4MO3M

Crystal structure of porcine c2 domain of blood coagulation factor viii
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
156
structure length
156
Chain Sequence
SCSMPLGMQNKAISDSQITASSHLSNIFATWSPSQARLHLQGRTNAWRPRVSSAEEWLQVDLQKTVKVTGITTQGVKSLLSSMYVKEFLVSSSQDGRRWTLFLQDGHTKVFQGNQDSSTPVVNALDPPLFTRYLRIHPTSWAQHIALRLEVLGCEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Coagulation factor VIII
publication title Crystal Structure of Porcine C2 Domain of Blood Coagulation Factor VIII (FoldIt Target)
rcsb
source organism Sus scrofa
molecule tags Blood clotting
total genus 35
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4mo3M00
4A42A 2V4VA 2WO1A 2QQNA 3D3AA 3LEIA 5JUVA 3ETPA 3CDZB 3IDAA 4DEQA 4XVHA 2OKXA 4QB6A 3I3DA 4CU6A 4QX2A 1UYZA 2E33A 2Y64A 2YFUA 4P02B 2QQLA 3E1F1 2WZ8A 1UXXX 1JZ7A 4DUVA 2ZEWA 4ET7A 3PUHA 3HOBA 3VD5A 3OGVA 3T09A 3UNPA 3OGSA 3ABZA 3ZM8A 3AC0A 3I2JA 2W47A 3OEAA 2VMDA 4OUEA 3C7HA 2VTFA 4A45A 1ULOA 3MV01 3P6BA 3OB8A 2YC2A 2X10A 4D8MA 3I2IA 4KI5M 5F7UA 3DYOA 1W9TA 4XUPA 2HLEA 2QQJA 4D0QA 1SHWB 3SKVA 4ARXA 1F4HA 4PT6A 2WO3A 4XURA 2VZSA 4DUXA 2X09A 1W99A 4CUBA 1OD3A 2ORZA 1T2XA 2J1EA 2VZ3A 3K75B 1UY3A 4GZ9A 1J83A 4OMCA 1J84A 4CU8A 1NAEA 2WZEA 3OBAA 2W46A 1F4AA 4LHSA 1JU3A 4QPWA 3EYPA 1JHJA 1OT5A 1SG3A 1GU3A 1GUIA 3W5MA 3F2ZA 4W50A 5EIYB 1UX7A 2W1SA 2HYXA 1L7RA 4MO3M 1H6XA 1BHGA 1O8PA 2VQTA 4UAPA 4E8CA 4ZXEA 5LA0A 3T2PA 5JXHA 5CZKA 2E26A 1NKGA 2VMEA 1LNSA 3K4ZA 4LKSA 5JXIA 4QB2A 2BGPA 1UY2A 4PQQA 1XNAA 4HG6B 5IFPA 2YB7A 1GNYA 3HNMA 2VZ1A 1UY4A 4RN5A 5FUIA 4CUAA 3GXUA 1EUTA 2QQMA 1CZTA 4QDRA 5IYYA 2WUHA 4JHZA 3THDA 3ACFA 3LPFA 2W1WA 3UESA 1PMJX 4M4RA 3DYMA 3BGAA 2VZPA 1W8OA 5C70A 2CDOA 3A23A 3VD4A 3C7FA 4A4AA 4LPLA 1O8SA 2VCBA 3C7GA 1HN1A 2Y6LA 2J1TA 2B9VA 4XZUG 3WNOA 4BK4A 1GOHA 1JYXA 3OGRA 2WN2A 4UOJA 3T0AA 4QX0A 3VD3A 2VM9A 4QX1A 3HPNA 2XONA 1JYNA 4M4PA 1DP0A 3WNLA 2J1UA 1DLCA 3WNNA 3WSOA 3HN3A 1WKYA 3VDCA 2ID4A 2WO2A 3BN6A 1K3IA 4QX3A 1JZ4A 1PMHX 5LCWL 5HPOA 3IAPA 2J1RA 4A6OA 3K4AA 5DMYA 2WABA 3CIHA 5DPNA 2W5FA 3MV11 4JX0A 5CYYA 2VC9A 1K12A 4E8DA 1JZ5A 3MBWA 1JU4A 3WNKA 5I0DA 1XNTA 3A22A 1KGYA 4ARYA 1EUUA 2E32A 1XC6A 2V72A 3J7HA 2JKXA 2B4KA 2EIEA 4TTGA 2WN3A 2VZUA 1JYWA 4XUOA 2VZQA 3MUZ1 4QAWA 1JZ3A 2J22A 4OYUA 4AAXA 4DXSA 4DXRA 5HXMA 2Y6HA 2KD7A 2XHNA 3FL7A 4BJ0A 3ACHA 3A21A 2ZEYA 3DYPA 5J1XA 2Y6KA 2WBKA 4Z2AA 4OZOA 3IIIA 1NX9A 5JXGA 4ZZ8A 2VR4A 1OF3A 5DN2A 3VDAA 4A44A 5LA1A 3I97A 3WF0A 2VMCA 3FN9A 3W5NA 3GDBA 2W95A 2V5DA 2W3JA 5A1AA 2EIDA 2C4XA 5LA2A 2CDPA 3T0BA 2BBAA 2QQIA 2J1AA 4W8JA 4MADA 1XPWA 1PX3A 2Z4FA 5JXJA 3C8XA 5B4NA 3T2OA 1CIYA 2JDAA 3K77A 3WF1A 3GGLA 2L9LA 3LEKA 3A7QA 1H6YA 3PUIA 3IB3A 4UI9L 3WF2A 1ULPA 2LS6A 2RJ2A 2LW8A 1O59A 1K45A 1GQPA 2VZTA 3WF3A 3ECQA 4KWUA 2WDBA 3CMGA 2W1UA 3CQOA 1W8NA 4KMQA 2VQUA 4XUTA 1PX4A 2WQ8A 1KEXA 1DYOA 2ZEXA 5EJ1B 3UETA 4A3ZA 3FHQA 2DCJA 1JZ8A 2YC4A 1TVGA 2VCAA 2DCKA 4QDSA 5JMOA 1MPXA 2VOTA 5G04L 2VL4A 3MO4A 1RYYA 3MUY1 2VZRA 5IFTA 2DDUA 4JKMA 4P00B 2YG0A 3NJXA 1JI6A 4YPJA 4ZZ5A 4AG4A 1WCQA 2W91A 2Y6JA 3I3EA 2R7EB 1NUKA 3P1IA 3HJRA 3K4DA 2JD9A 2W9XA 1I5PA 1R64A 3SEPA 1GOGA 1UWWA 1UY0A 2VJXA 1UY1A 1CZSA 4IUGA 1IQDC 4DUWA 1W9SA 3VD9A 1CZVA 1OF4A 1P8JA 2EICA 1JZ6A 3C7OA 5IJRA 4JKLA 3EB7A 4BXSV 5C71A 3VDBA 1W0NA 2J7MA 4CUCA 3WNPA 2W92A 2Y6GA 3I2GA 2XQXA 5C7GA 4MGSA 2C9KA 3ACGA 1US2A 2X05A 3HNYM 1L7QA 4JKKA 3SEEA 3LEGA 3NQHA 1UMHA 1JYVA 1D7PM 3NJVA 1UYXA 2VMFA 2PQSA 4MOAA 4W4ZA 5B4XA 4QDQA 1UYYA 2VZVA 1GOFA 3HEIA 4GWJA 4FI9A 1TG7A 3NRUA 3DECA 4A41A 2EIBA 4BK5A 3I2KA 3THCA 4XUQA 2VCCA 4GWIA 2XOMA 3JXSA 2J1VA 3I3BA 3OG2A 3VD7A 3I2HA 3I2FA 4LQRA 3FHAA 1JZ2A 1UZ0A 2W87A 2E31A 2W1QA 2RV9A 3SKJE 4PF1A 4CVUA 3LE0A 2Y8KA 4P5YA 4P08A 5DQ0A 3T2QA 4BDVB 2BZDA 4DEVA 2BERA 3WNMA 2WYSA 2ZEZA 3CZUA 4QB1A 4ZY9A 5EJZB 5IHRA 3HNBM 3T0DA 4TXWA 2BGOA 1US3A 2WAAA 4CU9A 2J1SA 3LPGA 2QQOA 2QBXA 1K42A 3CKHA 3LQCA 2QQKA 3WQBA 2RVAA 2W94A 2C26A 2YFZA 4CU7A 5G05L 3WEZA 1CX1A 3WF4A 4MGQA 2ORXA 3C7EA 4OMDA 2ZXQA 2VO5A 3IAQA 3T08A 2JE8A 3NNGA 3OEBA 4RYDA 1OH4A 1SDDB 2WAOA 3GM8A 5JR2A 4DXTA 3U37A 1W9WA 1YQ2A 1UMIA 1GMMA 2VZOA 3ACIA 3K46A 4L0PA 3CZJA 1UXZA 4XUNA
chains in the Genus database with same CATH superfamily
5F5CA 3SMHA 2V4VA 2HEWF 2WO1A 4PI2A 5FTTC 3D3AA 4HZFA 1VIWB 3LEIA 3ETPA 1OUSA 4CP9B 2JECA 2RS13 2XKPA 5FPVA 2WL1A 3KGLA 1HIXA 5EFUA 5DXDA 2X5IB 3AP7A 3WP5A 3POBA 1V6LA 2E33A 4M01A 1QJEA 1EPWA 3S57A 2XJPA 2UURA 4AFCA 3H3ZA 3CJIC 5C4WB 2RDQA 2VH9A 4BISA 4MGTA 1AR83 2P6HA 2WZ8A 4DY5A 1UXXX 1MS9A 3HD8B 5L7OB 1JZ7A 4EV0A 4DUVA 5L36A 4D94A 4ET7A 4M3CA 4AFBA 3K3OA 1FAYA 4FO9A 4JRAA 2GP5A 1PM7A 4FCAA 4EN6B 3T09A 1AL23 3UNPA 1LEMA 1S55A 3P5BA 1NCQA 1YFYA 1LHVA 3KGZA 2ZCWA 3N7MA 2XGXA 3URFA 1PIV3 3C7HA 2D6PA 3H1MA 4OUEA 5FK7A 3LA3A 2A3WA 4XETA 2WIIB 1FNYA 2I07B 2ZGUA 2ZHKA 3X29B 1YWKA 3KD4A 2FZ1A 2GNMA 4XF3A 4FPCA 2RMU2 2DUPA 2RHPA 1X9TA 2QNKA 2X10A 2ZMLA 3VBSB 4KI5M 4XJ8A 2GC0A 3S5QA 3VBOA 4MH0E 5DZEA 2XWBB 2WS93 2Q4SA 4MZUA 1A8MA 4XUPA 2YBKA 5FP4A 5HV0A 2UWAA 5KXCA 3LIHA 2QQJA 2A6WA 5FPBA 3KSCA 1BK1A 1LHUA 1SHWB 4XTPA 1K5MC 4NIHA 4NHMA 3WDXA 2R0HA 2QCSB 2BQPA 4OULA 4X6RB 3UJQA 4QXKA 1W90A 2WO3A 4QD2A 2W08A 4JGYB 4K8RB 1W99A 2YU1A 2CGOA 2OT7A 2C9AA 1T2XA 4GZ9A 4HBNA 1NCRB 4MGYE 5JLVA 5KC6A 1SQ4A 3PURA 1MVEA 5FZ9A 4OMCA 5FOJB 1F35A 1BMV1 3LSEA 2R063 2CHHA 3IIAA 4PDWA 4L9BA 2XR4A 2W46A 1QJY3 4HLTA 2PHFA 4JDNA 1JU3A 1RUI3 4BQ5A 3EYPA 1YIFA 2KXLA 4ES8A 2VW1A 3U10A 3HT1A 5E6HA 2XUMA 2JIGA 1Z78A 3BOPA 3JD71 4LOSA 5IVCA 3WG3A 1O3QA 1GU3A 4EZHA 4K6BA 2W52A 3NSTA 1H8TA 1FXZA 3FMGA 1VBE1 3WT3A 5FDBA 3J7MA 1L7RA 3RSJA 4LBNA 4JQTA 1O8PA 1SLCA 3NWKA 4E8CA 1PM4A 2Y33A 3LWCA 1UU5A 2WT0A 3WX5A 3WG2A 4BXFA 4B4QA 5CZKA 2E26A 4KU7A 5A3WA 3M7AA 3D4KA 3B7MA 1LNSA 2K9ZA 3VLBB 1AR72 4N53B 2ZACA 2UYBA 2GU9A 4HPKB 5IUQA 3IMNA 3JCIA 4CDQA 4HMZA 5FMBA 1DZRA 2YPJA 5C8CB 1G6NA 1LOEA 3VDDA 4XW3A 2XWJB 4YZ4A 1UY4A 2VBPA 2IC1A 1A6CA 3I3QA 5IAVA 5A3PA 4CUAA 3GXUA 4CEYA 2QQMA 1GQGA 1JOBA 4JHZA 3THDA 2YHJA 4D69A 1GZTA 4XBQA 4MXWB 1F2NA 4QHZA 5T3NA 4CXYA 3GBWA 3UESA 3PVEA 3MIBA 3OY8B 4OHXA 1W39A 4M4RA 1BMV2 1W9FA 4EJRA 1S1AA 4DXZA 4OUMA 1F5FA 3H1WA 2ZJCA 3JB8A 4LR4A 1C8M3 2LUWA 5FZEA 2AACA 2CDOA 2FCTA 4LPLA 4AQ6A 5H9PA 3KB5A 4IETA 4Q8KA 1OOPA 1HN1A 2ETEA 4C90A 2WINB 4XZUG 5F6LB 4C8DA 1VBE2 4UOJA 2WN2A 3OPZA 4YGDA 1POV3 3LKJA 3T0AA 1YCIA 1A34A 5JPMB 3VD3A 1AR63 4C0BA 4WZCA 1H9PA 2AENA 4Y22B 4EWAA 1LHNA 3MF9A 3AFGA 2EA7A 3N9OA 1OFSA 3AYDA 2ZPXA 4TLGA 1AR93 2XONA 4GJZA 1W3XA 2P6CA 1XJAA 1CAVA 2RDSA 4LJHA 2PTMA 4BMBA 3DKQA 4Y20A 1VJ2A 3VBUC 3MW3A 3WSOA 4CEWA 1R083 3RWNA 4PBPA 2YC0A 3SXWA 5K0UB 5FZKA 2QFEA 4HETA 5LRSA 4OUSA 3USSA 2XQRA 1PMHX 4LIVA 4YVWA 2VNVA 3M3CA 3VGIA 1YC61 4NWWA 1NG0A 1WUVA 1T6GC 1XYOA 1W6QB 5IK4A 4FFFA 1ND2C 4RQPC 3IN9A 4XF1A 5DPNA 2W5FA 3I2OA 5L9VA 1ONAA 1RINA 2A6ZA 2E53A 1LODA 1MACA 1N1TA 1S0CA 2DVAA 3Q8BA 4A3XA 5CAZA 5JOYA 1HB1A 4QPIB 5A3TA 2RS51 3WDTA 4F8AA 4QPGA 1HKDA 5F3GA 2RR11 3WNKA 3ZYGA 5FPAA 2V4AA 2WQZC 4MVTA 1EUUA 2E32A 2IVIB 3M70A 2V72A 5I8TA 4IL7A 1OVSA 1YO8A 3RI8A 2EIEA 3KF5A 5BNOB 5GZGA 3WDWA 2WNVB 1JYWA 4RHV2 1B35B 1YJKA 4OI4A 2VQ0A 3U1XA 1VALA 3OTFA 4YWAA 2EVXA 3MUZ1 3FLTA 4UFMA 4YW3A 3TN93 5ABJC 1VAKA 3OSDA 1KS4A 4PLNA 4XHXA 3UGGA 3WDVA 1H2NA 3ZO0B 2IXLA 2NYYA 3M2MA 2JG8B 1OSGA 2RM21 4YVSC 3AVRA 5L9RA 1UZWA 1POV0 3ZXAC 2WLQA 4N7IA 3RS6A 1JOPA 1YFWA 4Y1ZA 1AXKA 1E5SA 2VULA 3FBMA 2ZMKA 4C1WA 2WBKA 1VRH3 1PGL1 4OZOA 3PIGA 3QCWA 3BYWA 4IE7A 2VR4A 4BM8A 4URTA 4ZZ8A 4CP2A 2X53S 3I97A 3O0WA 3R0RA 3BTZA 2DBIA 1VR3A 1ULFA 4XF9A 1UIJA 1CWPA 3FLRA 2W3JA 5A1AA 5F2WA 2GN7A 3LOIA 1O4TA 1H4HA 3T0BA 2O0OA 5J09A 2QQIA 1ULDA 5T50A 5FXXA 4GIQA 4NRQA 3VUOA 1RHI1 3WHTA 5J7MA 2FCUA 4Q5OA 1DF0A 2D40A 3C8XA 3TEXA 2R071 2EAKA 2RS52 2VNGA 1Y9GA 5FWEA 4AI9A 3PUSA 3GZTB 3UL2A 2RR12 2D43A 3GGLA 3A7QA 3KV6A 4XF4A 4CP1A 1MEC3 4S2DA 4UI9L 1EPZA 3WF2A 2JENA 3JBG1 1S0JA 4RR3B 1TMF1 1O4YA 2DF7A 5DAXA 4UYBA 1W6OB 1IOAA 2ZHNA 4GMP1 1FOD3 5LBEA 2O14A 2LW8A 3CJIA 1KXGA 5FZDA 3PTYA 2GC2A 3I49A 1S2KA 1QNWA 1ACCA 3WF3A 3ECQA 4Q1RA 3HQXA 2FCVA 1GV9A 5DZGA 3K51A 5CKQA 1HRI1 2W1UA 1GZCA 1W8NA 4WVMB 5FZ4A 2FHRA 5APAA 4CE8A 1RJ8A 3GJBA 1SCSA 3M8LA 4RS5A 4UBGA 5BNNC 1CQ9A 1KEXA 1PGL2 3VHRA 1YEWA 2RMU3 4ORFA 1SFNA 3GHMA 4QU1A 1JZ8A 1TVGA 5FYVA 2IXKA 4URAA 4GALA 3ZN4A 3PJQA 1DYKA 5A6QA 1MS3A 2DCKA 2DVBA 4QDSA 4AFMA 3L9JT 2OYZA 1O3TA 1WGPA 4META 1YUDA 3CF6E 3AL6A 1IGOA 4AEDB 1VBD1 3U4XA 2RS11 3MUY1 3QLQA 2VZRA 4HVOA 5FP3A 5HBAA 5IFTA 2Y6FA 2ZX1A 4L8QA 5CFDB 2YG0A 5C33A 1PMIA 3NJXA 2OXBA 2WSVA 3RYRA 1RHI2 5A7SA 3QH7A 1XU1A 1AR81 2BFUL 2R072 1K5MA 2BYVE 5GKAC 2R7EB 3AXEA 4P9GA 4UF0A 4EN0A 1NUKA 5E89A 1UOJA 5GM0A 4KWLA 3HJRA 2HJIA 1FPN1 2BWCA 1OURA 2ZHLA 5CISA 1DDLA 1QOTA 3AJYA 5M0TA 4R52A 2W9XA 5T52A 1OQDA 1I5PA 4E4ZA 5BNQA 1Q5OA 1TMF2 1GOGA 1PIV1 1PGSA 1UWWA 4LBKA 1CZSA 1ZBA3 4IUGA 4DUWA 1W9SA 1YXWA 4HFSA 1IPSA 3VZMA 1A78A 1XSQA 1SLIA 1YQ5A 1Q8QA 3B01A 1HRI2 2WS91 3C7OA 5IJRA 1OUXA 4EN8B 3NAPB 4JKLA 3N9QA 4B1LA 2JDHA 3NV2A 5C71A 1MZFA 4CCEA 3VDBA 4BQ1A 4I02A 3LAGA 3IPVA 2GDFA 5BV6A 1AR73 1W6MB 2Y6GA 5BNPC 3I2GA 1D4M1 5C7GA 2WRAA 3V0AB 1ZA4A 3SNMA 2JB4A 1ULGA 4IEVA 3ACGA 4NHYA 5C3QA 4I3GA 3B02A 2ZGOA 3JZVA 2X05A 5IATA 1L7QA 4JKKA 4IV1B 3Q9OA 1UZZA 1NQDA 3NQHA 1VBD2 1UMHA 2RS12 3GBFA 4XZPA 2PAMA 1WCKA 4RGAA 2H0BA 3NJVA 4IV3B 5FFOC 4AI2A 5KWRA 4EN9B 1QJY1 3ZXFA 2ILMA 2IUWA 3VKOA 1PO13 4QKNA 2BNNA 1RUI1 1AR82 1NCQC 1OBNA 4FI9A 4XJWA 1TG7A 3V0BA 2OUJA 1UU6A 2JJ6A 3DECA 3CL1A 4YYOA 3THCA 4OLLA 4JGZC 2EXIA 1Q56A 2VCCA 3ZSKA 4P9YA 5A7NA 1FPN2 2EAAA 3MFAA 3OG2A 4XF0A 3U75A 1DQ0A 3DXTA 3PLQA 1TQ5A 4LQRA 4AQTA 3FHAA 2AH2A 1PIV2 3WCSA 4Q0UA 1W2NA 3BPZA 2J42A 4CVUA 3LE0A 2QUOA 2Y8KA 1PVC3 3PVOA 4LKEA 4XFHA 5IVFA 1WMEA 4LBOA 1WCUA 4P08A 5AC93 1HQNA 1SBEA 4BDVB 1G9BA 1OKOA 1S4CA 5E16A 2WYSA 3ST7A 2ZEZA 3CZUA 4HANA 2HBUA 5EJZB 4ZU7A 5BUVA 3GCXA 2WS92 4YGEA 3HNBM 2BUKA 2LROA 3H3LA 4CA9A 5GZDA 1US3A 5FR3A 4HSJA 4YNIA 3R6SA 4L99A 1QF3A 3GF6A 3D5OA 2D5HA 3LPGA 2QQOA 1RL3A 2XB6C 2FBEA 1D4M2 3DN7A 1QQP3 5EWSA 4N43C 3PHMA 1YFUA 1E5RA 4BCUA 2QQKA 3O1RA 3WCRA 3BU0A 2O8QA 2RVAA 4AGVA 5IW0A 1W0PA 4PLOA 1OA4A 4M0HA 1L7LA 4N90A 5FYUA 5K4LA 1ZREA 3VBUA 5KXDA 4WM7B 3WEZA 1CX1A 2BFUS 1QJY2 5IK7A 3ZFFC 5FPXA 5IAXA 3JU9A 3AX4A 2E6VA 4OMDA 2VO5A 5FY9A 3TWIA 2P4EA 2JE8A 3WXPA 4CDXB 5JSOA 4Y5Z0 3O12A 3OEBA 4FFHA 3VBRC 5F5AA 1OH4A 1SDDB 5JR2A 4N9HA 4HN1A 4ZS2A 4RQPA 1ND2A 1S0BA 4BYYA 5A6XA 4LBMA 4E9KA 4WM8B 4GH4C 2WFF1 4N8MA 4XCAA 3WDYA 1SLAA 1LOAA 4LOTA 3IDEA 4DFSA 2CWMA 3B3QE 2NQYA 4XABA 1TNRA 3AYAA 2QQPA 1HW5A 2DFBA 4RHV3 3RMYA 3TOJA 1MZ6A 2FDFA 1OLRA 4LT5A 5C9AC 4XUNA 4IEQA 5F3EA 2UYAA 4BIOA 5JUVA 2TBVA 1CPNA 1W2AX 4MLOA 4QX2A 1UYZA 5FPLA 3VBHC 4BA6A 1RUOA 5ANQA 5FZCA 4RGKA 1F5JA 1W05A 1MQTB 1NOVA 1S0DA 4K21A 4P02B 2OX0A 1SLTA 5ABJA 2VOWA 4P9IA 2BBVA 5D8AB 5HXVA 3HBZA 2BU9A 2Q1ZB 3TYJA 1LHWA 3HT2A 4YVSA 1LU1A 2VQAA 3HMYA 5KR7A 1OC1A 1G8WA 2ZEWA 3NNJA 3PUHA 3HOBA 4P9WA 1ZZ6A 4FSJA 3NV3A 1NZIA 2P2KA 2P3YA 1PK6C 4X8PA 1W3VA 2YROA 4RD7A 4KH9A 5ERLA 1ND3B 1LGBA 5FYIA 2A6XA 1UZYA 2P37A 1OOPC 3AC0A 1RVF3 4LBQB 3WR0A 4Q4W3 5JDBA 2HH9A 4A45A 1ULOA 3GYDA 3MV01 3IKWA 3I59A 3P6BA 1J59A 2W39A 1W2UA 3ZFEB 1ZBE2 3KS7A 4RFT0 3VZOA 3SLIA 1C1LA 2JDPA 3R4DB 2DCYA 2XJTA 1DU3D 2BTVC 2R042 1OLQA 2AEZA 3SCGA 5F7UA 3Q8AA 2G9ZA 1TEIA 3DYOA 1W9TA 2RR13 1GZWB 2WFF2 1O5LA 3SKVA 4Y1XA 1C5HA 1F4HA 4PT6A 1V00A 5LY2A 1VMHA 1RUG3 1WBFA 1XNBA 2ARCA 4I0BA 4FP2A 5JIAA 2HYKA 1Z7S1 4R9AA 4IEOA 3BTYA 1OD3A 2XLAA 2J1EA 1URXA 2VZ3A 3K75B 1UY3A 1FMD1 1LULA 4LULA 2QQUA 4YVWC 4CXXA 5T5JA 3T30A 1PGW1 2VE1A 2XG3A 2FDIA 4MGKE 4R4ZA 2JX9A 2BP6A 3K3NA 1NAEA 4AHYA 3DEMA 5C5TA 3DGTA 3ZLIA 1F4AA 2ATFA 4LHSA 1V6IA 4QKFA 1OT5A 3ASIA 3OD4A 1H2LA 3O1UA 1SG3A 2WNUB 1O91A 5FLHA 3NL1A 2VOXA 3ZN6A 3KMHA 3FUOA 4YFZA 3WQ1A 4P9XA 4CCKA 5BNNA 3WINE 2BOIA 5I0SA 2EIGA 1UX7A 4XAAA 1WBLA 2HYXA 3WQ0A 1R1A2 1H1AA 1JTZX 1LU2A 2R49A 1G9CA 2NM1A 4UAPA 4ZXEA 4OI2A 1ZZBA 1RHI3 1O3SA 1U5XA 1MEC1 1OQ1A 2PHRA 4BLIA 5FYCA 3AMNA 4LMFA 1H30A 5FWJA 4NPLA 4AEKA 1WMDA 5A80A 1UN1A 5GZFA 2D6LX 1FOD1 4D7TA 5J3UA 1XNAA 5FZ1A 4BPZA 1KQRA 4JTOA 4AVAA 3J4UH 2O8OA 4UXAA 3KCYA 1UCXA 5J96B 2P17A 5CG9A 3T3YA 4RN5A 5FUIA 4XIOA 2Z79A 1TMF3 5CBLA 1VB4A 3APBA 1W6QA 1CZTA 3TB0A 4GMP3 5FIXA 5IYYA 1Z7S2 2CY6A 2WUHA 4FVVA 3TNPB 3DPRB 4QX7A 2WNEA 3LPFA 3T1MA 3VL8A 1PZ7A 1AZDA 1FMD2 5F32A 4GKYA 4AVCA 1PGW2 4G9SB 1FI2A 1HRI3 4LLFA 2CGPA 1D0HA 1NA1A 1Y9QA 3BGAA 4Q4Y1 2VZPA 1WCSA 2K46A 1W8OA 4CCOA 5AFBA 5BNOA 5C70A 1EY2A 2QTWB 5FBJA 1CONA 5CFCB 4LIUA 1IS4A 4Y4YA 2HWE1 1SPPB 5D21A 4QX5A 3T2TA 3NV4A 4A4AA 5C3OA 4FOVA 2WC2A 4BLJA 4DOUA 4YZ5A 2P1BA 1MZ5A 2Y6LA 4HL0A 2JG9C 2A75A 2B9VA 2WSUA 3EO6A 1VAMA 4DMIA 4OI1A 4BK4A 5LATA 1GOHA 1VBD3 4J6GA 4PQ9A 4DPNA 4DINB 3OGRA 3RMXA 4NE9A 3UGHA 1JYXA 1IS5A 1G9AA 5DUWA 5BNPA 1AJKA 1XBFA 1IS6A 5DAQA 1TE1B 3M3IA 3MZHA 3G6JB 5I8SA 3A0NA 1DQ5A 4IE0A 4QX1A 4AI8A 1VMJA 2FDHA 1MEC2 4XC9A 3Q8FA 1DP0A 4XEZA 4B4RA 5FAXA 3NKGA 5FYHA 1NYWA 4CRQA 4HN0A 1ASJ1 1ZBA1 3BPSA 5GLWA 1FOD2 3TNQA 2DU0A 3ZX7A 1BZWA 1WKYA 4Y1YA 3TEYA 4RS5C 1FPN3 1MS5A 4D3WA 3PJYA 4AW7A 3DKWA 4A7ZA 4QX3A 5LRRA 3BN6A 1K3IA 5JZGC 2OQ6A 5F2SA 1XE8A 2OW4A 3U14A 1U5IA 3IAPA 4JGZA 4AVBA 1XB9A 5FYBA 4QXHA 2WNOA 2B9UA 4FFGA 4LE3A 2PYTA 1W6PB 1PHMA 4GMP0 1AR71 2ARXA 3UK9A 3AK0A 1NQJA 2HWB1 1WD3A 5CYYA 1GFF2 4ISRA 3ITQA 2VC9A 4I09A 1REDA 5KHJA 4Y1UA 1N3PA 3MBWA 1JU4A 1C4RA 2WYFA 4Q4Y2 2RDNA 4ZXKA 4COYA 4FBFA 2PHWA 4CDUC 3MGUA 5C3RA 4CP0A 2HWE2 4FPKA 4AGRA 2JKXA 1D4M3 3B9IA 3MPBA 3ZXDA 3H8RA 1VAVA 4TTGA 3E97A 2WN3A 2VZUA 4FPGA 1PO11 3RPQA 5JOXA 3OYWA 3ZIWA 3MLLA 2VZQA 4HVQA 1ZA7A 2RDRA 4GWMA 3ZYPA 4QAWA 4Q8LA 1GP5A 1QMJA 2WZR3 4XTMA 4LHNA 5DDJ1 2J22A 1BBT1 4DXSA 3H9AA 4AK3A 4DXRA 5C8WA 1ENQA 2Y6HA 4N43A 3AKSA 3POSA 1H2MA 1XNDA 2XHNA 4IXLA 4CDWC 3ACHA 4YM0A 4K1ZA 3A21A 5DABA 4JCKA 1RIRA 2GH8A 1CJDA 1ASJ2 1GZ9A 1ZBA2 2PN5A 4LEJA 1LCLA 1HV0A 1PVC1 2ZABA 1G7YA 3ZFFA 5DAVA 4B8EA 4LO7A 4A44A 1IZ3A 5AC91 1ZRCA 4AI0A 3WF0A 5A7WA 3I54A 2G9GA 4BQWA 3O0VA 3AMMA 1DBNA 1HXS1 4ISQA 1S2EA 2C1FA 1PZ9A 2MHFA 3VBRA 3W5NA 2V5DA 3TRSB 5FZ3A 5JMCA 2YDEA 5LA2A 2CDPA 2J1AA 2XVKA 1OA3A 3ZFGC 4GH4A 2GZWA 2D3SA 1QHDA 3KV5A 1QQP1 2HWB2 3MIDA 5C3PA 3T2OA 5JXJA 4IE6A 2I45A 4I3PA 4EWEA 5FUNA 4QX8A 4FXGB 1H8VA 1HJGA 1RC6A 2A5ZA 1QGLA 4HKLA 1BYHA 2JDYA 4B29A 1F15A 1RUH1 2PHTA 3WF1A 5AFEA 5C9AA 1HDKA 5FLJA 3RWKX 1H6YA 3VBFB 5JI7A 1SLLA 3IB3A 3KQRA 1LRHA 1X8MA 1JHNA 3ZYJB 1PO12 2PLV3 3VBHA 3V65A 4NMIA 3R4SA 2RJ2A 3SISA 4CCLA 1W2OA 3B00A 1K45A 1IKPA 1YLLA 5DDJ2 2CU5A 1BBT2 2AC1A 2VZTA 4KWUA 3CMGA 4G4FA 1U5YA 2JDKA 3ILNA 5FQ0A 3CQOA 1RGSA 1DQ4A 1V6KA 4I0AA 4E27A 1PK6A 2X5IC 4COZA 1ZBE3 2Y34A 5IVYA 5EJ1B 1PVC2 3GALA 4RHV1 3PUAA 2R043 3AP9A 3L2YA 1Y4WA 5AC92 4AEJA 2HWD3 5A6YA 4MG2A 4NWVA 2WLPA 1KFUL 2E9QA 4ZU4A 4FTSA 3AKTA 5L7OC 2JB8A 1GLHA 2WFF3 3M3EA 5GLUA 3WD5A 1HXS2 1E5HA 2D7FA 5BXXA 2ZS6B 1GWMA 3OPTA 3WY6A 1RYYA 3LA2A 5EYXA 2F6BA 3E6BA 1NXD1 2DDUA 4FPJA 5LEJA 4V2VA 4P00B 4BIFA 3TEWA 3WP6A 4BQ3A 4MHUA 5FUPA 1HV1A 1CGPA 1QQP2 2KR2A 5FZHA 4O65A 5FCCA 2W91A 5E1RA 3RNSA 4FXKB 4BWOA 4D7YA 4QQHA 4W65A 1JXNA 1NXMA 4XDOA 1UF2C 4LTAA 3RZHA 1ENRA 1RUH2 1LHOA 4YLZA 3P1IA 3USUA 2BGCA 2FMYA 1CAUB 3VBSC 3K4DA 2ZZJA 3FWEA 3RDIA 1RVF1 5KXBA 1ULCA 3ZN5A 1X50A 4Q4W1 4HKOA 4K9SA 5IK5A 2DCZA 3GHNA 4AWDA 5A33B 4P9LA 4XFGA 1T6BX 1IQDC 3G7DA 3OGJA 5I0RA 4I01A 4J25A 1DIWA 1Y43B 5DG1A 2CWSA 4JGYC 1UAIA 4ES9A 2WR9A 5FY8A 1UPSA 1JZ6A 5F37A 3E6CC 1R1A3 4XJAA 2DU1A 4H7LA 3JQWA 5FLIA 5FZ6A 5LY1A 3FBYA 1NCRC 3FJSA 1BJQA 3MIEA 2WZPP 3UYJA 2ZAAA 4DQAA 5FZOA 1U5ZA 3BCWA 1LGCA 1DZQA 2J7MA 4IE4A 3WW3A 3WNPA 1RUG1 1ZM1A 4LKFA 2AR6A 3RQ0A 2GMPA 1KDMA 1JYTA 2V5YA 2C9KA 4PJYA 3M3OA 1US2A 3I2DA 4R8HA 4DY3A 2G1MA 1W6NA 2GMMA 1D7PM 3KWVA 2ZMNA 4W4ZA 3AB0A 1ZZ8A 4COUA 5KXEA 4HONA 2HEVF 1DGRN 4YW7A 1ULEA 1UYYA 4GXLA 4QWNA 2YZ4A 1Z7S3 2E7TA 4H7MA 2AREA 1CAWB 1I5ZA 4Q26A 2WT1A 1FMD3 2CYFA 4OCTA 3ZKUA 3NRUA 4A41A 1VMFA 5I91A 1W0OA 2XJUA 2Q8OA 3ZDSA 2R16A 4Q4V3 3ZXJA 3MW4A 3PDQA 3JXSA 4R9DA 4N53C 1I3HA 3IDBB 3J8F3 1W06A 3AKQA 1IG3A 1RVF2 2XBO3 4XCBA 3LFIA 1UZ0A 2W87A 4Q4W2 3POWA 4R4XA 4AFDA 5C8CC 1C28A 1OA2A 2RV9A 4YM2A 2GNDA 1VBB2 1JH5A 3S7EA 3KHCA 5DQ0A 3ME2A 3MIHA 3ZSJA 2D6KA 1UNBA 5DUUA 5K8SA 2BZDA 4QGLA 3KVAA 3VHPA 5F1RA 4XBNA 4M3CB 3VKNA 1DQ6A 3VZNA 5LWBA 3ZSMA 4K20A 4C1XA 1WLTA 2JG9A 1Q8SA 2BGOA 1NCQB 4YFWA 3AM2A 2B7YA 4XDQA 2J1SA 4K40A 4AI3A 1K42A 1RUG2 3CKHA 3K48A 2XLGA 3LDBA 5T5OA 5IVEA 3D6EA 3DF0A 5A7OA 3RVHA 4FTEA 2W94A 1W8HA 3VL9A 3N9LA 3VBOB 1CJPA 1WLCA 4A6SA 3L2HA 3WF4A 4XMIA 2ZKLA 4MGQA 2UY9A 3BKZA 1LOGA 2D93A 5F8PA 1IHMA 5HCBA 4E4HA 1J3RA 5J36A 2ZXQA 4Y26A 5JZGA 3KLSA 1X8EA 3MDPA 3NNGA 3ZXEA 2ZGLA 2A71A 4RYDA 2BWAA 2DURA 3FHIB 3WDUA 3ROUA 3WG1A 5JCTA 2XVLA 5FY7A 4Q0PA 1N1SA 4DXTA 1N1VA 4Q4Y3 2Q1FA 3N9NA 4UT5A 2VW2A 1WA6X 3EHKA 4AQSA 3UKNA 4PIYA 4UW5A 1BK0A 5K0UC 1DFQA 1VBC1 2HWE3 5A32A 2B45X 4PDWB 2VZOA 4FOQA 3ACIA 1DQ2A 3K46A 3AKPA 3CZJA 5A3OA 1CAXA 2EXHA 4DS0A 5C6CA 1JYIA 1EAH3 5DUXA 2VUDA 4A42A 1SEFA 4CDUA 4CYDA 5A3NA 2QQNA 4QXBA 4Q4X1 3IDAA 4I30A 4DEQA 4HOOA 4XVHA 2OKXA 4QB6A 3ZXLA 1H8TB 2X29A 4HK8A 4CU6A 3DV8A 4AEMA 3QH6A 4QPIC 2YFUA 3E1F1 4JZRA 1ODNA 4LO8A 1J58A 1ASJ3 3GCWA 3A0KA 1NA1C 3KZ4C 4WVZA 2DUQA 5FYSA 3KT7A 4UBHA 2XJSA 4CDWA 3T1LA 3VD5A 1IPJA 1N1YA 3BB6A 5EP9A 3T4HB 5GLTA 5BNOC 2YBSA 4DB5A 1RUD1 2PAEA 3WW2A 1QWRA 4PLMA 2JWPA 4QM9A 3OGSA 4FQ4A 4ATEA 1CPMA 2VW0A 2ZZQA 4KL1A 3ZM8A 4CDQB 1JMUB 4ZHNA 1I1EA 2ARBA 4NROA 1C5IA 2VMDA 3IM0A 4KU8A 3VDDB 2ZOEB 2HWF2 3SC7X 2BVVA 4E2GA 2JG8C 1KITA 2VXJA 3OB8A 4AHWA 4CEYB 4IEUA 4NN0A 4Y33A 2HWB3 3ZKYA 2ZGTA 4GA9A 1VPHA 2MPFA 3AP6A 4IESA 4LHKA 4XJ9A 5K9YA 2CV6A 2H0VA 2JDNA 2PHXA 4JRLA 2CGNA 2VGDA 1RITA 2RJLA 2WZR1 3ZFGA 4P9JA 4MYEA 4V1PA 2HLEA 1BQPA 4D0QA 3SH4A 1VBC2 3VKLA 4ARXA 1V0AA 4NIDA 1QOSA 4NHKA 1YFXA 3JQXA 3FC0A 3ZDVA 5FYMA 2F17A 3ZPYA 4O61A 4DNYA 2XJQA 4S2GA 1GKBA 3INAA 1UX6A 4FPEA 4CUBA 1I9RA 2FD8A 2ORZA 5DDJ3 3ZR5A 1BBT3 4XYXA 4N9IA 2JDZA 1OOPB 2XJRA 4Q4X2 5CB7A 1M06G 1ENXA 3RJRA 1W8FA 1J84A 1DLLA 1CVNA 2WZEA 4PF5A 4QQLA 1WLWA 1TZOA 1FATA 4EZ4A 2PHDA 4DRRA 5DG2A 3F95A 3FFQA 1JHJA 1PNGA 3PMEA 5FZMA 3J7NA 1Q8OA 5L73A 4OHVA 2H6CA 1E5IA 3GNEA 3RZGA 1DHKB 5I0UA 1GUIA 1CAVB 2LRPA 3N36A 4CP9A 4RGGA 1A3KA 3F2ZA 4IE5A 4RR3C 1X7NA 1LR5A 1RUD2 4W50A 2X5IA 4Y20B 1N47A 3B5LB 1HXS3 2W1SA 4V2WA 1YNAA 2FDGA 2IXCA 3LEMA 4JHTA 4QGNA 4CEWB 1KFXL 5C4WA 1EP0A 4B7KA 1JN2P 2VQTA 3W20A 1OQEA 3WOGA 2GMEA 4WVWA 5LA0A 1W8WA 3T2PA 5L7OA 4OHWA 4YVWB 1NKGA 3MYXA 5AVPA 5FO7B 5FZFA 5A7QA 2PLV1 3K4ZA 4GWNA 4XFAA 2OA2A 1S0IA 1OVPA 1REFA 2ZGPA 3GBGA 4QMAA 2NP0A 1UY2A 2RS33 1RUC3 1RUH3 3OGGA 3ZSLA 4HG6B 4NPRA 2WZR2 2YB7A 3ZPOA 5IFPA 3O1PA 2FZ2A 3HNMA 5JPNB 1Y9MA 2VZ1A 4YSFA 2XL9A 4Y5TA 2VUAA 4QPGB 4FPYA 4Q0VA 2B42B 1XE7A 4F7ZA 3AZZA 2F4LA 4AEDC 5CEHA 4IQPA 1DGWX 3LZZA 3GJAA 4KNCA 4GJYA 4LA3A 3VBSA 1AJOA 3ACFA 1TNFA 1ZZ9A 1ZBE1 1C57A 4QPYA 1UO9A 3THTA 5CFDC 3QACA 2VPVA 2R041 1COV1 2HWD1 3LF7A 4HT1T 2ZGRA 3B93A 3LGRA 4QGMA 5FZ0A 1F31A 2DTYA 3WUDA 1RTVA 3PUQA 4GB31 2FMDA 4AE2A 3AMPA 4O9EA 1POQA 3E5QA 3WQ7A 1MZEA 3AVSA 3AZVA 4JGYA 1UYPA 1QNYA 4AR2A 1QJU3 4M00A 3A23A 4J1XA 3E5UA 1G86A 2Y38A 3RRDA 4LBJA 1CN1A 1NCRA 1Y3TA 2DWRA 3S6PA 2DVGA 4BOWA 3O1SA 3W58A 4QXCA 3VV1A 3WNOA 4QM8A 1QDOA 4NIAA 3H0OA 5BY5A 4QX0A 1AX2A 2VM9A 2Q8CA 1NE6A 4YGCA 1RUF2 3VZKA 2OS2A 3A4UA 3RYKA 3B94A 4JAAA 3HPNA 4YZ2A 3IWZA 1JYNA 5FZ8A 2QQVA 1AHSA 4M4PA 3NAPC 3WNLA 2PLV2 1GP4A 5JSPA 2QQWA 4BQ2A 1DLCA 4FPHA 3AMHA 1QJX1 2AUYA 3ATGA 1RXGA 2WWUA 1LAJA 2D97A 2NZ9A 2VVDA 1DZTA 1R1A1 4E2QA 2ID4A 4ZPIA 4LBLA 4IV1C 5HPOA 3ZIXA 2J1RA 4P5HA 1VBB3 4N53A 4HPKA 1TME1 2E7QA 5A1FA 3CIHA 5D1IA 2CAVA 4JX0A 5FZBA 1MS0A 1COV2 2HWD2 5C8CA 5I8YA 1NY71 2ZHMA 2MEV2 4MHRA 4Z82A 4GB32 1H0BA 5FYTA 5TSWA 3K2OA 3CJIB 5IVVA 1JZ5A 4NJ4A 4B4PA 2Y26A 3AZXA 5I0DA 1XNTA 2VTXJ 2QZ3A 3WP4A 5A3LA 4IERA 1WW7A 3ZMOA 1XC6A 5EV7A 4MXWA 1AXYA 3J7HA 3ZYIB 1WW4A 2D6OX 3PMSA 2JKBA 4MGZE 5KBFA 3OY8A 4RS5B 3PIJA 4ASMB 2WQ4A 2VBDA 4AVSA 5GZCA 4FFIA 2W0XA 5F9TA 3H8UA 1YI9A 3N35A 1HLCA 2B46X 4AAXA 4Q4V1 4XILA 4MGIE 4QKBA 4YARA 3TEZA 1CIWA 3FL7A 1LGNA 2AZ5A 3J8F1 5SV8A 2PELA 2XBO1 3MIFA 2BNOA 2ZEYA 3DYPA 2Y6KA 5FV3A 3AYEA 5CNAA 4Z2AA 5LBBA 3IIIA 1NX9A 4O7XA 1QXPA 5DN2A 4FPLA 1DCSA 5ANNA 1QJX2 4FAHA 1OXCA 1HRV2 1HX6A 1W03A 4GULA 4IW3A 4Y22A 1K5MB 1SDWA 3FN9A 3P3NA 5H9SA 5EPAA 1V6NA 2XJVA 4LO4B 3ILFA 4UF0B 3D82A 4XBLA 3UT0A 3GDBA 1U12A 2W95A 5C5UA 3TBDA 2EIDA 3MPPG 2C4XA 2JDMA 1XOYA 1A8DA 1OLME 5KHGA 2ENRA 2BBAA 2B39A 1TME2 4JVAA 2XKOA 4MSVA 4U2AA 2R0FA 5CVRA 4WM7C 4TWTA 4KWJA 4IEYA 1JODA 5K0UA 4IGPA 2RG4A 5B4NA 1ST8A 4KGGA 1NY72 1C3HA 5A6ZA 3N7JA 1CIYA 1GICA 4UW3A 4CDXC 5DAPA 3K77A 5IWFA 1JOJA 1OPOA 4K1YA 2L9LA 2YGMA 3LEKA 4UFHA 3FLPA 4WBBA 3VHNA 2JICA 1RUJ1 2Z5WA 3WP3A 4KBZA 1AF9A 4TZDA 1PZ8A 4S2HA 4WM8C 1OKQA 1ULPA 2LS6A 4H3WA 5T54A 1WW6A 1LEDA 5FO8B 4C0HA 3ES4A 4QPIA 4B1MA 4XAEA 3IPVB 5F5IA 2D5FA 3LDKA 2BJSA 2VY0A 4Q4V2 1DGLA 3AYCA 4L97A 2WDBA 2B5HA 3W5MA 4PIXA 3RG0A 2HWF3 1W9YA 3J8F2 2P3JA 5J98B 2VQUA 2XBO2 2WNVA 4EN7B 1B35A 1UKGA 4XUTA 1PX4A 3VZJA 3MICA 3BIEA 1HB3A 2V73A 2WO7A 2ZTNA 1DYOA 2ZEXA 3UETA 3FFZA 3OUHA 4A3ZA 1MQTC 2DCJA 4KBBA 2YC4A 4ONUA 3WG4A 1H2KA 1RUE2 2RE9A 3P3PA 1Q8PA 1EAH1 5D8AC 3GZEA 2R1BA 3V0BB 2JG8A 2VOTA 1XYNA 1EV13 4YW6A 3MO4A 1GP6A 1VBC3 2SBAA 1XE0A 5FBZA 5KHKA 4WZFA 3NJZA 1GWKA 1DGWA 1ND3C 1DG6A 1HB4A 4TSVA 1H1IA 1JI6A 4IGQA 4LO5B 5FZGA 1HJFA 2PMWB 2ZGNA 5C3SA 3ZVXA 4ZZ5A 4AG4A 1WCQA 2Y0OA 5IVBA 4LXLA 3I3EA 3R05A 4Q4X3 1RB8G 1JYCA 1J1LA 2P34A 3CO2A 2HWC1 3ZFEC 3MLKA 1VP6A 2F4PA 2LALA 3MF6A 3LD8A 1RUJ2 4S2FA 2JD9A 2IXJA 1BEV2 3LIGA 3SCHA 3SEPA 1MS4A 1W28A 1F8VA 2Q5TA 1UY1A 1W8ZA 4SLIA 4K8FA 2OIIA 3N9PA 5J48A 1RUD3 4NHXA 3VD9A 2RJKA 1QXJA 1SLBA 1CZVA 2O1QA 1W2TA 3OPWA 1OF4A 4XJZA 1N3OA 1W04A 2ZBJA 5T5LA 2UWCA 4JDOA 1UD1A 4MV2A 4RR3A 1SCRA 2ARAA 3EB7A 4XACA 4BXSV 4I2OA 2VU9A 2P3IA 4XFCA 1W6OA 3VBUB 1AYM3 3KQ4B 4Z07A 3H50A 2W92A 3O0XA 4YG3A 4L2NA 2TEPA 1EAH2 1V70A 1STMA 1V9U1 1L3JA 3HNYM 1KS5A 2WNUC 2JIJA 3SEEA 4YZ1A 4WVMA 1ZZCA 5E8AA 5FZ7A 3RYPA 5GJ6A 1FYUA 2VMFA 3AJZA 2KA3A 4MOAA 4COVA 4RQPB 1ND2B 4W6XA 4UFIA 3H7JA 2VZVA 3B9CA 3MW2A 3HEIA 4H55A 3QD6A 4XPVA 2DUOA 2NMNA 3Q8EA 3DL3A 3IZOA 3HVDA 2WA3A 4OVEA 5FREA 1R093 2VMIA 3HBKA 2C6SA 2Q8EA 2EIBA 1S0FA 2YV8A 4TLFA 5IK8A 4AEDA 2ET1A 2HWC2 4NR1A 4L11A 4GWIA 3O1OA 1J3QA 2XOMA 3W21A 2J1VA 3WVJA 4W6YA 3U4SA 4ZKTB 5CFDA 2D6MA 4NRPA 3BTXA 2VMHA 3I2HA 2BW8A 1LTEA 1UIKA 3I2FA 5EHDA 4CCDA 3JUUA 1QJFA 1DYPA 3PTRB 2XHKA 4HK9A 3ZYFA 4XE9A 4YM1A 4AYUA 4NAOA 4PF1A 2YPDA 2DVFA 4XMAA 5ABJB 3OCPA 1NLRA 4JC1A 4P5YA 3I7DA 5JIUA 4DEVA 3CLPA 4KG0A 4YVSB 4QB1A 4YW4A 4ZY9A 3POYA 4XQDA 3DPRC 2RS31 3H3UA 1RUC1 1SFYA 4OHYA 1RUF3 1RJ7A 1VRBA 2BV4A 3FX3A 3NMBA 3OD0A 3T0DA 3AXDA 3KV9A 3WV6A 4Y4RA 4OI0A 4A7KA 2WAAA 3DXUA 3M1HA 4Q0QA 1BVP1 2QBXA 2VOVA 4KQ7A 3M3QA 4GQ7A 4QHOA 3LQCA 5FMOL 1D4VB 4YW2A 4MX3A 2VVEA 2UU8A 3I59B 4RA0A 5F3IA 4DO0A 4E4DX 1V9U2 5CFCC 3BIWE 3S30A 4HKWA 2AYHA 1NLSA 2E7AA 3LFMA 3RFRA 2TUNA 2XPJA 1CD3G 3NAPA 2C26A 3E5XA 5FPZA 3BUCA 4CU7A 1PNFA 3LDRA 3DUIA 3O5SA 4ZONA 4ATFA 3T4VA 5FZIA 1UL9A 4XQ4A 3S0MA 1ZNPA 1W6MA 1OD5A 2PQQA 2FQPA 1BLZA 2ZGMA 1WA4A 3V0AA 1QJU1 1BCXA 1J3PA 4ASKA 3AP4A 3C7EA 1IG0A 5IVJA 3IAQA 3T08A 1H9WA 1COV3 1JS9A 5C4WC 5A3MA 2XUEA 4IV1A 1K5JA 2MEV3 4FP3A 1LENA 4GB33 2WAOA 1AXZA 3MI8A 4IV3A 3SH3A 3U37A 3NNLA 2EXJA 4P14A 4AAPA 1F9KA 3DCQA 2ZX4A 2R1DA 2VXRA 1QH6A 4YZ3A 1YQ2A 1UMIA 4AFAA 2WWJA 1GMMA 2C0ZA 4CCJA 4GD4A 4BH9A 4DRVA 4L0PA 4WVVA 4Q27A 4AHXA 5LK5A 2YXSA 1H1MA 1UXZA 1ZRIA 3JD72 5EZWA 4QQPA 5HCHA 2DCTA 2A70A 1HQWA 4LBQD 4AVTA 5FPUA 5CKNA 5A3UA 2I2SA 1VBA1 4NAMA 2RS32 3CDZB 1RUC2 2NPIA 2VD7A 3OUIA 4WV8A 5FP7A 3ZN6B 1ZRDA 2IWGB 5FJHA 1UQXA 1QOOA 3I3DA 5BNNB 4J1WA 2Y64A 2XXZA 5F3CA 1GBGA 1M4WA 2QQLA 2GN3A 1Y7BA 5FRAA 1S0EA 4PIZA 1QH7A 2EALA 3O7OA 1W8TA 1KRIA 1OH3A 3KM5A 1VBB1 1NT0A 1REEA 1QJX3 1HRV3 4Q1PA 3BALA 3OGVA 4EQVA 2PFWA 3UGFA 3ES1A 3OOXA 2JDUA 3ABZA 3OJBA 4EYUA 3KHBA 2ZAHA 2LM3A 1HB2A 1AYN1 2W47A 3I2JA 1D0GA 3OEAA 5FYZA 5KHHA 1BXHA 2OPWA 4UW4A 1SACA 5BPXA 1TME3 2VTFA 1J1TA 1QJU2 4LA2A 3O14A 4QQ2A 3OUJA 3R4UA 1JUHA 4UW6A 2G4IA 5LEKA 4JV4A 2YC2A 3KT1A 4JQRA 4KWKA 3VKFC 1RMU3 3V56A 1OLMA 3I2IA 4D8MA 4AVVA 2ZX2A 5A70A 3H8XA 4BQ4A 1D2SA 1LOFC 1O7FA 4WM7A 2A3YA 3MFCA 5DAWA 4CZSA 3NO8A 3ZYRA 1X9PA 2WA4A 2YBPA 1AVBA 5FXWA 4QT6A 1NA1B 1QDCA 2BDRA 2VOKA 3C2UA 3NNMA 4N7UA 4R9BA 4CDXA 4FT8A 2ZX0A 4XURA 5FZLA 2VZSA 2CTVA 3N7LA 4DUXA 2YMZA 2XL7A 2X09A 4QU2A 3WW1A 5FY0A 1VBA2 1VLNA 1KJRA 5KC5A 2CL2A 3CU7A 5L19A 4WM8A 1UOFA 1J83A 5CADA 4IEXA 4CU8A 3J9SA 1S0GA 3OBAA 4TYSA 4UWDA 2A7AA 4AXOA 5FMOS 4AI1A 5BNPB 5IT6A 1FV2A 2GALA 4LUKA 4QPWA 4MXVA 3RJ2X 2NLRA 1I6XA 1PO23 1AX1A 1RUE3 2HBTA 4Y24A 3VBFC 3POFA 4BE3A 4X8NA 4XIKA 5LA9A 4Y1VA 1JBCA 2VAUA 4CUGA 5EIYB 3KV4A 1GNHA 4FPOB 4Z2WA 5FXZA 4K3UA 5CU1A 1O5UA 1MQTA 3BU7A 4MO3M 1AYN2 1H6XA 2WWSA 5ACA3 1BHGA 2ZGQA 4AHZA 5D8AA 5FY4A 2JEMA 3AZYA 3RGBA 2D98A 5JXHA 1YQCA 1Z0HA 4FQZA 1OHFA 2Y60A 2VMEA 4QQOA 4JGZB 3RZLA 5SV5A 3OF1A 3W59A 5I93A 4LKSA 4A7YA 4QB2A 5JXIA 1ZRFA 2BGPA 2ZGKA 1ND3A 1QU0A 4PQQA 2UWBA 5F39A 4LBQA 4XXAA 1GNYA 2E51A 5A7PA 4JDMA 3MLJA 1RUJ3 1BEV3 1GSLA 4AGGA 3M4FA 1MS8A 1EUTA 2QJVA 2HWF1 3ZFEA 4QDRA 1UU4A 4D6QA 2C5DA 5JWPA 4TN7A 5FO9B 3KT4A 1XXNA 5FYYA 4XFIA 1GYKA 4Q0SA 1ZRRA 2DTWA 3ZYHA 3CBNA 3B69A 1QIQA 2BEOA 2W1WA 2Z2SB 4G3YC 4RFRB 1GZWA 4C91A 2GC1A 1PMJX 4LITA 3OYWB 4XHBA 4M0NA 1UMZA 3I8TA 3DYMA 3PVNA 1EV11 2JD4A 2IVJA 2RM22 3CNAA 3SH5A 4XQWA 4N43B 2C24A 1S2BA 5FY1A 3VD4A 1LKNA 2QDNA 3C7FA 1UOBA 2FDJA 1O8SA 2VCBA 3C7GA 4O9GA 2Q8DA 1HN0A 4Y5SA 2H6BA 1XNCA 1ZVFA 1ALYA 1QY4A 4LK7A 2J1TA 5GZEA 1FNZA 3SCFA 3UJOA 4CXWA 4XDPA 1UOGA 4B3NA 3J26N 3NNFA 4NO4A 3ZFFB 2N7GA 3NW4A 4LORA 5A7WB 5EQUA 2OVUA 4LNVA 3THPA 1Q3EA 2WNUA 1N3QA 3VBRB 3PL0A 3ZYBA 2QDRA 5FMDA 1LESA 1X82A 2ET7A 4GKXA 5T55A 2Q1MA 1IQAA 2J1UA 2VCMA 4CCNA 3PU3A 4KGQA 1W8UA 2HWC3 3KCXA 3WNNA 3POJA 3OBZA 2YGLA 4OZXA 5FY5A 4CTEA 3H8OA 3HN3A 4GH4B 2WNVC 3GZAA 1B35C 3VDCA 1U0AA 4AZZA 1YQ6A 1KJLA 2IXHA 3UV9A 5H9RA 1QXRA 5LBCA 1AL21 4OQ9A 3ALQA 1YI7A 2IFWA 1OFNA 2PA7A 2WO2A 3V64A 4F83A 5LCWL 1OI6A 1DGRA 1JZ4A 1NLQA 2GAUA 5C9AB 5J37A 1LOBA 1HQLA 1EYBA 2A3XA 1BKZA 2OPKA 3JBG2 3K4AA 4NIIA 4A6OA 1SZBA 2WABA 4U36A 1AYM1 2DBNA 5DMYA 3FZ3A 3ON7A 3MV11 4UFKA 1MR5A 5JSRA 2ES3A 2GH2A 4RL7A 2E63A 3VBHB 4D6SA 4Z92B 3LCPA 4E8DA 1K12A 2QVSB 1XSRA 1EV12 2G9FA 1AX0A 3A22A 1KGYA 4ARYA 2GNTA 3N3HA 4NOTA 3LSDA 3LA7A 2Y0IA 3DPRA 5FQ0B 2EXKA 2B4KA 1PK6B 4IEZA 4OQ8A 1YIPA 1V9U3 3POEA 4XUOA 4FOYA 3KF3A 1R091 1X36A 3CHXA 4CPBD 5LZ6A 4PCRA 4GAZA 4BU2A 2JXAA 1JZ3A 4PHZA 3ENRA 3SITA 4OYUA 1ODMA 5GALA 3MIGA 3ORJA 5A1LA 4M3CF 5HXMA 3WZ1A 1C8NA 2KD7A 1O4ZA 5CFCA 2Q30A 2Z69A 3JB4C 1UZVA 1SPPA 3WHUA 1UPIA 4M3CE 2R061 4BJ0A 5JI9A 4Q2FA 1KD7A 2ADEA 4LKDA 3RI9A 1SFPA 2PXJA 4XJUA 5J1XA 4COWA 4D6RA 2VNOA 3LOBA 1JW6A 2QKDA 4R9CA 5JXGA 2HEYF 1OF3A 4BMEA 3VDAA 3EMRA 1NE4A 3ELNA 5LA1A 2DV9A 5L9BA 2EF6A 1MS1A 2GC3A 1IPKA 1CX4A 2A6YA 2AGSA 2VMCA 2ZX3A 3O1VA 2CAUA 3HIFA 1AL22 3HQRA 4EWDA 1LOCA 1RUF1 5LB6A 1LB2A 3USUB 5F6KA 3OBRA 4K7JA 2VVFA 5EYYA 3EQEA 4DZGA 3VBOC 3POIA 4F3JA 2LTNA 3JD73 1AYM2 3C3VA 3VKMA 2XVGA 4NRMA 4W8JA 2A73B 2IZWA 2VECA 1XPWA 1WZXA 3IT8A 2DVDA 4MADA 1PX3A 2XH6A 2Z4FA 1XNKA 5BYNA 1G9DA 1VBE3 2OUHA 4OHZA 1GANA 2YY1A 1C1FA 1GWLA 2G19A 3PNAA 3J7LA 2KM2A 3ZOIA 2XLFA 2JDAA 4Z8BA 3ZSEA 3CJXA 1BVVA 4LE4A 2K2SA 1APNA 5FXVA 3PUIA 3E6DA 3VN4A 4CSWA 2D3RA 2GNBA 2PAKA 4SBVA 5CA6A 1W6PA 5FOBB 4HSLA 5H9QA 5FZAA 3WNXA 5JVVA 5FP9A 5FZOB 2FDKA 3N4MA 1LJ7A 1R092 2Z42A 3AP5A 4PDWC 5GLZA 5B2GB 3AL5A 1O59A 1OMIA 1CESA 2SLIA 3IMMA 4HVRA 1GQPA 1AUYA 4B7EA 2MEV1 3NJYA 4NPMA 3WW4A 3HN1A 1FV3A 1YYNA 4FPFA 3I4IA 4LO6B 1AL0G 1X33A 1W6NB 3NKTA 5FMCA 4CCMA 3BVCA 1YHFA 2R062 4KMQA 4E2SA 2W68A 2IFRA 3U0ZA 3EJKA 1H8TC 4Z1VA 3EXUA 5LW9A 2WQ8A 1C8M1 1RUI2 1Q8VA 5ISLA 4YM3A 2JE7A 3FHQA 4ZS3A 4Y3OA 4UFLA 4XFBA 1IKQA 2VCAA 5EXOA 1ZX5A 3W9AA 3HQUA 5JMOA 3ZR6A 1MPXA 3ILRA 4PBOA 4BB3A 4DIQA 5G04L 2YUEA 2VL4A 2ZKNA 4L92A 1UKRA 1FT9A 2WKKA 2OZ6A 1POV1 4RSUA 3AFKA 1WD4A 4AF9A 1AR61 3OBTA 3H42B 4JKMA 3S5AA 3WUCA 1LOFA 4CDQC 5JOWA 4ITCA 2YYOA 3ETQA 1O6UA 4YPJA 1AR91 3NV1A 4HXCA 3BODA 3ZXKA 1YJLA 3VDDC 1VBA3 4UFJA 1D2QA 2Y6JA 1SMVA 1HRV1 4YG0A 4CEYC 2OZJA 3VHOA 2WT2A 5LASA 3I3MA 3GZUC 1R081 3S7IA 5LBFA 4CPBA 3QBQA 1YQ8A 5T5PA 2OQ7A 3N9MA 4H2AA 5DUVA 5CIRA 3H1YA 4NVPA 1R64A 2JG9B 4AL9A 1UY0A 2AEYA 2VJXA 4IV3C 4FOWA 4XOGA 3PVBB 1RUNA 2ADDA 3HR9A 1KDKA 2BVBA 1YRZA 2D44A 3U78A 1NZCA 2VMGA 2VUJA 5HCAA 1OPMA 1XU2A 1Q43A 1RMU1 3RZMA 1P8JA 4PI0A 2EICA 1AYN3 5FK8A 3VBFA 3H7YA 4LHLA 4JTNA 1PVXA 4BZ4A 5FKBA 1V6JA 5DZFA 4NIGA 5AVAA 1C8M2 4LK6A 1W0NA 4QKDA 2VUCA 4CUCA 5F5QA 1XQNA 3N7KA 1VE0A 2XQXA 2D6NA 2YU2A 4YW5A 4MGSA 4AOCA 2GSYA 2WJSA 2RS53 5LK7B 3SQOA 5HV4A 2XMLA 2ZA9A 4KG8A 4D7SA 5JZGB 1QEXA 4I0WB 4FAGA 2VTXA 3LEGA 1GQHA 1QJZA 3TN91 4BHPA 1JYVA 2D3PA 5CKMA 4ASLA 1UYXA 5EJ3A 2PQSA 1MVQA 5B4XA 1AR62 2XDVA 1R1ZA 2GP3A 4QDQA 2R32A 4YG6A 4EROA 1GOFA 1RXFA 4CEWC 3ZXGA 3WLUA 2CNAA 3FUQA 1AR92 3PU8A 3CEWA 2BPA2 5A32B 3KVBA 4GWJA 2I74A 3BTAA 1CR7A 4H14A 1PO21 1RUE1 1VRH1 1CAXB 3I2KA 4BK5A 3O1TA 4YRDA 2ERFA 4XUQA 5JR7B 1B09A 1ZZ7A 2BRTA 1R082 4MUVA 4YGBA 4CDUB 2TNFA 3IDCB 4NUBA 2RM23 1FX5A 2BOJA 3AKRA 3I3BA 4LLOA 1WWYA 2DFCA 3HAGA 4Q29A 5FP8A 3VD7A 1WLDA 3AZWA 1GR3A 3BI3A 4X6QB 5ACA1 1JZ2A 1GNZA 2R6QA 2QE3A 5K7PA 2E31A 2V09A 2W1QA 4EE2A 2JE9A 3SKJE 4QPGC 5I0TA 3AMQA 2NN8A 2PHLA 3T2QA 3ACLA 3EBRA 3BOWA 3D0SA 1RMU2 2A6VA 2BERA 1ENSA 3U07A 3WNMA 3HWJA 1CAUA 4AQ2A 1O3RA 4FTBA 4CDWB 1DQ1A 3QOPA 1IS3A 1QKQA 1LECA 5IHRA 4TXWA 1WW5A 5E88A 3RZJA 4NHLA 4XFFA 5A33A 2MNGA 3KCCA 1BEV1 3UKVA 4CU9A 1H4GA 5HI0A 5D2AA 3IBMA 1UW8A 2P3KA 3ZMNA 5CG8A 2VBBA 3LB9A 3Q8CA 2R073 4QHBA 4XXPA 3WQBA 1WMXA 1V6MA 2PHUA 4INDA 2CSGA 3NVCA 4IDZA 4BQYA 5JAXA 3TN92 5JOZA 2YFZA 2ZGSA 4IEPA 3D8CA 1V6OA 1WMFA 3UKTA 4ZU5A 5G05L 4BQXA 3ZFGB 1XYPA 3JBG3 2HKXA 1WCDJ 3VZLA 2UY8A 5HCFA 5GLVA 1SBFA 2IXIA 2ORXA 2P5BA 4LUMA 3VB9A 3MHZA 2A1XA 4IEWA 5FJKA 3FE5A 1XRUA 3TAYA 4A2UA 1PO22 1VRH2 1JUIA 2B8MA 2RMU1 2BNMA 1SBDA 2Q0AA 2VNRA 4CCCA 4W6WA 2NMOA 4IGOA 3GM8A 5KHIA 1VB2A 1ZYBA 5FKCA 3POGA 2VG9A 2K0GA 2WFPA 1E57A 3O1MA 2X8KA 1W9WA 3SHRA 4YW1A 4OFGA 3D0JA 2DYCA 5ACA2 2W2IA 1CAWA 2QZ2A 1G9FA 3U11A 2R30A 3RZZA 4E4SA 3RZKA 3MEPA
chains in the Genus database with same CATH topology
4A42A 2V4VA 2WO1A 2QQNA 3D3AA 3LEIA 5JUVA 3ETPA 3CDZB 3IDAA 4DEQA 4XVHA 2OKXA 4QB6A 3I3DA 4CU6A 4QX2A 1UYZA 2E33A 2Y64A 2YFUA 4P02B 2QQLA 3E1F1 2WZ8A 1UXXX 1JZ7A 4DUVA 2ZEWA 4ET7A 3PUHA 3HOBA 3VD5A 3OGVA 3T09A 3UNPA 3OGSA 3ABZA 3ZM8A 3AC0A 3I2JA 2W47A 3OEAA 2VMDA 4OUEA 3C7HA 2VTFA 4A45A 1ULOA 3MV01 3P6BA 3OB8A 2YC2A 2X10A 4D8MA 3I2IA 4KI5M 5F7UA 3DYOA 1W9TA 4XUPA 2HLEA 2QQJA 4D0QA 1SHWB 3SKVA 4ARXA 1F4HA 4PT6A 2WO3A 4XURA 2VZSA 4DUXA 2X09A 1W99A 4CUBA 1OD3A 2ORZA 1T2XA 2J1EA 2VZ3A 3K75B 1UY3A 4GZ9A 1J83A 4OMCA 1J84A 4CU8A 1NAEA 2WZEA 3OBAA 2W46A 1F4AA 4LHSA 1JU3A 4QPWA 3EYPA 1JHJA 1OT5A 1SG3A 1GU3A 1GUIA 3W5MA 3F2ZA 4W50A 5EIYB 1UX7A 2W1SA 2HYXA 1L7RA 4MO3M 1H6XA 1BHGA 1O8PA 2VQTA 4UAPA 4E8CA 4ZXEA 5LA0A 3T2PA 5JXHA 5CZKA 2E26A 1NKGA 2VMEA 1LNSA 3K4ZA 4LKSA 5JXIA 4QB2A 2BGPA 1UY2A 4PQQA 1XNAA 4HG6B 5IFPA 2YB7A 1GNYA 3HNMA 2VZ1A 1UY4A 4RN5A 5FUIA 4CUAA 3GXUA 1EUTA 2QQMA 1CZTA 4QDRA 5IYYA 2WUHA 4JHZA 3THDA 3ACFA 3LPFA 2W1WA 3UESA 1PMJX 4M4RA 3DYMA 3BGAA 2VZPA 1W8OA 5C70A 2CDOA 3A23A 3VD4A 3C7FA 4A4AA 4LPLA 1O8SA 2VCBA 3C7GA 1HN1A 2Y6LA 2J1TA 2B9VA 4XZUG 3WNOA 4BK4A 1GOHA 1JYXA 3OGRA 2WN2A 4UOJA 3T0AA 4QX0A 3VD3A 2VM9A 4QX1A 3HPNA 2XONA 1JYNA 4M4PA 1DP0A 3WNLA 2J1UA 1DLCA 3WNNA 3WSOA 3HN3A 1WKYA 3VDCA 2ID4A 2WO2A 3BN6A 1K3IA 4QX3A 1JZ4A 1PMHX 5LCWL 5HPOA 3IAPA 2J1RA 4A6OA 3K4AA 5DMYA 2WABA 3CIHA 5DPNA 2W5FA 3MV11 4JX0A 5CYYA 2VC9A 1K12A 4E8DA 1JZ5A 3MBWA 1JU4A 3WNKA 5I0DA 1XNTA 3A22A 1KGYA 4ARYA 1EUUA 2E32A 1XC6A 2V72A 3J7HA 2JKXA 2B4KA 2EIEA 4TTGA 2WN3A 2VZUA 1JYWA 4XUOA 2VZQA 3MUZ1 4QAWA 1JZ3A 2J22A 4OYUA 4AAXA 4DXSA 4DXRA 5HXMA 2Y6HA 2KD7A 2XHNA 3FL7A 4BJ0A 3ACHA 3A21A 2ZEYA 3DYPA 5J1XA 2Y6KA 2WBKA 4Z2AA 4OZOA 3IIIA 1NX9A 5JXGA 4ZZ8A 2VR4A 1OF3A 5DN2A 3VDAA 4A44A 5LA1A 3I97A 3WF0A 2VMCA 3FN9A 3W5NA 3GDBA 2W95A 2V5DA 2W3JA 5A1AA 2EIDA 2C4XA 5LA2A 2CDPA 3T0BA 2BBAA 2QQIA 2J1AA 4W8JA 4MADA 1XPWA 1PX3A 2Z4FA 5JXJA 3C8XA 5B4NA 3T2OA 1CIYA 2JDAA 3K77A 3WF1A 3GGLA 2L9LA 3LEKA 3A7QA 1H6YA 3PUIA 3IB3A 4UI9L 3WF2A 1ULPA 2LS6A 2RJ2A 2LW8A 1O59A 1K45A 1GQPA 2VZTA 3WF3A 3ECQA 4KWUA 2WDBA 3CMGA 2W1UA 3CQOA 1W8NA 4KMQA 2VQUA 4XUTA 1PX4A 2WQ8A 1KEXA 1DYOA 2ZEXA 5EJ1B 3UETA 4A3ZA 3FHQA 2DCJA 1JZ8A 2YC4A 1TVGA 2VCAA 2DCKA 4QDSA 5JMOA 1MPXA 2VOTA 5G04L 2VL4A 3MO4A 1RYYA 3MUY1 2VZRA 5IFTA 2DDUA 4JKMA 4P00B 2YG0A 3NJXA 1JI6A 4YPJA 4ZZ5A 4AG4A 1WCQA 2W91A 2Y6JA 3I3EA 2R7EB 1NUKA 3P1IA 3HJRA 3K4DA 2JD9A 2W9XA 1I5PA 1R64A 3SEPA 1GOGA 1UWWA 1UY0A 2VJXA 1UY1A 1CZSA 4IUGA 1IQDC 4DUWA 1W9SA 3VD9A 1CZVA 1OF4A 1P8JA 2EICA 1JZ6A 3C7OA 5IJRA 4JKLA 3EB7A 4BXSV 5C71A 3VDBA 1W0NA 2J7MA 4CUCA 3WNPA 2W92A 2Y6GA 3I2GA 2XQXA 5C7GA 4MGSA 2C9KA 3ACGA 1US2A 2X05A 3HNYM 1L7QA 4JKKA 3SEEA 3LEGA 3NQHA 1UMHA 1JYVA 1D7PM 3NJVA 1UYXA 2VMFA 2PQSA 4MOAA 4W4ZA 5B4XA 4QDQA 1UYYA 2VZVA 1GOFA 3HEIA 4GWJA 4FI9A 1TG7A 3NRUA 3DECA 4A41A 2EIBA 4BK5A 3I2KA 3THCA 4XUQA 2VCCA 4GWIA 2XOMA 3JXSA 2J1VA 3I3BA 3OG2A 3VD7A 3I2HA 3I2FA 4LQRA 3FHAA 1JZ2A 1UZ0A 2W87A 2E31A 2W1QA 2RV9A 3SKJE 4PF1A 4CVUA 3LE0A 2Y8KA 4P5YA 4P08A 5DQ0A 3T2QA 4BDVB 2BZDA 4DEVA 2BERA 3WNMA 2WYSA 2ZEZA 3CZUA 4QB1A 4ZY9A 5EJZB 5IHRA 3HNBM 3T0DA 4TXWA 2BGOA 1US3A 2WAAA 4CU9A 2J1SA 3LPGA 2QQOA 2QBXA 1K42A 3CKHA 3LQCA 2QQKA 3WQBA 2RVAA 2W94A 2C26A 2YFZA 4CU7A 5G05L 3WEZA 1CX1A 3WF4A 4MGQA 2ORXA 3C7EA 4OMDA 2ZXQA 2VO5A 3IAQA 3T08A 2JE8A 3NNGA 3OEBA 4RYDA 1OH4A 1SDDB 2WAOA 3GM8A 5JR2A 4DXTA 3U37A 1W9WA 1YQ2A 1UMIA 1GMMA 2VZOA 3ACIA 3K46A 4L0PA 3CZJA 1UXZA 4XUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A42 A;  2V4V A;  2WO1 A;  2QQN A;  3D3A A;  3LEI A;  5JUV A;  3ETP A;  3CDZ B;  3IDA A;  4DEQ A;  4XVH A;  2OKX A;  4QB6 A;  3I3D A;  4CU6 A;  4QX2 A;  1UYZ A;  2E33 A;  2Y64 A;  2YFU A;  4P02 B;  2QQL A;  3E1F 1;  2WZ8 A;  1UXX X;  1JZ7 A;  4DUV A;  2ZEW A;  4ET7 A;  3PUH A;  3HOB A;  3VD5 A;  3OGV A;  3T09 A;  3UNP A;  3OGS A;  3ABZ A;  3ZM8 A;  3AC0 A;  3I2J A;  2W47 A;  3OEA A;  2VMD A;  4OUE A;  3C7H A;  2VTF A;  4A45 A;  1ULO A;  3MV0 1;  3P6B A;  3OB8 A;  2YC2 A;  2X10 A;  4D8M A;  3I2I A;  4KI5 M;  5F7U A;  3DYO A;  1W9T A;  4XUP A;  2HLE A;  2QQJ A;  4D0Q A;  1SHW B;  3SKV A;  4ARX A;  1F4H A;  4PT6 A;  2WO3 A;  4XUR A;  2VZS A;  4DUX A;  2X09 A;  1W99 A;  4CUB A;  1OD3 A;  2ORZ A;  1T2X A;  2J1E A;  2VZ3 A;  3K75 B;  1UY3 A;  4GZ9 A;  1J83 A;  4OMC A;  1J84 A;  4CU8 A;  1NAE A;  2WZE A;  3OBA A;  2W46 A;  1F4A A;  4LHS A;  1JU3 A;  4QPW A;  3EYP A;  1JHJ A;  1OT5 A;  1SG3 A;  1GU3 A;  1GUI A;  3W5M A;  3F2Z A;  4W50 A;  5EIY B;  1UX7 A;  2W1S A;  2HYX A;  1L7R A;  4MO3 M;  1H6X A;  1BHG A;  1O8P A;  2VQT A;  4UAP A;  4E8C A;  4ZXE A;  5LA0 A;  3T2P A;  5JXH A;  5CZK A;  2E26 A;  1NKG A;  2VME A;  1LNS A;  3K4Z A;  4LKS A;  5JXI A;  4QB2 A;  2BGP A;  1UY2 A;  4PQQ A;  1XNA A;  4HG6 B;  5IFP A;  2YB7 A;  1GNY A;  3HNM A;  2VZ1 A;  1UY4 A;  4RN5 A;  5FUI A;  4CUA A;  3GXU A;  1EUT A;  2QQM A;  1CZT A;  4QDR A;  5IYY A;  2WUH A;  4JHZ A;  3THD A;  3ACF A;  3LPF A;  2W1W A;  3UES A;  1PMJ X;  4M4R A;  3DYM A;  3BGA A;  2VZP A;  1W8O A;  5C70 A;  2CDO A;  3A23 A;  3VD4 A;  3C7F A;  4A4A A;  4LPL A;  1O8S A;  2VCB A;  3C7G A;  1HN1 A;  2Y6L A;  2J1T A;  2B9V A;  4XZU G;  3WNO A;  4BK4 A;  1GOH A;  1JYX A;  3OGR A;  2WN2 A;  4UOJ A;  3T0A A;  4QX0 A;  3VD3 A;  2VM9 A;  4QX1 A;  3HPN A;  2XON A;  1JYN A;  4M4P A;  1DP0 A;  3WNL A;  2J1U A;  1DLC A;  3WNN A;  3WSO A;  3HN3 A;  1WKY A;  3VDC A;  2ID4 A;  2WO2 A;  3BN6 A;  1K3I A;  4QX3 A;  1JZ4 A;  1PMH X;  5LCW L;  5HPO A;  3IAP A;  2J1R A;  4A6O A;  3K4A A;  5DMY A;  2WAB A;  3CIH A;  5DPN A;  2W5F A;  3MV1 1;  4JX0 A;  5CYY A;  2VC9 A;  1K12 A;  4E8D A;  1JZ5 A;  3MBW A;  1JU4 A;  3WNK A;  5I0D A;  1XNT A;  3A22 A;  1KGY A;  4ARY A;  1EUU A;  2E32 A;  1XC6 A;  2V72 A;  3J7H A;  2JKX A;  2B4K A;  2EIE A;  4TTG A;  2WN3 A;  2VZU A;  1JYW A;  4XUO A;  2VZQ A;  3MUZ 1;  4QAW A;  1JZ3 A;  2J22 A;  4OYU A;  4AAX A;  4DXS A;  4DXR A;  5HXM A;  2Y6H A;  2KD7 A;  2XHN A;  3FL7 A;  4BJ0 A;  3ACH A;  3A21 A;  2ZEY A;  3DYP A;  5J1X A;  2Y6K A;  2WBK A;  4Z2A A;  4OZO A;  3III A;  1NX9 A;  5JXG A;  4ZZ8 A;  2VR4 A;  1OF3 A;  5DN2 A;  3VDA A;  4A44 A;  5LA1 A;  3I97 A;  3WF0 A;  2VMC A;  3FN9 A;  3W5N A;  3GDB A;  2W95 A;  2V5D A;  2W3J A;  5A1A A;  2EID A;  2C4X A;  5LA2 A;  2CDP A;  3T0B A;  2BBA A;  2QQI A;  2J1A A;  4W8J A;  4MAD A;  1XPW A;  1PX3 A;  2Z4F A;  5JXJ A;  3C8X A;  5B4N A;  3T2O A;  1CIY A;  2JDA A;  3K77 A;  3WF1 A;  3GGL A;  2L9L A;  3LEK A;  3A7Q A;  1H6Y A;  3PUI A;  3IB3 A;  4UI9 L;  3WF2 A;  1ULP A;  2LS6 A;  2RJ2 A;  2LW8 A;  1O59 A;  1K45 A;  1GQP A;  2VZT A;  3WF3 A;  3ECQ A;  4KWU A;  2WDB A;  3CMG A;  2W1U A;  3CQO A;  1W8N A;  4KMQ A;  2VQU A;  4XUT A;  1PX4 A;  2WQ8 A;  1KEX A;  1DYO A;  2ZEX A;  5EJ1 B;  3UET A;  4A3Z A;  3FHQ A;  2DCJ A;  1JZ8 A;  2YC4 A;  1TVG A;  2VCA A;  2DCK A;  4QDS A;  5JMO A;  1MPX A;  2VOT A;  5G04 L;  2VL4 A;  3MO4 A;  1RYY A;  3MUY 1;  2VZR A;  5IFT A;  2DDU A;  4JKM A;  4P00 B;  2YG0 A;  3NJX A;  1JI6 A;  4YPJ A;  4ZZ5 A;  4AG4 A;  1WCQ A;  2W91 A;  2Y6J A;  3I3E A;  2R7E B;  1NUK A;  3P1I A;  3HJR A;  3K4D A;  2JD9 A;  2W9X A;  1I5P A;  1R64 A;  3SEP A;  1GOG A;  1UWW A;  1UY0 A;  2VJX A;  1UY1 A;  1CZS A;  4IUG A;  1IQD C;  4DUW A;  1W9S A;  3VD9 A;  1CZV A;  1OF4 A;  1P8J A;  2EIC A;  1JZ6 A;  3C7O A;  5IJR A;  4JKL A;  3EB7 A;  4BXS V;  5C71 A;  3VDB A;  1W0N A;  2J7M A;  4CUC A;  3WNP A;  2W92 A;  2Y6G A;  3I2G A;  2XQX A;  5C7G A;  4MGS A;  2C9K A;  3ACG A;  1US2 A;  2X05 A;  3HNY M;  1L7Q A;  4JKK A;  3SEE A;  3LEG A;  3NQH A;  1UMH A;  1JYV A;  1D7P M;  3NJV A;  1UYX A;  2VMF A;  2PQS A;  4MOA A;  4W4Z A;  5B4X A;  4QDQ A;  1UYY A;  2VZV A;  1GOF A;  3HEI A;  4GWJ A;  4FI9 A;  1TG7 A;  3NRU A;  3DEC A;  4A41 A;  2EIB A;  4BK5 A;  3I2K A;  3THC A;  4XUQ A;  2VCC A;  4GWI A;  2XOM A;  3JXS A;  2J1V A;  3I3B A;  3OG2 A;  3VD7 A;  3I2H A;  3I2F A;  4LQR A;  3FHA A;  1JZ2 A;  1UZ0 A;  2W87 A;  2E31 A;  2W1Q A;  2RV9 A;  3SKJ E;  4PF1 A;  4CVU A;  3LE0 A;  2Y8K A;  4P5Y A;  4P08 A;  5DQ0 A;  3T2Q A;  4BDV B;  2BZD A;  4DEV A;  2BER A;  3WNM A;  2WYS A;  2ZEZ A;  3CZU A;  4QB1 A;  4ZY9 A;  5EJZ B;  5IHR A;  3HNB M;  3T0D A;  4TXW A;  2BGO A;  1US3 A;  2WAA A;  4CU9 A;  2J1S A;  3LPG A;  2QQO A;  2QBX A;  1K42 A;  3CKH A;  3LQC A;  2QQK A;  3WQB A;  2RVA A;  2W94 A;  2C26 A;  2YFZ A;  4CU7 A;  5G05 L;  3WEZ A;  1CX1 A;  3WF4 A;  4MGQ A;  2ORX A;  3C7E A;  4OMD A;  2ZXQ A;  2VO5 A;  3IAQ A;  3T08 A;  2JE8 A;  3NNG A;  3OEB A;  4RYD A;  1OH4 A;  1SDD B;  2WAO A;  3GM8 A;  5JR2 A;  4DXT A;  3U37 A;  1W9W A;  1YQ2 A;  1UMI A;  1GMM A;  2VZO A;  3ACI A;  3K46 A;  4L0P A;  3CZJ A;  1UXZ A;  4XUN A; 
#chains in the Genus database with same CATH topology
 5F5C A;  3SMH A;  2V4V A;  2HEW F;  2WO1 A;  4PI2 A;  5FTT C;  3D3A A;  4HZF A;  1VIW B;  3LEI A;  3ETP A;  1OUS A;  4CP9 B;  2JEC A;  2RS1 3;  2XKP A;  5FPV A;  2WL1 A;  3KGL A;  1HIX A;  5EFU A;  5DXD A;  2X5I B;  3AP7 A;  3WP5 A;  3POB A;  1V6L A;  2E33 A;  4M01 A;  1QJE A;  1EPW A;  3S57 A;  2XJP A;  2UUR A;  4AFC A;  3H3Z A;  3CJI C;  5C4W B;  2RDQ A;  2VH9 A;  4BIS A;  4MGT A;  1AR8 3;  2P6H A;  2WZ8 A;  4DY5 A;  1UXX X;  1MS9 A;  3HD8 B;  5L7O B;  1JZ7 A;  4EV0 A;  4DUV A;  5L36 A;  4D94 A;  4ET7 A;  4M3C A;  4AFB A;  3K3O A;  1FAY A;  4FO9 A;  4JRA A;  2GP5 A;  1PM7 A;  4FCA A;  4EN6 B;  3T09 A;  1AL2 3;  3UNP A;  1LEM A;  1S55 A;  3P5B A;  1NCQ A;  1YFY A;  1LHV A;  3KGZ A;  2ZCW A;  3N7M A;  2XGX A;  3URF A;  1PIV 3;  3C7H A;  2D6P A;  3H1M A;  4OUE A;  5FK7 A;  3LA3 A;  2A3W A;  4XET A;  2WII B;  1FNY A;  2I07 B;  2ZGU A;  2ZHK A;  3X29 B;  1YWK A;  3KD4 A;  2FZ1 A;  2GNM A;  4XF3 A;  4FPC A;  2RMU 2;  2DUP A;  2RHP A;  1X9T A;  2QNK A;  2X10 A;  2ZML A;  3VBS B;  4KI5 M;  4XJ8 A;  2GC0 A;  3S5Q A;  3VBO A;  4MH0 E;  5DZE A;  2XWB B;  2WS9 3;  2Q4S A;  4MZU A;  1A8M A;  4XUP A;  2YBK A;  5FP4 A;  5HV0 A;  2UWA A;  5KXC A;  3LIH A;  2QQJ A;  2A6W A;  5FPB A;  3KSC A;  1BK1 A;  1LHU A;  1SHW B;  4XTP A;  1K5M C;  4NIH A;  4NHM A;  3WDX A;  2R0H A;  2QCS B;  2BQP A;  4OUL A;  4X6R B;  3UJQ A;  4QXK A;  1W90 A;  2WO3 A;  4QD2 A;  2W08 A;  4JGY B;  4K8R B;  1W99 A;  2YU1 A;  2CGO A;  2OT7 A;  2C9A A;  1T2X A;  4GZ9 A;  4HBN A;  1NCR B;  4MGY E;  5JLV A;  5KC6 A;  1SQ4 A;  3PUR A;  1MVE A;  5FZ9 A;  4OMC A;  5FOJ B;  1F35 A;  1BMV 1;  3LSE A;  2R06 3;  2CHH A;  3IIA A;  4PDW A;  4L9B A;  2XR4 A;  2W46 A;  1QJY 3;  4HLT A;  2PHF A;  4JDN A;  1JU3 A;  1RUI 3;  4BQ5 A;  3EYP A;  1YIF A;  2KXL A;  4ES8 A;  2VW1 A;  3U10 A;  3HT1 A;  5E6H A;  2XUM A;  2JIG A;  1Z78 A;  3BOP A;  3JD7 1;  4LOS A;  5IVC A;  3WG3 A;  1O3Q A;  1GU3 A;  4EZH A;  4K6B A;  2W52 A;  3NST A;  1H8T A;  1FXZ A;  3FMG A;  1VBE 1;  3WT3 A;  5FDB A;  3J7M A;  1L7R A;  3RSJ A;  4LBN A;  4JQT A;  1O8P A;  1SLC A;  3NWK A;  4E8C A;  1PM4 A;  2Y33 A;  3LWC A;  1UU5 A;  2WT0 A;  3WX5 A;  3WG2 A;  4BXF A;  4B4Q A;  5CZK A;  2E26 A;  4KU7 A;  5A3W A;  3M7A A;  3D4K A;  3B7M A;  1LNS A;  2K9Z A;  3VLB B;  1AR7 2;  4N53 B;  2ZAC A;  2UYB A;  2GU9 A;  4HPK B;  5IUQ A;  3IMN A;  3JCI A;  4CDQ A;  4HMZ A;  5FMB A;  1DZR A;  2YPJ A;  5C8C B;  1G6N A;  1LOE A;  3VDD A;  4XW3 A;  2XWJ B;  4YZ4 A;  1UY4 A;  2VBP A;  2IC1 A;  1A6C A;  3I3Q A;  5IAV A;  5A3P A;  4CUA A;  3GXU A;  4CEY A;  2QQM A;  1GQG A;  1JOB A;  4JHZ A;  3THD A;  2YHJ A;  4D69 A;  1GZT A;  4XBQ A;  4MXW B;  1F2N A;  4QHZ A;  5T3N A;  4CXY A;  3GBW A;  3UES A;  3PVE A;  3MIB A;  3OY8 B;  4OHX A;  1W39 A;  4M4R A;  1BMV 2;  1W9F A;  4EJR A;  1S1A A;  4DXZ A;  4OUM A;  1F5F A;  3H1W A;  2ZJC A;  3JB8 A;  4LR4 A;  1C8M 3;  2LUW A;  5FZE A;  2AAC A;  2CDO A;  2FCT A;  4LPL A;  4AQ6 A;  5H9P A;  3KB5 A;  4IET A;  4Q8K A;  1OOP A;  1HN1 A;  2ETE A;  4C90 A;  2WIN B;  4XZU G;  5F6L B;  4C8D A;  1VBE 2;  4UOJ A;  2WN2 A;  3OPZ A;  4YGD A;  1POV 3;  3LKJ A;  3T0A A;  1YCI A;  1A34 A;  5JPM B;  3VD3 A;  1AR6 3;  4C0B A;  4WZC A;  1H9P A;  2AEN A;  4Y22 B;  4EWA A;  1LHN A;  3MF9 A;  3AFG A;  2EA7 A;  3N9O A;  1OFS A;  3AYD A;  2ZPX A;  4TLG A;  1AR9 3;  2XON A;  4GJZ A;  1W3X A;  2P6C A;  1XJA A;  1CAV A;  2RDS A;  4LJH A;  2PTM A;  4BMB A;  3DKQ A;  4Y20 A;  1VJ2 A;  3VBU C;  3MW3 A;  3WSO A;  4CEW A;  1R08 3;  3RWN A;  4PBP A;  2YC0 A;  3SXW A;  5K0U B;  5FZK A;  2QFE A;  4HET A;  5LRS A;  4OUS A;  3USS A;  2XQR A;  1PMH X;  4LIV A;  4YVW A;  2VNV A;  3M3C A;  3VGI A;  1YC6 1;  4NWW A;  1NG0 A;  1WUV A;  1T6G C;  1XYO A;  1W6Q B;  5IK4 A;  4FFF A;  1ND2 C;  4RQP C;  3IN9 A;  4XF1 A;  5DPN A;  2W5F A;  3I2O A;  5L9V A;  1ONA A;  1RIN A;  2A6Z A;  2E53 A;  1LOD A;  1MAC A;  1N1T A;  1S0C A;  2DVA A;  3Q8B A;  4A3X A;  5CAZ A;  5JOY A;  1HB1 A;  4QPI B;  5A3T A;  2RS5 1;  3WDT A;  4F8A A;  4QPG A;  1HKD A;  5F3G A;  2RR1 1;  3WNK A;  3ZYG A;  5FPA A;  2V4A A;  2WQZ C;  4MVT A;  1EUU A;  2E32 A;  2IVI B;  3M70 A;  2V72 A;  5I8T A;  4IL7 A;  1OVS A;  1YO8 A;  3RI8 A;  2EIE A;  3KF5 A;  5BNO B;  5GZG A;  3WDW A;  2WNV B;  1JYW A;  4RHV 2;  1B35 B;  1YJK A;  4OI4 A;  2VQ0 A;  3U1X A;  1VAL A;  3OTF A;  4YWA A;  2EVX A;  3MUZ 1;  3FLT A;  4UFM A;  4YW3 A;  3TN9 3;  5ABJ C;  1VAK A;  3OSD A;  1KS4 A;  4PLN A;  4XHX A;  3UGG A;  3WDV A;  1H2N A;  3ZO0 B;  2IXL A;  2NYY A;  3M2M A;  2JG8 B;  1OSG A;  2RM2 1;  4YVS C;  3AVR A;  5L9R A;  1UZW A;  1POV 0;  3ZXA C;  2WLQ A;  4N7I A;  3RS6 A;  1JOP A;  1YFW A;  4Y1Z A;  1AXK A;  1E5S A;  2VUL A;  3FBM A;  2ZMK A;  4C1W A;  2WBK A;  1VRH 3;  1PGL 1;  4OZO A;  3PIG A;  3QCW A;  3BYW A;  4IE7 A;  2VR4 A;  4BM8 A;  4URT A;  4ZZ8 A;  4CP2 A;  2X53 S;  3I97 A;  3O0W A;  3R0R A;  3BTZ A;  2DBI A;  1VR3 A;  1ULF A;  4XF9 A;  1UIJ A;  1CWP A;  3FLR A;  2W3J A;  5A1A A;  5F2W A;  2GN7 A;  3LOI A;  1O4T A;  1H4H A;  3T0B A;  2O0O A;  5J09 A;  2QQI A;  1ULD A;  5T50 A;  5FXX A;  4GIQ A;  4NRQ A;  3VUO A;  1RHI 1;  3WHT A;  5J7M A;  2FCU A;  4Q5O A;  1DF0 A;  2D40 A;  3C8X A;  3TEX A;  2R07 1;  2EAK A;  2RS5 2;  2VNG A;  1Y9G A;  5FWE A;  4AI9 A;  3PUS A;  3GZT B;  3UL2 A;  2RR1 2;  2D43 A;  3GGL A;  3A7Q A;  3KV6 A;  4XF4 A;  4CP1 A;  1MEC 3;  4S2D A;  4UI9 L;  1EPZ A;  3WF2 A;  2JEN A;  3JBG 1;  1S0J A;  4RR3 B;  1TMF 1;  1O4Y A;  2DF7 A;  5DAX A;  4UYB A;  1W6O B;  1IOA A;  2ZHN A;  4GMP 1;  1FOD 3;  5LBE A;  2O14 A;  2LW8 A;  3CJI A;  1KXG A;  5FZD A;  3PTY A;  2GC2 A;  3I49 A;  1S2K A;  1QNW A;  1ACC A;  3WF3 A;  3ECQ A;  4Q1R A;  3HQX A;  2FCV A;  1GV9 A;  5DZG A;  3K51 A;  5CKQ A;  1HRI 1;  2W1U A;  1GZC A;  1W8N A;  4WVM B;  5FZ4 A;  2FHR A;  5APA A;  4CE8 A;  1RJ8 A;  3GJB A;  1SCS A;  3M8L A;  4RS5 A;  4UBG A;  5BNN C;  1CQ9 A;  1KEX A;  1PGL 2;  3VHR A;  1YEW A;  2RMU 3;  4ORF A;  1SFN A;  3GHM A;  4QU1 A;  1JZ8 A;  1TVG A;  5FYV A;  2IXK A;  4URA A;  4GAL A;  3ZN4 A;  3PJQ A;  1DYK A;  5A6Q A;  1MS3 A;  2DCK A;  2DVB A;  4QDS A;  4AFM A;  3L9J T;  2OYZ A;  1O3T A;  1WGP A;  4MET A;  1YUD A;  3CF6 E;  3AL6 A;  1IGO A;  4AED B;  1VBD 1;  3U4X A;  2RS1 1;  3MUY 1;  3QLQ A;  2VZR A;  4HVO A;  5FP3 A;  5HBA A;  5IFT A;  2Y6F A;  2ZX1 A;  4L8Q A;  5CFD B;  2YG0 A;  5C33 A;  1PMI A;  3NJX A;  2OXB A;  2WSV A;  3RYR A;  1RHI 2;  5A7S A;  3QH7 A;  1XU1 A;  1AR8 1;  2BFU L;  2R07 2;  1K5M A;  2BYV E;  5GKA C;  2R7E B;  3AXE A;  4P9G A;  4UF0 A;  4EN0 A;  1NUK A;  5E89 A;  1UOJ A;  5GM0 A;  4KWL A;  3HJR A;  2HJI A;  1FPN 1;  2BWC A;  1OUR A;  2ZHL A;  5CIS A;  1DDL A;  1QOT A;  3AJY A;  5M0T A;  4R52 A;  2W9X A;  5T52 A;  1OQD A;  1I5P A;  4E4Z A;  5BNQ A;  1Q5O A;  1TMF 2;  1GOG A;  1PIV 1;  1PGS A;  1UWW A;  4LBK A;  1CZS A;  1ZBA 3;  4IUG A;  4DUW A;  1W9S A;  1YXW A;  4HFS A;  1IPS A;  3VZM A;  1A78 A;  1XSQ A;  1SLI A;  1YQ5 A;  1Q8Q A;  3B01 A;  1HRI 2;  2WS9 1;  3C7O A;  5IJR A;  1OUX A;  4EN8 B;  3NAP B;  4JKL A;  3N9Q A;  4B1L A;  2JDH A;  3NV2 A;  5C71 A;  1MZF A;  4CCE A;  3VDB A;  4BQ1 A;  4I02 A;  3LAG A;  3IPV A;  2GDF A;  5BV6 A;  1AR7 3;  1W6M B;  2Y6G A;  5BNP C;  3I2G A;  1D4M 1;  5C7G A;  2WRA A;  3V0A B;  1ZA4 A;  3SNM A;  2JB4 A;  1ULG A;  4IEV A;  3ACG A;  4NHY A;  5C3Q A;  4I3G A;  3B02 A;  2ZGO A;  3JZV A;  2X05 A;  5IAT A;  1L7Q A;  4JKK A;  4IV1 B;  3Q9O A;  1UZZ A;  1NQD A;  3NQH A;  1VBD 2;  1UMH A;  2RS1 2;  3GBF A;  4XZP A;  2PAM A;  1WCK A;  4RGA A;  2H0B A;  3NJV A;  4IV3 B;  5FFO C;  4AI2 A;  5KWR A;  4EN9 B;  1QJY 1;  3ZXF A;  2ILM A;  2IUW A;  3VKO A;  1PO1 3;  4QKN A;  2BNN A;  1RUI 1;  1AR8 2;  1NCQ C;  1OBN A;  4FI9 A;  4XJW A;  1TG7 A;  3V0B A;  2OUJ A;  1UU6 A;  2JJ6 A;  3DEC A;  3CL1 A;  4YYO A;  3THC A;  4OLL A;  4JGZ C;  2EXI A;  1Q56 A;  2VCC A;  3ZSK A;  4P9Y A;  5A7N A;  1FPN 2;  2EAA A;  3MFA A;  3OG2 A;  4XF0 A;  3U75 A;  1DQ0 A;  3DXT A;  3PLQ A;  1TQ5 A;  4LQR A;  4AQT A;  3FHA A;  2AH2 A;  1PIV 2;  3WCS A;  4Q0U A;  1W2N A;  3BPZ A;  2J42 A;  4CVU A;  3LE0 A;  2QUO A;  2Y8K A;  1PVC 3;  3PVO A;  4LKE A;  4XFH A;  5IVF A;  1WME A;  4LBO A;  1WCU A;  4P08 A;  5AC9 3;  1HQN A;  1SBE A;  4BDV B;  1G9B A;  1OKO A;  1S4C A;  5E16 A;  2WYS A;  3ST7 A;  2ZEZ A;  3CZU A;  4HAN A;  2HBU A;  5EJZ B;  4ZU7 A;  5BUV A;  3GCX A;  2WS9 2;  4YGE A;  3HNB M;  2BUK A;  2LRO A;  3H3L A;  4CA9 A;  5GZD A;  1US3 A;  5FR3 A;  4HSJ A;  4YNI A;  3R6S A;  4L99 A;  1QF3 A;  3GF6 A;  3D5O A;  2D5H A;  3LPG A;  2QQO A;  1RL3 A;  2XB6 C;  2FBE A;  1D4M 2;  3DN7 A;  1QQP 3;  5EWS A;  4N43 C;  3PHM A;  1YFU A;  1E5R A;  4BCU A;  2QQK A;  3O1R A;  3WCR A;  3BU0 A;  2O8Q A;  2RVA A;  4AGV A;  5IW0 A;  1W0P A;  4PLO A;  1OA4 A;  4M0H A;  1L7L A;  4N90 A;  5FYU A;  5K4L A;  1ZRE A;  3VBU A;  5KXD A;  4WM7 B;  3WEZ A;  1CX1 A;  2BFU S;  1QJY 2;  5IK7 A;  3ZFF C;  5FPX A;  5IAX A;  3JU9 A;  3AX4 A;  2E6V A;  4OMD A;  2VO5 A;  5FY9 A;  3TWI A;  2P4E A;  2JE8 A;  3WXP A;  4CDX B;  5JSO A;  4Y5Z 0;  3O12 A;  3OEB A;  4FFH A;  3VBR C;  5F5A A;  1OH4 A;  1SDD B;  5JR2 A;  4N9H A;  4HN1 A;  4ZS2 A;  4RQP A;  1ND2 A;  1S0B A;  4BYY A;  5A6X A;  4LBM A;  4E9K A;  4WM8 B;  4GH4 C;  2WFF 1;  4N8M A;  4XCA A;  3WDY A;  1SLA A;  1LOA A;  4LOT A;  3IDE A;  4DFS A;  2CWM A;  3B3Q E;  2NQY A;  4XAB A;  1TNR A;  3AYA A;  2QQP A;  1HW5 A;  2DFB A;  4RHV 3;  3RMY A;  3TOJ A;  1MZ6 A;  2FDF A;  1OLR A;  4LT5 A;  5C9A C;  4XUN A;  4IEQ A;  5F3E A;  2UYA A;  4BIO A;  5JUV A;  2TBV A;  1CPN A;  1W2A X;  4MLO A;  4QX2 A;  1UYZ A;  5FPL A;  3VBH C;  4BA6 A;  1RUO A;  5ANQ A;  5FZC A;  4RGK A;  1F5J A;  1W05 A;  1MQT B;  1NOV A;  1S0D A;  4K21 A;  4P02 B;  2OX0 A;  1SLT A;  5ABJ A;  2VOW A;  4P9I A;  2BBV A;  5D8A B;  5HXV A;  3HBZ A;  2BU9 A;  2Q1Z B;  3TYJ A;  1LHW A;  3HT2 A;  4YVS A;  1LU1 A;  2VQA A;  3HMY A;  5KR7 A;  1OC1 A;  1G8W A;  2ZEW A;  3NNJ A;  3PUH A;  3HOB A;  4P9W A;  1ZZ6 A;  4FSJ A;  3NV3 A;  1NZI A;  2P2K A;  2P3Y A;  1PK6 C;  4X8P A;  1W3V A;  2YRO A;  4RD7 A;  4KH9 A;  5ERL A;  1ND3 B;  1LGB A;  5FYI A;  2A6X A;  1UZY A;  2P37 A;  1OOP C;  3AC0 A;  1RVF 3;  4LBQ B;  3WR0 A;  4Q4W 3;  5JDB A;  2HH9 A;  4A45 A;  1ULO A;  3GYD A;  3MV0 1;  3IKW A;  3I59 A;  3P6B A;  1J59 A;  2W39 A;  1W2U A;  3ZFE B;  1ZBE 2;  3KS7 A;  4RFT 0;  3VZO A;  3SLI A;  1C1L A;  2JDP A;  3R4D B;  2DCY A;  2XJT A;  1DU3 D;  2BTV C;  2R04 2;  1OLQ A;  2AEZ A;  3SCG A;  5F7U A;  3Q8A A;  2G9Z A;  1TEI A;  3DYO A;  1W9T A;  2RR1 3;  1GZW B;  2WFF 2;  1O5L A;  3SKV A;  4Y1X A;  1C5H A;  1F4H A;  4PT6 A;  1V00 A;  5LY2 A;  1VMH A;  1RUG 3;  1WBF A;  1XNB A;  2ARC A;  4I0B A;  4FP2 A;  5JIA A;  2HYK A;  1Z7S 1;  4R9A A;  4IEO A;  3BTY A;  1OD3 A;  2XLA A;  2J1E A;  1URX A;  2VZ3 A;  3K75 B;  1UY3 A;  1FMD 1;  1LUL A;  4LUL A;  2QQU A;  4YVW C;  4CXX A;  5T5J A;  3T30 A;  1PGW 1;  2VE1 A;  2XG3 A;  2FDI A;  4MGK E;  4R4Z A;  2JX9 A;  2BP6 A;  3K3N A;  1NAE A;  4AHY A;  3DEM A;  5C5T A;  3DGT A;  3ZLI A;  1F4A A;  2ATF A;  4LHS A;  1V6I A;  4QKF A;  1OT5 A;  3ASI A;  3OD4 A;  1H2L A;  3O1U A;  1SG3 A;  2WNU B;  1O91 A;  5FLH A;  3NL1 A;  2VOX A;  3ZN6 A;  3KMH A;  3FUO A;  4YFZ A;  3WQ1 A;  4P9X A;  4CCK A;  5BNN A;  3WIN E;  2BOI A;  5I0S A;  2EIG A;  1UX7 A;  4XAA A;  1WBL A;  2HYX A;  3WQ0 A;  1R1A 2;  1H1A A;  1JTZ X;  1LU2 A;  2R49 A;  1G9C A;  2NM1 A;  4UAP A;  4ZXE A;  4OI2 A;  1ZZB A;  1RHI 3;  1O3S A;  1U5X A;  1MEC 1;  1OQ1 A;  2PHR A;  4BLI A;  5FYC A;  3AMN A;  4LMF A;  1H30 A;  5FWJ A;  4NPL A;  4AEK A;  1WMD A;  5A80 A;  1UN1 A;  5GZF A;  2D6L X;  1FOD 1;  4D7T A;  5J3U A;  1XNA A;  5FZ1 A;  4BPZ A;  1KQR A;  4JTO A;  4AVA A;  3J4U H;  2O8O A;  4UXA A;  3KCY A;  1UCX A;  5J96 B;  2P17 A;  5CG9 A;  3T3Y A;  4RN5 A;  5FUI A;  4XIO A;  2Z79 A;  1TMF 3;  5CBL A;  1VB4 A;  3APB A;  1W6Q A;  1CZT A;  3TB0 A;  4GMP 3;  5FIX A;  5IYY A;  1Z7S 2;  2CY6 A;  2WUH A;  4FVV A;  3TNP B;  3DPR B;  4QX7 A;  2WNE A;  3LPF A;  3T1M A;  3VL8 A;  1PZ7 A;  1AZD A;  1FMD 2;  5F32 A;  4GKY A;  4AVC A;  1PGW 2;  4G9S B;  1FI2 A;  1HRI 3;  4LLF A;  2CGP A;  1D0H A;  1NA1 A;  1Y9Q A;  3BGA A;  4Q4Y 1;  2VZP A;  1WCS A;  2K46 A;  1W8O A;  4CCO A;  5AFB A;  5BNO A;  5C70 A;  1EY2 A;  2QTW B;  5FBJ A;  1CON A;  5CFC B;  4LIU A;  1IS4 A;  4Y4Y A;  2HWE 1;  1SPP B;  5D21 A;  4QX5 A;  3T2T A;  3NV4 A;  4A4A A;  5C3O A;  4FOV A;  2WC2 A;  4BLJ A;  4DOU A;  4YZ5 A;  2P1B A;  1MZ5 A;  2Y6L A;  4HL0 A;  2JG9 C;  2A75 A;  2B9V A;  2WSU A;  3EO6 A;  1VAM A;  4DMI A;  4OI1 A;  4BK4 A;  5LAT A;  1GOH A;  1VBD 3;  4J6G A;  4PQ9 A;  4DPN A;  4DIN B;  3OGR A;  3RMX A;  4NE9 A;  3UGH A;  1JYX A;  1IS5 A;  1G9A A;  5DUW A;  5BNP A;  1AJK A;  1XBF A;  1IS6 A;  5DAQ A;  1TE1 B;  3M3I A;  3MZH A;  3G6J B;  5I8S A;  3A0N A;  1DQ5 A;  4IE0 A;  4QX1 A;  4AI8 A;  1VMJ A;  2FDH A;  1MEC 2;  4XC9 A;  3Q8F A;  1DP0 A;  4XEZ A;  4B4R A;  5FAX A;  3NKG A;  5FYH A;  1NYW A;  4CRQ A;  4HN0 A;  1ASJ 1;  1ZBA 1;  3BPS A;  5GLW A;  1FOD 2;  3TNQ A;  2DU0 A;  3ZX7 A;  1BZW A;  1WKY A;  4Y1Y A;  3TEY A;  4RS5 C;  1FPN 3;  1MS5 A;  4D3W A;  3PJY A;  4AW7 A;  3DKW A;  4A7Z A;  4QX3 A;  5LRR A;  3BN6 A;  1K3I A;  5JZG C;  2OQ6 A;  5F2S A;  1XE8 A;  2OW4 A;  3U14 A;  1U5I A;  3IAP A;  4JGZ A;  4AVB A;  1XB9 A;  5FYB A;  4QXH A;  2WNO A;  2B9U A;  4FFG A;  4LE3 A;  2PYT A;  1W6P B;  1PHM A;  4GMP 0;  1AR7 1;  2ARX A;  3UK9 A;  3AK0 A;  1NQJ A;  2HWB 1;  1WD3 A;  5CYY A;  1GFF 2;  4ISR A;  3ITQ A;  2VC9 A;  4I09 A;  1RED A;  5KHJ A;  4Y1U A;  1N3P A;  3MBW A;  1JU4 A;  1C4R A;  2WYF A;  4Q4Y 2;  2RDN A;  4ZXK A;  4COY A;  4FBF A;  2PHW A;  4CDU C;  3MGU A;  5C3R A;  4CP0 A;  2HWE 2;  4FPK A;  4AGR A;  2JKX A;  1D4M 3;  3B9I A;  3MPB A;  3ZXD A;  3H8R A;  1VAV A;  4TTG A;  3E97 A;  2WN3 A;  2VZU A;  4FPG A;  1PO1 1;  3RPQ A;  5JOX A;  3OYW A;  3ZIW A;  3MLL A;  2VZQ A;  4HVQ A;  1ZA7 A;  2RDR A;  4GWM A;  3ZYP A;  4QAW A;  4Q8L A;  1GP5 A;  1QMJ A;  2WZR 3;  4XTM A;  4LHN A;  5DDJ 1;  2J22 A;  1BBT 1;  4DXS A;  3H9A A;  4AK3 A;  4DXR A;  5C8W A;  1ENQ A;  2Y6H A;  4N43 A;  3AKS A;  3POS A;  1H2M A;  1XND A;  2XHN A;  4IXL A;  4CDW C;  3ACH A;  4YM0 A;  4K1Z A;  3A21 A;  5DAB A;  4JCK A;  1RIR A;  2GH8 A;  1CJD A;  1ASJ 2;  1GZ9 A;  1ZBA 2;  2PN5 A;  4LEJ A;  1LCL A;  1HV0 A;  1PVC 1;  2ZAB A;  1G7Y A;  3ZFF A;  5DAV A;  4B8E A;  4LO7 A;  4A44 A;  1IZ3 A;  5AC9 1;  1ZRC A;  4AI0 A;  3WF0 A;  5A7W A;  3I54 A;  2G9G A;  4BQW A;  3O0V A;  3AMM A;  1DBN A;  1HXS 1;  4ISQ A;  1S2E A;  2C1F A;  1PZ9 A;  2MHF A;  3VBR A;  3W5N A;  2V5D A;  3TRS B;  5FZ3 A;  5JMC A;  2YDE A;  5LA2 A;  2CDP A;  2J1A A;  2XVK A;  1OA3 A;  3ZFG C;  4GH4 A;  2GZW A;  2D3S A;  1QHD A;  3KV5 A;  1QQP 1;  2HWB 2;  3MID A;  5C3P A;  3T2O A;  5JXJ A;  4IE6 A;  2I45 A;  4I3P A;  4EWE A;  5FUN A;  4QX8 A;  4FXG B;  1H8V A;  1HJG A;  1RC6 A;  2A5Z A;  1QGL A;  4HKL A;  1BYH A;  2JDY A;  4B29 A;  1F15 A;  1RUH 1;  2PHT A;  3WF1 A;  5AFE A;  5C9A A;  1HDK A;  5FLJ A;  3RWK X;  1H6Y A;  3VBF B;  5JI7 A;  1SLL A;  3IB3 A;  3KQR A;  1LRH A;  1X8M A;  1JHN A;  3ZYJ B;  1PO1 2;  2PLV 3;  3VBH A;  3V65 A;  4NMI A;  3R4S A;  2RJ2 A;  3SIS A;  4CCL A;  1W2O A;  3B00 A;  1K45 A;  1IKP A;  1YLL A;  5DDJ 2;  2CU5 A;  1BBT 2;  2AC1 A;  2VZT A;  4KWU A;  3CMG A;  4G4F A;  1U5Y A;  2JDK A;  3ILN A;  5FQ0 A;  3CQO A;  1RGS A;  1DQ4 A;  1V6K A;  4I0A A;  4E27 A;  1PK6 A;  2X5I C;  4COZ A;  1ZBE 3;  2Y34 A;  5IVY A;  5EJ1 B;  1PVC 2;  3GAL A;  4RHV 1;  3PUA A;  2R04 3;  3AP9 A;  3L2Y A;  1Y4W A;  5AC9 2;  4AEJ A;  2HWD 3;  5A6Y A;  4MG2 A;  4NWV A;  2WLP A;  1KFU L;  2E9Q A;  4ZU4 A;  4FTS A;  3AKT A;  5L7O C;  2JB8 A;  1GLH A;  2WFF 3;  3M3E A;  5GLU A;  3WD5 A;  1HXS 2;  1E5H A;  2D7F A;  5BXX A;  2ZS6 B;  1GWM A;  3OPT A;  3WY6 A;  1RYY A;  3LA2 A;  5EYX A;  2F6B A;  3E6B A;  1NXD 1;  2DDU A;  4FPJ A;  5LEJ A;  4V2V A;  4P00 B;  4BIF A;  3TEW A;  3WP6 A;  4BQ3 A;  4MHU A;  5FUP A;  1HV1 A;  1CGP A;  1QQP 2;  2KR2 A;  5FZH A;  4O65 A;  5FCC A;  2W91 A;  5E1R A;  3RNS A;  4FXK B;  4BWO A;  4D7Y A;  4QQH A;  4W65 A;  1JXN A;  1NXM A;  4XDO A;  1UF2 C;  4LTA A;  3RZH A;  1ENR A;  1RUH 2;  1LHO A;  4YLZ A;  3P1I A;  3USU A;  2BGC A;  2FMY A;  1CAU B;  3VBS C;  3K4D A;  2ZZJ A;  3FWE A;  3RDI A;  1RVF 1;  5KXB A;  1ULC A;  3ZN5 A;  1X50 A;  4Q4W 1;  4HKO A;  4K9S A;  5IK5 A;  2DCZ A;  3GHN A;  4AWD A;  5A33 B;  4P9L A;  4XFG A;  1T6B X;  1IQD C;  3G7D A;  3OGJ A;  5I0R A;  4I01 A;  4J25 A;  1DIW A;  1Y43 B;  5DG1 A;  2CWS A;  4JGY C;  1UAI A;  4ES9 A;  2WR9 A;  5FY8 A;  1UPS A;  1JZ6 A;  5F37 A;  3E6C C;  1R1A 3;  4XJA A;  2DU1 A;  4H7L A;  3JQW A;  5FLI A;  5FZ6 A;  5LY1 A;  3FBY A;  1NCR C;  3FJS A;  1BJQ A;  3MIE A;  2WZP P;  3UYJ A;  2ZAA A;  4DQA A;  5FZO A;  1U5Z A;  3BCW A;  1LGC A;  1DZQ A;  2J7M A;  4IE4 A;  3WW3 A;  3WNP A;  1RUG 1;  1ZM1 A;  4LKF A;  2AR6 A;  3RQ0 A;  2GMP A;  1KDM A;  1JYT A;  2V5Y A;  2C9K A;  4PJY A;  3M3O A;  1US2 A;  3I2D A;  4R8H A;  4DY3 A;  2G1M A;  1W6N A;  2GMM A;  1D7P M;  3KWV A;  2ZMN A;  4W4Z A;  3AB0 A;  1ZZ8 A;  4COU A;  5KXE A;  4HON A;  2HEV F;  1DGR N;  4YW7 A;  1ULE A;  1UYY A;  4GXL A;  4QWN A;  2YZ4 A;  1Z7S 3;  2E7T A;  4H7M A;  2ARE A;  1CAW B;  1I5Z A;  4Q26 A;  2WT1 A;  1FMD 3;  2CYF A;  4OCT A;  3ZKU A;  3NRU A;  4A41 A;  1VMF A;  5I91 A;  1W0O A;  2XJU A;  2Q8O A;  3ZDS A;  2R16 A;  4Q4V 3;  3ZXJ A;  3MW4 A;  3PDQ A;  3JXS A;  4R9D A;  4N53 C;  1I3H A;  3IDB B;  3J8F 3;  1W06 A;  3AKQ A;  1IG3 A;  1RVF 2;  2XBO 3;  4XCB A;  3LFI A;  1UZ0 A;  2W87 A;  4Q4W 2;  3POW A;  4R4X A;  4AFD A;  5C8C C;  1C28 A;  1OA2 A;  2RV9 A;  4YM2 A;  2GND A;  1VBB 2;  1JH5 A;  3S7E A;  3KHC A;  5DQ0 A;  3ME2 A;  3MIH A;  3ZSJ A;  2D6K A;  1UNB A;  5DUU A;  5K8S A;  2BZD A;  4QGL A;  3KVA A;  3VHP A;  5F1R A;  4XBN A;  4M3C B;  3VKN A;  1DQ6 A;  3VZN A;  5LWB A;  3ZSM A;  4K20 A;  4C1X A;  1WLT A;  2JG9 A;  1Q8S A;  2BGO A;  1NCQ B;  4YFW A;  3AM2 A;  2B7Y A;  4XDQ A;  2J1S A;  4K40 A;  4AI3 A;  1K42 A;  1RUG 2;  3CKH A;  3K48 A;  2XLG A;  3LDB A;  5T5O A;  5IVE A;  3D6E A;  3DF0 A;  5A7O A;  3RVH A;  4FTE A;  2W94 A;  1W8H A;  3VL9 A;  3N9L A;  3VBO B;  1CJP A;  1WLC A;  4A6S A;  3L2H A;  3WF4 A;  4XMI A;  2ZKL A;  4MGQ A;  2UY9 A;  3BKZ A;  1LOG A;  2D93 A;  5F8P A;  1IHM A;  5HCB A;  4E4H A;  1J3R A;  5J36 A;  2ZXQ A;  4Y26 A;  5JZG A;  3KLS A;  1X8E A;  3MDP A;  3NNG A;  3ZXE A;  2ZGL A;  2A71 A;  4RYD A;  2BWA A;  2DUR A;  3FHI B;  3WDU A;  3ROU A;  3WG1 A;  5JCT A;  2XVL A;  5FY7 A;  4Q0P A;  1N1S A;  4DXT A;  1N1V A;  4Q4Y 3;  2Q1F A;  3N9N A;  4UT5 A;  2VW2 A;  1WA6 X;  3EHK A;  4AQS A;  3UKN A;  4PIY A;  4UW5 A;  1BK0 A;  5K0U C;  1DFQ A;  1VBC 1;  2HWE 3;  5A32 A;  2B45 X;  4PDW B;  2VZO A;  4FOQ A;  3ACI A;  1DQ2 A;  3K46 A;  3AKP A;  3CZJ A;  5A3O A;  1CAX A;  2EXH A;  4DS0 A;  5C6C A;  1JYI A;  1EAH 3;  5DUX A;  2VUD A;  4A42 A;  1SEF A;  4CDU A;  4CYD A;  5A3N A;  2QQN A;  4QXB A;  4Q4X 1;  3IDA A;  4I30 A;  4DEQ A;  4HOO A;  4XVH A;  2OKX A;  4QB6 A;  3ZXL A;  1H8T B;  2X29 A;  4HK8 A;  4CU6 A;  3DV8 A;  4AEM A;  3QH6 A;  4QPI C;  2YFU A;  3E1F 1;  4JZR A;  1ODN A;  4LO8 A;  1J58 A;  1ASJ 3;  3GCW A;  3A0K A;  1NA1 C;  3KZ4 C;  4WVZ A;  2DUQ A;  5FYS A;  3KT7 A;  4UBH A;  2XJS A;  4CDW A;  3T1L A;  3VD5 A;  1IPJ A;  1N1Y A;  3BB6 A;  5EP9 A;  3T4H B;  5GLT A;  5BNO C;  2YBS A;  4DB5 A;  1RUD 1;  2PAE A;  3WW2 A;  1QWR A;  4PLM A;  2JWP A;  4QM9 A;  3OGS A;  4FQ4 A;  4ATE A;  1CPM A;  2VW0 A;  2ZZQ A;  4KL1 A;  3ZM8 A;  4CDQ B;  1JMU B;  4ZHN A;  1I1E A;  2ARB A;  4NRO A;  1C5I A;  2VMD A;  3IM0 A;  4KU8 A;  3VDD B;  2ZOE B;  2HWF 2;  3SC7 X;  2BVV A;  4E2G A;  2JG8 C;  1KIT A;  2VXJ A;  3OB8 A;  4AHW A;  4CEY B;  4IEU A;  4NN0 A;  4Y33 A;  2HWB 3;  3ZKY A;  2ZGT A;  4GA9 A;  1VPH A;  2MPF A;  3AP6 A;  4IES A;  4LHK A;  4XJ9 A;  5K9Y A;  2CV6 A;  2H0V A;  2JDN A;  2PHX A;  4JRL A;  2CGN A;  2VGD A;  1RIT A;  2RJL A;  2WZR 1;  3ZFG A;  4P9J A;  4MYE A;  4V1P A;  2HLE A;  1BQP A;  4D0Q A;  3SH4 A;  1VBC 2;  3VKL A;  4ARX A;  1V0A A;  4NID A;  1QOS A;  4NHK A;  1YFX A;  3JQX A;  3FC0 A;  3ZDV A;  5FYM A;  2F17 A;  3ZPY A;  4O61 A;  4DNY A;  2XJQ A;  4S2G A;  1GKB A;  3INA A;  1UX6 A;  4FPE A;  4CUB A;  1I9R A;  2FD8 A;  2ORZ A;  5DDJ 3;  3ZR5 A;  1BBT 3;  4XYX A;  4N9I A;  2JDZ A;  1OOP B;  2XJR A;  4Q4X 2;  5CB7 A;  1M06 G;  1ENX A;  3RJR A;  1W8F A;  1J84 A;  1DLL A;  1CVN A;  2WZE A;  4PF5 A;  4QQL A;  1WLW A;  1TZO A;  1FAT A;  4EZ4 A;  2PHD A;  4DRR A;  5DG2 A;  3F95 A;  3FFQ A;  1JHJ A;  1PNG A;  3PME A;  5FZM A;  3J7N A;  1Q8O A;  5L73 A;  4OHV A;  2H6C A;  1E5I A;  3GNE A;  3RZG A;  1DHK B;  5I0U A;  1GUI A;  1CAV B;  2LRP A;  3N36 A;  4CP9 A;  4RGG A;  1A3K A;  3F2Z A;  4IE5 A;  4RR3 C;  1X7N A;  1LR5 A;  1RUD 2;  4W50 A;  2X5I A;  4Y20 B;  1N47 A;  3B5L B;  1HXS 3;  2W1S A;  4V2W A;  1YNA A;  2FDG A;  2IXC A;  3LEM A;  4JHT A;  4QGN A;  4CEW B;  1KFX L;  5C4W A;  1EP0 A;  4B7K A;  1JN2 P;  2VQT A;  3W20 A;  1OQE A;  3WOG A;  2GME A;  4WVW A;  5LA0 A;  1W8W A;  3T2P A;  5L7O A;  4OHW A;  4YVW B;  1NKG A;  3MYX A;  5AVP A;  5FO7 B;  5FZF A;  5A7Q A;  2PLV 1;  3K4Z A;  4GWN A;  4XFA A;  2OA2 A;  1S0I A;  1OVP A;  1REF A;  2ZGP A;  3GBG A;  4QMA A;  2NP0 A;  1UY2 A;  2RS3 3;  1RUC 3;  1RUH 3;  3OGG A;  3ZSL A;  4HG6 B;  4NPR A;  2WZR 2;  2YB7 A;  3ZPO A;  5IFP A;  3O1P A;  2FZ2 A;  3HNM A;  5JPN B;  1Y9M A;  2VZ1 A;  4YSF A;  2XL9 A;  4Y5T A;  2VUA A;  4QPG B;  4FPY A;  4Q0V A;  2B42 B;  1XE7 A;  4F7Z A;  3AZZ A;  2F4L A;  4AED C;  5CEH A;  4IQP A;  1DGW X;  3LZZ A;  3GJA A;  4KNC A;  4GJY A;  4LA3 A;  3VBS A;  1AJO A;  3ACF A;  1TNF A;  1ZZ9 A;  1ZBE 1;  1C57 A;  4QPY A;  1UO9 A;  3THT A;  5CFD C;  3QAC A;  2VPV A;  2R04 1;  1COV 1;  2HWD 1;  3LF7 A;  4HT1 T;  2ZGR A;  3B93 A;  3LGR A;  4QGM A;  5FZ0 A;  1F31 A;  2DTY A;  3WUD A;  1RTV A;  3PUQ A;  4GB3 1;  2FMD A;  4AE2 A;  3AMP A;  4O9E A;  1POQ A;  3E5Q A;  3WQ7 A;  1MZE A;  3AVS A;  3AZV A;  4JGY A;  1UYP A;  1QNY A;  4AR2 A;  1QJU 3;  4M00 A;  3A23 A;  4J1X A;  3E5U A;  1G86 A;  2Y38 A;  3RRD A;  4LBJ A;  1CN1 A;  1NCR A;  1Y3T A;  2DWR A;  3S6P A;  2DVG A;  4BOW A;  3O1S A;  3W58 A;  4QXC A;  3VV1 A;  3WNO A;  4QM8 A;  1QDO A;  4NIA A;  3H0O A;  5BY5 A;  4QX0 A;  1AX2 A;  2VM9 A;  2Q8C A;  1NE6 A;  4YGC A;  1RUF 2;  3VZK A;  2OS2 A;  3A4U A;  3RYK A;  3B94 A;  4JAA A;  3HPN A;  4YZ2 A;  3IWZ A;  1JYN A;  5FZ8 A;  2QQV A;  1AHS A;  4M4P A;  3NAP C;  3WNL A;  2PLV 2;  1GP4 A;  5JSP A;  2QQW A;  4BQ2 A;  1DLC A;  4FPH A;  3AMH A;  1QJX 1;  2AUY A;  3ATG A;  1RXG A;  2WWU A;  1LAJ A;  2D97 A;  2NZ9 A;  2VVD A;  1DZT A;  1R1A 1;  4E2Q A;  2ID4 A;  4ZPI A;  4LBL A;  4IV1 C;  5HPO A;  3ZIX A;  2J1R A;  4P5H A;  1VBB 3;  4N53 A;  4HPK A;  1TME 1;  2E7Q A;  5A1F A;  3CIH A;  5D1I A;  2CAV A;  4JX0 A;  5FZB A;  1MS0 A;  1COV 2;  2HWD 2;  5C8C A;  5I8Y A;  1NY7 1;  2ZHM A;  2MEV 2;  4MHR A;  4Z82 A;  4GB3 2;  1H0B A;  5FYT A;  5TSW A;  3K2O A;  3CJI B;  5IVV A;  1JZ5 A;  4NJ4 A;  4B4P A;  2Y26 A;  3AZX A;  5I0D A;  1XNT A;  2VTX J;  2QZ3 A;  3WP4 A;  5A3L A;  4IER A;  1WW7 A;  3ZMO A;  1XC6 A;  5EV7 A;  4MXW A;  1AXY A;  3J7H A;  3ZYI B;  1WW4 A;  2D6O X;  3PMS A;  2JKB A;  4MGZ E;  5KBF A;  3OY8 A;  4RS5 B;  3PIJ A;  4ASM B;  2WQ4 A;  2VBD A;  4AVS A;  5GZC A;  4FFI A;  2W0X A;  5F9T A;  3H8U A;  1YI9 A;  3N35 A;  1HLC A;  2B46 X;  4AAX A;  4Q4V 1;  4XIL A;  4MGI E;  4QKB A;  4YAR A;  3TEZ A;  1CIW A;  3FL7 A;  1LGN A;  2AZ5 A;  3J8F 1;  5SV8 A;  2PEL A;  2XBO 1;  3MIF A;  2BNO A;  2ZEY A;  3DYP A;  2Y6K A;  5FV3 A;  3AYE A;  5CNA A;  4Z2A A;  5LBB A;  3III A;  1NX9 A;  4O7X A;  1QXP A;  5DN2 A;  4FPL A;  1DCS A;  5ANN A;  1QJX 2;  4FAH A;  1OXC A;  1HRV 2;  1HX6 A;  1W03 A;  4GUL A;  4IW3 A;  4Y22 A;  1K5M B;  1SDW A;  3FN9 A;  3P3N A;  5H9S A;  5EPA A;  1V6N A;  2XJV A;  4LO4 B;  3ILF A;  4UF0 B;  3D82 A;  4XBL A;  3UT0 A;  3GDB A;  1U12 A;  2W95 A;  5C5U A;  3TBD A;  2EID A;  3MPP G;  2C4X A;  2JDM A;  1XOY A;  1A8D A;  1OLM E;  5KHG A;  2ENR A;  2BBA A;  2B39 A;  1TME 2;  4JVA A;  2XKO A;  4MSV A;  4U2A A;  2R0F A;  5CVR A;  4WM7 C;  4TWT A;  4KWJ A;  4IEY A;  1JOD A;  5K0U A;  4IGP A;  2RG4 A;  5B4N A;  1ST8 A;  4KGG A;  1NY7 2;  1C3H A;  5A6Z A;  3N7J A;  1CIY A;  1GIC A;  4UW3 A;  4CDX C;  5DAP A;  3K77 A;  5IWF A;  1JOJ A;  1OPO A;  4K1Y A;  2L9L A;  2YGM A;  3LEK A;  4UFH A;  3FLP A;  4WBB A;  3VHN A;  2JIC A;  1RUJ 1;  2Z5W A;  3WP3 A;  4KBZ A;  1AF9 A;  4TZD A;  1PZ8 A;  4S2H A;  4WM8 C;  1OKQ A;  1ULP A;  2LS6 A;  4H3W A;  5T54 A;  1WW6 A;  1LED A;  5FO8 B;  4C0H A;  3ES4 A;  4QPI A;  4B1M A;  4XAE A;  3IPV B;  5F5I A;  2D5F A;  3LDK A;  2BJS A;  2VY0 A;  4Q4V 2;  1DGL A;  3AYC A;  4L97 A;  2WDB A;  2B5H A;  3W5M A;  4PIX A;  3RG0 A;  2HWF 3;  1W9Y A;  3J8F 2;  2P3J A;  5J98 B;  2VQU A;  2XBO 2;  2WNV A;  4EN7 B;  1B35 A;  1UKG A;  4XUT A;  1PX4 A;  3VZJ A;  3MIC A;  3BIE A;  1HB3 A;  2V73 A;  2WO7 A;  2ZTN A;  1DYO A;  2ZEX A;  3UET A;  3FFZ A;  3OUH A;  4A3Z A;  1MQT C;  2DCJ A;  4KBB A;  2YC4 A;  4ONU A;  3WG4 A;  1H2K A;  1RUE 2;  2RE9 A;  3P3P A;  1Q8P A;  1EAH 1;  5D8A C;  3GZE A;  2R1B A;  3V0B B;  2JG8 A;  2VOT A;  1XYN A;  1EV1 3;  4YW6 A;  3MO4 A;  1GP6 A;  1VBC 3;  2SBA A;  1XE0 A;  5FBZ A;  5KHK A;  4WZF A;  3NJZ A;  1GWK A;  1DGW A;  1ND3 C;  1DG6 A;  1HB4 A;  4TSV A;  1H1I A;  1JI6 A;  4IGQ A;  4LO5 B;  5FZG A;  1HJF A;  2PMW B;  2ZGN A;  5C3S A;  3ZVX A;  4ZZ5 A;  4AG4 A;  1WCQ A;  2Y0O A;  5IVB A;  4LXL A;  3I3E A;  3R05 A;  4Q4X 3;  1RB8 G;  1JYC A;  1J1L A;  2P34 A;  3CO2 A;  2HWC 1;  3ZFE C;  3MLK A;  1VP6 A;  2F4P A;  2LAL A;  3MF6 A;  3LD8 A;  1RUJ 2;  4S2F A;  2JD9 A;  2IXJ A;  1BEV 2;  3LIG A;  3SCH A;  3SEP A;  1MS4 A;  1W28 A;  1F8V A;  2Q5T A;  1UY1 A;  1W8Z A;  4SLI A;  4K8F A;  2OII A;  3N9P A;  5J48 A;  1RUD 3;  4NHX A;  3VD9 A;  2RJK A;  1QXJ A;  1SLB A;  1CZV A;  2O1Q A;  1W2T A;  3OPW A;  1OF4 A;  4XJZ A;  1N3O A;  1W04 A;  2ZBJ A;  5T5L A;  2UWC A;  4JDO A;  1UD1 A;  4MV2 A;  4RR3 A;  1SCR A;  2ARA A;  3EB7 A;  4XAC A;  4BXS V;  4I2O A;  2VU9 A;  2P3I A;  4XFC A;  1W6O A;  3VBU B;  1AYM 3;  3KQ4 B;  4Z07 A;  3H50 A;  2W92 A;  3O0X A;  4YG3 A;  4L2N A;  2TEP A;  1EAH 2;  1V70 A;  1STM A;  1V9U 1;  1L3J A;  3HNY M;  1KS5 A;  2WNU C;  2JIJ A;  3SEE A;  4YZ1 A;  4WVM A;  1ZZC A;  5E8A A;  5FZ7 A;  3RYP A;  5GJ6 A;  1FYU A;  2VMF A;  3AJZ A;  2KA3 A;  4MOA A;  4COV A;  4RQP B;  1ND2 B;  4W6X A;  4UFI A;  3H7J A;  2VZV A;  3B9C A;  3MW2 A;  3HEI A;  4H55 A;  3QD6 A;  4XPV A;  2DUO A;  2NMN A;  3Q8E A;  3DL3 A;  3IZO A;  3HVD A;  2WA3 A;  4OVE A;  5FRE A;  1R09 3;  2VMI A;  3HBK A;  2C6S A;  2Q8E A;  2EIB A;  1S0F A;  2YV8 A;  4TLF A;  5IK8 A;  4AED A;  2ET1 A;  2HWC 2;  4NR1 A;  4L11 A;  4GWI A;  3O1O A;  1J3Q A;  2XOM A;  3W21 A;  2J1V A;  3WVJ A;  4W6Y A;  3U4S A;  4ZKT B;  5CFD A;  2D6M A;  4NRP A;  3BTX A;  2VMH A;  3I2H A;  2BW8 A;  1LTE A;  1UIK A;  3I2F A;  5EHD A;  4CCD A;  3JUU A;  1QJF A;  1DYP A;  3PTR B;  2XHK A;  4HK9 A;  3ZYF A;  4XE9 A;  4YM1 A;  4AYU A;  4NAO A;  4PF1 A;  2YPD A;  2DVF A;  4XMA A;  5ABJ B;  3OCP A;  1NLR A;  4JC1 A;  4P5Y A;  3I7D A;  5JIU A;  4DEV A;  3CLP A;  4KG0 A;  4YVS B;  4QB1 A;  4YW4 A;  4ZY9 A;  3POY A;  4XQD A;  3DPR C;  2RS3 1;  3H3U A;  1RUC 1;  1SFY A;  4OHY A;  1RUF 3;  1RJ7 A;  1VRB A;  2BV4 A;  3FX3 A;  3NMB A;  3OD0 A;  3T0D A;  3AXD A;  3KV9 A;  3WV6 A;  4Y4R A;  4OI0 A;  4A7K A;  2WAA A;  3DXU A;  3M1H A;  4Q0Q A;  1BVP 1;  2QBX A;  2VOV A;  4KQ7 A;  3M3Q A;  4GQ7 A;  4QHO A;  3LQC A;  5FMO L;  1D4V B;  4YW2 A;  4MX3 A;  2VVE A;  2UU8 A;  3I59 B;  4RA0 A;  5F3I A;  4DO0 A;  4E4D X;  1V9U 2;  5CFC C;  3BIW E;  3S30 A;  4HKW A;  2AYH A;  1NLS A;  2E7A A;  3LFM A;  3RFR A;  2TUN A;  2XPJ A;  1CD3 G;  3NAP A;  2C26 A;  3E5X A;  5FPZ A;  3BUC A;  4CU7 A;  1PNF A;  3LDR A;  3DUI A;  3O5S A;  4ZON A;  4ATF A;  3T4V A;  5FZI A;  1UL9 A;  4XQ4 A;  3S0M A;  1ZNP A;  1W6M A;  1OD5 A;  2PQQ A;  2FQP A;  1BLZ A;  2ZGM A;  1WA4 A;  3V0A A;  1QJU 1;  1BCX A;  1J3P A;  4ASK A;  3AP4 A;  3C7E A;  1IG0 A;  5IVJ A;  3IAQ A;  3T08 A;  1H9W A;  1COV 3;  1JS9 A;  5C4W C;  5A3M A;  2XUE A;  4IV1 A;  1K5J A;  2MEV 3;  4FP3 A;  1LEN A;  4GB3 3;  2WAO A;  1AXZ A;  3MI8 A;  4IV3 A;  3SH3 A;  3U37 A;  3NNL A;  2EXJ A;  4P14 A;  4AAP A;  1F9K A;  3DCQ A;  2ZX4 A;  2R1D A;  2VXR A;  1QH6 A;  4YZ3 A;  1YQ2 A;  1UMI A;  4AFA A;  2WWJ A;  1GMM A;  2C0Z A;  4CCJ A;  4GD4 A;  4BH9 A;  4DRV A;  4L0P A;  4WVV A;  4Q27 A;  4AHX A;  5LK5 A;  2YXS A;  1H1M A;  1UXZ A;  1ZRI A;  3JD7 2;  5EZW A;  4QQP A;  5HCH A;  2DCT A;  2A70 A;  1HQW A;  4LBQ D;  4AVT A;  5FPU A;  5CKN A;  5A3U A;  2I2S A;  1VBA 1;  4NAM A;  2RS3 2;  3CDZ B;  1RUC 2;  2NPI A;  2VD7 A;  3OUI A;  4WV8 A;  5FP7 A;  3ZN6 B;  1ZRD A;  2IWG B;  5FJH A;  1UQX A;  1QOO A;  3I3D A;  5BNN B;  4J1W A;  2Y64 A;  2XXZ A;  5F3C A;  1GBG A;  1M4W A;  2QQL A;  2GN3 A;  1Y7B A;  5FRA A;  1S0E A;  4PIZ A;  1QH7 A;  2EAL A;  3O7O A;  1W8T A;  1KRI A;  1OH3 A;  3KM5 A;  1VBB 1;  1NT0 A;  1REE A;  1QJX 3;  1HRV 3;  4Q1P A;  3BAL A;  3OGV A;  4EQV A;  2PFW A;  3UGF A;  3ES1 A;  3OOX A;  2JDU A;  3ABZ A;  3OJB A;  4EYU A;  3KHB A;  2ZAH A;  2LM3 A;  1HB2 A;  1AYN 1;  2W47 A;  3I2J A;  1D0G A;  3OEA A;  5FYZ A;  5KHH A;  1BXH A;  2OPW A;  4UW4 A;  1SAC A;  5BPX A;  1TME 3;  2VTF A;  1J1T A;  1QJU 2;  4LA2 A;  3O14 A;  4QQ2 A;  3OUJ A;  3R4U A;  1JUH A;  4UW6 A;  2G4I A;  5LEK A;  4JV4 A;  2YC2 A;  3KT1 A;  4JQR A;  4KWK A;  3VKF C;  1RMU 3;  3V56 A;  1OLM A;  3I2I A;  4D8M A;  4AVV A;  2ZX2 A;  5A70 A;  3H8X A;  4BQ4 A;  1D2S A;  1LOF C;  1O7F A;  4WM7 A;  2A3Y A;  3MFC A;  5DAW A;  4CZS A;  3NO8 A;  3ZYR A;  1X9P A;  2WA4 A;  2YBP A;  1AVB A;  5FXW A;  4QT6 A;  1NA1 B;  1QDC A;  2BDR A;  2VOK A;  3C2U A;  3NNM A;  4N7U A;  4R9B A;  4CDX A;  4FT8 A;  2ZX0 A;  4XUR A;  5FZL A;  2VZS A;  2CTV A;  3N7L A;  4DUX A;  2YMZ A;  2XL7 A;  2X09 A;  4QU2 A;  3WW1 A;  5FY0 A;  1VBA 2;  1VLN A;  1KJR A;  5KC5 A;  2CL2 A;  3CU7 A;  5L19 A;  4WM8 A;  1UOF A;  1J83 A;  5CAD A;  4IEX A;  4CU8 A;  3J9S A;  1S0G A;  3OBA A;  4TYS A;  4UWD A;  2A7A A;  4AXO A;  5FMO S;  4AI1 A;  5BNP B;  5IT6 A;  1FV2 A;  2GAL A;  4LUK A;  4QPW A;  4MXV A;  3RJ2 X;  2NLR A;  1I6X A;  1PO2 3;  1AX1 A;  1RUE 3;  2HBT A;  4Y24 A;  3VBF C;  3POF A;  4BE3 A;  4X8N A;  4XIK A;  5LA9 A;  4Y1V A;  1JBC A;  2VAU A;  4CUG A;  5EIY B;  3KV4 A;  1GNH A;  4FPO B;  4Z2W A;  5FXZ A;  4K3U A;  5CU1 A;  1O5U A;  1MQT A;  3BU7 A;  4MO3 M;  1AYN 2;  1H6X A;  2WWS A;  5ACA 3;  1BHG A;  2ZGQ A;  4AHZ A;  5D8A A;  5FY4 A;  2JEM A;  3AZY A;  3RGB A;  2D98 A;  5JXH A;  1YQC A;  1Z0H A;  4FQZ A;  1OHF A;  2Y60 A;  2VME A;  4QQO A;  4JGZ B;  3RZL A;  5SV5 A;  3OF1 A;  3W59 A;  5I93 A;  4LKS A;  4A7Y A;  4QB2 A;  5JXI A;  1ZRF A;  2BGP A;  2ZGK A;  1ND3 A;  1QU0 A;  4PQQ A;  2UWB A;  5F39 A;  4LBQ A;  4XXA A;  1GNY A;  2E51 A;  5A7P A;  4JDM A;  3MLJ A;  1RUJ 3;  1BEV 3;  1GSL A;  4AGG A;  3M4F A;  1MS8 A;  1EUT A;  2QJV A;  2HWF 1;  3ZFE A;  4QDR A;  1UU4 A;  4D6Q A;  2C5D A;  5JWP A;  4TN7 A;  5FO9 B;  3KT4 A;  1XXN A;  5FYY A;  4XFI A;  1GYK A;  4Q0S A;  1ZRR A;  2DTW A;  3ZYH A;  3CBN A;  3B69 A;  1QIQ A;  2BEO A;  2W1W A;  2Z2S B;  4G3Y C;  4RFR B;  1GZW A;  4C91 A;  2GC1 A;  1PMJ X;  4LIT A;  3OYW B;  4XHB A;  4M0N A;  1UMZ A;  3I8T A;  3DYM A;  3PVN A;  1EV1 1;  2JD4 A;  2IVJ A;  2RM2 2;  3CNA A;  3SH5 A;  4XQW A;  4N43 B;  2C24 A;  1S2B A;  5FY1 A;  3VD4 A;  1LKN A;  2QDN A;  3C7F A;  1UOB A;  2FDJ A;  1O8S A;  2VCB A;  3C7G A;  4O9G A;  2Q8D A;  1HN0 A;  4Y5S A;  2H6B A;  1XNC A;  1ZVF A;  1ALY A;  1QY4 A;  4LK7 A;  2J1T A;  5GZE A;  1FNZ A;  3SCF A;  3UJO A;  4CXW A;  4XDP A;  1UOG A;  4B3N A;  3J26 N;  3NNF A;  4NO4 A;  3ZFF B;  2N7G A;  3NW4 A;  4LOR A;  5A7W B;  5EQU A;  2OVU A;  4LNV A;  3THP A;  1Q3E A;  2WNU A;  1N3Q A;  3VBR B;  3PL0 A;  3ZYB A;  2QDR A;  5FMD A;  1LES A;  1X82 A;  2ET7 A;  4GKX A;  5T55 A;  2Q1M A;  1IQA A;  2J1U A;  2VCM A;  4CCN A;  3PU3 A;  4KGQ A;  1W8U A;  2HWC 3;  3KCX A;  3WNN A;  3POJ A;  3OBZ A;  2YGL A;  4OZX A;  5FY5 A;  4CTE A;  3H8O A;  3HN3 A;  4GH4 B;  2WNV C;  3GZA A;  1B35 C;  3VDC A;  1U0A A;  4AZZ A;  1YQ6 A;  1KJL A;  2IXH A;  3UV9 A;  5H9R A;  1QXR A;  5LBC A;  1AL2 1;  4OQ9 A;  3ALQ A;  1YI7 A;  2IFW A;  1OFN A;  2PA7 A;  2WO2 A;  3V64 A;  4F83 A;  5LCW L;  1OI6 A;  1DGR A;  1JZ4 A;  1NLQ A;  2GAU A;  5C9A B;  5J37 A;  1LOB A;  1HQL A;  1EYB A;  2A3X A;  1BKZ A;  2OPK A;  3JBG 2;  3K4A A;  4NII A;  4A6O A;  1SZB A;  2WAB A;  4U36 A;  1AYM 1;  2DBN A;  5DMY A;  3FZ3 A;  3ON7 A;  3MV1 1;  4UFK A;  1MR5 A;  5JSR A;  2ES3 A;  2GH2 A;  4RL7 A;  2E63 A;  3VBH B;  4D6S A;  4Z92 B;  3LCP A;  4E8D A;  1K12 A;  2QVS B;  1XSR A;  1EV1 2;  2G9F A;  1AX0 A;  3A22 A;  1KGY A;  4ARY A;  2GNT A;  3N3H A;  4NOT A;  3LSD A;  3LA7 A;  2Y0I A;  3DPR A;  5FQ0 B;  2EXK A;  2B4K A;  1PK6 B;  4IEZ A;  4OQ8 A;  1YIP A;  1V9U 3;  3POE A;  4XUO A;  4FOY A;  3KF3 A;  1R09 1;  1X36 A;  3CHX A;  4CPB D;  5LZ6 A;  4PCR A;  4GAZ A;  4BU2 A;  2JXA A;  1JZ3 A;  4PHZ A;  3ENR A;  3SIT A;  4OYU A;  1ODM A;  5GAL A;  3MIG A;  3ORJ A;  5A1L A;  4M3C F;  5HXM A;  3WZ1 A;  1C8N A;  2KD7 A;  1O4Z A;  5CFC A;  2Q30 A;  2Z69 A;  3JB4 C;  1UZV A;  1SPP A;  3WHU A;  1UPI A;  4M3C E;  2R06 1;  4BJ0 A;  5JI9 A;  4Q2F A;  1KD7 A;  2ADE A;  4LKD A;  3RI9 A;  1SFP A;  2PXJ A;  4XJU A;  5J1X A;  4COW A;  4D6R A;  2VNO A;  3LOB A;  1JW6 A;  2QKD A;  4R9C A;  5JXG A;  2HEY F;  1OF3 A;  4BME A;  3VDA A;  3EMR A;  1NE4 A;  3ELN A;  5LA1 A;  2DV9 A;  5L9B A;  2EF6 A;  1MS1 A;  2GC3 A;  1IPK A;  1CX4 A;  2A6Y A;  2AGS A;  2VMC A;  2ZX3 A;  3O1V A;  2CAU A;  3HIF A;  1AL2 2;  3HQR A;  4EWD A;  1LOC A;  1RUF 1;  5LB6 A;  1LB2 A;  3USU B;  5F6K A;  3OBR A;  4K7J A;  2VVF A;  5EYY A;  3EQE A;  4DZG A;  3VBO C;  3POI A;  4F3J A;  2LTN A;  3JD7 3;  1AYM 2;  3C3V A;  3VKM A;  2XVG A;  4NRM A;  4W8J A;  2A73 B;  2IZW A;  2VEC A;  1XPW A;  1WZX A;  3IT8 A;  2DVD A;  4MAD A;  1PX3 A;  2XH6 A;  2Z4F A;  1XNK A;  5BYN A;  1G9D A;  1VBE 3;  2OUH A;  4OHZ A;  1GAN A;  2YY1 A;  1C1F A;  1GWL A;  2G19 A;  3PNA A;  3J7L A;  2KM2 A;  3ZOI A;  2XLF A;  2JDA A;  4Z8B A;  3ZSE A;  3CJX A;  1BVV A;  4LE4 A;  2K2S A;  1APN A;  5FXV A;  3PUI A;  3E6D A;  3VN4 A;  4CSW A;  2D3R A;  2GNB A;  2PAK A;  4SBV A;  5CA6 A;  1W6P A;  5FOB B;  4HSL A;  5H9Q A;  5FZA A;  3WNX A;  5JVV A;  5FP9 A;  5FZO B;  2FDK A;  3N4M A;  1LJ7 A;  1R09 2;  2Z42 A;  3AP5 A;  4PDW C;  5GLZ A;  5B2G B;  3AL5 A;  1O59 A;  1OMI A;  1CES A;  2SLI A;  3IMM A;  4HVR A;  1GQP A;  1AUY A;  4B7E A;  2MEV 1;  3NJY A;  4NPM A;  3WW4 A;  3HN1 A;  1FV3 A;  1YYN A;  4FPF A;  3I4I A;  4LO6 B;  1AL0 G;  1X33 A;  1W6N B;  3NKT A;  5FMC A;  4CCM A;  3BVC A;  1YHF A;  2R06 2;  4KMQ A;  4E2S A;  2W68 A;  2IFR A;  3U0Z A;  3EJK A;  1H8T C;  4Z1V A;  3EXU A;  5LW9 A;  2WQ8 A;  1C8M 1;  1RUI 2;  1Q8V A;  5ISL A;  4YM3 A;  2JE7 A;  3FHQ A;  4ZS3 A;  4Y3O A;  4UFL A;  4XFB A;  1IKQ A;  2VCA A;  5EXO A;  1ZX5 A;  3W9A A;  3HQU A;  5JMO A;  3ZR6 A;  1MPX A;  3ILR A;  4PBO A;  4BB3 A;  4DIQ A;  5G04 L;  2YUE A;  2VL4 A;  2ZKN A;  4L92 A;  1UKR A;  1FT9 A;  2WKK A;  2OZ6 A;  1POV 1;  4RSU A;  3AFK A;  1WD4 A;  4AF9 A;  1AR6 1;  3OBT A;  3H42 B;  4JKM A;  3S5A A;  3WUC A;  1LOF A;  4CDQ C;  5JOW A;  4ITC A;  2YYO A;  3ETQ A;  1O6U A;  4YPJ A;  1AR9 1;  3NV1 A;  4HXC A;  3BOD A;  3ZXK A;  1YJL A;  3VDD C;  1VBA 3;  4UFJ A;  1D2Q A;  2Y6J A;  1SMV A;  1HRV 1;  4YG0 A;  4CEY C;  2OZJ A;  3VHO A;  2WT2 A;  5LAS A;  3I3M A;  3GZU C;  1R08 1;  3S7I A;  5LBF A;  4CPB A;  3QBQ A;  1YQ8 A;  5T5P A;  2OQ7 A;  3N9M A;  4H2A A;  5DUV A;  5CIR A;  3H1Y A;  4NVP A;  1R64 A;  2JG9 B;  4AL9 A;  1UY0 A;  2AEY A;  2VJX A;  4IV3 C;  4FOW A;  4XOG A;  3PVB B;  1RUN A;  2ADD A;  3HR9 A;  1KDK A;  2BVB A;  1YRZ A;  2D44 A;  3U78 A;  1NZC A;  2VMG A;  2VUJ A;  5HCA A;  1OPM A;  1XU2 A;  1Q43 A;  1RMU 1;  3RZM A;  1P8J A;  4PI0 A;  2EIC A;  1AYN 3;  5FK8 A;  3VBF A;  3H7Y A;  4LHL A;  4JTN A;  1PVX A;  4BZ4 A;  5FKB A;  1V6J A;  5DZF A;  4NIG A;  5AVA A;  1C8M 2;  4LK6 A;  1W0N A;  4QKD A;  2VUC A;  4CUC A;  5F5Q A;  1XQN A;  3N7K A;  1VE0 A;  2XQX A;  2D6N A;  2YU2 A;  4YW5 A;  4MGS A;  4AOC A;  2GSY A;  2WJS A;  2RS5 3;  5LK7 B;  3SQO A;  5HV4 A;  2XML A;  2ZA9 A;  4KG8 A;  4D7S A;  5JZG B;  1QEX A;  4I0W B;  4FAG A;  2VTX A;  3LEG A;  1GQH A;  1QJZ A;  3TN9 1;  4BHP A;  1JYV A;  2D3P A;  5CKM A;  4ASL A;  1UYX A;  5EJ3 A;  2PQS A;  1MVQ A;  5B4X A;  1AR6 2;  2XDV A;  1R1Z A;  2GP3 A;  4QDQ A;  2R32 A;  4YG6 A;  4ERO A;  1GOF A;  1RXF A;  4CEW C;  3ZXG A;  3WLU A;  2CNA A;  3FUQ A;  1AR9 2;  3PU8 A;  3CEW A;  2BPA 2;  5A32 B;  3KVB A;  4GWJ A;  2I74 A;  3BTA A;  1CR7 A;  4H14 A;  1PO2 1;  1RUE 1;  1VRH 1;  1CAX B;  3I2K A;  4BK5 A;  3O1T A;  4YRD A;  2ERF A;  4XUQ A;  5JR7 B;  1B09 A;  1ZZ7 A;  2BRT A;  1R08 2;  4MUV A;  4YGB A;  4CDU B;  2TNF A;  3IDC B;  4NUB A;  2RM2 3;  1FX5 A;  2BOJ A;  3AKR A;  3I3B A;  4LLO A;  1WWY A;  2DFC A;  3HAG A;  4Q29 A;  5FP8 A;  3VD7 A;  1WLD A;  3AZW A;  1GR3 A;  3BI3 A;  4X6Q B;  5ACA 1;  1JZ2 A;  1GNZ A;  2R6Q A;  2QE3 A;  5K7P A;  2E31 A;  2V09 A;  2W1Q A;  4EE2 A;  2JE9 A;  3SKJ E;  4QPG C;  5I0T A;  3AMQ A;  2NN8 A;  2PHL A;  3T2Q A;  3ACL A;  3EBR A;  3BOW A;  3D0S A;  1RMU 2;  2A6V A;  2BER A;  1ENS A;  3U07 A;  3WNM A;  3HWJ A;  1CAU A;  4AQ2 A;  1O3R A;  4FTB A;  4CDW B;  1DQ1 A;  3QOP A;  1IS3 A;  1QKQ A;  1LEC A;  5IHR A;  4TXW A;  1WW5 A;  5E88 A;  3RZJ A;  4NHL A;  4XFF A;  5A33 A;  2MNG A;  3KCC A;  1BEV 1;  3UKV A;  4CU9 A;  1H4G A;  5HI0 A;  5D2A A;  3IBM A;  1UW8 A;  2P3K A;  3ZMN A;  5CG8 A;  2VBB A;  3LB9 A;  3Q8C A;  2R07 3;  4QHB A;  4XXP A;  3WQB A;  1WMX A;  1V6M A;  2PHU A;  4IND A;  2CSG A;  3NVC A;  4IDZ A;  4BQY A;  5JAX A;  3TN9 2;  5JOZ A;  2YFZ A;  2ZGS A;  4IEP A;  3D8C A;  1V6O A;  1WMF A;  3UKT A;  4ZU5 A;  5G05 L;  4BQX A;  3ZFG B;  1XYP A;  3JBG 3;  2HKX A;  1WCD J;  3VZL A;  2UY8 A;  5HCF A;  5GLV A;  1SBF A;  2IXI A;  2ORX A;  2P5B A;  4LUM A;  3VB9 A;  3MHZ A;  2A1X A;  4IEW A;  5FJK A;  3FE5 A;  1XRU A;  3TAY A;  4A2U A;  1PO2 2;  1VRH 2;  1JUI A;  2B8M A;  2RMU 1;  2BNM A;  1SBD A;  2Q0A A;  2VNR A;  4CCC A;  4W6W A;  2NMO A;  4IGO A;  3GM8 A;  5KHI A;  1VB2 A;  1ZYB A;  5FKC A;  3POG A;  2VG9 A;  2K0G A;  2WFP A;  1E57 A;  3O1M A;  2X8K A;  1W9W A;  3SHR A;  4YW1 A;  4OFG A;  3D0J A;  2DYC A;  5ACA 2;  2W2I A;  1CAW A;  2QZ2 A;  1G9F A;  3U11 A;  2R30 A;  3RZZ A;  4E4S A;  3RZK A;  3MEP A; 
#chains in the Genus database with same CATH homology
 4A42 A;  2V4V A;  2WO1 A;  2QQN A;  3D3A A;  3LEI A;  5JUV A;  3ETP A;  3CDZ B;  3IDA A;  4DEQ A;  4XVH A;  2OKX A;  4QB6 A;  3I3D A;  4CU6 A;  4QX2 A;  1UYZ A;  2E33 A;  2Y64 A;  2YFU A;  4P02 B;  2QQL A;  3E1F 1;  2WZ8 A;  1UXX X;  1JZ7 A;  4DUV A;  2ZEW A;  4ET7 A;  3PUH A;  3HOB A;  3VD5 A;  3OGV A;  3T09 A;  3UNP A;  3OGS A;  3ABZ A;  3ZM8 A;  3AC0 A;  3I2J A;  2W47 A;  3OEA A;  2VMD A;  4OUE A;  3C7H A;  2VTF A;  4A45 A;  1ULO A;  3MV0 1;  3P6B A;  3OB8 A;  2YC2 A;  2X10 A;  4D8M A;  3I2I A;  4KI5 M;  5F7U A;  3DYO A;  1W9T A;  4XUP A;  2HLE A;  2QQJ A;  4D0Q A;  1SHW B;  3SKV A;  4ARX A;  1F4H A;  4PT6 A;  2WO3 A;  4XUR A;  2VZS A;  4DUX A;  2X09 A;  1W99 A;  4CUB A;  1OD3 A;  2ORZ A;  1T2X A;  2J1E A;  2VZ3 A;  3K75 B;  1UY3 A;  4GZ9 A;  1J83 A;  4OMC A;  1J84 A;  4CU8 A;  1NAE A;  2WZE A;  3OBA A;  2W46 A;  1F4A A;  4LHS A;  1JU3 A;  4QPW A;  3EYP A;  1JHJ A;  1OT5 A;  1SG3 A;  1GU3 A;  1GUI A;  3W5M A;  3F2Z A;  4W50 A;  5EIY B;  1UX7 A;  2W1S A;  2HYX A;  1L7R A;  4MO3 M;  1H6X A;  1BHG A;  1O8P A;  2VQT A;  4UAP A;  4E8C A;  4ZXE A;  5LA0 A;  3T2P A;  5JXH A;  5CZK A;  2E26 A;  1NKG A;  2VME A;  1LNS A;  3K4Z A;  4LKS A;  5JXI A;  4QB2 A;  2BGP A;  1UY2 A;  4PQQ A;  1XNA A;  4HG6 B;  5IFP A;  2YB7 A;  1GNY A;  3HNM A;  2VZ1 A;  1UY4 A;  4RN5 A;  5FUI A;  4CUA A;  3GXU A;  1EUT A;  2QQM A;  1CZT A;  4QDR A;  5IYY A;  2WUH A;  4JHZ A;  3THD A;  3ACF A;  3LPF A;  2W1W A;  3UES A;  1PMJ X;  4M4R A;  3DYM A;  3BGA A;  2VZP A;  1W8O A;  5C70 A;  2CDO A;  3A23 A;  3VD4 A;  3C7F A;  4A4A A;  4LPL A;  1O8S A;  2VCB A;  3C7G A;  1HN1 A;  2Y6L A;  2J1T A;  2B9V A;  4XZU G;  3WNO A;  4BK4 A;  1GOH A;  1JYX A;  3OGR A;  2WN2 A;  4UOJ A;  3T0A A;  4QX0 A;  3VD3 A;  2VM9 A;  4QX1 A;  3HPN A;  2XON A;  1JYN A;  4M4P A;  1DP0 A;  3WNL A;  2J1U A;  1DLC A;  3WNN A;  3WSO A;  3HN3 A;  1WKY A;  3VDC A;  2ID4 A;  2WO2 A;  3BN6 A;  1K3I A;  4QX3 A;  1JZ4 A;  1PMH X;  5LCW L;  5HPO A;  3IAP A;  2J1R A;  4A6O A;  3K4A A;  5DMY A;  2WAB A;  3CIH A;  5DPN A;  2W5F A;  3MV1 1;  4JX0 A;  5CYY A;  2VC9 A;  1K12 A;  4E8D A;  1JZ5 A;  3MBW A;  1JU4 A;  3WNK A;  5I0D A;  1XNT A;  3A22 A;  1KGY A;  4ARY A;  1EUU A;  2E32 A;  1XC6 A;  2V72 A;  3J7H A;  2JKX A;  2B4K A;  2EIE A;  4TTG A;  2WN3 A;  2VZU A;  1JYW A;  4XUO A;  2VZQ A;  3MUZ 1;  4QAW A;  1JZ3 A;  2J22 A;  4OYU A;  4AAX A;  4DXS A;  4DXR A;  5HXM A;  2Y6H A;  2KD7 A;  2XHN A;  3FL7 A;  4BJ0 A;  3ACH A;  3A21 A;  2ZEY A;  3DYP A;  5J1X A;  2Y6K A;  2WBK A;  4Z2A A;  4OZO A;  3III A;  1NX9 A;  5JXG A;  4ZZ8 A;  2VR4 A;  1OF3 A;  5DN2 A;  3VDA A;  4A44 A;  5LA1 A;  3I97 A;  3WF0 A;  2VMC A;  3FN9 A;  3W5N A;  3GDB A;  2W95 A;  2V5D A;  2W3J A;  5A1A A;  2EID A;  2C4X A;  5LA2 A;  2CDP A;  3T0B A;  2BBA A;  2QQI A;  2J1A A;  4W8J A;  4MAD A;  1XPW A;  1PX3 A;  2Z4F A;  5JXJ A;  3C8X A;  5B4N A;  3T2O A;  1CIY A;  2JDA A;  3K77 A;  3WF1 A;  3GGL A;  2L9L A;  3LEK A;  3A7Q A;  1H6Y A;  3PUI A;  3IB3 A;  4UI9 L;  3WF2 A;  1ULP A;  2LS6 A;  2RJ2 A;  2LW8 A;  1O59 A;  1K45 A;  1GQP A;  2VZT A;  3WF3 A;  3ECQ A;  4KWU A;  2WDB A;  3CMG A;  2W1U A;  3CQO A;  1W8N A;  4KMQ A;  2VQU A;  4XUT A;  1PX4 A;  2WQ8 A;  1KEX A;  1DYO A;  2ZEX A;  5EJ1 B;  3UET A;  4A3Z A;  3FHQ A;  2DCJ A;  1JZ8 A;  2YC4 A;  1TVG A;  2VCA A;  2DCK A;  4QDS A;  5JMO A;  1MPX A;  2VOT A;  5G04 L;  2VL4 A;  3MO4 A;  1RYY A;  3MUY 1;  2VZR A;  5IFT A;  2DDU A;  4JKM A;  4P00 B;  2YG0 A;  3NJX A;  1JI6 A;  4YPJ A;  4ZZ5 A;  4AG4 A;  1WCQ A;  2W91 A;  2Y6J A;  3I3E A;  2R7E B;  1NUK A;  3P1I A;  3HJR A;  3K4D A;  2JD9 A;  2W9X A;  1I5P A;  1R64 A;  3SEP A;  1GOG A;  1UWW A;  1UY0 A;  2VJX A;  1UY1 A;  1CZS A;  4IUG A;  1IQD C;  4DUW A;  1W9S A;  3VD9 A;  1CZV A;  1OF4 A;  1P8J A;  2EIC A;  1JZ6 A;  3C7O A;  5IJR A;  4JKL A;  3EB7 A;  4BXS V;  5C71 A;  3VDB A;  1W0N A;  2J7M A;  4CUC A;  3WNP A;  2W92 A;  2Y6G A;  3I2G A;  2XQX A;  5C7G A;  4MGS A;  2C9K A;  3ACG A;  1US2 A;  2X05 A;  3HNY M;  1L7Q A;  4JKK A;  3SEE A;  3LEG A;  3NQH A;  1UMH A;  1JYV A;  1D7P M;  3NJV A;  1UYX A;  2VMF A;  2PQS A;  4MOA A;  4W4Z A;  5B4X A;  4QDQ A;  1UYY A;  2VZV A;  1GOF A;  3HEI A;  4GWJ A;  4FI9 A;  1TG7 A;  3NRU A;  3DEC A;  4A41 A;  2EIB A;  4BK5 A;  3I2K A;  3THC A;  4XUQ A;  2VCC A;  4GWI A;  2XOM A;  3JXS A;  2J1V A;  3I3B A;  3OG2 A;  3VD7 A;  3I2H A;  3I2F A;  4LQR A;  3FHA A;  1JZ2 A;  1UZ0 A;  2W87 A;  2E31 A;  2W1Q A;  2RV9 A;  3SKJ E;  4PF1 A;  4CVU A;  3LE0 A;  2Y8K A;  4P5Y A;  4P08 A;  5DQ0 A;  3T2Q A;  4BDV B;  2BZD A;  4DEV A;  2BER A;  3WNM A;  2WYS A;  2ZEZ A;  3CZU A;  4QB1 A;  4ZY9 A;  5EJZ B;  5IHR A;  3HNB M;  3T0D A;  4TXW A;  2BGO A;  1US3 A;  2WAA A;  4CU9 A;  2J1S A;  3LPG A;  2QQO A;  2QBX A;  1K42 A;  3CKH A;  3LQC A;  2QQK A;  3WQB A;  2RVA A;  2W94 A;  2C26 A;  2YFZ A;  4CU7 A;  5G05 L;  3WEZ A;  1CX1 A;  3WF4 A;  4MGQ A;  2ORX A;  3C7E A;  4OMD A;  2ZXQ A;  2VO5 A;  3IAQ A;  3T08 A;  2JE8 A;  3NNG A;  3OEB A;  4RYD A;  1OH4 A;  1SDD B;  2WAO A;  3GM8 A;  5JR2 A;  4DXT A;  3U37 A;  1W9W A;  1YQ2 A;  1UMI A;  1GMM A;  2VZO A;  3ACI A;  3K46 A;  4L0P A;  3CZJ A;  1UXZ A;  4XUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...