 4I33A 4SGBE 4FUFA 3ZIAD 1Q31A 1UTPA 2W5EA 5J4SA 2M5TA 3P92A 1IQKA 1FIWA 4TPYA 4ZHLU 1B0FA 2VJ1A 2BMGB 5CHAC 1H8IH 1ZYOA 3ZVAA 4CRDA 2PKAA 4AN7A 1FPHH 4D8NA 2KR7A 2Z9IA 2ZDVH 4OS7A 4AZ2B 1EATA 4BNRA 2WYJA 3E3TA 1SGRE 2KCYA 1QB1A 3SV2H 2A7CA 2P8OC 2PUQH 5C20A 1XMNB 1BTHH 4NA9H 2CJIA 2QC2A 1HAOH 1UK2A 3QTVH 3Q3XA 4DG4A 3E0PB 2TPIZ 3W95A 3UNQA 2JETC 3SHCH 3NCLA 1HIAA 4BAQB 2XCNA 3CS0A 4AORA 4MPXA 5IYTA 2TGDA 1O3FA 5A0AE 1KXBA 2XW9A 5FXLA 2XC5A 4NIYA 2DE8A 3UFAA 1SGYE 1KLTA 1O2OA 3Q00A 1UCYE 4FUIA 1GJ8B 1LPGB 1O3EA 1MKXH 1PPFE 1GHZA 1QTFA 3P95A 2VVUA 3FP7E 5EG4A 1E35B 1V6DA 5A8ZA 3D49H 4ACBA 5T1VA 3BF6H 1K1LA 2J98B 5JPMH 2L74A 2JJ2D 3RXPA 4Y0ZE 2UWOA 1TLDA 2RDLA 3DCLA 1F5LA 1P2OA 1UVUH 1V2JT 2XBWA 1C5YB 1ANBA 1JOUB 4ZAEA 1WDIA 4CH8B 1WSSH 2A5AA 4KKDA 2ZECA 2A4OA 1GDUA 1BMMH 3BTME 3KNXA 3SBKA 4Y11E 4X8UH 2AMPA 1S82A 1LKBA 1DUAA 1V2WT 1BQYA 5F8ZA 3MU5A 5EIYA 2BDIA 2AFQB 2HWLB 2EY4C 1A4WH 1CO7E 1EAUA 2UUFB 3VG8A 1AB9B 1HAYB 2WPMS 3OU0A 2STAE 1QBOA 5T6GA 1GHXH 1ZGIA 2M2AA 1CBWB 4X1RU 4UFFH 5EXMA 1EPTB 4FU7A 1NFYA 1ETRH 1MKXK 2Z9KA 1FDPA 1W14U 1GBMA 3UOUA 4XOJA 1AGJA 4INHA 3AW0A 1BTPA 2YNBA 1BMAA 1AI8H 1NPMA 5DP5A 8KME2 1F0UA 3ZZ6A 1TRYA 5EGMA 4GAWA 5C17A 2IOTA 1SGEE 3F1SB 5JBCS 3DHKH 1QBVH 3SJOA 4Q4LA 1C9PA 3A7XA 1LVYA 3M37A 3OAAD 4ZHMU 1HJ8A 1GI9B 1Y5BT 1A3BH 2J97A 2W3IA 4YOIA 2RDEA 4DT7B 1IQFA
chains in the Genus database with same CATH topology
1ELAA 4YZUA 1OX1A 1QL8A 2P59A 3DT0H 1EOLA 4NSYA 4ZROA 2PKSC 4K8BA 2GTBA 1SQTA 2C8YB 1ETTH 5K7RA 3GCHC 1BCUH 1WQSA 3N7OA 4JZDH 4B74A 4OS4A 1GBCA 3L3TA 1ZJDA 1WAYB 2FYRA 4ZUHA 1MTNB 3RM0H 4GLYA 2BQ7B 3GY4A 4GHQA 2QXHA 1C1TA 1O2WA 3UY9A 1C5QA 2ZDLA 2ZG0H 4AX9H 1JIRA 4ESTE 1NTPA 1AFQB 1C2MA 1CT2E 1RJXB 3RU4E 2BQWB 2ZHQH 3BTQE 1O0DH 2XWBI 4FUDA 3T2NA 1GDNA 1BDAA 2FOAA 1IQEA 2FLBH 2ZDAH 3M36A 1H8DH 1CHOG 1THPB 1AN1E 5G4BA 1SBWA 1Y3VA 1G3EA 3ZVDA 4OGYA 3PWCA 1MUEB 3UPEA 2FYQA 1L1NA 1VCPA 2OC8A 1RD3B 1O3MA 2QCYA 4MNXA 2BZ6H 1J16A 3MYWA 1D3QB 1GDQA 1RIWC 2G5VA 1RRKA 3TIUA 4Y7BA 3KF2A 5JBAS 1MAYA 5E2OA 3KIDU 1KDQA 1GG6C 4AFUA 1A46H 3BTKE 3GCTG 1HLTH 1ZHRA 2BY6X 4VGCC 2BHGA 4ZKOU 4B2CA 2G51A 2OC7A 2ZHFH 2BVXH 1AO5A 1PYTC 2V3HH 1OS8A 2HVXA 1GI7B 1O3KA 3L33A 3ZVCA 5EW2H 2B9LA 3WY8A 2GZ7A 5T6FA 2DUCA 2A4GA 1BB0B 3T27A 4CHAB 1V2OT 1S5SA 1TGNA 3P70B 3SI3H 1ZR0A 1A0HB 1ELBA 1TALA 3PO1B 2BDBA 2PW8H 3ODDA 5EW1H 1XVMA 2BVSH 3ZYEA 1WV7H 1QCPA 1HUTH 2Y81A 4GPGA 4I32A 2ZGHA 1GWAA 1LHEH 2H9TH 3MFJA 2Q6FA 4BTTB 2ZPQA 3QLPH 1MTSA 2HGTH 1K28D 3A85A 1C2EA 2BLOA 6CHAC 4NZQA 3SJ8A 1RS0A 1J15A 1GHVH 1G32B 3MMGA 4X6NA 1TQ0B 3QGNB 4JZIA 2CV3A 3RXDA 4WH8A 2GT8A 2XWAA 2ZTXA 1O2TA 3SW2B 1V2ST 3HKIB 5JYIA 4BAHB 2BY5X 4YO9A 1CE5A 1AZZA 1DY8A 2BD5A 3PMAB 1FLEE 1SSXA 4CRAA 1FNIA 1F0TA 2Q6GA 2ZC9H 2UUYA 4CRFA 3OTJE 1IQHA 1MAXA 1O3OA 2NU3E 1BTYA 3VB3A 1XUJA 2QF0A 3E91A 4GHTA 1KYNA 1PJPA 2F91A 4E7RG 1O5FH 2Y6TA 1DSTA 1GI0A 1FXYA 1TABE 1W12U 1UTQA 3OYPA 3VXEH 1HJ9A 1SOTA 1BTZA 3HK6B 1V2RT 1IQIA 3RMMH 3U98H 1UK3A 5L30H 3K6YA 3SOSA 1C5MD 1CHOF 1IQLA 2H2ZA 4O3UA 4D9RA 4B75A 1SR5C 1T32A 3KEEA 1ACBE 4TYDA 3TJOA 1NU7B 4MLFB 3RXHA 3AVZA 3BTTE 1HAIH 3B23B 1O2QA 5LH8A 1W8BH 2PKAB 1SQAA 4CRGA 5BRRE 1HFDA 4LZ1H 1NRPH 1K9OE 3RXKA 5A09A 3TNSA 1H9LB 3A89A 3VGCC 3GCTF 3M7QA 1G2MA 1ZLRA 1ELDE 2VIDA 1OYTH 2H5DA 1C9TA 2H6MA 2Z3DA 2W26A 1GI8B 2J38A 3O8DA 5JDUB 4AB8A 1LHFH 2R2WU 3PROA 3MHWU 4X0WU 5A8XA 2VNTA 3BN9A 3UREA 1HIAB 1KTSB 1HXEH 4JMYA 1OSSA 2B7DH 3AAUA 1Y3UA 1S0QA 2O8TA 2DE9A 2VIVA 2BD4A 3VPKA 5FPSA 4MNYA 1TPPA 4HFPB 4UDWH 2BDGA 3STJA 1CA0B 1C1WH 3U9AH 3TJNA 1LVMA 5FPTA 2VWLA 3MI4A 3T28A 5LGOA 4OS2A 1FY8E 3ZZ4A 1ZPZA 3EAJA 4E05H 1MKWH 1TX8A 1HB0B 5E0GA 2PSYA 1TWXB 3A87A 1ANDA 1BITA 2D1JA 4B2BA 1AVGH 4K2YA 1G37A 4YOGA 3M7TA 3TK9A 2WPLS 3QK1A 4Z0KA 3ZVBA 1QRWA 5DKMA 3A83A 6ESTA 2AS9A 1JRTA 2GDDA 3U1IB 1O32A 1NFXA 1OKXA 4Y0YE 3SUEA 1O3NA 3TH2H 1P9UA 3OX7U 4CH2B 3MNCA 5DJ7A 4X1SU 3RU4T 3LGVA 3MU8A 2G4TA 2O8WA 1O3CA 5L2ZH 5JBBS 3A84A 2ZFFH 1MKWK 2BXTH 4TWWA 1C5ZB 1GBFA 8ESTE 2AIQA 1BMLA 3MH6A 2GKVE 2GMTB 3E90B 1O3JA 1A7SA 3QDZB 2ZHDA 5C1UA 1GGDB 1SVPA 3TH4H 1K1PA 2R0LA 4OGXA 1CBWC 2NWNA 2ZHWH 1EPTC 1CT4E 2QIQA 4H6TA 4J1YA 1TNLA 1VCQA 5E0HA 1C5SA 3RXAA 1Z71A 7GCHG 1H9HE 4IMQA 2Y7ZA 4XBCA 5DO4H 2NU0E 1AE5A 2SGQE 1ABJH 1HAHH 4FXGH 1HGTH 2BY9X 3M5OA 4BANB 3SU4A 5IDKA 4U30A 2KAIB 3PMHB 1DSUA 1C1RA 3UQOA 3LH1A 1Z6EA 1NESE 1OWDA 1C4Y2 1O5DH 2TBSA 4JYUH 3GY3A 4CR9A 5GXPA 5F8TA 7ESTE 5PTPA 1UTOA 1UVTH 1O5CB 2BD9A 3ENSB 3VXFH 4X2VA 3GY6A 3SU1A 3Q3KA 1X7AC 4X2XA 1SGNE 1EJNA 1DLKB 4NIVA 1FONA 3UNSA 3RMOH 1MTNC 1QA0A 1GI2A 4I8KA 5J4QA 1C5RA 1DXPA 3BIVH 1PQAA 1QJ7B 1KDQB 1O36A 4WWYA 3RXVA 1YYY1 3MU0A 1DT2A 3ZZ5A 2ANYA 2FEQH 3BTDE 1P11E 4YOJA 5C2ZA 1K22H 1NRQH 3MOCA 4ZHAA 3GOVB 3LJJA 1GCDA 4D76A 3H5CB 3P8FA 1FZZA 1O3AA 2IPHA 2IJOB 1K1MA 2RG3A 1CA8B 4M7GA 3M61U 1C1UH 3QZQA 3NXPA 1LVOA 1MD8A 3A7ZA 1ZPCA 1HAGE 1FIZA 1GBKA 3NKKA 3O8RA 2P3FH 4Y8XA 1GJBB 3MNBA 1ZTJA 2ZP0H 3IWMA 2VWNA 2A7HA 3GY8A 1GBLA 3QGJA 1TOMH 2QF3A 2F9UA 2HPQH 4D9QA 2P94A 1Z1JA 3DFLA 1EZSC 1QY6A 3BTWE 2PGQB 3A7YA 1PPGE 5K0HA 2ZZUH 3PTNA 1LKAA 4JZ1A 5LPFA 1W2KH 2FX4A 1LHGH 1V2UT 2AYWA 3C27B 2H9EH 1C5WB 3F68H 5GWZA 2UUKB 3PO1C 1O2UA 1F5RA 4DIHH 2OUAA 3PLKA 4JYVH 2PWXA 7GCHF 1KXFA 2C93B 1BRUP 1V2VT 1F5KU 3AW1A 3PTBA 1ZTKA 3OSYA 2GV6A 1Q3XA 1WCZA 3FFGA 1GHBG 1MMJN 1O2HA 2PUXB 5GDSH 4AYYB 4NFEA 1XUKA 3E0NB 4MVNA 4ZXYH 1P12E 1OP8A 1XVOA 2HNTF 1ARCA 3BSQA 1SOZA 1UJ1A 3TK5A 4UONA 2HPPH 1P04A 1MBQA 3E6PH 1T7CA 1NROH 2ZFPH 2SFAA 1NM6A 1ZSKA 1ELCA 2ZFSA 1GVKB 1DFPA 1Y3YA 1DWBH 5DGJA 1C2KA 1TFXA 2BQ6B 3TGIE 1OYQA 5T6DA 1GI6A 2I6SA 4NA8A 1P03A 1U6QA 1XKBC 3F9GA 2PTNA 4Y76A 2C8ZB 1SLVB 2PV9B 1WUNH 4WJG2 1V2QT 3MNXA 2G5NA 2ZU1A 3A86A 4IW4E 1C1MA 1IAUA 1GJCB 3RXTA 3VB4A 1QL7A 2FO9A 1AFEH 2D26C 3A88A 1MTWA 5C1YA 3SUDA 3ZYDA 2TGTA 4RSPA 4HGCA 3U8OH 1GVZA 1ZOMA 3SU0A 3GY5A 2P93A 3CENA 1P2NA 1MTUA 4A7IB 5ESBA 4Y10E 1DXWA 5GPIB 1PPEE 4A5TS 4BTUB 3AAVA 2FLRH 1O35A 2F83A 2GT7A 5BPEA 2F9OA 3UOPA 1ORFA 3HK3B 2NU4E 2G4UA 3BG4B 5FBEA 1ZSLA 2FOFA 1O37A 1P02A 1C5TA 2RA0A 3STIA 3A80A 1P9SA 1UMAH 3M5MA 2VIWA 3SQEE 2ZU4A 3IITA 1W11U 1O3BA 2FZZA 1LMWB 1QJ1B 3E8LA 2O8UA 3A8AA 4QT8C 1UCYH 1DICA 5EU8A 3KL6A 4KP0A 1DWEH 4CR5A 2BD7A 4ISOA 4U32A 1CGIE 1GHAG 1HJAB 1C5VA 2ZA5A 2F9NA 1A0LA 4FVBA 4BXSA 1KXEA 1HRTH 3TGKE 4IN2A 4D7FA 4GCHG 3VFEA 1SB1H 1FY5A 1PPZA 1HBTH 2TRMA 1O2YA 1SLUB 3SGBE 1N6XA 1BIOA 1IQNA 4DGJA 2CN0H 4ABEA 3NUMA 1GJ4H 1RFNA 4K60A 3URCA 4AFSA 2EC9H 1GHBF 2XXLA 4DVAU 2A1DB 1IQGA 1EUFA 2WPJS 1TMTH 1OWJA 1V2PT 4LK4A 1O2VA 2IN2A 1N6YA 2GCTB 3CP7A 5F6MA 1UCYK 1Y59T 1DPOA 1N8OC 4GVUA 4ZH8A 5AF9H 2CHAB 1Y5AT 1Z7KA 4E06H 9LPRA 1QHRB 3SNDA 4K5ZA 1AZ8A 4MTBA 1RGQA 1ZPBA 3VB5A 5DP4A 1CQQA 2KAIA 3ZVEA 2VB0A 2NU1E 1GL1A 1EJAA 1SHYA 1TPOA 2W3KA 1ANCA 2QN5T 2ODQA 2ILNA 1L0ZA 1HAZB 4MPVA 1GBAA 1A2CH 2HLCA 2AMQA 1ELGA 3SZNA 2GMTC 2Y82A 1C2GA 3RXRA 3RLYH 5EPNA 1EASA 3A8BA 3M5NA 4IMZA 3UTUH 3FP6E 1NN6A 2J2UA 3RM2H 1XXDA 1GI5A 1BTWA 1DY9A 1ZHMA 1YLDA 2NU2E 3T5FH 2R2MB 2VGCB 1Z8JB 3P17H 5F8XA 5SGAE 2R3YA 1ELEE 2BDAA 3RXMA 4OS5A 5AVDA 4WMFA 2A5KA 1T8LA 1TONA 4MG3A 4MDSA 1S84A 1BHXF 2WUBA 1EOJA 1K21H 1MU8B 2SGPE 4NA7A 1OXGA 2ZTZA 4Y71A 4ISLA 1HYLA 5DPAA 3RXSA 5FCKA 1XUHA 1O2LA 7LPRA 3G01A 1BMNH 1G3CA 1GHAF 3KQCA 1PQ8A 3GCNA 3P8OA 1IOEA 1LCYA 4JCNA 3ESTA 4IS5A 3FZDA 1GBDA 1PQ5A 2OXSA 2ANWA 5H4IB 5A8YA 1NFWA 2BOHB 1EQ9A 3MO6A 1P2KA 2ZGCA 5GCHG 4GCHF 1MCTA 1P10A 3BEIB 3T29A 1CU1A 1W7GH 1WQVH 2FIRH 1TA2A 3EA7A 4E7NA 3NWUA 1BHXB 5FPYA 4YTAA 4HI3A 5B6OA 1MQ6A 1EXFA 3D23A 1NU9A 3KGPA 2FX6A 4FUJA 5T3HA 3RXOA 5EQRA 4ZMAH 2AIPA 1XX9A 1O39A 3EA9A 1UHBA 4Z6AH 3EGKH 4CRCA 1AMHA 1K1NA 4H6SB 2AGGX 4X6PA 1GMHF 1H9IE 1TBQH 1Z8IB 2EI8A 1LPZB 1A3EH 1BT7A 1GMCG 1O2NA 1QJ6B 4TWYA 3S69A 1FMGA 1TRNA 1ZGVA 1ELVA 5CMXH 3T25A 1MZAA 2FP7B 2AH4X 2FXRA 5CHAB 1LO6A 3LPRA 4YESB 1D6WA 5I46H 2THFB 2A2QH 2ZDKA 3O8CA 4I8JA 2XC4A 1P06A 1C2LA 1BJUA 1C1VH 4Q7XA 2GV7A 3SJKA 2GP9B 3SI4H 2VIQA 2P8OB 3DA9B 5L6NH 3PB1E 2PTCE 1UTLM 2Y80A 3V13A 2BDHA 3TLOA 1VJ9U 1FY1A 1MU6B 1O2JA 4WY3A 1TNKA 1MBMA 3PMJA 2BLWA 2SGEE 1SLWB 1ZMJA 4NZLA 1PPHE 2PFEA 2A0QB 3TH3H 1V3XA 4I8GA 1S0RA 1DANH 3ATIA 3LC5A 5HMAA 1O2SA 5EQSA 1IQMA 1YCPM 1AHTH 4XBDA 3ZZ8A 1QRZA 2BB4A 3RXFA 2BDCA 1FY3A 2BXUH 1AVWA 2FOEA 5DP7A 3SU2A 1NC6A 1SGQE 3QUMP 1DOJA 2D8WA 4U01A 1GCTB 1YF4A 3RP2A 1DWCH 4X2WA 1LHDH 1WOFA 3HPTB 6LPRA 3EA8A 2GDEH 3T26A 2B5TB 1NFUA 1YCPH 1TGCA 1SPJA 2ZU5A 1EZXC 1HXFH 1P09A 1O31A 1EP5A 4JK5A 1EAXA 1J9CH 5E0JA 1C1NA 2GZ8A 1GJ7B 3RMLH 5GCHF 4X1PU 5A0CA 1KXCA 1ELTA 3UUZA 1ZMLA 3MH7A 1ID5H 3IG6B 1O5EH 4DIIH 4DCDA 3SV9A 3RXUA 2ZGJA 1AVXA 1C5LH 1SC8U 3L6PA 2HNTC 2AERH 4WMDA 2FM2A 1J17T 3KCGH 4JZEH 3RC4A 1XUGA 2G8TA 2A7JA 3PLPA 4LOYH 1D4PB 1Y8TA 3RXGA 3MH4A 2QA9E 4A1TA 1NRNH 1YCPK 4NSVA 1FAKH 2VVCA 2BM2A 2XC0A 3SU6A 4OS6A 1GMCF 3BG4C 1XM1A 1VR1H 4ISIH 5HXFA 6GCHG 1SGIB 1GBBA 2PKSB 2SGFE 2V3OH 1RTLA 2WUCA 1UK4A 1FUJA 4I7YH 2ZFRH 3GISB 3K2UA 4YLUA 4UE7H 5F03A 2K1QA 3EDXB 3GCHB 2G81E 1UO6A 2FS9A 3SJIA 4DURA 4IC5A 5EXNA 3U8TH 2ALPA 1OOKB 3V0XA 1AB9C 3LOXA 4MQAA 2WINI 4FUBA 2EI7A 1P3EA 2OTVA 2ZCKP 1B0EA 1IHSH 2ZWLH 2BYAX 1HJAC 3A7WA 1ZTLA 1GJ6A 1RXPA 3PMBB 1FPCH 3TPIZ 2O8MA 1KXDA 2VWMA 4FUCA 3SNBA 3TNTA 3RC6A 1C5XB 3PYHA 3S7KB 2G52A 2C3SA 3UWJH 1C2DA 2Q1JA 1O2PA 3LJOA 2AGIX