4MO3M

Crystal structure of porcine c2 domain of blood coagulation factor viii
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
156
structure length
156
Chain Sequence
b'SCSMPLGMQNKAISDSQITASSHLSNIFATWSPSQARLHLQGRTNAWRPRVSSAEEWLQVDLQKTVKVTGITTQGVKSLLSSMYVKEFLVSSSQDGRRWTLFLQDGHTKVFQGNQDSSTPVVNALDPPLFTRYLRIHPTSWAQHIALRLEVLGCEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Coagulation factor VIII
publication title Crystal Structure of Porcine C2 Domain of Blood Coagulation Factor VIII (FoldIt Target)
rcsb
source organism Sus scrofa
molecule tags Blood clotting
total genus 35
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4mo3M00
2VQUA 4QDRA 5EJZB 5JMOA 3WF1A 1UY1A 4FI9A 3C7FA 2VCBA 3OGSA 1JZ4A 4P02B 1GMMA 1SHWB 1UXZA 4L0PA 3MO4A 4XUQA 5JXHA 1TG7A 2Y6LA 3T0DA 2KD7A 3A7QA 3AC0A 3NJXA 2ID4A 3WNPA 4CU7A 3LQCA 2PQSA 2X05A 3MV01 4DXTA 2ZEZA 5HXMA 2WDBA 1UYZA 4QB6A 4QAWA 4A45A 2J1VA 1W0NA 5C70A 3SEPA 2J1UA 2VJXA 4JKKA 4AAXA 4LQRA 2W91A 5IFPA 3VDBA 4OMDA 2V4VA 4UAPA 1H6XA 3EB7A 4ARYA 1NX9A 3FHQA 4ZXEA 2VZPA 2J1TA 4XUTA 1UWWA 3ACHA 1UYXA 1T2XA 4A41A 2W3JA 1OH4A 1UX7A 1GUIA 1K12A 2W46A 3T0BA 1UYYA 5JXGA 1L7RA 4QPWA 5J1XA 2ORXA 1L7QA 5G04L 1UMIA 3SEEA 3IAPA 5IHRA 2B9VA 3K4DA 5IJRA 2WBKA 4W50A 3BN6A 1J84A 3I3EA 1I5PA 2CDPA 2VMCA 4QX2A 4CUBA 2RVAA 3NJVA 4OUEA 4DUXA 4XUNA 3LEGA 3NRUA 4MGQA 4ZY9A 1GU3A 3WF2A 2QBXA 1NAEA 2BGPA 1CIYA 3OBAA 5DMYA 4UI9L 4M4RA 4QDSA 3HOBA 2W47A 4P08A 1DP0A 2X09A 2WYSA 5HPOA 1DLCA 1KGYA 4KI5M 3I2JA 3CIHA 2VQTA 3DYOA 4DEQA 2E33A 2R7EB 2YB7A 3K4ZA 4BXSV 4LPLA 2VZVA 1H6YA 3THCA 4CUCA 4BK5A 4P5YA 3ACIA 3D3AA 2ZEXA 3I2GA 4A42A 1UY0A 2VZOA 4QX3A 1R64A 2QQNA 1GOFA 3I3BA 1JZ3A 4A4AA 2W9XA 2EIBA 3CMGA 2DCKA 5JUVA 2VCAA 3WF3A 1BHGA 1W8NA 2XHNA 1K3IA 1YQ2A 3ACGA 4P00B 2J1SA 2ZEYA 4QB2A 4MGSA 3HNYM 2WO3A 1JU3A 5DPNA 2V72A 3GDBA 2DDUA 2VZ1A 4XURA 2VZRA 2RV9A 3WNNA 1TVGA 3K46A 1JYXA 3T2QA 4QB1A 3C7EA 4JKLA 2XONA 3GXUA 2Y6HA 1XNTA 2QQMA 1HN1A 2BERA 5B4XA 4QX0A 3IIIA 5LA0A 3W5MA 2ZXQA 4TTGA 1O8PA 4DUVA 3FL7A 1JYWA 4ZZ8A 3VD5A 3C7OA 4XUOA 2VMFA 3SKVA 4IUGA 1US2A 4W8JA 3WSOA 3FN9A 1EUTA 2ORZA 2EIEA 2W87A 2VM9A 3IDAA 3OEBA 4CU9A 2VZTA 3HNMA 1JYNA 2WN3A 3J7HA 4JKMA 4CVUA 2HYXA 4PT6A 3UETA 3WF4A 4ARXA 4JX0A 5G05L 2XQXA 4UOJA 3I2HA 3VDAA 5JXIA 3WQBA 1JI6A 5DN2A 3LEIA 5FUIA 1SG3A 2JE8A 4RYDA 1OT5A 5JXJA 2L9LA 2LS6A 1ULOA 1OF3A 2JKXA 3CZJA 1PMHX 3NNGA 1CZSA 3UNPA 1P8JA 2Y6GA 2VL4A 3IAQA 3JXSA 2VO5A 4A44A 3CZUA 2J1RA 3I2IA 5IFTA 5F7UA 2YC2A 3OG2A 1W8OA 4RN5A 4Z2AA 3U37A 2EIDA 4LHSA 2XOMA 2VMDA 2LW8A 2CDOA 3K77A 1DYOA 3W5NA 2YFUA 3MV11 1JYVA 2ZEWA 2VOTA 3WNKA 2W5FA 1O59A 3I2FA 3MBWA 3GM8A 2YC4A 3T0AA 3VD9A 3WNLA 1CZTA 1GOGA 1PMJX 1K42A 5DQ0A 1SDDB 2WO1A 4LKSA 4ET7A 3VDCA 1CZVA 3T2OA 3ETPA 3THDA 2J1EA 3ACFA 4BDVB 1K45A 2B4KA 4JHZA 1JZ7A 2YFZA 1JU4A 3BGAA 3VD7A 2W95A 4KWUA 2J22A 4D8MA 1UY2A 4DUWA 2E32A 1F4AA 3T09A 4QDQA 3NQHA 2JD9A 2J1AA 3A21A 1J83A 3C7GA 5LCWL 1CX1A 3MUY1 2WAAA 3HEIA 2JDAA 3LE0A 4HG6B 4XUPA 4CU8A 3A22A 3PUIA 1O8SA 3I2KA 2WABA 1JZ6A 4GZ9A 5IYYA 4ZZ5A 1F4HA 2BBAA 1KEXA 1LNSA 2VTFA 2E31A 3LEKA 4PQQA 2VZSA 1OD3A 3PUHA 2C26A 1MPXA 2W1WA 1GQPA 4A3ZA 1EUUA 2V5DA 2QQJA 2VZ3A 2WZ8A 4TXWA 2DCJA 3K75B 1WCQA 4DXRA 4MO3M 2WN2A 1PX3A 2VMEA 1W9WA 3T2PA 2C9KA 4XVHA 2W1SA 4D0QA 3LPGA 3HPNA 4OZOA 1XPWA 1JHJA 1OF4A 2WZEA 2OKXA 3OB8A 1UY4A 4W4ZA 4XZUG 5JR2A 2W92A 2E26A 4MOAA 1W99A 4AG4A 4E8CA 1PX4A 1GOHA 3C8XA 2QQIA 3LPFA 4M4PA 3E1F1 3CKHA 2W94A 3DECA 3FHAA 5LA2A 2WAOA 3OGVA 2W1QA 2C4XA 3ABZA 2QQKA 2Y6JA 1UY3A 3GGLA 2X10A 4GWIA 3EYPA 2Y6KA 4YPJA 5B4NA 1GNYA 3WEZA 2J7MA 2HLEA 3F2ZA 3IB3A 1UMHA 4E8DA 3K4AA 2VR4A 3I3DA 2VCCA 2EICA 5I0DA 1US3A 5C7GA 1JZ8A 3I97A 2Z4FA 3WNMA 2YG0A 5EIYB 3CDZB 1XC6A 5C71A 5EJ1B 3VD3A 1JZ2A 1ULPA 3WF0A 3C7HA 1UZ0A 2WQ8A 3HJRA 2QQLA 3VD4A 2Y64A 4BK4A 3SKJE 2WO2A 2VZQA 3HN3A 3P1IA 4KMQA 5LA1A 1UXXX 2W1UA 5A1AA 3A23A 1RYYA 4A6OA 2VC9A 5CYYA 1IQDC 3OGRA 1JZ5A 1W9TA 1NKGA 3ECQA 1W9SA 3T08A 2BZDA 1NUKA 2QQOA 3HNBM 3MUZ1 4CUAA 2BGOA 3OEAA 4DEVA 1WKYA 2WUHA 3ZM8A 1D7PM 2RJ2A 4OMCA 5CZKA 3UESA 4DXSA 3P6BA 2Y8KA 3DYMA 4OYUA 4QX1A 4MADA 3CQOA 3DYPA 1XNAA 4PF1A 4CU6A 4BJ0A 2VZUA 4GWJA 3WNOA
chains in the Genus database with same CATH superfamily
5E1RA 5KBFA 4DXZA 1OOPB 5JMOA 3WOGA 4EN7B 3ZYJB 1PO13 2P5BA 1N1YA 3OGSA 2ZAHA 4EROA 3KLSA 1LESA 1POQA 1VBE3 2G9ZA 1GMMA 1LOFC 5FWJA 2BNMA 4AVAA 3M7AA 2WNUA 3PJYA 1YIFA 3MO4A 4IV3B 3NKGA 4AGVA 1GR3A 1ULEA 1YFWA 2XVGA 1SBFA 3JBG2 4OI2A 1DZTA 2JB4A 3ZN6B 3NJXA 2ZHLA 2EIGA 4Q8LA 2ZHNA 5E6HA 5A3PA 3KSCA 5D1IA 4CU7A 3LQCA 3RZJA 4IW3A 2R0HA 4XJAA 3S7IA 3MV01 3HWJA 1IHMA 1W2AX 2ZEZA 1MEC3 2F4LA 2ADDA 2ZMKA 4N8MA 5BPXA 4ZKTB 1O7FA 1OVPA 1UYZA 1D0HA 4QAWA 4GA9A 3AP6A 1QF3A 1S55A 1ZRRA 3O12A 1UU5A 2WZR3 5BNOA 2J1UA 3PIJA 1WCUA 3V0AA 1AR72 2W91A 3MW3A 4Q4V3 5BNNA 3VDBA 4Q4X2 1CAVB 3AP9A 1GZWA 1O5LA 4RQPC 4LNVA 4Q1PA 5ACA3 4ZXEA 3FHQA 4QPIA 4LORA 3ZN4A 2DBNA 4CCEA 3I2OA 3ZN5A 4PDWB 2RS32 1HJGA 4LLFA 2SLIA 4Q4W3 5EZWA 3ACHA 1DQ6A 2D7FA 2VXRA 4INDA 4Y1VA 3RJRA 4LO4B 3RVHA 2WNUB 1PGSA 3ETQA 5IK7A 5F5QA 2YU2A 2PHLA 5FP7A 4CDWA 2MHFA 3RYPA 1OH4A 1RXGA 1BK1A 1OI6A 4Q2FA 4ZXKA 4Q0QA 3ZLIA 1GUIA 1K12A 2W46A 1GSLA 1FV2A 4GH4A 4LBKA 2DF7A 1TME2 1VRH3 3J7LA 4Z1VA 1UMIA 4LE4A 2W2IA 1S0GA 2JKBA 1Y9GA 1ZZ8A 4QD2A 3SEEA 5C8WA 5LZ6A 2OXBA 3K4DA 5FLHA 2WBKA 1AR93 2XWJB 1APNA 1G8WA 2R1BA 1LTEA 1WA4A 4PHZA 5H9RA 1NA1C 4Q27A 4CA9A 2OPKA 2VMCA 2Z42A 4M00A 4QX2A 4M3CA 3U78A 5BNNB 2PXJA 1Q5OA 5CFDB 1CAUA 4OUEA 2X5IC 4DUXA 3RFRA 3LEGA 1MZFA 3ROUA 2DTYA 4OI1A 5FK7A 4WVZA 3OPWA 1U5ZA 5ABJB 1NYWA 2QDNA 1LAJA 2ZAAA 3ZYIB 3USUA 5GLWA 3PMEA 4K3UA 5TSWA 5FK8A 3C2UA 3RNSA 3RYKA 1ZBA1 1EAH2 1RUG1 4L97A 3TEYA 2P1BA 3OBAA 4RFT0 2ZJCA 1MS3A 1R082 5DMYA 4JTOA 1LOAA 2PHDA 2IXKA 3O0WA 5ISLA 2PYTA 3J7NA 4QDSA 1LOEA 1SCRA 3GF6A 2N7GA 4EZHA 3MLKA 3KQ4B 4GH4B 1RVF2 2WYSA 4XEZA 2DCZA 4HKLA 2A5ZA 2D3PA 4KI5M 1DQ5A 1PVC2 1XNKA 3BODA 4LA2A 4YVWA 2WQZC 3WQ7A 3DYOA 2FDFA 4F8AA 4ZU4A 1V6MA 4I0BA 2YB7A 1PNFA 1AXYA 3PU8A 1GNZA 4S2GA 4J6GA 2PFWA 2ZX1A 3VZOA 1CPNA 4CTEA 4M3CB 2E53A 2XKPA 2QNKA 1CAUB 3I8TA 3O5SA 4XF1A 4XPVA 4BK5A 4IEPA 3ACIA 2DVFA 1J59A 3AMPA 1JBCA 4N43A 3D3AA 2ZHKA 4B7KA 3O1OA 2GP3A 1D4M2 4A42A 1UY0A 4YZ4A 1X36A 4QX3A 2H0BA 2QQNA 4UF0B 1Z78A 4PIZA 5C3OA 2A1XA 2EIBA 2DCKA 3EHKA 5EXOA 3OYWB 5FREA 4BE3A 5FZ9A 1QIQA 3HIFA 3W58A 5FYIA 1KFXL 1W8NA 4AI3A 4PLNA 2Y26A 1POV1 2QTWB 3CEWA 1ENSA 3T4HB 5FZ7A 3ATGA 4QB2A 1GANA 4FQZA 2ILMA 1SLTA 5GLUA 3E5UA 3N9MA 2CY6A 4A3XA 1AYM3 3GDBA 2CGPA 2DDUA 2XJSA 2VZ1A 4YVWB 4FVVA 1NCRA 4ATFA 4C0BA 2B9UA 4CP1A 3WHUA 3J8F1 2QFEA 4IESA 2XBO3 3VBSC 3ZSLA 4QGLA 1W0PA 3H1MA 3SH4A 3V0BB 2D3RA 2EXHA 2HBUA 3WCSA 1YWKA 3Q8EA 3TYJA 1CAXB 5A7WA 4WM8C 2Q1FA 1JYCA 2Y6HA 2YBKA 1XNTA 4XHXA 1GP5A 1HN1A 2BERA 1FAYA 1IPSA 4N43B 3L2YA 5B4XA 5HCBA 3W5MA 4OQ9A 3RZKA 2R043 1MS1A 2ZXQA 4LBQD 2VNOA 4B3NA 3E6DA 2RJLA 1JYWA 4ZZ8A 1W03A 3VD5A 1ST8A 5CBLA 4FOVA 3VDDA 4OZXA 1FMD2 4I3GA 1BYHA 3Q8AA 2RS53 3AL6A 4IUGA 4KWJA 2BWCA 3SKVA 4DFSA 1G86A 5FO8B 2W0XA 1BEV3 1DG6A 2HWE3 4W8JA 3M3QA 1TEIA 1H2LA 2OW4A 2ORZA 4MXVA 3ZMNA 2PLV1 4AQ6A 2CNAA 2ZABA 3IDAA 3OEBA 4CU9A 1JYNA 2E9QA 2XB6C 2CGNA 2WN3A 4PIXA 1BZWA 1NCRB 3GHNA 4HXCA 4CVUA 5A1FA 2UWCA 5JOXA 1Z7S3 5LA9A 3UETA 4BISA 1H8TC 4JX0A 1H9WA 1AX2A 2K46A 2P3IA 4UOJA 4BQ1A 4Z8BA 4BQ3A 2VVDA 3KM5A 3VDAA 2FMDA 2A3WA 2VUCA 3H50A 4FPJA 3LEIA 3VBUB 4XFBA 4R9AA 2OZJA 1PIV1 3LDBA 4NE9A 4QKDA 5CU1A 1SZBA 4I09A 4AEKA 2JE8A 2JDNA 1CX4A 4O9GA 5C4WA 1OT5A 4AGGA 4H14A 4LJHA 2LS6A 3RPQA 3S30A 4OHYA 1SBEA 2I45A 3ZYBA 1K5MC 5DUVA 1VBB3 2H6BA 3N3HA 3ZKYA 4AI1A 2AACA 1PMHX 1NCQB 3NNGA 3RQ0A 4R9BA 1P8JA 2Y6GA 3MLJA 2VL4A 2WYFA 2O8OA 4B1LA 3UNPA 3H3ZA 3JXSA 4PI0A 4A44A 4HKWA 4QHOA 1G9AA 4BYYA 2E63A 3B01A 3VL9A 4CSWA 2O0OA 1W8OA 3BOPA 4RN5A 3U37A 2R32A 1QNWA 4Z2AA 4BLIA 1RUG2 2NMNA 4Q5OA 1HB2A 1UU4A 3N7JA 4LHSA 4XCAA 1OC1A 3VHNA 4HT1T 4XOGA 1X8MA 2JDKA 4B4QA 1XYOA 5FLJA 4CDUC 1QOSA 3W5NA 3SITA 2ZGOA 3OBZA 1Q56A 1V6JA 3GYDA 5CEHA 3H7YA 3HT2A 3ZSJA 4ORFA 1O59A 3MBWA 4COUA 2WNVB 3RRDA 4AEMA 5D8AA 1E5RA 1ZRDA 4CEWA 5CIRA 2TNFA 4RHV3 4X8PA 4CRQA 1KITA 1GOGA 2LROA 3LCPA 1NLQA 3KHCA 1C57A 1PK6C 2HWB3 1K42A 3ZPOA 4HK9A 2R30A 4PI2A 1VBE1 4IEOA 2WSVA 4ASMB 1WD3A 2WNEA 2LM3A 2KM2A 4KU8A 5F3CA 3ETPA 3WG4A 1LKNA 1OLQA 5F6LB 5BY5A 4JGYB 2B4KA 3OCPA 2YFZA 3DV8A 2YHJA 2OS2A 5BNPA 3P3NA 4AVCA 2W95A 2VUJA 1V6KA 4XTMA 4OLLA 2ARCA 1UY2A 1DZQA 2LUWA 3AL5A 3H42B 3WP5A 3SH3A 1QH7A 1DQ4A 2WAAA 2F6BA 2W68A 4JDOA 4ONUA 2ZGSA 4P9GA 4XUPA 3MLLA 5LB6A 2QUOA 3A22A 3PUIA 1BVP1 1O8SA 4K20A 3J8F2 4QPGA 4GB33 5DG1A 2WABA 2B46X 1O91A 4I0WB 1V00A 5JIAA 3QH7A 1JZ6A 1NY71 4FOYA 2A75A 4Y22B 3AYEA 4GZ9A 1DDLA 3E5XA 1ENXA 3FUOA 1WLCA 1D2SA 3H8OA 1F4HA 5FZKA 4L11A 4DNYA 4MXWA 2ZGUA 1R1A3 4YRDA 2Y34A 2E31A 3LEKA 4FP2A 4FXGB 1IG3A 2UWBA 1DGRA 3AZXA 1QDCA 1XU1A 2HWD3 4Z82A 4A3ZA 1GQPA 1OLMA 1LOGA 4RA0A 4WM7C 2G19A 1N47A 2NQYA 1RHI1 2VZ3A 5DAXA 3TB0A 1O3QA 3RWNA 4CP2A 3POFA 1JUIA 2XL9A 1W9FA 4E4ZA 1EY2A 4DXRA 1S0DA 1LR5A 5A3NA 3NNJA 3VZKA 3KV6A 2CTVA 5IAVA 3KGLA 3M1HA 1RJ8A 2DUPA 4DIQA 2PLV2 2TEPA 4QXKA 5BXXA 2AYHA 3B02A 5IAXA 1U12A 1W6MA 3ES4A 4NHKA 4N53C 3IKWA 5L7OA 1IS3A 4FFGA 3WDUA 4AEDC 5T50A 5C9AC 2A6XA 2D93A 2WZEA 5JOWA 1YI9A 1SMVA 1W6NA 2OKXA 2WT2A 1HXS3 1UY4A 2JX9A 3UJQA 2FCTA 1AR63 2DCTA 3H1WA 1HRV1 2W92A 2UU8A 1W99A 2JG9B 5DABA 5SV5A 1PX4A 2UWAA 4YZ3A 1RUD1 2K9ZA 3LPFA 1SLCA 1QJU2 4LBOA 4M4PA 1WCSA 2OQ6A 3E1F1 3MIGA 2GN3A 2R0FA 4NAOA 4D7YA 3KB5A 1C8M3 2VNRA 5A33A 2IXHA 4D69A 2IC1A 4NIGA 2WAOA 2WS91 5F9TA 2K0GA 1S2EA 3JD72 5FZLA 4O7XA 2JG8C 3SMHA 4EZ4A 2QQKA 2VNGA 1REDA 3EQEA 5K0UA 1UY3A 2Q30A 1ULFA 1RUI3 2Y6KA 3FHIB 4YPJA 4B7EA 3VBRC 1HIXA 1T6GC 2ZX3A 2PHFA 5E88A 5C5UA 3RMXA 4AI8A 4JV4A 1FT9A 2RR13 3IB3A 1PHMA 3WQ0A 4C91A 3K4AA 1NXMA 1JOPA 5AFEA 4XBNA 4IE6A 2X29A 4K21A 5T3NA 5I0DA 2QVSB 5H9SA 4COWA 2LTNA 2AENA 1TZOA 2X53S 1OLRA 3BPSA 4AOCA 3BCWA 2GC2A 1H1IA 5EJ1B 5FXZA 5C71A 1COV3 3ME2A 3L2HA 3X29B 3C7HA 4KNCA 4LBJA 5T5JA 4BB3A 4Y1YA 5FPBA 4V1PA 3POYA 4JDMA 1PO12 3NAPC 4PBPA 2Y64A 3GZEA 3O7OA 4RSUA 2EAAA 3GJAA 2EA7A 2R063 2VZQA 3HN3A 1VBE2 3VBHA 2O8QA 1ND2C 1UXXX 2W39A 2W1UA 3K51A 3MIFA 5FP3A 3VHPA 4CDXC 5IVBA 2VOWA 2FDGA 2KXLA 2ZACA 1DGLA 2XHKA 3D0JA 5FZ0A 2VC9A 5CYYA 3N9PA 1JZ5A 1V9U3 1NT0A 2NYYA 1ULCA 2VQ0A 4HLTA 2EF6A 4L92A 3T08A 3OBTA 1GV9A 2ARBA 4MVTA 5FMDA 1ZREA 1W6PA 1E5SA 3HNBM 1C5HA 4CUAA 5AC93 1X82A 3IPVA 3TN93 1OSGA 1UAIA 1YIPA 2BDRA 3WG1A 4XJ8A 3ZR5A 3VBFA 1O5UA 2WUHA 4AHWA 2WQ4A 1NOVA 3AVSA 1AYN1 3AMMA 1PGW1 2G9GA 3WNXA 2WZR2 4AQSA 5I0SA 2XJRA 5FYZA 4YARA 3AMQA 4CUGA 4DXSA 3AJZA 2Y8KA 1ND3A 4HSLA 4Q4V2 4MADA 4XFCA 5JOYA 3M3EA 1LRHA 5LK7B 3S0MA 1NY72 4OQ8A 4PF1A 1ASJ3 5ACA2 1BEV1 2FDHA 4CU6A 4BJ0A 1PGL2 2BGCA 1FV3A 4CCNA 3B9CA 4NHYA 1RUC1 1GKBA 2RMU1 1OUSA 4IEVA 2VQUA 4JGZB 4Q4W2 3VBHB 3WNOA 4EV0A 2ZX4A 2NM1A 3WF1A 1F8VA 2W52A 1UY1A 4FI9A 5I8TA 3ZFEC 1QKQA 1WMXA 2CAVA 2VCBA 2E7TA 4CEYB 1JZ4A 1QJY3 3LSEA 3ZX7A 1QGLA 4BQ2A 4P02B 2JENA 2BNOA 1SCSA 1VBD3 4L0PA 3WHTA 1ONAA 4OCTA 1IKPA 3FLRA 3HQUA 3PNAA 3FLTA 1EP0A 3S6PA 3POWA 2VOVA 3HQXA 4FP3A 3AC0A 5DZEA 3WNPA 2ID4A 3IDEA 4FTBA 3I54A 3VBFB 1MQTA 2PQSA 1AR92 1VBA3 2RM23 3DCQA 4LBNA 1H2MA 3IDBB 4FO9A 2CGOA 5FKBA 2BPA2 1WZXA 3KZ4C 1DQ0A 2EXKA 2FHRA 4YVSC 3SCHA 1IOAA 1VBB1 5F6KA 5FZDA 3A0NA 2J1VA 3VBOC 5JZGA 4QQ2A 4SLIA 1QOTA 3OUIA 1GNHA 4JKKA 1YJKA 2YC0A 1X33A 1YLLA 4H7LA 1AJOA 2VU9A 1YXWA 4IE4A 4OMDA 3WDXA 1ZX5A 4Q4X1 5CKQA 2JIJA 4XQ4A 1RUD2 1NX9A 3GBFA 2VZPA 1V70A 1MS5A 3PU3A 2XXZA 4RS5C 4XUTA 3AP4A 1MR5A 5EQUA 3VB9A 2RS31 4P5HA 2WS92 3POSA 4NUBA 4GXLA 4Q0PA 1XNCA 4P9YA 3OUHA 2YMZA 4FPGA 2W3JA 4NHMA 2O14A 2RJKA 4LUMA 3WNNA 1UL9A 3MW2A 1VPHA 2VOKA 4YFZA 5HV4A 3OUJA 1MQTB 3D8CA 5JXGA 1L7RA 1U5IA 1CJPA 1W3VA 1L7QA 1JUHA 3M3IA 4QPWA 4RHV1 3OBRA 2VE1A 5CB7A 3AXDA 4LIVA 3J4UH 5G04L 3BTZA 2SBAA 4NIDA 5KXDA 1N1TA 2HWB1 2JDMA 4XF3A 5DAQA 4AFAA 5DDJ1 4N7UA 1X9TA 5FZMA 2JWPA 4W50A 1JHNA 1WBFA 2VBDA 3TNPB 1NXD1 5JZGB 1RUH3 1SFPA 1J84A 1LEDA 1I5PA 3DPRC 3W21A 1IKQA 1Q8OA 5FZGA 4R9DA 1PO23 3S5AA 4AFMA 1FXZA 2DTWA 1VMFA 4C8DA 3NV1A 1CONA 3W59A 3DGTA 3P5BA 5A1LA 4V2VA 3RGBA 5L73A 5A7QA 4LHLA 5FJKA 3ST7A 3E6CC 4R4ZA 1SPPA 2BNNA 1N1VA 4X6RB 3P3PA 5GKAC 3WW3A 4AF9A 2ETEA 4ASKA 4UI9L 1XYPA 1R081 3GJBA 1AL23 2HJIA 1EV11 4M4RA 5FYCA 1GP4A 5EWSA 5IVFA 3HBKA 5FXXA 2X09A 1S0IA 3ALQA 3OPTA 5HPOA 5LEKA 1O3RA 1RVF1 1YFYA 3FMGA 1KGYA 2YBPA 1SFNA 4U2AA 1MZEA 3RWKX 2VQTA 3VL8A 3NMBA 1X9PA 4DEQA 2E33A 3K4ZA 4LPLA 4MGYE 3T2TA 1TMF3 1QJZA 1JS9A 5K7PA 3ZFFC 1W2TA 3M3OA 5CVRA 5APAA 2XLFA 2GNBA 1SFYA 4KH9A 1T6BX 4QX8A 3IN9A 1H0BA 2WT0A 1BEV2 3ZFGC 1DBNA 2P6HA 2P17A 1MVQA 1R64A 3H1YA 3AB0A 3U1XA 1RUC2 1NLSA 4E9KA 5D2AA 4A4AA 5C3SA 1JZ3A 3FJSA 4MYEA 4WBBA 5KHKA 4S2DA 4AVVA 1R093 2Q4SA 1CAVA 3ILNA 4IEQA 3ZO0B 4RR3C 2RDRA 2P3YA 1POV0 2ZKNA 2OPWA 5FYBA 1YQ2A 3KV5A 4PDWA 1W9YA 2J1SA 2P34A 4XC9A 3GBGA 3GZUC 4GAZA 4UXAA 4MGSA 3ZOIA 5FRAA 3B9IA 1JU3A 5DPNA 2V72A 2VMHA 1HXS1 5IUQA 1WWYA 1QJX3 1D0GA 1HB3A 2ZGMA 1C1LA 3POJA 1STMA 2VZRA 3PIGA 4XXAA 3ZXGA 4TZDA 2HWC3 4DRVA 4C0HA 2ZBJA 3PDQA 3MIBA 4QB1A 3UJOA 4FTSA 3QBQA 2VVFA 3U07A 2QZ3A 2QQMA 1F9KA 1VBB2 1W04A 2JDYA 2JEMA 5JDBA 1C28A 1OD5A 1VR3A 1NG0A 4QX0A 5LA0A 1OH3A 3OTFA 1AX1A 4IETA 3SLIA 3NNLA 1A34A 1XXNA 2GP5A 5JI9A 4O65A 3C7OA 1ZRIA 3NV4A 1NA1B 2V4AA 1OQDA 5FP9A 2VMFA 4E2QA 1FMD1 2ADEA 5BUVA 5CFDA 4DMIA 1C8NA 4SBVA 5FYUA 3QD6A 2HWF3 3HVDA 5DAVA 1HRI3 4UW3A 4YW1A 5ABJA 3LDRA 4XIOA 3FLPA 4HPKA 4YZ2A 4EWEA 3G6JB 1WMFA 3TBDA 1YHFA 3RI8A 1FOD1 5JCTA 3VV1A 5FZOB 2BJSA 5FY5A 4K7JA 3AVRA 1NZCA 4Q4Y3 4AFCA 3I2DA 1GQHA 3SXWA 2XQXA 1VAVA 3HQRA 5FV3A 4RHV2 2VXJA 5JSPA 3S57A 4TSVA 4HVOA 2FMYA 1OOPC 2YZ4A 4QM9A 1PZ9A 4PLMA 3ZXJA 3EXUA 3OPZA 2HWB2 3M2MA 3BTYA 5DDJ2 4NRQA 1QWRA 4LKFA 4XBQA 5FUIA 4P9WA 4XFFA 2Y38A 3KF5A 3BUCA 2D6LX 1VAKA 2O1QA 4HL0A 4QXCA 1ZRFA 2B7YA 3O1VA 3KQRA 3K3NA 4IV3C 5FXWA 1B35C 3CZJA 1BQPA 4FFFA 3ZKUA 3IAQA 3V56A 3RDIA 2ZGNA 3MIEA 5IW0A 5FZEA 4M3CE 4YM1A 2Q8OA 3WD5A 5IFTA 5FY0A 3LWCA 1XNDA 3OG2A 4HPKB 3ZYFA 1O3SA 1IS4A 2KA3A 4DS0A 2VVEA 3DXTA 1HB1A 4UF0A 3I49A 3O1TA 4CCCA 1EV12 4Y5Z0 3ASIA 4AR2A 4AYUA 3OYWA 2EAKA 1SLBA 1F31A 2YFUA 4K6BA 2ZPXA 3WY6A 4AQTA 1JYVA 5GALA 1WGPA 5LBEA 1DGWA 4GB32 3PVEA 4XFHA 5JMCA 2QE3A 3I2FA 3UV9A 2RS13 2YC4A 3THPA 1ASJ1 2JDPA 4CCDA 2DV9A 3WNLA 4FPFA 2B45X 1FI2A 4QX7A 5J48A 1CZTA 1GWMA 1WCDJ 2EVXA 1AUYA 1QY4A 1ACCA 3MW4A 4QPYA 4CCLA 4CPBA 4D94A 1PMJX 2GU9A 1DGWX 2G1MA 1R1A2 2WNUC 5T55A 5A3TA 5ANNA 1AL0G 3V0BA 5J37A 2P6CA 5FAXA 3WVJA 1KJLA 1CAXA 3AMNA 1CZVA 1VBD1 1QOOA 3FFZA 3I3MA 3THDA 2J1EA 4YYOA 4EQVA 2ZMNA 4CCMA 4IEXA 3ACFA 2Q1MA 3JZVA 3WUCA 5IVCA 1K45A 3VLBB 1XE8A 1MVEA 2WO7A 4QKNA 1JU4A 1KXGA 2VMGA 4A6SA 1VBA1 1W8WA 2AUYA 3HBZA 1Y7BA 5BNOC 4D8MA 4DUWA 1A3KA 2PTMA 3T09A 4EN6B 1WUVA 2C24A 2JD9A 4QDQA 3WLUA 2J1AA 3ZDSA 5BNNC 1ZBE3 4RL7A 5JPNB 1CAWB 2WFPA 3LA7A 4YZ5A 3S5QA 1I5ZA 4QPIC 4AVSA 2GH8A 1HXS2 4HG6B 4XETA 4G4FA 2WINB 1AR62 3PHMA 4H7MA 5L36A 4AHYA 2AH2A 3OOXA 5FMCA 4F83A 2I74A 1H8TB 2HH9A 3CBNA 3WR0A 4CDWC 4ZZ5A 5DZGA 1I1EA 2DVGA 1KD7A 2BBAA 4FPKA 4GALA 2UYBA 3CJIA 3VBUA 1CWPA 2B8MA 3IIAA 1BLZA 1L7LA 1LOBA 3JB8A 2XUEA 4GH4C 4LO6B 3QH6A 3PUHA 3R4UA 1DF0A 4WVMB 4Q0VA 3WG2A 2V5DA 2QQJA 4KL1A 5FP8A 1A8DA 4FSJA 2DFBA 3LDKA 4QQHA 5JWPA 1NCQA 3PLQA 1W8FA 2Y0IA 4EN9B 1LGBA 5M0TA 4MO3M 2WN2A 1QH6A 5JPMB 4OI0A 2VMEA 4QGNA 1QMJA 3UK9A 1W9WA 2CU5A 2RR12 1CQ9A 3LOIA 4MH0E 2C9KA 4C1XA 5C8CA 2NP0A 1XU2A 2PHXA 1YRZA 4X8NA 5LBBA 4IEZA 4XVHA 4YW4A 2YV8A 3N9OA 1FOD2 1AX0A 5DZFA 5JI7A 4D0QA 4XCBA 3UKTA 5GZGA 5KHGA 4XAEA 3OJBA 4QHBA 4LHNA 4NPRA 4CDUB 1UIJA 4D7SA 2JICA 1JOJA 1COV2 3ZXDA 2PAKA 2JE9A 3H8UA 4AK3A 3VHRA 4FQ4A 5FZ6A 2WNVA 4OHXA 1PNGA 3CJIB 3M4FA 2E26A 2ZGTA 3ELNA 3WW1A 3LB9A 1PVXA 1YQCA 2G4IA 1K5JA 2R062 3C8XA 3BPZA 4E4DX 4BMBA 3CKHA 1QJU1 3DECA 5LA2A 4META 3T1MA 4YGBA 1LECA 3IWZA 4J1WA 4YVWC 1QQP3 3ZYPA 5LY1A 4EE2A 5A80A 2GNMA 1QXPA 4IV1A 4A7KA 4B29A 3JD71 1X7NA 1Y9MA 5HI0A 3I3QA 1REEA 1G9DA 1O4ZA 4AVBA 1PMIA 2JECA 4HOOA 1KS5A 5C8CB 3WX5A 3B00A 4UW4A 5AC92 4AQ2A 1DZRA 1GNYA 3CF6E 3TN92 3WINE 1S4CA 4JGYA 3ENRA 3O1RA 3E5QA 4QXHA 4XW3A 2J7MA 2HLEA 2AZ5A 1O4TA 4WV8A 1O4YA 1VAMA 3PUSA 4I0AA 1UMHA 2IXCA 2E7QA 4UFIA 5FMOS 1WLDA 2R073 3JQXA 4DINB 4YW2A 5FJHA 1W6QB 5FZBA 2EICA 5KR7A 1UOJA 4D6SA 4CCJA 2Q8CA 3I97A 2Z4FA 1CVNA 3WNMA 1ASJ2 2D6PA 2YG0A 5GZEA 3RZMA 2ZGQA 4XE9A 3VD3A 4JC1A 3O1SA 4AEJA 1C1FA 2ET1A 1JZ2A 5LY2A 3WF0A 1V6OA 3PTRB 3VD4A 4BK4A 4Y22A 1PO11 2WO2A 4LO8A 5JVVA 1NCRC 1QJY2 4XMAA 1W8TA 1S2BA 4IV1B 1DYKA 2ZZQA 1LEMA 1VBD2 2DCYA 2D44A 5A7PA 3ZDVA 3AZVA 1KDMA 3H8XA 1RYYA 4MHUA 1ODNA 2DU1A 2TBVA 2FQPA 4Y33A 1ZZ9A 4MGZE 3THTA 5HV0A 5IATA 4WM7B 1W9TA 2HWC1 2Y33A 2XG3A 2RM22 1VBA2 4AAPA 4MGTA 1W6OA 2FCVA 1MS4A 2A3YA 1G6NA 3KV4A 4HFSA 1AXKA 2BGOA 3GHMA 1MEC1 4QU1A 1UQXA 1GWKA 3VDDC 3ZM8A 1D7PM 5B2GB 1CGPA 2RJ2A 1TE1B 5EYXA 3QOPA 4NHLA 2VW0A 4XTPA 1LHVA 2WZR1 5FY7A 3P6BA 5A3LA 4Y20B 4GMP3 3DYMA 3ZPYA 4OYUA 4D6QA 5HCHA 4QX1A 2J42A 5I91A 1ULGA 4Q4V1 4JRLA 2MEV3 3DYPA 1J1TA 1SLLA 1NQJA 2CL2A 3LA2A 5C9AB 2CWMA 4COVA 5KHIA 1WLTA 4HN1A 4CDQA 5ACA1 1OA4A 2VZUA 5LRSA 2BWAA 1HRI1 1Y9QA 3VKNA 3AK0A 1PGL1 5EJZB 1AHSA 4AVTA 3A4UA 5BV6A 2RG4A 4Q4W1 2AEYA 2XWBB 2JG9A 5JSRA 4O9EA 5LWBA 3H3UA 3AZYA 2D97A 4FPCA 1RUF3 1UOBA 1I3HA 4Y5TA 3I59B 3LD8A 4FFIA 1W6OB 5C4WC 1OLME 1ZA4A 5DG2A 2ZZJA 2DYCA 2Y6LA 3T0DA 3VN4A 1Q8PA 3N7MA 2IXJA 1VRH1 3A7QA 4NJ4A 1PVC3 2JDHA 2I07B 2Q5TA 2X05A 5A7OA 2DVBA 1AR91 3AJYA 3QLQA 4QGMA 4ES9A 4DXTA 2WIIB 1WW5A 2D5FA 5AVPA 4QB6A 5JOZA 2JD4A 4AXOA 5I93A 4ASLA 4K1ZA 1PO22 5F3IA 2VQAA 3Q8CA 1VBC3 3BOWA 1CJDA 1RUJ3 3WDTA 3GALA 4CDQB 2ZCWA 4NRMA 5FZAA 4MHRA 3MPPG 4E2GA 1D4M3 2V4VA 1B09A 4U36A 5EJ3A 1HN0A 3EB7A 1F5FA 3WP4A 4B1MA 2BVBA 3NW4A 3GZTB 3HAGA 3WG3A 5J09A 4JCKA 4LBMA 2XH6A 1EPZA 1IS6A 1VMHA 3LIHA 5DUWA 4OUSA 2YU1A 3VGIA 1UYXA 5L19A 2DWRA 1UW8A 3ZR6A 3NAPB 5D8AC 1T2XA 3NNMA 4CEWC 4R52A 3RZZA 5FBJA 1W2OA 2XKOA 4P9JA 4AGRA 5L9BA 1FATA 2BVVA 3H0OA 3OF1A 1LENA 3LFIA 4GJZA 4AZZA 5LBFA 2QQWA 1UYYA 3SCGA 5J1XA 2ORXA 4EN8B 2RDSA 2Q8DA 1W3XA 3WW4A 1DLLA 3IAPA 4XF9A 1HX6A 3ZIXA 2OVUA 2VECA 2WSUA 2JDZA 3BN6A 4UBGA 1AZDA 2MNGA 5BNPC 3VKFC 3KMHA 3KT4A 5I0TA 3U14A 1UZYA 4FAHA 2VAUA 1GZCA 2RVAA 3ITQA 2VULA 4X6QB 5GLVA 3KWVA 2ZGRA 5FMOL 4XUNA 1OKQA 3N36A 3CO2A 4FAGA 1URXA 3POBA 5EV7A 3BI3A 3NRUA 4MGQA 4ZY9A 4OVEA 2ET7A 1GU3A 4LHKA 1R092 2XGXA 3POIA 4JTNA 1NAEA 1ULDA 2VW1A 4KQ7A 3ZVXA 1PM7A 2TUNA 4W6XA 3DXUA 4LTAA 4FBFA 1LGCA 1QJFA 1YUDA 1F15A 1YEWA 2ATFA 3CJXA 3NJYA 4JGZA 4QPGC 5GZFA 5LATA 3ORJA 1OMIA 2IVJA 3FFQA 2HEYF 2W47A 3UYJA 1Q8QA 2W08A 3HT1A 5FQ0A 2WWUA 1AYM1 2WT1A 3BTAA 4P08A 4YGEA 4CEYA 1AJKA 3IM0A 1GP6A 1DLCA 1FNYA 4JVAA 2HWC2 3IT8A 2XBO1 3Q8BA 2WZPP 5KHJA 3L9JT 2RDNA 1W2UA 2IFRA 4NO4A 4CCKA 4HETA 1MEC2 5FZ1A 1W8HA 2VTXJ 2FDJA 2VG9A 2R7EB 3K48A 4P14A 4IE5A 5C33A 5T5PA 5CG8A 2WC2A 5FYSA 2R041 4QX5A 3AMHA 3AYCA 4NAMA 4P5YA 3O0XA 4P9LA 4D7TA 1XQNA 3MF9A 3I2GA 2VW2A 3DKQA 3F95A 1HB4A 1H2KA 2RS51 3NWKA 2GDFA 3VBOB 2C9AA 1Q43A 2VZOA 1JN2P 2HWE1 3FZ3A 3GZAA 4JAAA 1GOFA 2C0ZA 3I3BA 1HRI2 5CG9A 4LBQB 2JE7A 3VZNA 3OY8B 5L7OC 3UL2A 5J7MA 1MS8A 1WW4A 1RC6A 4N9IA 4YG3A 1QHDA 2VCAA 1ZBA3 5F5CA 2D3SA 3ZXLA 1BHGA 3DKWA 5A7SA 5FQ0B 2XHNA 4ITCA 1R1ZA 4RS5B 4GULA 4LK7A 1RUE3 2ZEYA 2D43A 1H2NA 5CFCA 4Q4Y2 1Z7S1 4QKBA 1D4VB 4XDPA 3MZHA 3VKOA 2BRTA 3LGRA 1N3QA 5FY8A 4S2HA 4XURA 3UGFA 1OFSA 3BVCA 1VRH2 4AW7A 3AP7A 2VOXA 1TVGA 3K46A 2AGSA 1VE0A 1JYXA 1QEXA 2BEOA 4XHBA 1W2NA 1YQ5A 4JKLA 5K0UC 5F8PA 3GXUA 4HSJA 3TNQA 5I8YA 3ZXKA 1XOYA 4L8QA 4Y3OA 4A7YA 4YGDA 4E27A 2Z69A 2LALA 1O8PA 3Q9OA 3FL7A 2A6VA 4IEUA 4RGAA 4AI9A 4DUVA 2PHTA 3EO6A 3VUOA 4CCOA 3KVAA 5A6ZA 3DPRB 4K9SA 5KWRA 1RITA 5C6CA 3HN1A 5H9PA 4BIOA 5FPXA 1BBT3 4URAA 5FXVA 2YDEA 2YPJA 5FDBA 2WFF3 3JB4C 4QQLA 2P3JA 4LE3A 4XF0A 1EUTA 2PAMA 2QQVA 3AYAA 5CFCB 1OKOA 3POEA 3LKJA 2VZTA 2Z2SB 3HNMA 3MDPA 2FZ1A 5L9RA 5FBZA 4GIQA 1SQ4A 3J7HA 2DVDA 2RS12 2OUJA 3QACA 2HYXA 3KS7A 1VMJA 2A71A 1IGOA 4QM8A 4XACA 5G05L 5FPVA 4URTA 1XNBA 3I2HA 4ZS3A 3VBHC 1NZIA 4IEYA 3J8F3 5FWEA 4IE0A 5JXIA 1SEFA 3WQBA 4ZU5A 5A6QA 5DN2A 1PZ8A 2VPVA 1LOFA 3GCXA 1YO8A 1WCKA 1H8VA 2HEWF 3IMNA 3KT7A 1OURA 3WT3A 1SG3A 4FPEA 1C3HA 5JXJA 5FZ3A 4K1YA 2L9LA 2QDRA 4YFWA 2EXJA 3TWIA 1Y4WA 3USSA 4A2UA 1EPWA 2YGMA 1RGSA 3BIWE 5C3RA 1OPOA 5IT6A 1YNAA 1ZZBA 2VO5A 3PJQA 3VBFC 3CZUA 2A73B 2J1RA 3N4MA 4DZGA 3R05A 2PMWB 4JQTA 3GNEA 3ZFGB 1ND3C 2A7AA 3Q8FA 2VMDA 1ZBE2 2LW8A 2CDOA 2Z79A 3H8RA 4COYA 3U4XA 4UFMA 4XJ9A 4RQPA 3MV11 1KQRA 1IPJA 4Y1ZA 1AYM2 5GLZA 2ZEWA 3W9AA 4WVWA 2VOTA 2PAEA 5FLIA 1YQ8A 4GB31 4N90A 2DURA 1NLRA 2MEV1 2XBO2 3SC7X 4DRRA 4QQOA 3VD9A 3WXPA 4Q1RA 3PVNA 2VUAA 4YM2A 2GMEA 3FWEA 3V65A 2EALA 5A6YA 4B8EA 1J3RA 3LOBA 1AVBA 1UZZA 1BJQA 1QXRA 1PIV3 5GZCA 3POGA 1O6UA 2XJVA 4YSFA 1R1A1 4LBLA 2R042 2BV4A 1SDDB 5FFOC 4NIAA 3NVCA 2WO1A 4HMZA 1UIKA 2HWD1 4ISRA 2VTXA 1ENRA 2WKKA 2VUDA 3FC0A 1UPIA 4UFJA 3FBMA 5JAXA 4I01A 4JRAA 3T2OA 2WNOA 4FPOB 1AR83 2RS52 5DUUA 4LA3A 4IE7A 5F5IA 1E5IA 2HWE2 5I0RA 1XYNA 4E4HA 2AEZA 1C5IA 4JHZA 5A70A 1RB8G 1NA1A 4CXXA 1DGRN 1B35A 3BGAA 3J9SA 1JH5A 5LASA 5FYVA 5JZGC 1QNYA 4KWUA 2HEVF 4RQPB 2GC0A 2E32A 1F4AA 3NJZA 2X5IA 1IZ3A 2V09A 1S0CA 5E89A 5JLVA 2YYOA 4EYUA 4MV2A 4UFLA 1S0FA 5LCWL 1CX1A 1Z7S2 1JMUB 2GALA 5CISA 4XFIA 1J3QA 1VBC1 5JIUA 2JDAA 1RUJ1 2ZGLA 2BQPA 3LE0A 4FPHA 4BZ4A 4CU8A 5FZOA 1G9FA 3GCWA 4EWDA 1AR61 4XZPA 1W8ZA 1QDOA 1ZA7A 1H4HA 2WJSA 4XQDA 4YLZA 3RZLA 2IWGB 3T30A 1YFUA 4DB5A 3IDCB 1U5YA 3KCXA 3WCRA 5ERLA 4I2OA 4NIIA 5JR7B 1C8M1 2NMOA 5FUNA 1LNSA 1QQP2 2VTFA 3KHBA 5FY9A 2VZSA 1AF9A 1XJAA 3J26N 5FIXA 1IPKA 1EUUA 4AE2A 2ENRA 3AKRA 3O1PA 4KU7A 2IZWA 3MICA 4KWLA 1RUI1 1B35B 5IVEA 2WZ8A 1F35A 2VD7A 4TXWA 2DCJA 3MGUA 4Y4RA 1BK0A 1JW6A 1M4WA 1PX3A 2X5IB 2ZGPA 5LBCA 3U11A 3ZSKA 3E97A 3T2PA 5F2SA 2RR11 4JQRA 4MUVA 2R072 1HQLA 2FCUA 5KXEA 2HBTA 2W1SA 5EYYA 1UO9A 2P37A 4NOTA 3LPGA 3ON7A 1A8MA 5BYNA 3CU7A 2QCSB 1V0AA 1BKZA 1I9RA 3R4DB 1OF4A 1ZNPA 4RFRB 1KFUL 4N9HA 4YNIA 3CNAA 1KRIA 2XMLA 3OB8A 3URFA 1COV1 4FOWA 4BM8A 2D5HA 4W4ZA 1UD1A 4XZUG 5JR2A 1SLIA 2A70A 4MOAA 1HKDA 2IVIB 4AG4A 1VRBA 3PURA 3U10A 1RUNA 1GOHA 1DIWA 1S0JA 2QQIA 2XLGA 5F37A 2R061 2VY0A 3M70A 2W94A 2JXAA 4XFGA 3T1LA 3APBA 4ZU7A 4CYDA 3VBSA 5FZIA 2BU9A 3CLPA 4HN0A 2W1QA 4GJYA 4IL7A 5K8SA 1UPSA 3OGJA 1V9U1 2OZ6A 1RHI3 2X10A 4WM8A 3EYPA 2XL7A 4PQ9A 4YG6A 5B4NA 1VIWB 3WEZA 5AC91 4XDOA 3TN91 5FCCA 1U0AA 5SV8A 4OULA 1H4GA 3JCIA 1M06G 3B5LB 3F2ZA 4E8DA 2YY1A 2CSGA 2VR4A 1UN1A 4YG0A 5BNOB 2FBEA 5FP4A 2VCCA 4YW3A 3V0AB 5L9VA 1US3A 2X8KA 4M0NA 3ZXEA 5C7GA 1JZ8A 2MEV2 4XQWA 4RGKA 1J1LA 1GZWB 1CAWA 1MACA 3IBMA 4NMIA 3CDZB 4CP0A 4HBNA 4NWWA 4R9CA 4QPIB 2VBBA 2ERFA 3A0KA 4FCAA 5FZFA 4Q8KA 3BU7A 3D82A 4PDWC 2RDQA 1HRV3 1ULPA 3NKTA 1UZ0A 1UZVA 2WLQA 4GQ7A 2WQ8A 3LZZA 4C90A 2XVLA 3WP6A 4FTEA 1LGNA 1WBLA 4PIYA 3SKJE 1RUD3 3VBSB 3TEZA 1H8TA 2H6CA 2ARXA 2JIGA 3EMRA 2HWD2 4NRPA 4CDWB 1RUF2 3P1IA 2UYAA 4I02A 1QJY1 4KMQA 5LA1A 1RUE1 2WLPA 5A1AA 5CA6A 4WM8B 5FYTA 4PJYA 3W20A 2WS93 3WDYA 2B5HA 1UZWA 1IQDC 3NV3A 4UFKA 3PVOA 4Q0SA 1U5XA 5ANQA 4WVMA 5F3EA 4XILA 5FYHA 2XJUA 4UWDA 4Y24A 3EBRA 1NKGA 2OIIA 4XBLA 1W05A 4HZFA 3SCFA 1K5MA 3MPBA 1NUKA 2RM21 4OFGA 4UBHA 3MUZ1 3RS6A 4ZHNA 5K4LA 1HV1A 1FPN3 3IZOA 5DAPA 2WWSA 4L2NA 1HLCA 2GNDA 3WDWA 3ILRA 4IGPA 5CZKA 1LHWA 4QMAA 5CFDC 2IUWA 1VBC2 3UESA 4Y1UA 4BH9A 1RUJ2 4YWAA 5FUPA 3ILFA 5CNAA 5ABJC 1VJ2A 1YJLA 2BP6A 2Y6FA 3DN7A 5T52A 1W0OA 4XJWA 3USUB 4CDUA 1BBT1 3B93A 2B42B 2ZA9A 2CV6A 5AFBA 5E16A 2WFF1 2YUEA 4GWJA 2NZ9A 4DPNA 1MS0A 1PZ7A 4QDRA 4XMIA 1C8M2 4AHZA 4BQXA 4CZSA 1RUOA 3B3QE 3C7FA 3PUAA 2BFUS 1LHUA 3BALA 2VBPA 3U4SA 3WV6A 1JXNA 1BMV1 3R0RA 1SHWB 1XB9A 1UXZA 4KG0A 4BQWA 5GM0A 1I6XA 1N3PA 1PK6A 1RJ7A 1RUI2 5A32A 4XUQA 1K5MB 1RXFA 5JXHA 5KXCA 1HV0A 1TG7A 2GC3A 2GN7A 3MEPA 5FY4A 2XJQA 2A6WA 1RMU3 3VZLA 2KD7A 1V6IA 5IK8A 3RJ2X 3LSDA 1NE4A 4FFHA 5E8AA 2OQ7A 5HXVA 1VLNA 4BWOA 4DOUA 4R4XA 2WDBA 4B4PA 5HXMA 1RUH1 1W8UA 4G9SB 4W6YA 4A45A 1AYN3 1ZYBA 3LEMA 3ZSMA 4F3JA 3U0ZA 2DU0A 4TWTA 1W0NA 4QHZA 5C70A 3SEPA 4AI2A 4H3WA 2VJXA 1PO21 4L99A 4AAXA 3FX3A 4ATEA 4Z92B 1W6QA 4LQRA 3RI9A 5IFPA 4AFDA 2CWSA 4UAPA 1H6XA 2IXLA 2YPDA 3B7MA 3PTYA 4ARYA 3VKLA 4OI4A 3D0SA 1RUC3 2RMU3 1CD3G 2UY8A 2J1TA 2ZS6B 3D5OA 1LHOA 2G9FA 1UWWA 1VB2A 1AL21 1GZTA 5LW9A 4MG2A 4LXLA 1OQEA 1PK6B 4ZONA 3LIGA 1VB4A 2OA2A 3AFKA 2R16A 5A32B 4A41A 5JSOA 5C5TA 1Q3EA 3NNFA 3ZYRA 4KBBA 1V9U2 4CXWA 4LKEA 5FPLA 1ODMA 4F7ZA 5C3PA 4DQAA 2JJ6A 2B39A 1UX7A 5FO9B 3D4KA 3T0BA 2D98A 3UGGA 4K40A 4KGGA 5F5AA 1ALYA 2QKDA 5GJ6A 5T5LA 1H1MA 3RYRA 5IVVA 3JBG3 5A7WB 1LULA 3H3LA 4UT5A 1GQGA 1Z0HA 1DQ2A 4GKYA 5AVAA 4JDNA 4WM7A 2WR9A 4L9BA 4N43C 5FOJB 3OGGA 5IHRA 3JU9A 2B9VA 5IJRA 2ZX2A 1TMF1 3N9QA 3TRSB 3DF0A 2P4EA 2ZKLA 4Y1XA 1IQAA 3K3OA 1NE6A 3DUIA 4KGQA 1YCIA 3I3EA 3VDDB 2CDPA 5EP9A 1AR81 2R6QA 1HJFA 4CUBA 3NJVA 3B69A 4NIHA 4FPLA 1JYTA 4LR4A 2NPIA 1H1AA 4Y20A 5FPZA 2A3XA 1OXCA 1MZ5A 1UOGA 2P3KA 3KVBA 3O14A 3WF2A 1AR73 1LHNA 2QBXA 3J7MA 3M3CA 2GH2A 4N53A 4Q4X3 2NLRA 1R091 1ZBA2 2BGPA 1GFF2 2YGLA 4QKFA 4YM0A 5I0UA 4AEDA 5C9AA 1CIYA 4J1XA 1TNFA 3MFAA 4AFBA 4DO0A 4P9XA 1L3JA 1RUE2 3H9AA 4BMEA 2C6SA 2RS33 3CHXA 2QJVA 4C1WA 3HOBA 3AKSA 1G7YA 5H9QA 2ZOEB 3AZZA 3H7JA 4UYBA 4Y5SA 1DP0A 1W28A 1QJX1 1UOFA 2IFWA 3CJIC 3T3YA 2PA7A 3VBUC 1OUXA 3I59A 1YI7A 4BQYA 3I2JA 4H55A 1H9PA 3CIHA 5C4WB 3NL1A 1GLHA 1G9CA 5GZDA 2XJPA 2JG8A 4RGGA 3CL1A 2GZWA 1TME3 2E7AA 4IXLA 4BCUA 5DDJ3 3VHOA 3WDVA 2YXSA 4BHPA 4BXSV 2VZVA 1NCQC 4XAAA 1H6YA 4GWNA 4M0HA 5A3OA 4TN7A 1ENQA 3THCA 3T4VA 1YC61 3VBRA 4CUCA 4NN0A 5C8CC 2D6KA 4LO5B 2ARAA 2ZEXA 4N53B 5FMBA 1BBT2 4D3WA 4AEDB 3SQOA 3UKVA 2WFF2 4I30A 3AKPA 3E6BA 2XVKA 3SISA 5BNQA 2HWF1 5FO7B 4KG8A 2E51A 4EN0A 3HD8B 2W9XA 4WVVA 3CMGA 5JUVA 4YW6A 2PHWA 5HCFA 5DUXA 5IWFA 4YW5A 1BXHA 3ACLA 2GSYA 3WF3A 1IG0A 1EAH3 3OSDA 1LB2A 1BMV2 1K3IA 4IQPA 3ACGA 4P00B 3N7LA 1R083 2WNVC 4LKDA 5FPAA 1EV13 1RIRA 2AC1A 2EXIA 2WO3A 3HNYM 3EJKA 3NAPA 4Q4Y1 4XIKA 4MGKE 5D8AB 4LT5A 3I7DA 4CEWB 5A7NA 4Z07A 2Q8EA 3FBYA 2FZ2A 1RVF3 2BFUL 3N35A 2JG8B 2RV9A 4Q29A 4RD7A 4XJZA 2RHPA 1ND2A 1XSRA 3BB6A 3KCCA 3N9NA 3KV9A 1QXJA 4CDXA 4YM3A 4EJRA 3AKQA 3T2QA 4IV1C 1UMZA 2PQQA 3KD4A 4R8HA 3C7EA 4WZFA 2XONA 5KC6A 1DQ1A 1RUH2 3VBRB 2R49A 4COZA 3ZXFA 5C3QA 3S7EA 4AI0A 3IIIA 5F39A 3BYWA 2ES3A 4NPMA 4HKOA 4TTGA 4JGYC 4BIFA 4UW5A 3HR9A 1W06A 3KF3A 3TEXA 3AXEA 4NVPA 3RMYA 4CP9A 4AL9A 2BBVA 2AREA 4HVQA 1CIWA 2XLAA 4D6RA 5BNPB 4QT6A 1H30A 4XUOA 2DBIA 5D21A 2BYVE 1US2A 4GWMA 1XE0A 3VZMA 2MPFA 1NQDA 2K2SA 3U75A 3WSOA 3MIHA 1KDKA 3R4SA 3FN9A 1KS4A 1LOCA 4M01A 3AP5A 1AL22 1OPMA 4OHWA 2P2KA 2EIEA 2GMPA 2W87A 1UX6A 3UT0A 2FDIA 2DFCA 2VM9A 4E4SA 3LFMA 4FPYA 1XBFA 4NWVA 4QPGB 5EHDA 5EPAA 1WW7A 4JKMA 5FZCA 5J36A 1ZM1A 4PT6A 2E6VA 3DEMA 5FYYA 1ND2B 2RS11 1OA3A 3WF4A 4ARXA 4CDXB 1QU0A 2BTVC 2NN8A 4MX3A 1Q8VA 1UF2C 3ZFEA 1J58A 1OA2A 2Q1ZB 1ZRCA 4HONA 4N7IA 3V64A 1PIV2 1JI6A 4HVRA 4PLOA 5F2WA 3RZGA 4MXWB 4A7ZA 4BQ4A 1UKGA 1TMF2 1O3TA 2GAUA 1RINA 2D6OX 4RYDA 4TLFA 3RZHA 2CHHA 2F17A 4Q0UA 5KHHA 1ULOA 4CP9B 1WW6A 1GYKA 1AR82 1OF3A 4GD4A 3ZMOA 2JKXA 1CZSA 5T5OA 1E57A 4ZS2A 4XXPA 4TYSA 4CXYA 3O0VA 4B4RA 3B94A 4Y26A 4YVSA 3I2IA 3PL0A 4OHVA 2WRAA 5F7UA 1FMD3 2UY9A 2YC2A 3MI8A 4XJUA 3ZYGA 1FPN1 3VBOA 2EIDA 1A6CA 1W6MB 3JUUA 2ZHMA 5IK5A 2XOMA 1S1AA 4P9IA 5F32A 4LBQA 2ZMLA 4AWDA 5HBAA 3OY8A 1ZBE1 4ES8A 4LMFA 5L7OB 3K77A 1DYOA 2VNVA 5J3UA 4GKXA 4CDQC 1FOD3 4GMP0 1W6NB 1MS9A 3OD4A 3ZFEB 5T54A 1QJX2 1XE7A 2ZGKA 1OFNA 2W5FA 4RS5A 3WNKA 4XFAA 5J96B 1DCSA 3GM8A 1W39A 3JQWA 2JG9C 3T0AA 3PUQA 2FDKA 3AFGA 1ZZCA 1Y43B 4I3PA 1CESA 2V5YA 4LUKA 1GICA 4LOTA 2JDUA 4O61A 5A33B 5CAZA 5FPUA 3DL3A 3MFCA 1J3PA 4LEJA 5DQ0A 4XYXA 3WQ1A 1CR7A 3ZXAC 1E5HA 2V73A 5FZHA 5K0UB 4LKSA 4OUMA 4ET7A 3VDCA 1JTZX 2FD8A 1BVVA 2GNTA 1XSQA 2CYFA 4YVSB 1SACA 2Y0OA 3BU0A 2DVAA 5I8SA 4BDVB 1IS5A 1RMU1 5CADA 1JZ7A 1UKRA 2HWF2 1TNRA 2VCMA 2AR6A 3MF6A 5FZ8A 3DPRA 3VD7A 3O1UA 3FUQA 4MZUA 2OT7A 2J22A 4V2WA 2BOIA 4YGCA 1WA6X 1RUG3 3NQHA 1D2QA 4BLJA 1JODA 4Z2WA 1JYIA 3A21A 1J83A 2H0VA 3C7GA 4UFHA 3MUY1 2HYKA 1YYNA 2WA4A 2XR4A 3HEIA 1Y3TA 2A6YA 3PVBB 5K9YA 1OBNA 3I2KA 5FOBB 5FR3A 1W90A 3K2OA 5A3UA 2VH9A 1GZ9A 2OX0A 3NSTA 4HK8A 5A3WA 3LF7A 3BKZA 4LK6A 2OUHA 3AM2A 1EYBA 5IYYA 5LK5A 1PM4A 4NROA 3SH5A 1SLAA 3ZIWA 5KXBA 4OHZA 3AZWA 2VGDA 1KEXA 3UKNA 3AX4A 4S2FA 1C4RA 4PQQA 5FKCA 1BCXA 1OD3A 1QQP1 1RTVA 2QZ2A 4QU2A 4K8FA 2C26A 1CN1A 1MPXA 1RHI2 2W1WA 3HMYA 3O1MA 4M3CF 1UCXA 4IGQA 4ZPIA 2OYZA 1W6PB 1VALA 3VKMA 4KWKA 5EFUA 4EWAA 3MIDA 3K75B 4FXKB 1A78A 1WCQA 3IPVB 3JBG1 3ZFFA 1FYUA 1KJRA 4W6WA 1CPMA 4JHTA 2HKXA 4XF4A 1YQ6A 4FT8A 4QWNA 4PBOA 3N9LA 5DAWA 4LLOA 1X50A 2Q0AA 2R071 2R1DA 3ZFGA 4CPBD 1F2NA 1WLWA 1ND3B 5A3MA 5FY1A 2DUQA 2I2SA 1POV3 3HPNA 2GC1A 4OZOA 1XPWA 3PMSA 5CKNA 1JHJA 1LJ7A 1HW5A 5A6XA 3WW2A 1DFQA 2XUMA 4RR3A 1RL3A 1HQWA 1S2KA 1SBDA 1HRV2 2WL1A 4JGZC 4LOSA 3ZSEA 4BOWA 1AR71 3ZYHA 2RE9A 5CKMA 4E8CA 3WUDA 4CEYC 4NHXA 3UGHA 4J25A 3AYDA 2QQUA 4BQ5A 2JB8A 2WA3A 3FHAA 1V6LA 4PCRA 3BTXA 3AKTA 1DHKB 1WMEA 2D6NA 3LAGA 5DXDA 2PELA 3MYXA 3OGVA 1LCLA 4NPLA 2BUKA 3NV2A 2C4XA 3ABZA 4W65A 5LEJA 1OQ1A 3IMMA 5LRRA 3R6SA 4HANA 2Y6JA 3ZFFB 5IK4A 1JOBA 1HQNA 3GGLA 1UNBA 4GWIA 3GBWA 3TEWA 1MZ6A 1WD4A 2A6ZA 3SHRA 1FPN2 5HCAA 1X8EA 3G7DA 1FNZA 3KT1A 4QXBA 1OHFA 1TME1 4LULA 1WMDA 2D40A 4XDQA 5KC5A 3I4IA 4Q26A 3FE5A 3LA3A 4YZ1A 2VMIA 4MSVA 3I3DA 4Y4YA 2PLV3 2CAUA 2GMMA 4RR3B 2BOJA 2IXIA 4GMP1 2C5DA 4K8RB 4IGOA 2C1FA 3WP3A 3TOJA 4BXFA 4MGIE 4PF5A 4LO7A 4NR1A 4AHXA 1ZVFA 5EIYB 1ZZ6A 1OVSA 5F1RA 1XC6A 2XDVA 2XJTA 3KGZA 2Y60A 5FYMA 5J98B 5IVJA 1Q8SA 4IERA 2UURA 1DYPA 4TLGA 5FTTC 1HDKA 2KR2A 5CFCC 4IEWA 3HJRA 2QQLA 3M8LA 3RG0A 4DY5A 1GBGA 2ZX0A 2LRPA 4QQPA 1EAH1 3VZJA 4BA6A 4UW6A 2F4PA 1ZZ7A 1QJU3 1UYPA 1OOPA 1QJEA 1RUF1 3NO8A 1SDWA 1N1SA 3A23A 4IDZA 4LIUA 1GWLA 1MQTC 2QQPA 4A6OA 4MLOA 4WZCA 3JD73 3OGRA 4DY3A 1VP6A 1RMU2 1DU3D 1XRUA 1LU1A 1AXZA 1S0EA 2PHRA 4E2SA 2Z5WA 1FX5A 1REFA 1W9SA 3ECQA 5GLTA 2BZDA 2PHUA 2YROA 1PVC1 4IV3A 1LU2A 4CE8A 2QQOA 3TAYA 4BPZA 4XABA 3SNMA 2YBSA 3OD0A 3OEAA 3BIEA 2BW8A 5F3GA 4JZRA 3ZN6A 1V6NA 1WKYA 4LITA 4DEVA 3C3VA 4BU2A 1AYN2 1PGW2 4FOQA 4YW7A 4OMCA 5FZ4A 1TQ5A 4ISQA 3RSJA 4KBZA 3WZ1A 2D6MA 2ZTNA 1LODA 4H2AA 1N3OA 3MHZA 3N7KA 1F5JA 1UU6A 3CQOA 2WWJA 3D6EA 2XPJA 1D4M1 1XNAA 4G3YC 5IVYA 3KCYA 2XQRA 1SPPB 1YFXA 2DUOA 1G9BA 2RMU2 3ES1A 3INAA 3QCWA 1S0BA 2PN5A
chains in the Genus database with same CATH topology
2VQUA 4QDRA 5EJZB 5JMOA 3WF1A 1UY1A 4FI9A 3C7FA 2VCBA 3OGSA 1JZ4A 4P02B 1GMMA 1SHWB 1UXZA 4L0PA 3MO4A 4XUQA 5JXHA 1TG7A 2Y6LA 3T0DA 2KD7A 3A7QA 3AC0A 3NJXA 2ID4A 3WNPA 4CU7A 3LQCA 2PQSA 2X05A 3MV01 4DXTA 2ZEZA 5HXMA 2WDBA 1UYZA 4QB6A 4QAWA 4A45A 2J1VA 1W0NA 5C70A 3SEPA 2J1UA 2VJXA 4JKKA 4AAXA 4LQRA 2W91A 5IFPA 3VDBA 4OMDA 2V4VA 4UAPA 1H6XA 3EB7A 4ARYA 1NX9A 3FHQA 4ZXEA 2VZPA 2J1TA 4XUTA 1UWWA 3ACHA 1UYXA 1T2XA 4A41A 2W3JA 1OH4A 1UX7A 1GUIA 1K12A 2W46A 3T0BA 1UYYA 5JXGA 1L7RA 4QPWA 5J1XA 2ORXA 1L7QA 5G04L 1UMIA 3SEEA 3IAPA 5IHRA 2B9VA 3K4DA 5IJRA 2WBKA 4W50A 3BN6A 1J84A 3I3EA 1I5PA 2CDPA 2VMCA 4QX2A 4CUBA 2RVAA 3NJVA 4OUEA 4DUXA 4XUNA 3LEGA 3NRUA 4MGQA 4ZY9A 1GU3A 3WF2A 2QBXA 1NAEA 2BGPA 1CIYA 3OBAA 5DMYA 4UI9L 4M4RA 4QDSA 3HOBA 2W47A 4P08A 1DP0A 2X09A 2WYSA 5HPOA 1DLCA 1KGYA 4KI5M 3I2JA 3CIHA 2VQTA 3DYOA 4DEQA 2E33A 2R7EB 2YB7A 3K4ZA 4BXSV 4LPLA 2VZVA 1H6YA 3THCA 4CUCA 4BK5A 4P5YA 3ACIA 3D3AA 2ZEXA 3I2GA 4A42A 1UY0A 2VZOA 4QX3A 1R64A 2QQNA 1GOFA 3I3BA 1JZ3A 4A4AA 2W9XA 2EIBA 3CMGA 2DCKA 5JUVA 2VCAA 3WF3A 1BHGA 1W8NA 2XHNA 1K3IA 1YQ2A 3ACGA 4P00B 2J1SA 2ZEYA 4QB2A 4MGSA 3HNYM 2WO3A 1JU3A 5DPNA 2V72A 3GDBA 2DDUA 2VZ1A 4XURA 2VZRA 2RV9A 3WNNA 1TVGA 3K46A 1JYXA 3T2QA 4QB1A 3C7EA 4JKLA 2XONA 3GXUA 2Y6HA 1XNTA 2QQMA 1HN1A 2BERA 5B4XA 4QX0A 3IIIA 5LA0A 3W5MA 2ZXQA 4TTGA 1O8PA 4DUVA 3FL7A 1JYWA 4ZZ8A 3VD5A 3C7OA 4XUOA 2VMFA 3SKVA 4IUGA 1US2A 4W8JA 3WSOA 3FN9A 1EUTA 2ORZA 2EIEA 2W87A 2VM9A 3IDAA 3OEBA 4CU9A 2VZTA 3HNMA 1JYNA 2WN3A 3J7HA 4JKMA 4CVUA 2HYXA 4PT6A 3UETA 3WF4A 4ARXA 4JX0A 5G05L 2XQXA 4UOJA 3I2HA 3VDAA 5JXIA 3WQBA 1JI6A 5DN2A 3LEIA 5FUIA 1SG3A 2JE8A 4RYDA 1OT5A 5JXJA 2L9LA 2LS6A 1ULOA 1OF3A 2JKXA 3CZJA 1PMHX 3NNGA 1CZSA 3UNPA 1P8JA 2Y6GA 2VL4A 3IAQA 3JXSA 2VO5A 4A44A 3CZUA 2J1RA 3I2IA 5IFTA 5F7UA 2YC2A 3OG2A 1W8OA 4RN5A 4Z2AA 3U37A 2EIDA 4LHSA 2XOMA 2VMDA 2LW8A 2CDOA 3K77A 1DYOA 3W5NA 2YFUA 3MV11 1JYVA 2ZEWA 2VOTA 3WNKA 2W5FA 1O59A 3I2FA 3MBWA 3GM8A 2YC4A 3T0AA 3VD9A 3WNLA 1CZTA 1GOGA 1PMJX 1K42A 5DQ0A 1SDDB 2WO1A 4LKSA 4ET7A 3VDCA 1CZVA 3T2OA 3ETPA 3THDA 2J1EA 3ACFA 4BDVB 1K45A 2B4KA 4JHZA 1JZ7A 2YFZA 1JU4A 3BGAA 3VD7A 2W95A 4KWUA 2J22A 4D8MA 1UY2A 4DUWA 2E32A 1F4AA 3T09A 4QDQA 3NQHA 2JD9A 2J1AA 3A21A 1J83A 3C7GA 5LCWL 1CX1A 3MUY1 2WAAA 3HEIA 2JDAA 3LE0A 4HG6B 4XUPA 4CU8A 3A22A 3PUIA 1O8SA 3I2KA 2WABA 1JZ6A 4GZ9A 5IYYA 4ZZ5A 1F4HA 2BBAA 1KEXA 1LNSA 2VTFA 2E31A 3LEKA 4PQQA 2VZSA 1OD3A 3PUHA 2C26A 1MPXA 2W1WA 1GQPA 4A3ZA 1EUUA 2V5DA 2QQJA 2VZ3A 2WZ8A 4TXWA 2DCJA 3K75B 1WCQA 4DXRA 4MO3M 2WN2A 1PX3A 2VMEA 1W9WA 3T2PA 2C9KA 4XVHA 2W1SA 4D0QA 3LPGA 3HPNA 4OZOA 1XPWA 1JHJA 1OF4A 2WZEA 2OKXA 3OB8A 1UY4A 4W4ZA 4XZUG 5JR2A 2W92A 2E26A 4MOAA 1W99A 4AG4A 4E8CA 1PX4A 1GOHA 3C8XA 2QQIA 3LPFA 4M4PA 3E1F1 3CKHA 2W94A 3DECA 3FHAA 5LA2A 2WAOA 3OGVA 2W1QA 2C4XA 3ABZA 2QQKA 2Y6JA 1UY3A 3GGLA 2X10A 4GWIA 3EYPA 2Y6KA 4YPJA 5B4NA 1GNYA 3WEZA 2J7MA 2HLEA 3F2ZA 3IB3A 1UMHA 4E8DA 3K4AA 2VR4A 3I3DA 2VCCA 2EICA 5I0DA 1US3A 5C7GA 1JZ8A 3I97A 2Z4FA 3WNMA 2YG0A 5EIYB 3CDZB 1XC6A 5C71A 5EJ1B 3VD3A 1JZ2A 1ULPA 3WF0A 3C7HA 1UZ0A 2WQ8A 3HJRA 2QQLA 3VD4A 2Y64A 4BK4A 3SKJE 2WO2A 2VZQA 3HN3A 3P1IA 4KMQA 5LA1A 1UXXX 2W1UA 5A1AA 3A23A 1RYYA 4A6OA 2VC9A 5CYYA 1IQDC 3OGRA 1JZ5A 1W9TA 1NKGA 3ECQA 1W9SA 3T08A 2BZDA 1NUKA 2QQOA 3HNBM 3MUZ1 4CUAA 2BGOA 3OEAA 4DEVA 1WKYA 2WUHA 3ZM8A 1D7PM 2RJ2A 4OMCA 5CZKA 3UESA 4DXSA 3P6BA 2Y8KA 3DYMA 4OYUA 4QX1A 4MADA 3CQOA 3DYPA 1XNAA 4PF1A 4CU6A 4BJ0A 2VZUA 4GWJA 3WNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQU A;  4QDR A;  5EJZ B;  5JMO A;  3WF1 A;  1UY1 A;  4FI9 A;  3C7F A;  2VCB A;  3OGS A;  1JZ4 A;  4P02 B;  1GMM A;  1SHW B;  1UXZ A;  4L0P A;  3MO4 A;  4XUQ A;  5JXH A;  1TG7 A;  2Y6L A;  3T0D A;  2KD7 A;  3A7Q A;  3AC0 A;  3NJX A;  2ID4 A;  3WNP A;  4CU7 A;  3LQC A;  2PQS A;  2X05 A;  3MV0 1;  4DXT A;  2ZEZ A;  5HXM A;  2WDB A;  1UYZ A;  4QB6 A;  4QAW A;  4A45 A;  2J1V A;  1W0N A;  5C70 A;  3SEP A;  2J1U A;  2VJX A;  4JKK A;  4AAX A;  4LQR A;  2W91 A;  5IFP A;  3VDB A;  4OMD A;  2V4V A;  4UAP A;  1H6X A;  3EB7 A;  4ARY A;  1NX9 A;  3FHQ A;  4ZXE A;  2VZP A;  2J1T A;  4XUT A;  1UWW A;  3ACH A;  1UYX A;  1T2X A;  4A41 A;  2W3J A;  1OH4 A;  1UX7 A;  1GUI A;  1K12 A;  2W46 A;  3T0B A;  1UYY A;  5JXG A;  1L7R A;  4QPW A;  5J1X A;  2ORX A;  1L7Q A;  5G04 L;  1UMI A;  3SEE A;  3IAP A;  5IHR A;  2B9V A;  3K4D A;  5IJR A;  2WBK A;  4W50 A;  3BN6 A;  1J84 A;  3I3E A;  1I5P A;  2CDP A;  2VMC A;  4QX2 A;  4CUB A;  2RVA A;  3NJV A;  4OUE A;  4DUX A;  4XUN A;  3LEG A;  3NRU A;  4MGQ A;  4ZY9 A;  1GU3 A;  3WF2 A;  2QBX A;  1NAE A;  2BGP A;  1CIY A;  3OBA A;  5DMY A;  4UI9 L;  4M4R A;  4QDS A;  3HOB A;  2W47 A;  4P08 A;  1DP0 A;  2X09 A;  2WYS A;  5HPO A;  1DLC A;  1KGY A;  4KI5 M;  3I2J A;  3CIH A;  2VQT A;  3DYO A;  4DEQ A;  2E33 A;  2R7E B;  2YB7 A;  3K4Z A;  4BXS V;  4LPL A;  2VZV A;  1H6Y A;  3THC A;  4CUC A;  4BK5 A;  4P5Y A;  3ACI A;  3D3A A;  2ZEX A;  3I2G A;  4A42 A;  1UY0 A;  2VZO A;  4QX3 A;  1R64 A;  2QQN A;  1GOF A;  3I3B A;  1JZ3 A;  4A4A A;  2W9X A;  2EIB A;  3CMG A;  2DCK A;  5JUV A;  2VCA A;  3WF3 A;  1BHG A;  1W8N A;  2XHN A;  1K3I A;  1YQ2 A;  3ACG A;  4P00 B;  2J1S A;  2ZEY A;  4QB2 A;  4MGS A;  3HNY M;  2WO3 A;  1JU3 A;  5DPN A;  2V72 A;  3GDB A;  2DDU A;  2VZ1 A;  4XUR A;  2VZR A;  2RV9 A;  3WNN A;  1TVG A;  3K46 A;  1JYX A;  3T2Q A;  4QB1 A;  3C7E A;  4JKL A;  2XON A;  3GXU A;  2Y6H A;  1XNT A;  2QQM A;  1HN1 A;  2BER A;  5B4X A;  4QX0 A;  3III A;  5LA0 A;  3W5M A;  2ZXQ A;  4TTG A;  1O8P A;  4DUV A;  3FL7 A;  1JYW A;  4ZZ8 A;  3VD5 A;  3C7O A;  4XUO A;  2VMF A;  3SKV A;  4IUG A;  1US2 A;  4W8J A;  3WSO A;  3FN9 A;  1EUT A;  2ORZ A;  2EIE A;  2W87 A;  2VM9 A;  3IDA A;  3OEB A;  4CU9 A;  2VZT A;  3HNM A;  1JYN A;  2WN3 A;  3J7H A;  4JKM A;  4CVU A;  2HYX A;  4PT6 A;  3UET A;  3WF4 A;  4ARX A;  4JX0 A;  5G05 L;  2XQX A;  4UOJ A;  3I2H A;  3VDA A;  5JXI A;  3WQB A;  1JI6 A;  5DN2 A;  3LEI A;  5FUI A;  1SG3 A;  2JE8 A;  4RYD A;  1OT5 A;  5JXJ A;  2L9L A;  2LS6 A;  1ULO A;  1OF3 A;  2JKX A;  3CZJ A;  1PMH X;  3NNG A;  1CZS A;  3UNP A;  1P8J A;  2Y6G A;  2VL4 A;  3IAQ A;  3JXS A;  2VO5 A;  4A44 A;  3CZU A;  2J1R A;  3I2I A;  5IFT A;  5F7U A;  2YC2 A;  3OG2 A;  1W8O A;  4RN5 A;  4Z2A A;  3U37 A;  2EID A;  4LHS A;  2XOM A;  2VMD A;  2LW8 A;  2CDO A;  3K77 A;  1DYO A;  3W5N A;  2YFU A;  3MV1 1;  1JYV A;  2ZEW A;  2VOT A;  3WNK A;  2W5F A;  1O59 A;  3I2F A;  3MBW A;  3GM8 A;  2YC4 A;  3T0A A;  3VD9 A;  3WNL A;  1CZT A;  1GOG A;  1PMJ X;  1K42 A;  5DQ0 A;  1SDD B;  2WO1 A;  4LKS A;  4ET7 A;  3VDC A;  1CZV A;  3T2O A;  3ETP A;  3THD A;  2J1E A;  3ACF A;  4BDV B;  1K45 A;  2B4K A;  4JHZ A;  1JZ7 A;  2YFZ A;  1JU4 A;  3BGA A;  3VD7 A;  2W95 A;  4KWU A;  2J22 A;  4D8M A;  1UY2 A;  4DUW A;  2E32 A;  1F4A A;  3T09 A;  4QDQ A;  3NQH A;  2JD9 A;  2J1A A;  3A21 A;  1J83 A;  3C7G A;  5LCW L;  1CX1 A;  3MUY 1;  2WAA A;  3HEI A;  2JDA A;  3LE0 A;  4HG6 B;  4XUP A;  4CU8 A;  3A22 A;  3PUI A;  1O8S A;  3I2K A;  2WAB A;  1JZ6 A;  4GZ9 A;  5IYY A;  4ZZ5 A;  1F4H A;  2BBA A;  1KEX A;  1LNS A;  2VTF A;  2E31 A;  3LEK A;  4PQQ A;  2VZS A;  1OD3 A;  3PUH A;  2C26 A;  1MPX A;  2W1W A;  1GQP A;  4A3Z A;  1EUU A;  2V5D A;  2QQJ A;  2VZ3 A;  2WZ8 A;  4TXW A;  2DCJ A;  3K75 B;  1WCQ A;  4DXR A;  4MO3 M;  2WN2 A;  1PX3 A;  2VME A;  1W9W A;  3T2P A;  2C9K A;  4XVH A;  2W1S A;  4D0Q A;  3LPG A;  3HPN A;  4OZO A;  1XPW A;  1JHJ A;  1OF4 A;  2WZE A;  2OKX A;  3OB8 A;  1UY4 A;  4W4Z A;  4XZU G;  5JR2 A;  2W92 A;  2E26 A;  4MOA A;  1W99 A;  4AG4 A;  4E8C A;  1PX4 A;  1GOH A;  3C8X A;  2QQI A;  3LPF A;  4M4P A;  3E1F 1;  3CKH A;  2W94 A;  3DEC A;  3FHA A;  5LA2 A;  2WAO A;  3OGV A;  2W1Q A;  2C4X A;  3ABZ A;  2QQK A;  2Y6J A;  1UY3 A;  3GGL A;  2X10 A;  4GWI A;  3EYP A;  2Y6K A;  4YPJ A;  5B4N A;  1GNY A;  3WEZ A;  2J7M A;  2HLE A;  3F2Z A;  3IB3 A;  1UMH A;  4E8D A;  3K4A A;  2VR4 A;  3I3D A;  2VCC A;  2EIC A;  5I0D A;  1US3 A;  5C7G A;  1JZ8 A;  3I97 A;  2Z4F A;  3WNM A;  2YG0 A;  5EIY B;  3CDZ B;  1XC6 A;  5C71 A;  5EJ1 B;  3VD3 A;  1JZ2 A;  1ULP A;  3WF0 A;  3C7H A;  1UZ0 A;  2WQ8 A;  3HJR A;  2QQL A;  3VD4 A;  2Y64 A;  4BK4 A;  3SKJ E;  2WO2 A;  2VZQ A;  3HN3 A;  3P1I A;  4KMQ A;  5LA1 A;  1UXX X;  2W1U A;  5A1A A;  3A23 A;  1RYY A;  4A6O A;  2VC9 A;  5CYY A;  1IQD C;  3OGR A;  1JZ5 A;  1W9T A;  1NKG A;  3ECQ A;  1W9S A;  3T08 A;  2BZD A;  1NUK A;  2QQO A;  3HNB M;  3MUZ 1;  4CUA A;  2BGO A;  3OEA A;  4DEV A;  1WKY A;  2WUH A;  3ZM8 A;  1D7P M;  2RJ2 A;  4OMC A;  5CZK A;  3UES A;  4DXS A;  3P6B A;  2Y8K A;  3DYM A;  4OYU A;  4QX1 A;  4MAD A;  3CQO A;  3DYP A;  1XNA A;  4PF1 A;  4CU6 A;  4BJ0 A;  2VZU A;  4GWJ A;  3WNO A; 
#chains in the Genus database with same CATH topology
 5E1R A;  5KBF A;  4DXZ A;  1OOP B;  5JMO A;  3WOG A;  4EN7 B;  3ZYJ B;  1PO1 3;  2P5B A;  1N1Y A;  3OGS A;  2ZAH A;  4ERO A;  3KLS A;  1LES A;  1POQ A;  1VBE 3;  2G9Z A;  1GMM A;  1LOF C;  5FWJ A;  2BNM A;  4AVA A;  3M7A A;  2WNU A;  3PJY A;  1YIF A;  3MO4 A;  4IV3 B;  3NKG A;  4AGV A;  1GR3 A;  1ULE A;  1YFW A;  2XVG A;  1SBF A;  3JBG 2;  4OI2 A;  1DZT A;  2JB4 A;  3ZN6 B;  3NJX A;  2ZHL A;  2EIG A;  4Q8L A;  2ZHN A;  5E6H A;  5A3P A;  3KSC A;  5D1I A;  4CU7 A;  3LQC A;  3RZJ A;  4IW3 A;  2R0H A;  4XJA A;  3S7I A;  3MV0 1;  3HWJ A;  1IHM A;  1W2A X;  2ZEZ A;  1MEC 3;  2F4L A;  2ADD A;  2ZMK A;  4N8M A;  5BPX A;  4ZKT B;  1O7F A;  1OVP A;  1UYZ A;  1D0H A;  4QAW A;  4GA9 A;  3AP6 A;  1QF3 A;  1S55 A;  1ZRR A;  3O12 A;  1UU5 A;  2WZR 3;  5BNO A;  2J1U A;  3PIJ A;  1WCU A;  3V0A A;  1AR7 2;  2W91 A;  3MW3 A;  4Q4V 3;  5BNN A;  3VDB A;  4Q4X 2;  1CAV B;  3AP9 A;  1GZW A;  1O5L A;  4RQP C;  4LNV A;  4Q1P A;  5ACA 3;  4ZXE A;  3FHQ A;  4QPI A;  4LOR A;  3ZN4 A;  2DBN A;  4CCE A;  3I2O A;  3ZN5 A;  4PDW B;  2RS3 2;  1HJG A;  4LLF A;  2SLI A;  4Q4W 3;  5EZW A;  3ACH A;  1DQ6 A;  2D7F A;  2VXR A;  4IND A;  4Y1V A;  3RJR A;  4LO4 B;  3RVH A;  2WNU B;  1PGS A;  3ETQ A;  5IK7 A;  5F5Q A;  2YU2 A;  2PHL A;  5FP7 A;  4CDW A;  2MHF A;  3RYP A;  1OH4 A;  1RXG A;  1BK1 A;  1OI6 A;  4Q2F A;  4ZXK A;  4Q0Q A;  3ZLI A;  1GUI A;  1K12 A;  2W46 A;  1GSL A;  1FV2 A;  4GH4 A;  4LBK A;  2DF7 A;  1TME 2;  1VRH 3;  3J7L A;  4Z1V A;  1UMI A;  4LE4 A;  2W2I A;  1S0G A;  2JKB A;  1Y9G A;  1ZZ8 A;  4QD2 A;  3SEE A;  5C8W A;  5LZ6 A;  2OXB A;  3K4D A;  5FLH A;  2WBK A;  1AR9 3;  2XWJ B;  1APN A;  1G8W A;  2R1B A;  1LTE A;  1WA4 A;  4PHZ A;  5H9R A;  1NA1 C;  4Q27 A;  4CA9 A;  2OPK A;  2VMC A;  2Z42 A;  4M00 A;  4QX2 A;  4M3C A;  3U78 A;  5BNN B;  2PXJ A;  1Q5O A;  5CFD B;  1CAU A;  4OUE A;  2X5I C;  4DUX A;  3RFR A;  3LEG A;  1MZF A;  3ROU A;  2DTY A;  4OI1 A;  5FK7 A;  4WVZ A;  3OPW A;  1U5Z A;  5ABJ B;  1NYW A;  2QDN A;  1LAJ A;  2ZAA A;  3ZYI B;  3USU A;  5GLW A;  3PME A;  4K3U A;  5TSW A;  5FK8 A;  3C2U A;  3RNS A;  3RYK A;  1ZBA 1;  1EAH 2;  1RUG 1;  4L97 A;  3TEY A;  2P1B A;  3OBA A;  4RFT 0;  2ZJC A;  1MS3 A;  1R08 2;  5DMY A;  4JTO A;  1LOA A;  2PHD A;  2IXK A;  3O0W A;  5ISL A;  2PYT A;  3J7N A;  4QDS A;  1LOE A;  1SCR A;  3GF6 A;  2N7G A;  4EZH A;  3MLK A;  3KQ4 B;  4GH4 B;  1RVF 2;  2WYS A;  4XEZ A;  2DCZ A;  4HKL A;  2A5Z A;  2D3P A;  4KI5 M;  1DQ5 A;  1PVC 2;  1XNK A;  3BOD A;  4LA2 A;  4YVW A;  2WQZ C;  3WQ7 A;  3DYO A;  2FDF A;  4F8A A;  4ZU4 A;  1V6M A;  4I0B A;  2YB7 A;  1PNF A;  1AXY A;  3PU8 A;  1GNZ A;  4S2G A;  4J6G A;  2PFW A;  2ZX1 A;  3VZO A;  1CPN A;  4CTE A;  4M3C B;  2E53 A;  2XKP A;  2QNK A;  1CAU B;  3I8T A;  3O5S A;  4XF1 A;  4XPV A;  4BK5 A;  4IEP A;  3ACI A;  2DVF A;  1J59 A;  3AMP A;  1JBC A;  4N43 A;  3D3A A;  2ZHK A;  4B7K A;  3O1O A;  2GP3 A;  1D4M 2;  4A42 A;  1UY0 A;  4YZ4 A;  1X36 A;  4QX3 A;  2H0B A;  2QQN A;  4UF0 B;  1Z78 A;  4PIZ A;  5C3O A;  2A1X A;  2EIB A;  2DCK A;  3EHK A;  5EXO A;  3OYW B;  5FRE A;  4BE3 A;  5FZ9 A;  1QIQ A;  3HIF A;  3W58 A;  5FYI A;  1KFX L;  1W8N A;  4AI3 A;  4PLN A;  2Y26 A;  1POV 1;  2QTW B;  3CEW A;  1ENS A;  3T4H B;  5FZ7 A;  3ATG A;  4QB2 A;  1GAN A;  4FQZ A;  2ILM A;  1SLT A;  5GLU A;  3E5U A;  3N9M A;  2CY6 A;  4A3X A;  1AYM 3;  3GDB A;  2CGP A;  2DDU A;  2XJS A;  2VZ1 A;  4YVW B;  4FVV A;  1NCR A;  4ATF A;  4C0B A;  2B9U A;  4CP1 A;  3WHU A;  3J8F 1;  2QFE A;  4IES A;  2XBO 3;  3VBS C;  3ZSL A;  4QGL A;  1W0P A;  3H1M A;  3SH4 A;  3V0B B;  2D3R A;  2EXH A;  2HBU A;  3WCS A;  1YWK A;  3Q8E A;  3TYJ A;  1CAX B;  5A7W A;  4WM8 C;  2Q1F A;  1JYC A;  2Y6H A;  2YBK A;  1XNT A;  4XHX A;  1GP5 A;  1HN1 A;  2BER A;  1FAY A;  1IPS A;  4N43 B;  3L2Y A;  5B4X A;  5HCB A;  3W5M A;  4OQ9 A;  3RZK A;  2R04 3;  1MS1 A;  2ZXQ A;  4LBQ D;  2VNO A;  4B3N A;  3E6D A;  2RJL A;  1JYW A;  4ZZ8 A;  1W03 A;  3VD5 A;  1ST8 A;  5CBL A;  4FOV A;  3VDD A;  4OZX A;  1FMD 2;  4I3G A;  1BYH A;  3Q8A A;  2RS5 3;  3AL6 A;  4IUG A;  4KWJ A;  2BWC A;  3SKV A;  4DFS A;  1G86 A;  5FO8 B;  2W0X A;  1BEV 3;  1DG6 A;  2HWE 3;  4W8J A;  3M3Q A;  1TEI A;  1H2L A;  2OW4 A;  2ORZ A;  4MXV A;  3ZMN A;  2PLV 1;  4AQ6 A;  2CNA A;  2ZAB A;  3IDA A;  3OEB A;  4CU9 A;  1JYN A;  2E9Q A;  2XB6 C;  2CGN A;  2WN3 A;  4PIX A;  1BZW A;  1NCR B;  3GHN A;  4HXC A;  4CVU A;  5A1F A;  2UWC A;  5JOX A;  1Z7S 3;  5LA9 A;  3UET A;  4BIS A;  1H8T C;  4JX0 A;  1H9W A;  1AX2 A;  2K46 A;  2P3I A;  4UOJ A;  4BQ1 A;  4Z8B A;  4BQ3 A;  2VVD A;  3KM5 A;  3VDA A;  2FMD A;  2A3W A;  2VUC A;  3H50 A;  4FPJ A;  3LEI A;  3VBU B;  4XFB A;  4R9A A;  2OZJ A;  1PIV 1;  3LDB A;  4NE9 A;  4QKD A;  5CU1 A;  1SZB A;  4I09 A;  4AEK A;  2JE8 A;  2JDN A;  1CX4 A;  4O9G A;  5C4W A;  1OT5 A;  4AGG A;  4H14 A;  4LJH A;  2LS6 A;  3RPQ A;  3S30 A;  4OHY A;  1SBE A;  2I45 A;  3ZYB A;  1K5M C;  5DUV A;  1VBB 3;  2H6B A;  3N3H A;  3ZKY A;  4AI1 A;  2AAC A;  1PMH X;  1NCQ B;  3NNG A;  3RQ0 A;  4R9B A;  1P8J A;  2Y6G A;  3MLJ A;  2VL4 A;  2WYF A;  2O8O A;  4B1L A;  3UNP A;  3H3Z A;  3JXS A;  4PI0 A;  4A44 A;  4HKW A;  4QHO A;  1G9A A;  4BYY A;  2E63 A;  3B01 A;  3VL9 A;  4CSW A;  2O0O A;  1W8O A;  3BOP A;  4RN5 A;  3U37 A;  2R32 A;  1QNW A;  4Z2A A;  4BLI A;  1RUG 2;  2NMN A;  4Q5O A;  1HB2 A;  1UU4 A;  3N7J A;  4LHS A;  4XCA A;  1OC1 A;  3VHN A;  4HT1 T;  4XOG A;  1X8M A;  2JDK A;  4B4Q A;  1XYO A;  5FLJ A;  4CDU C;  1QOS A;  3W5N A;  3SIT A;  2ZGO A;  3OBZ A;  1Q56 A;  1V6J A;  3GYD A;  5CEH A;  3H7Y A;  3HT2 A;  3ZSJ A;  4ORF A;  1O59 A;  3MBW A;  4COU A;  2WNV B;  3RRD A;  4AEM A;  5D8A A;  1E5R A;  1ZRD A;  4CEW A;  5CIR A;  2TNF A;  4RHV 3;  4X8P A;  4CRQ A;  1KIT A;  1GOG A;  2LRO A;  3LCP A;  1NLQ A;  3KHC A;  1C57 A;  1PK6 C;  2HWB 3;  1K42 A;  3ZPO A;  4HK9 A;  2R30 A;  4PI2 A;  1VBE 1;  4IEO A;  2WSV A;  4ASM B;  1WD3 A;  2WNE A;  2LM3 A;  2KM2 A;  4KU8 A;  5F3C A;  3ETP A;  3WG4 A;  1LKN A;  1OLQ A;  5F6L B;  5BY5 A;  4JGY B;  2B4K A;  3OCP A;  2YFZ A;  3DV8 A;  2YHJ A;  2OS2 A;  5BNP A;  3P3N A;  4AVC A;  2W95 A;  2VUJ A;  1V6K A;  4XTM A;  4OLL A;  2ARC A;  1UY2 A;  1DZQ A;  2LUW A;  3AL5 A;  3H42 B;  3WP5 A;  3SH3 A;  1QH7 A;  1DQ4 A;  2WAA A;  2F6B A;  2W68 A;  4JDO A;  4ONU A;  2ZGS A;  4P9G A;  4XUP A;  3MLL A;  5LB6 A;  2QUO A;  3A22 A;  3PUI A;  1BVP 1;  1O8S A;  4K20 A;  3J8F 2;  4QPG A;  4GB3 3;  5DG1 A;  2WAB A;  2B46 X;  1O91 A;  4I0W B;  1V00 A;  5JIA A;  3QH7 A;  1JZ6 A;  1NY7 1;  4FOY A;  2A75 A;  4Y22 B;  3AYE A;  4GZ9 A;  1DDL A;  3E5X A;  1ENX A;  3FUO A;  1WLC A;  1D2S A;  3H8O A;  1F4H A;  5FZK A;  4L11 A;  4DNY A;  4MXW A;  2ZGU A;  1R1A 3;  4YRD A;  2Y34 A;  2E31 A;  3LEK A;  4FP2 A;  4FXG B;  1IG3 A;  2UWB A;  1DGR A;  3AZX A;  1QDC A;  1XU1 A;  2HWD 3;  4Z82 A;  4A3Z A;  1GQP A;  1OLM A;  1LOG A;  4RA0 A;  4WM7 C;  2G19 A;  1N47 A;  2NQY A;  1RHI 1;  2VZ3 A;  5DAX A;  3TB0 A;  1O3Q A;  3RWN A;  4CP2 A;  3POF A;  1JUI A;  2XL9 A;  1W9F A;  4E4Z A;  1EY2 A;  4DXR A;  1S0D A;  1LR5 A;  5A3N A;  3NNJ A;  3VZK A;  3KV6 A;  2CTV A;  5IAV A;  3KGL A;  3M1H A;  1RJ8 A;  2DUP A;  4DIQ A;  2PLV 2;  2TEP A;  4QXK A;  5BXX A;  2AYH A;  3B02 A;  5IAX A;  1U12 A;  1W6M A;  3ES4 A;  4NHK A;  4N53 C;  3IKW A;  5L7O A;  1IS3 A;  4FFG A;  3WDU A;  4AED C;  5T50 A;  5C9A C;  2A6X A;  2D93 A;  2WZE A;  5JOW A;  1YI9 A;  1SMV A;  1W6N A;  2OKX A;  2WT2 A;  1HXS 3;  1UY4 A;  2JX9 A;  3UJQ A;  2FCT A;  1AR6 3;  2DCT A;  3H1W A;  1HRV 1;  2W92 A;  2UU8 A;  1W99 A;  2JG9 B;  5DAB A;  5SV5 A;  1PX4 A;  2UWA A;  4YZ3 A;  1RUD 1;  2K9Z A;  3LPF A;  1SLC A;  1QJU 2;  4LBO A;  4M4P A;  1WCS A;  2OQ6 A;  3E1F 1;  3MIG A;  2GN3 A;  2R0F A;  4NAO A;  4D7Y A;  3KB5 A;  1C8M 3;  2VNR A;  5A33 A;  2IXH A;  4D69 A;  2IC1 A;  4NIG A;  2WAO A;  2WS9 1;  5F9T A;  2K0G A;  1S2E A;  3JD7 2;  5FZL A;  4O7X A;  2JG8 C;  3SMH A;  4EZ4 A;  2QQK A;  2VNG A;  1RED A;  3EQE A;  5K0U A;  1UY3 A;  2Q30 A;  1ULF A;  1RUI 3;  2Y6K A;  3FHI B;  4YPJ A;  4B7E A;  3VBR C;  1HIX A;  1T6G C;  2ZX3 A;  2PHF A;  5E88 A;  5C5U A;  3RMX A;  4AI8 A;  4JV4 A;  1FT9 A;  2RR1 3;  3IB3 A;  1PHM A;  3WQ0 A;  4C91 A;  3K4A A;  1NXM A;  1JOP A;  5AFE A;  4XBN A;  4IE6 A;  2X29 A;  4K21 A;  5T3N A;  5I0D A;  2QVS B;  5H9S A;  4COW A;  2LTN A;  2AEN A;  1TZO A;  2X53 S;  1OLR A;  3BPS A;  4AOC A;  3BCW A;  2GC2 A;  1H1I A;  5EJ1 B;  5FXZ A;  5C71 A;  1COV 3;  3ME2 A;  3L2H A;  3X29 B;  3C7H A;  4KNC A;  4LBJ A;  5T5J A;  4BB3 A;  4Y1Y A;  5FPB A;  4V1P A;  3POY A;  4JDM A;  1PO1 2;  3NAP C;  4PBP A;  2Y64 A;  3GZE A;  3O7O A;  4RSU A;  2EAA A;  3GJA A;  2EA7 A;  2R06 3;  2VZQ A;  3HN3 A;  1VBE 2;  3VBH A;  2O8Q A;  1ND2 C;  1UXX X;  2W39 A;  2W1U A;  3K51 A;  3MIF A;  5FP3 A;  3VHP A;  4CDX C;  5IVB A;  2VOW A;  2FDG A;  2KXL A;  2ZAC A;  1DGL A;  2XHK A;  3D0J A;  5FZ0 A;  2VC9 A;  5CYY A;  3N9P A;  1JZ5 A;  1V9U 3;  1NT0 A;  2NYY A;  1ULC A;  2VQ0 A;  4HLT A;  2EF6 A;  4L92 A;  3T08 A;  3OBT A;  1GV9 A;  2ARB A;  4MVT A;  5FMD A;  1ZRE A;  1W6P A;  1E5S A;  3HNB M;  1C5H A;  4CUA A;  5AC9 3;  1X82 A;  3IPV A;  3TN9 3;  1OSG A;  1UAI A;  1YIP A;  2BDR A;  3WG1 A;  4XJ8 A;  3ZR5 A;  3VBF A;  1O5U A;  2WUH A;  4AHW A;  2WQ4 A;  1NOV A;  3AVS A;  1AYN 1;  3AMM A;  1PGW 1;  2G9G A;  3WNX A;  2WZR 2;  4AQS A;  5I0S A;  2XJR A;  5FYZ A;  4YAR A;  3AMQ A;  4CUG A;  4DXS A;  3AJZ A;  2Y8K A;  1ND3 A;  4HSL A;  4Q4V 2;  4MAD A;  4XFC A;  5JOY A;  3M3E A;  1LRH A;  5LK7 B;  3S0M A;  1NY7 2;  4OQ8 A;  4PF1 A;  1ASJ 3;  5ACA 2;  1BEV 1;  2FDH A;  4CU6 A;  4BJ0 A;  1PGL 2;  2BGC A;  1FV3 A;  4CCN A;  3B9C A;  4NHY A;  1RUC 1;  1GKB A;  2RMU 1;  1OUS A;  4IEV A;  2VQU A;  4JGZ B;  4Q4W 2;  3VBH B;  3WNO A;  4EV0 A;  2ZX4 A;  2NM1 A;  3WF1 A;  1F8V A;  2W52 A;  1UY1 A;  4FI9 A;  5I8T A;  3ZFE C;  1QKQ A;  1WMX A;  2CAV A;  2VCB A;  2E7T A;  4CEY B;  1JZ4 A;  1QJY 3;  3LSE A;  3ZX7 A;  1QGL A;  4BQ2 A;  4P02 B;  2JEN A;  2BNO A;  1SCS A;  1VBD 3;  4L0P A;  3WHT A;  1ONA A;  4OCT A;  1IKP A;  3FLR A;  3HQU A;  3PNA A;  3FLT A;  1EP0 A;  3S6P A;  3POW A;  2VOV A;  3HQX A;  4FP3 A;  3AC0 A;  5DZE A;  3WNP A;  2ID4 A;  3IDE A;  4FTB A;  3I54 A;  3VBF B;  1MQT A;  2PQS A;  1AR9 2;  1VBA 3;  2RM2 3;  3DCQ A;  4LBN A;  1H2M A;  3IDB B;  4FO9 A;  2CGO A;  5FKB A;  2BPA 2;  1WZX A;  3KZ4 C;  1DQ0 A;  2EXK A;  2FHR A;  4YVS C;  3SCH A;  1IOA A;  1VBB 1;  5F6K A;  5FZD A;  3A0N A;  2J1V A;  3VBO C;  5JZG A;  4QQ2 A;  4SLI A;  1QOT A;  3OUI A;  1GNH A;  4JKK A;  1YJK A;  2YC0 A;  1X33 A;  1YLL A;  4H7L A;  1AJO A;  2VU9 A;  1YXW A;  4IE4 A;  4OMD A;  3WDX A;  1ZX5 A;  4Q4X 1;  5CKQ A;  2JIJ A;  4XQ4 A;  1RUD 2;  1NX9 A;  3GBF A;  2VZP A;  1V70 A;  1MS5 A;  3PU3 A;  2XXZ A;  4RS5 C;  4XUT A;  3AP4 A;  1MR5 A;  5EQU A;  3VB9 A;  2RS3 1;  4P5H A;  2WS9 2;  3POS A;  4NUB A;  4GXL A;  4Q0P A;  1XNC A;  4P9Y A;  3OUH A;  2YMZ A;  4FPG A;  2W3J A;  4NHM A;  2O14 A;  2RJK A;  4LUM A;  3WNN A;  1UL9 A;  3MW2 A;  1VPH A;  2VOK A;  4YFZ A;  5HV4 A;  3OUJ A;  1MQT B;  3D8C A;  5JXG A;  1L7R A;  1U5I A;  1CJP A;  1W3V A;  1L7Q A;  1JUH A;  3M3I A;  4QPW A;  4RHV 1;  3OBR A;  2VE1 A;  5CB7 A;  3AXD A;  4LIV A;  3J4U H;  5G04 L;  3BTZ A;  2SBA A;  4NID A;  5KXD A;  1N1T A;  2HWB 1;  2JDM A;  4XF3 A;  5DAQ A;  4AFA A;  5DDJ 1;  4N7U A;  1X9T A;  5FZM A;  2JWP A;  4W50 A;  1JHN A;  1WBF A;  2VBD A;  3TNP B;  1NXD 1;  5JZG B;  1RUH 3;  1SFP A;  1J84 A;  1LED A;  1I5P A;  3DPR C;  3W21 A;  1IKQ A;  1Q8O A;  5FZG A;  4R9D A;  1PO2 3;  3S5A A;  4AFM A;  1FXZ A;  2DTW A;  1VMF A;  4C8D A;  3NV1 A;  1CON A;  3W59 A;  3DGT A;  3P5B A;  5A1L A;  4V2V A;  3RGB A;  5L73 A;  5A7Q A;  4LHL A;  5FJK A;  3ST7 A;  3E6C C;  4R4Z A;  1SPP A;  2BNN A;  1N1V A;  4X6R B;  3P3P A;  5GKA C;  3WW3 A;  4AF9 A;  2ETE A;  4ASK A;  4UI9 L;  1XYP A;  1R08 1;  3GJB A;  1AL2 3;  2HJI A;  1EV1 1;  4M4R A;  5FYC A;  1GP4 A;  5EWS A;  5IVF A;  3HBK A;  5FXX A;  2X09 A;  1S0I A;  3ALQ A;  3OPT A;  5HPO A;  5LEK A;  1O3R A;  1RVF 1;  1YFY A;  3FMG A;  1KGY A;  2YBP A;  1SFN A;  4U2A A;  1MZE A;  3RWK X;  2VQT A;  3VL8 A;  3NMB A;  1X9P A;  4DEQ A;  2E33 A;  3K4Z A;  4LPL A;  4MGY E;  3T2T A;  1TMF 3;  1QJZ A;  1JS9 A;  5K7P A;  3ZFF C;  1W2T A;  3M3O A;  5CVR A;  5APA A;  2XLF A;  2GNB A;  1SFY A;  4KH9 A;  1T6B X;  4QX8 A;  3IN9 A;  1H0B A;  2WT0 A;  1BEV 2;  3ZFG C;  1DBN A;  2P6H A;  2P17 A;  1MVQ A;  1R64 A;  3H1Y A;  3AB0 A;  3U1X A;  1RUC 2;  1NLS A;  4E9K A;  5D2A A;  4A4A A;  5C3S A;  1JZ3 A;  3FJS A;  4MYE A;  4WBB A;  5KHK A;  4S2D A;  4AVV A;  1R09 3;  2Q4S A;  1CAV A;  3ILN A;  4IEQ A;  3ZO0 B;  4RR3 C;  2RDR A;  2P3Y A;  1POV 0;  2ZKN A;  2OPW A;  5FYB A;  1YQ2 A;  3KV5 A;  4PDW A;  1W9Y A;  2J1S A;  2P34 A;  4XC9 A;  3GBG A;  3GZU C;  4GAZ A;  4UXA A;  4MGS A;  3ZOI A;  5FRA A;  3B9I A;  1JU3 A;  5DPN A;  2V72 A;  2VMH A;  1HXS 1;  5IUQ A;  1WWY A;  1QJX 3;  1D0G A;  1HB3 A;  2ZGM A;  1C1L A;  3POJ A;  1STM A;  2VZR A;  3PIG A;  4XXA A;  3ZXG A;  4TZD A;  2HWC 3;  4DRV A;  4C0H A;  2ZBJ A;  3PDQ A;  3MIB A;  4QB1 A;  3UJO A;  4FTS A;  3QBQ A;  2VVF A;  3U07 A;  2QZ3 A;  2QQM A;  1F9K A;  1VBB 2;  1W04 A;  2JDY A;  2JEM A;  5JDB A;  1C28 A;  1OD5 A;  1VR3 A;  1NG0 A;  4QX0 A;  5LA0 A;  1OH3 A;  3OTF A;  1AX1 A;  4IET A;  3SLI A;  3NNL A;  1A34 A;  1XXN A;  2GP5 A;  5JI9 A;  4O65 A;  3C7O A;  1ZRI A;  3NV4 A;  1NA1 B;  2V4A A;  1OQD A;  5FP9 A;  2VMF A;  4E2Q A;  1FMD 1;  2ADE A;  5BUV A;  5CFD A;  4DMI A;  1C8N A;  4SBV A;  5FYU A;  3QD6 A;  2HWF 3;  3HVD A;  5DAV A;  1HRI 3;  4UW3 A;  4YW1 A;  5ABJ A;  3LDR A;  4XIO A;  3FLP A;  4HPK A;  4YZ2 A;  4EWE A;  3G6J B;  1WMF A;  3TBD A;  1YHF A;  3RI8 A;  1FOD 1;  5JCT A;  3VV1 A;  5FZO B;  2BJS A;  5FY5 A;  4K7J A;  3AVR A;  1NZC A;  4Q4Y 3;  4AFC A;  3I2D A;  1GQH A;  3SXW A;  2XQX A;  1VAV A;  3HQR A;  5FV3 A;  4RHV 2;  2VXJ A;  5JSP A;  3S57 A;  4TSV A;  4HVO A;  2FMY A;  1OOP C;  2YZ4 A;  4QM9 A;  1PZ9 A;  4PLM A;  3ZXJ A;  3EXU A;  3OPZ A;  2HWB 2;  3M2M A;  3BTY A;  5DDJ 2;  4NRQ A;  1QWR A;  4LKF A;  4XBQ A;  5FUI A;  4P9W A;  4XFF A;  2Y38 A;  3KF5 A;  3BUC A;  2D6L X;  1VAK A;  2O1Q A;  4HL0 A;  4QXC A;  1ZRF A;  2B7Y A;  3O1V A;  3KQR A;  3K3N A;  4IV3 C;  5FXW A;  1B35 C;  3CZJ A;  1BQP A;  4FFF A;  3ZKU A;  3IAQ A;  3V56 A;  3RDI A;  2ZGN A;  3MIE A;  5IW0 A;  5FZE A;  4M3C E;  4YM1 A;  2Q8O A;  3WD5 A;  5IFT A;  5FY0 A;  3LWC A;  1XND A;  3OG2 A;  4HPK B;  3ZYF A;  1O3S A;  1IS4 A;  2KA3 A;  4DS0 A;  2VVE A;  3DXT A;  1HB1 A;  4UF0 A;  3I49 A;  3O1T A;  4CCC A;  1EV1 2;  4Y5Z 0;  3ASI A;  4AR2 A;  4AYU A;  3OYW A;  2EAK A;  1SLB A;  1F31 A;  2YFU A;  4K6B A;  2ZPX A;  3WY6 A;  4AQT A;  1JYV A;  5GAL A;  1WGP A;  5LBE A;  1DGW A;  4GB3 2;  3PVE A;  4XFH A;  5JMC A;  2QE3 A;  3I2F A;  3UV9 A;  2RS1 3;  2YC4 A;  3THP A;  1ASJ 1;  2JDP A;  4CCD A;  2DV9 A;  3WNL A;  4FPF A;  2B45 X;  1FI2 A;  4QX7 A;  5J48 A;  1CZT A;  1GWM A;  1WCD J;  2EVX A;  1AUY A;  1QY4 A;  1ACC A;  3MW4 A;  4QPY A;  4CCL A;  4CPB A;  4D94 A;  1PMJ X;  2GU9 A;  1DGW X;  2G1M A;  1R1A 2;  2WNU C;  5T55 A;  5A3T A;  5ANN A;  1AL0 G;  3V0B A;  5J37 A;  2P6C A;  5FAX A;  3WVJ A;  1KJL A;  1CAX A;  3AMN A;  1CZV A;  1VBD 1;  1QOO A;  3FFZ A;  3I3M A;  3THD A;  2J1E A;  4YYO A;  4EQV A;  2ZMN A;  4CCM A;  4IEX A;  3ACF A;  2Q1M A;  3JZV A;  3WUC A;  5IVC A;  1K45 A;  3VLB B;  1XE8 A;  1MVE A;  2WO7 A;  4QKN A;  1JU4 A;  1KXG A;  2VMG A;  4A6S A;  1VBA 1;  1W8W A;  2AUY A;  3HBZ A;  1Y7B A;  5BNO C;  4D8M A;  4DUW A;  1A3K A;  2PTM A;  3T09 A;  4EN6 B;  1WUV A;  2C24 A;  2JD9 A;  4QDQ A;  3WLU A;  2J1A A;  3ZDS A;  5BNN C;  1ZBE 3;  4RL7 A;  5JPN B;  1CAW B;  2WFP A;  3LA7 A;  4YZ5 A;  3S5Q A;  1I5Z A;  4QPI C;  4AVS A;  2GH8 A;  1HXS 2;  4HG6 B;  4XET A;  4G4F A;  2WIN B;  1AR6 2;  3PHM A;  4H7M A;  5L36 A;  4AHY A;  2AH2 A;  3OOX A;  5FMC A;  4F83 A;  2I74 A;  1H8T B;  2HH9 A;  3CBN A;  3WR0 A;  4CDW C;  4ZZ5 A;  5DZG A;  1I1E A;  2DVG A;  1KD7 A;  2BBA A;  4FPK A;  4GAL A;  2UYB A;  3CJI A;  3VBU A;  1CWP A;  2B8M A;  3IIA A;  1BLZ A;  1L7L A;  1LOB A;  3JB8 A;  2XUE A;  4GH4 C;  4LO6 B;  3QH6 A;  3PUH A;  3R4U A;  1DF0 A;  4WVM B;  4Q0V A;  3WG2 A;  2V5D A;  2QQJ A;  4KL1 A;  5FP8 A;  1A8D A;  4FSJ A;  2DFB A;  3LDK A;  4QQH A;  5JWP A;  1NCQ A;  3PLQ A;  1W8F A;  2Y0I A;  4EN9 B;  1LGB A;  5M0T A;  4MO3 M;  2WN2 A;  1QH6 A;  5JPM B;  4OI0 A;  2VME A;  4QGN A;  1QMJ A;  3UK9 A;  1W9W A;  2CU5 A;  2RR1 2;  1CQ9 A;  3LOI A;  4MH0 E;  2C9K A;  4C1X A;  5C8C A;  2NP0 A;  1XU2 A;  2PHX A;  1YRZ A;  4X8N A;  5LBB A;  4IEZ A;  4XVH A;  4YW4 A;  2YV8 A;  3N9O A;  1FOD 2;  1AX0 A;  5DZF A;  5JI7 A;  4D0Q A;  4XCB A;  3UKT A;  5GZG A;  5KHG A;  4XAE A;  3OJB A;  4QHB A;  4LHN A;  4NPR A;  4CDU B;  1UIJ A;  4D7S A;  2JIC A;  1JOJ A;  1COV 2;  3ZXD A;  2PAK A;  2JE9 A;  3H8U A;  4AK3 A;  3VHR A;  4FQ4 A;  5FZ6 A;  2WNV A;  4OHX A;  1PNG A;  3CJI B;  3M4F A;  2E26 A;  2ZGT A;  3ELN A;  3WW1 A;  3LB9 A;  1PVX A;  1YQC A;  2G4I A;  1K5J A;  2R06 2;  3C8X A;  3BPZ A;  4E4D X;  4BMB A;  3CKH A;  1QJU 1;  3DEC A;  5LA2 A;  4MET A;  3T1M A;  4YGB A;  1LEC A;  3IWZ A;  4J1W A;  4YVW C;  1QQP 3;  3ZYP A;  5LY1 A;  4EE2 A;  5A80 A;  2GNM A;  1QXP A;  4IV1 A;  4A7K A;  4B29 A;  3JD7 1;  1X7N A;  1Y9M A;  5HI0 A;  3I3Q A;  1REE A;  1G9D A;  1O4Z A;  4AVB A;  1PMI A;  2JEC A;  4HOO A;  1KS5 A;  5C8C B;  3WX5 A;  3B00 A;  4UW4 A;  5AC9 2;  4AQ2 A;  1DZR A;  1GNY A;  3CF6 E;  3TN9 2;  3WIN E;  1S4C A;  4JGY A;  3ENR A;  3O1R A;  3E5Q A;  4QXH A;  4XW3 A;  2J7M A;  2HLE A;  2AZ5 A;  1O4T A;  4WV8 A;  1O4Y A;  1VAM A;  3PUS A;  4I0A A;  1UMH A;  2IXC A;  2E7Q A;  4UFI A;  5FMO S;  1WLD A;  2R07 3;  3JQX A;  4DIN B;  4YW2 A;  5FJH A;  1W6Q B;  5FZB A;  2EIC A;  5KR7 A;  1UOJ A;  4D6S A;  4CCJ A;  2Q8C A;  3I97 A;  2Z4F A;  1CVN A;  3WNM A;  1ASJ 2;  2D6P A;  2YG0 A;  5GZE A;  3RZM A;  2ZGQ A;  4XE9 A;  3VD3 A;  4JC1 A;  3O1S A;  4AEJ A;  1C1F A;  2ET1 A;  1JZ2 A;  5LY2 A;  3WF0 A;  1V6O A;  3PTR B;  3VD4 A;  4BK4 A;  4Y22 A;  1PO1 1;  2WO2 A;  4LO8 A;  5JVV A;  1NCR C;  1QJY 2;  4XMA A;  1W8T A;  1S2B A;  4IV1 B;  1DYK A;  2ZZQ A;  1LEM A;  1VBD 2;  2DCY A;  2D44 A;  5A7P A;  3ZDV A;  3AZV A;  1KDM A;  3H8X A;  1RYY A;  4MHU A;  1ODN A;  2DU1 A;  2TBV A;  2FQP A;  4Y33 A;  1ZZ9 A;  4MGZ E;  3THT A;  5HV0 A;  5IAT A;  4WM7 B;  1W9T A;  2HWC 1;  2Y33 A;  2XG3 A;  2RM2 2;  1VBA 2;  4AAP A;  4MGT A;  1W6O A;  2FCV A;  1MS4 A;  2A3Y A;  1G6N A;  3KV4 A;  4HFS A;  1AXK A;  2BGO A;  3GHM A;  1MEC 1;  4QU1 A;  1UQX A;  1GWK A;  3VDD C;  3ZM8 A;  1D7P M;  5B2G B;  1CGP A;  2RJ2 A;  1TE1 B;  5EYX A;  3QOP A;  4NHL A;  2VW0 A;  4XTP A;  1LHV A;  2WZR 1;  5FY7 A;  3P6B A;  5A3L A;  4Y20 B;  4GMP 3;  3DYM A;  3ZPY A;  4OYU A;  4D6Q A;  5HCH A;  4QX1 A;  2J42 A;  5I91 A;  1ULG A;  4Q4V 1;  4JRL A;  2MEV 3;  3DYP A;  1J1T A;  1SLL A;  1NQJ A;  2CL2 A;  3LA2 A;  5C9A B;  2CWM A;  4COV A;  5KHI A;  1WLT A;  4HN1 A;  4CDQ A;  5ACA 1;  1OA4 A;  2VZU A;  5LRS A;  2BWA A;  1HRI 1;  1Y9Q A;  3VKN A;  3AK0 A;  1PGL 1;  5EJZ B;  1AHS A;  4AVT A;  3A4U A;  5BV6 A;  2RG4 A;  4Q4W 1;  2AEY A;  2XWB B;  2JG9 A;  5JSR A;  4O9E A;  5LWB A;  3H3U A;  3AZY A;  2D97 A;  4FPC A;  1RUF 3;  1UOB A;  1I3H A;  4Y5T A;  3I59 B;  3LD8 A;  4FFI A;  1W6O B;  5C4W C;  1OLM E;  1ZA4 A;  5DG2 A;  2ZZJ A;  2DYC A;  2Y6L A;  3T0D A;  3VN4 A;  1Q8P A;  3N7M A;  2IXJ A;  1VRH 1;  3A7Q A;  4NJ4 A;  1PVC 3;  2JDH A;  2I07 B;  2Q5T A;  2X05 A;  5A7O A;  2DVB A;  1AR9 1;  3AJY A;  3QLQ A;  4QGM A;  4ES9 A;  4DXT A;  2WII B;  1WW5 A;  2D5F A;  5AVP A;  4QB6 A;  5JOZ A;  2JD4 A;  4AXO A;  5I93 A;  4ASL A;  4K1Z A;  1PO2 2;  5F3I A;  2VQA A;  3Q8C A;  1VBC 3;  3BOW A;  1CJD A;  1RUJ 3;  3WDT A;  3GAL A;  4CDQ B;  2ZCW A;  4NRM A;  5FZA A;  4MHR A;  3MPP G;  4E2G A;  1D4M 3;  2V4V A;  1B09 A;  4U36 A;  5EJ3 A;  1HN0 A;  3EB7 A;  1F5F A;  3WP4 A;  4B1M A;  2BVB A;  3NW4 A;  3GZT B;  3HAG A;  3WG3 A;  5J09 A;  4JCK A;  4LBM A;  2XH6 A;  1EPZ A;  1IS6 A;  1VMH A;  3LIH A;  5DUW A;  4OUS A;  2YU1 A;  3VGI A;  1UYX A;  5L19 A;  2DWR A;  1UW8 A;  3ZR6 A;  3NAP B;  5D8A C;  1T2X A;  3NNM A;  4CEW C;  4R52 A;  3RZZ A;  5FBJ A;  1W2O A;  2XKO A;  4P9J A;  4AGR A;  5L9B A;  1FAT A;  2BVV A;  3H0O A;  3OF1 A;  1LEN A;  3LFI A;  4GJZ A;  4AZZ A;  5LBF A;  2QQW A;  1UYY A;  3SCG A;  5J1X A;  2ORX A;  4EN8 B;  2RDS A;  2Q8D A;  1W3X A;  3WW4 A;  1DLL A;  3IAP A;  4XF9 A;  1HX6 A;  3ZIX A;  2OVU A;  2VEC A;  2WSU A;  2JDZ A;  3BN6 A;  4UBG A;  1AZD A;  2MNG A;  5BNP C;  3VKF C;  3KMH A;  3KT4 A;  5I0T A;  3U14 A;  1UZY A;  4FAH A;  2VAU A;  1GZC A;  2RVA A;  3ITQ A;  2VUL A;  4X6Q B;  5GLV A;  3KWV A;  2ZGR A;  5FMO L;  4XUN A;  1OKQ A;  3N36 A;  3CO2 A;  4FAG A;  1URX A;  3POB A;  5EV7 A;  3BI3 A;  3NRU A;  4MGQ A;  4ZY9 A;  4OVE A;  2ET7 A;  1GU3 A;  4LHK A;  1R09 2;  2XGX A;  3POI A;  4JTN A;  1NAE A;  1ULD A;  2VW1 A;  4KQ7 A;  3ZVX A;  1PM7 A;  2TUN A;  4W6X A;  3DXU A;  4LTA A;  4FBF A;  1LGC A;  1QJF A;  1YUD A;  1F15 A;  1YEW A;  2ATF A;  3CJX A;  3NJY A;  4JGZ A;  4QPG C;  5GZF A;  5LAT A;  3ORJ A;  1OMI A;  2IVJ A;  3FFQ A;  2HEY F;  2W47 A;  3UYJ A;  1Q8Q A;  2W08 A;  3HT1 A;  5FQ0 A;  2WWU A;  1AYM 1;  2WT1 A;  3BTA A;  4P08 A;  4YGE A;  4CEY A;  1AJK A;  3IM0 A;  1GP6 A;  1DLC A;  1FNY A;  4JVA A;  2HWC 2;  3IT8 A;  2XBO 1;  3Q8B A;  2WZP P;  5KHJ A;  3L9J T;  2RDN A;  1W2U A;  2IFR A;  4NO4 A;  4CCK A;  4HET A;  1MEC 2;  5FZ1 A;  1W8H A;  2VTX J;  2FDJ A;  2VG9 A;  2R7E B;  3K48 A;  4P14 A;  4IE5 A;  5C33 A;  5T5P A;  5CG8 A;  2WC2 A;  5FYS A;  2R04 1;  4QX5 A;  3AMH A;  3AYC A;  4NAM A;  4P5Y A;  3O0X A;  4P9L A;  4D7T A;  1XQN A;  3MF9 A;  3I2G A;  2VW2 A;  3DKQ A;  3F95 A;  1HB4 A;  1H2K A;  2RS5 1;  3NWK A;  2GDF A;  3VBO B;  2C9A A;  1Q43 A;  2VZO A;  1JN2 P;  2HWE 1;  3FZ3 A;  3GZA A;  4JAA A;  1GOF A;  2C0Z A;  3I3B A;  1HRI 2;  5CG9 A;  4LBQ B;  2JE7 A;  3VZN A;  3OY8 B;  5L7O C;  3UL2 A;  5J7M A;  1MS8 A;  1WW4 A;  1RC6 A;  4N9I A;  4YG3 A;  1QHD A;  2VCA A;  1ZBA 3;  5F5C A;  2D3S A;  3ZXL A;  1BHG A;  3DKW A;  5A7S A;  5FQ0 B;  2XHN A;  4ITC A;  1R1Z A;  4RS5 B;  4GUL A;  4LK7 A;  1RUE 3;  2ZEY A;  2D43 A;  1H2N A;  5CFC A;  4Q4Y 2;  1Z7S 1;  4QKB A;  1D4V B;  4XDP A;  3MZH A;  3VKO A;  2BRT A;  3LGR A;  1N3Q A;  5FY8 A;  4S2H A;  4XUR A;  3UGF A;  1OFS A;  3BVC A;  1VRH 2;  4AW7 A;  3AP7 A;  2VOX A;  1TVG A;  3K46 A;  2AGS A;  1VE0 A;  1JYX A;  1QEX A;  2BEO A;  4XHB A;  1W2N A;  1YQ5 A;  4JKL A;  5K0U C;  5F8P A;  3GXU A;  4HSJ A;  3TNQ A;  5I8Y A;  3ZXK A;  1XOY A;  4L8Q A;  4Y3O A;  4A7Y A;  4YGD A;  4E27 A;  2Z69 A;  2LAL A;  1O8P A;  3Q9O A;  3FL7 A;  2A6V A;  4IEU A;  4RGA A;  4AI9 A;  4DUV A;  2PHT A;  3EO6 A;  3VUO A;  4CCO A;  3KVA A;  5A6Z A;  3DPR B;  4K9S A;  5KWR A;  1RIT A;  5C6C A;  3HN1 A;  5H9P A;  4BIO A;  5FPX A;  1BBT 3;  4URA A;  5FXV A;  2YDE A;  2YPJ A;  5FDB A;  2WFF 3;  3JB4 C;  4QQL A;  2P3J A;  4LE3 A;  4XF0 A;  1EUT A;  2PAM A;  2QQV A;  3AYA A;  5CFC B;  1OKO A;  3POE A;  3LKJ A;  2VZT A;  2Z2S B;  3HNM A;  3MDP A;  2FZ1 A;  5L9R A;  5FBZ A;  4GIQ A;  1SQ4 A;  3J7H A;  2DVD A;  2RS1 2;  2OUJ A;  3QAC A;  2HYX A;  3KS7 A;  1VMJ A;  2A71 A;  1IGO A;  4QM8 A;  4XAC A;  5G05 L;  5FPV A;  4URT A;  1XNB A;  3I2H A;  4ZS3 A;  3VBH C;  1NZI A;  4IEY A;  3J8F 3;  5FWE A;  4IE0 A;  5JXI A;  1SEF A;  3WQB A;  4ZU5 A;  5A6Q A;  5DN2 A;  1PZ8 A;  2VPV A;  1LOF A;  3GCX A;  1YO8 A;  1WCK A;  1H8V A;  2HEW F;  3IMN A;  3KT7 A;  1OUR A;  3WT3 A;  1SG3 A;  4FPE A;  1C3H A;  5JXJ A;  5FZ3 A;  4K1Y A;  2L9L A;  2QDR A;  4YFW A;  2EXJ A;  3TWI A;  1Y4W A;  3USS A;  4A2U A;  1EPW A;  2YGM A;  1RGS A;  3BIW E;  5C3R A;  1OPO A;  5IT6 A;  1YNA A;  1ZZB A;  2VO5 A;  3PJQ A;  3VBF C;  3CZU A;  2A73 B;  2J1R A;  3N4M A;  4DZG A;  3R05 A;  2PMW B;  4JQT A;  3GNE A;  3ZFG B;  1ND3 C;  2A7A A;  3Q8F A;  2VMD A;  1ZBE 2;  2LW8 A;  2CDO A;  2Z79 A;  3H8R A;  4COY A;  3U4X A;  4UFM A;  4XJ9 A;  4RQP A;  3MV1 1;  1KQR A;  1IPJ A;  4Y1Z A;  1AYM 2;  5GLZ A;  2ZEW A;  3W9A A;  4WVW A;  2VOT A;  2PAE A;  5FLI A;  1YQ8 A;  4GB3 1;  4N90 A;  2DUR A;  1NLR A;  2MEV 1;  2XBO 2;  3SC7 X;  4DRR A;  4QQO A;  3VD9 A;  3WXP A;  4Q1R A;  3PVN A;  2VUA A;  4YM2 A;  2GME A;  3FWE A;  3V65 A;  2EAL A;  5A6Y A;  4B8E A;  1J3R A;  3LOB A;  1AVB A;  1UZZ A;  1BJQ A;  1QXR A;  1PIV 3;  5GZC A;  3POG A;  1O6U A;  2XJV A;  4YSF A;  1R1A 1;  4LBL A;  2R04 2;  2BV4 A;  1SDD B;  5FFO C;  4NIA A;  3NVC A;  2WO1 A;  4HMZ A;  1UIK A;  2HWD 1;  4ISR A;  2VTX A;  1ENR A;  2WKK A;  2VUD A;  3FC0 A;  1UPI A;  4UFJ A;  3FBM A;  5JAX A;  4I01 A;  4JRA A;  3T2O A;  2WNO A;  4FPO B;  1AR8 3;  2RS5 2;  5DUU A;  4LA3 A;  4IE7 A;  5F5I A;  1E5I A;  2HWE 2;  5I0R A;  1XYN A;  4E4H A;  2AEZ A;  1C5I A;  4JHZ A;  5A70 A;  1RB8 G;  1NA1 A;  4CXX A;  1DGR N;  1B35 A;  3BGA A;  3J9S A;  1JH5 A;  5LAS A;  5FYV A;  5JZG C;  1QNY A;  4KWU A;  2HEV F;  4RQP B;  2GC0 A;  2E32 A;  1F4A A;  3NJZ A;  2X5I A;  1IZ3 A;  2V09 A;  1S0C A;  5E89 A;  5JLV A;  2YYO A;  4EYU A;  4MV2 A;  4UFL A;  1S0F A;  5LCW L;  1CX1 A;  1Z7S 2;  1JMU B;  2GAL A;  5CIS A;  4XFI A;  1J3Q A;  1VBC 1;  5JIU A;  2JDA A;  1RUJ 1;  2ZGL A;  2BQP A;  3LE0 A;  4FPH A;  4BZ4 A;  4CU8 A;  5FZO A;  1G9F A;  3GCW A;  4EWD A;  1AR6 1;  4XZP A;  1W8Z A;  1QDO A;  1ZA7 A;  1H4H A;  2WJS A;  4XQD A;  4YLZ A;  3RZL A;  2IWG B;  3T30 A;  1YFU A;  4DB5 A;  3IDC B;  1U5Y A;  3KCX A;  3WCR A;  5ERL A;  4I2O A;  4NII A;  5JR7 B;  1C8M 1;  2NMO A;  5FUN A;  1LNS A;  1QQP 2;  2VTF A;  3KHB A;  5FY9 A;  2VZS A;  1AF9 A;  1XJA A;  3J26 N;  5FIX A;  1IPK A;  1EUU A;  4AE2 A;  2ENR A;  3AKR A;  3O1P A;  4KU7 A;  2IZW A;  3MIC A;  4KWL A;  1RUI 1;  1B35 B;  5IVE A;  2WZ8 A;  1F35 A;  2VD7 A;  4TXW A;  2DCJ A;  3MGU A;  4Y4R A;  1BK0 A;  1JW6 A;  1M4W A;  1PX3 A;  2X5I B;  2ZGP A;  5LBC A;  3U11 A;  3ZSK A;  3E97 A;  3T2P A;  5F2S A;  2RR1 1;  4JQR A;  4MUV A;  2R07 2;  1HQL A;  2FCU A;  5KXE A;  2HBT A;  2W1S A;  5EYY A;  1UO9 A;  2P37 A;  4NOT A;  3LPG A;  3ON7 A;  1A8M A;  5BYN A;  3CU7 A;  2QCS B;  1V0A A;  1BKZ A;  1I9R A;  3R4D B;  1OF4 A;  1ZNP A;  4RFR B;  1KFU L;  4N9H A;  4YNI A;  3CNA A;  1KRI A;  2XML A;  3OB8 A;  3URF A;  1COV 1;  4FOW A;  4BM8 A;  2D5H A;  4W4Z A;  1UD1 A;  4XZU G;  5JR2 A;  1SLI A;  2A70 A;  4MOA A;  1HKD A;  2IVI B;  4AG4 A;  1VRB A;  3PUR A;  3U10 A;  1RUN A;  1GOH A;  1DIW A;  1S0J A;  2QQI A;  2XLG A;  5F37 A;  2R06 1;  2VY0 A;  3M70 A;  2W94 A;  2JXA A;  4XFG A;  3T1L A;  3APB A;  4ZU7 A;  4CYD A;  3VBS A;  5FZI A;  2BU9 A;  3CLP A;  4HN0 A;  2W1Q A;  4GJY A;  4IL7 A;  5K8S A;  1UPS A;  3OGJ A;  1V9U 1;  2OZ6 A;  1RHI 3;  2X10 A;  4WM8 A;  3EYP A;  2XL7 A;  4PQ9 A;  4YG6 A;  5B4N A;  1VIW B;  3WEZ A;  5AC9 1;  4XDO A;  3TN9 1;  5FCC A;  1U0A A;  5SV8 A;  4OUL A;  1H4G A;  3JCI A;  1M06 G;  3B5L B;  3F2Z A;  4E8D A;  2YY1 A;  2CSG A;  2VR4 A;  1UN1 A;  4YG0 A;  5BNO B;  2FBE A;  5FP4 A;  2VCC A;  4YW3 A;  3V0A B;  5L9V A;  1US3 A;  2X8K A;  4M0N A;  3ZXE A;  5C7G A;  1JZ8 A;  2MEV 2;  4XQW A;  4RGK A;  1J1L A;  1GZW B;  1CAW A;  1MAC A;  3IBM A;  4NMI A;  3CDZ B;  4CP0 A;  4HBN A;  4NWW A;  4R9C A;  4QPI B;  2VBB A;  2ERF A;  3A0K A;  4FCA A;  5FZF A;  4Q8K A;  3BU7 A;  3D82 A;  4PDW C;  2RDQ A;  1HRV 3;  1ULP A;  3NKT A;  1UZ0 A;  1UZV A;  2WLQ A;  4GQ7 A;  2WQ8 A;  3LZZ A;  4C90 A;  2XVL A;  3WP6 A;  4FTE A;  1LGN A;  1WBL A;  4PIY A;  3SKJ E;  1RUD 3;  3VBS B;  3TEZ A;  1H8T A;  2H6C A;  2ARX A;  2JIG A;  3EMR A;  2HWD 2;  4NRP A;  4CDW B;  1RUF 2;  3P1I A;  2UYA A;  4I02 A;  1QJY 1;  4KMQ A;  5LA1 A;  1RUE 1;  2WLP A;  5A1A A;  5CA6 A;  4WM8 B;  5FYT A;  4PJY A;  3W20 A;  2WS9 3;  3WDY A;  2B5H A;  1UZW A;  1IQD C;  3NV3 A;  4UFK A;  3PVO A;  4Q0S A;  1U5X A;  5ANQ A;  4WVM A;  5F3E A;  4XIL A;  5FYH A;  2XJU A;  4UWD A;  4Y24 A;  3EBR A;  1NKG A;  2OII A;  4XBL A;  1W05 A;  4HZF A;  3SCF A;  1K5M A;  3MPB A;  1NUK A;  2RM2 1;  4OFG A;  4UBH A;  3MUZ 1;  3RS6 A;  4ZHN A;  5K4L A;  1HV1 A;  1FPN 3;  3IZO A;  5DAP A;  2WWS A;  4L2N A;  1HLC A;  2GND A;  3WDW A;  3ILR A;  4IGP A;  5CZK A;  1LHW A;  4QMA A;  5CFD C;  2IUW A;  1VBC 2;  3UES A;  4Y1U A;  4BH9 A;  1RUJ 2;  4YWA A;  5FUP A;  3ILF A;  5CNA A;  5ABJ C;  1VJ2 A;  1YJL A;  2BP6 A;  2Y6F A;  3DN7 A;  5T52 A;  1W0O A;  4XJW A;  3USU B;  4CDU A;  1BBT 1;  3B93 A;  2B42 B;  2ZA9 A;  2CV6 A;  5AFB A;  5E16 A;  2WFF 1;  2YUE A;  4GWJ A;  2NZ9 A;  4DPN A;  1MS0 A;  1PZ7 A;  4QDR A;  4XMI A;  1C8M 2;  4AHZ A;  4BQX A;  4CZS A;  1RUO A;  3B3Q E;  3C7F A;  3PUA A;  2BFU S;  1LHU A;  3BAL A;  2VBP A;  3U4S A;  3WV6 A;  1JXN A;  1BMV 1;  3R0R A;  1SHW B;  1XB9 A;  1UXZ A;  4KG0 A;  4BQW A;  5GM0 A;  1I6X A;  1N3P A;  1PK6 A;  1RJ7 A;  1RUI 2;  5A32 A;  4XUQ A;  1K5M B;  1RXF A;  5JXH A;  5KXC A;  1HV0 A;  1TG7 A;  2GC3 A;  2GN7 A;  3MEP A;  5FY4 A;  2XJQ A;  2A6W A;  1RMU 3;  3VZL A;  2KD7 A;  1V6I A;  5IK8 A;  3RJ2 X;  3LSD A;  1NE4 A;  4FFH A;  5E8A A;  2OQ7 A;  5HXV A;  1VLN A;  4BWO A;  4DOU A;  4R4X A;  2WDB A;  4B4P A;  5HXM A;  1RUH 1;  1W8U A;  4G9S B;  4W6Y A;  4A45 A;  1AYN 3;  1ZYB A;  3LEM A;  3ZSM A;  4F3J A;  3U0Z A;  2DU0 A;  4TWT A;  1W0N A;  4QHZ A;  5C70 A;  3SEP A;  4AI2 A;  4H3W A;  2VJX A;  1PO2 1;  4L99 A;  4AAX A;  3FX3 A;  4ATE A;  4Z92 B;  1W6Q A;  4LQR A;  3RI9 A;  5IFP A;  4AFD A;  2CWS A;  4UAP A;  1H6X A;  2IXL A;  2YPD A;  3B7M A;  3PTY A;  4ARY A;  3VKL A;  4OI4 A;  3D0S A;  1RUC 3;  2RMU 3;  1CD3 G;  2UY8 A;  2J1T A;  2ZS6 B;  3D5O A;  1LHO A;  2G9F A;  1UWW A;  1VB2 A;  1AL2 1;  1GZT A;  5LW9 A;  4MG2 A;  4LXL A;  1OQE A;  1PK6 B;  4ZON A;  3LIG A;  1VB4 A;  2OA2 A;  3AFK A;  2R16 A;  5A32 B;  4A41 A;  5JSO A;  5C5T A;  1Q3E A;  3NNF A;  3ZYR A;  4KBB A;  1V9U 2;  4CXW A;  4LKE A;  5FPL A;  1ODM A;  4F7Z A;  5C3P A;  4DQA A;  2JJ6 A;  2B39 A;  1UX7 A;  5FO9 B;  3D4K A;  3T0B A;  2D98 A;  3UGG A;  4K40 A;  4KGG A;  5F5A A;  1ALY A;  2QKD A;  5GJ6 A;  5T5L A;  1H1M A;  3RYR A;  5IVV A;  3JBG 3;  5A7W B;  1LUL A;  3H3L A;  4UT5 A;  1GQG A;  1Z0H A;  1DQ2 A;  4GKY A;  5AVA A;  4JDN A;  4WM7 A;  2WR9 A;  4L9B A;  4N43 C;  5FOJ B;  3OGG A;  5IHR A;  3JU9 A;  2B9V A;  5IJR A;  2ZX2 A;  1TMF 1;  3N9Q A;  3TRS B;  3DF0 A;  2P4E A;  2ZKL A;  4Y1X A;  1IQA A;  3K3O A;  1NE6 A;  3DUI A;  4KGQ A;  1YCI A;  3I3E A;  3VDD B;  2CDP A;  5EP9 A;  1AR8 1;  2R6Q A;  1HJF A;  4CUB A;  3NJV A;  3B69 A;  4NIH A;  4FPL A;  1JYT A;  4LR4 A;  2NPI A;  1H1A A;  4Y20 A;  5FPZ A;  2A3X A;  1OXC A;  1MZ5 A;  1UOG A;  2P3K A;  3KVB A;  3O14 A;  3WF2 A;  1AR7 3;  1LHN A;  2QBX A;  3J7M A;  3M3C A;  2GH2 A;  4N53 A;  4Q4X 3;  2NLR A;  1R09 1;  1ZBA 2;  2BGP A;  1GFF 2;  2YGL A;  4QKF A;  4YM0 A;  5I0U A;  4AED A;  5C9A A;  1CIY A;  4J1X A;  1TNF A;  3MFA A;  4AFB A;  4DO0 A;  4P9X A;  1L3J A;  1RUE 2;  3H9A A;  4BME A;  2C6S A;  2RS3 3;  3CHX A;  2QJV A;  4C1W A;  3HOB A;  3AKS A;  1G7Y A;  5H9Q A;  2ZOE B;  3AZZ A;  3H7J A;  4UYB A;  4Y5S A;  1DP0 A;  1W28 A;  1QJX 1;  1UOF A;  2IFW A;  3CJI C;  3T3Y A;  2PA7 A;  3VBU C;  1OUX A;  3I59 A;  1YI7 A;  4BQY A;  3I2J A;  4H55 A;  1H9P A;  3CIH A;  5C4W B;  3NL1 A;  1GLH A;  1G9C A;  5GZD A;  2XJP A;  2JG8 A;  4RGG A;  3CL1 A;  2GZW A;  1TME 3;  2E7A A;  4IXL A;  4BCU A;  5DDJ 3;  3VHO A;  3WDV A;  2YXS A;  4BHP A;  4BXS V;  2VZV A;  1NCQ C;  4XAA A;  1H6Y A;  4GWN A;  4M0H A;  5A3O A;  4TN7 A;  1ENQ A;  3THC A;  3T4V A;  1YC6 1;  3VBR A;  4CUC A;  4NN0 A;  5C8C C;  2D6K A;  4LO5 B;  2ARA A;  2ZEX A;  4N53 B;  5FMB A;  1BBT 2;  4D3W A;  4AED B;  3SQO A;  3UKV A;  2WFF 2;  4I30 A;  3AKP A;  3E6B A;  2XVK A;  3SIS A;  5BNQ A;  2HWF 1;  5FO7 B;  4KG8 A;  2E51 A;  4EN0 A;  3HD8 B;  2W9X A;  4WVV A;  3CMG A;  5JUV A;  4YW6 A;  2PHW A;  5HCF A;  5DUX A;  5IWF A;  4YW5 A;  1BXH A;  3ACL A;  2GSY A;  3WF3 A;  1IG0 A;  1EAH 3;  3OSD A;  1LB2 A;  1BMV 2;  1K3I A;  4IQP A;  3ACG A;  4P00 B;  3N7L A;  1R08 3;  2WNV C;  4LKD A;  5FPA A;  1EV1 3;  1RIR A;  2AC1 A;  2EXI A;  2WO3 A;  3HNY M;  3EJK A;  3NAP A;  4Q4Y 1;  4XIK A;  4MGK E;  5D8A B;  4LT5 A;  3I7D A;  4CEW B;  5A7N A;  4Z07 A;  2Q8E A;  3FBY A;  2FZ2 A;  1RVF 3;  2BFU L;  3N35 A;  2JG8 B;  2RV9 A;  4Q29 A;  4RD7 A;  4XJZ A;  2RHP A;  1ND2 A;  1XSR A;  3BB6 A;  3KCC A;  3N9N A;  3KV9 A;  1QXJ A;  4CDX A;  4YM3 A;  4EJR A;  3AKQ A;  3T2Q A;  4IV1 C;  1UMZ A;  2PQQ A;  3KD4 A;  4R8H A;  3C7E A;  4WZF A;  2XON A;  5KC6 A;  1DQ1 A;  1RUH 2;  3VBR B;  2R49 A;  4COZ A;  3ZXF A;  5C3Q A;  3S7E A;  4AI0 A;  3III A;  5F39 A;  3BYW A;  2ES3 A;  4NPM A;  4HKO A;  4TTG A;  4JGY C;  4BIF A;  4UW5 A;  3HR9 A;  1W06 A;  3KF3 A;  3TEX A;  3AXE A;  4NVP A;  3RMY A;  4CP9 A;  4AL9 A;  2BBV A;  2ARE A;  4HVQ A;  1CIW A;  2XLA A;  4D6R A;  5BNP B;  4QT6 A;  1H30 A;  4XUO A;  2DBI A;  5D21 A;  2BYV E;  1US2 A;  4GWM A;  1XE0 A;  3VZM A;  2MPF A;  1NQD A;  2K2S A;  3U75 A;  3WSO A;  3MIH A;  1KDK A;  3R4S A;  3FN9 A;  1KS4 A;  1LOC A;  4M01 A;  3AP5 A;  1AL2 2;  1OPM A;  4OHW A;  2P2K A;  2EIE A;  2GMP A;  2W87 A;  1UX6 A;  3UT0 A;  2FDI A;  2DFC A;  2VM9 A;  4E4S A;  3LFM A;  4FPY A;  1XBF A;  4NWV A;  4QPG B;  5EHD A;  5EPA A;  1WW7 A;  4JKM A;  5FZC A;  5J36 A;  1ZM1 A;  4PT6 A;  2E6V A;  3DEM A;  5FYY A;  1ND2 B;  2RS1 1;  1OA3 A;  3WF4 A;  4ARX A;  4CDX B;  1QU0 A;  2BTV C;  2NN8 A;  4MX3 A;  1Q8V A;  1UF2 C;  3ZFE A;  1J58 A;  1OA2 A;  2Q1Z B;  1ZRC A;  4HON A;  4N7I A;  3V64 A;  1PIV 2;  1JI6 A;  4HVR A;  4PLO A;  5F2W A;  3RZG A;  4MXW B;  4A7Z A;  4BQ4 A;  1UKG A;  1TMF 2;  1O3T A;  2GAU A;  1RIN A;  2D6O X;  4RYD A;  4TLF A;  3RZH A;  2CHH A;  2F17 A;  4Q0U A;  5KHH A;  1ULO A;  4CP9 B;  1WW6 A;  1GYK A;  1AR8 2;  1OF3 A;  4GD4 A;  3ZMO A;  2JKX A;  1CZS A;  5T5O A;  1E57 A;  4ZS2 A;  4XXP A;  4TYS A;  4CXY A;  3O0V A;  4B4R A;  3B94 A;  4Y26 A;  4YVS A;  3I2I A;  3PL0 A;  4OHV A;  2WRA A;  5F7U A;  1FMD 3;  2UY9 A;  2YC2 A;  3MI8 A;  4XJU A;  3ZYG A;  1FPN 1;  3VBO A;  2EID A;  1A6C A;  1W6M B;  3JUU A;  2ZHM A;  5IK5 A;  2XOM A;  1S1A A;  4P9I A;  5F32 A;  4LBQ A;  2ZML A;  4AWD A;  5HBA A;  3OY8 A;  1ZBE 1;  4ES8 A;  4LMF A;  5L7O B;  3K77 A;  1DYO A;  2VNV A;  5J3U A;  4GKX A;  4CDQ C;  1FOD 3;  4GMP 0;  1W6N B;  1MS9 A;  3OD4 A;  3ZFE B;  5T54 A;  1QJX 2;  1XE7 A;  2ZGK A;  1OFN A;  2W5F A;  4RS5 A;  3WNK A;  4XFA A;  5J96 B;  1DCS A;  3GM8 A;  1W39 A;  3JQW A;  2JG9 C;  3T0A A;  3PUQ A;  2FDK A;  3AFG A;  1ZZC A;  1Y43 B;  4I3P A;  1CES A;  2V5Y A;  4LUK A;  1GIC A;  4LOT A;  2JDU A;  4O61 A;  5A33 B;  5CAZ A;  5FPU A;  3DL3 A;  3MFC A;  1J3P A;  4LEJ A;  5DQ0 A;  4XYX A;  3WQ1 A;  1CR7 A;  3ZXA C;  1E5H A;  2V73 A;  5FZH A;  5K0U B;  4LKS A;  4OUM A;  4ET7 A;  3VDC A;  1JTZ X;  2FD8 A;  1BVV A;  2GNT A;  1XSQ A;  2CYF A;  4YVS B;  1SAC A;  2Y0O A;  3BU0 A;  2DVA A;  5I8S A;  4BDV B;  1IS5 A;  1RMU 1;  5CAD A;  1JZ7 A;  1UKR A;  2HWF 2;  1TNR A;  2VCM A;  2AR6 A;  3MF6 A;  5FZ8 A;  3DPR A;  3VD7 A;  3O1U A;  3FUQ A;  4MZU A;  2OT7 A;  2J22 A;  4V2W A;  2BOI A;  4YGC A;  1WA6 X;  1RUG 3;  3NQH A;  1D2Q A;  4BLJ A;  1JOD A;  4Z2W A;  1JYI A;  3A21 A;  1J83 A;  2H0V A;  3C7G A;  4UFH A;  3MUY 1;  2HYK A;  1YYN A;  2WA4 A;  2XR4 A;  3HEI A;  1Y3T A;  2A6Y A;  3PVB B;  5K9Y A;  1OBN A;  3I2K A;  5FOB B;  5FR3 A;  1W90 A;  3K2O A;  5A3U A;  2VH9 A;  1GZ9 A;  2OX0 A;  3NST A;  4HK8 A;  5A3W A;  3LF7 A;  3BKZ A;  4LK6 A;  2OUH A;  3AM2 A;  1EYB A;  5IYY A;  5LK5 A;  1PM4 A;  4NRO A;  3SH5 A;  1SLA A;  3ZIW A;  5KXB A;  4OHZ A;  3AZW A;  2VGD A;  1KEX A;  3UKN A;  3AX4 A;  4S2F A;  1C4R A;  4PQQ A;  5FKC A;  1BCX A;  1OD3 A;  1QQP 1;  1RTV A;  2QZ2 A;  4QU2 A;  4K8F A;  2C26 A;  1CN1 A;  1MPX A;  1RHI 2;  2W1W A;  3HMY A;  3O1M A;  4M3C F;  1UCX A;  4IGQ A;  4ZPI A;  2OYZ A;  1W6P B;  1VAL A;  3VKM A;  4KWK A;  5EFU A;  4EWA A;  3MID A;  3K75 B;  4FXK B;  1A78 A;  1WCQ A;  3IPV B;  3JBG 1;  3ZFF A;  1FYU A;  1KJR A;  4W6W A;  1CPM A;  4JHT A;  2HKX A;  4XF4 A;  1YQ6 A;  4FT8 A;  4QWN A;  4PBO A;  3N9L A;  5DAW A;  4LLO A;  1X50 A;  2Q0A A;  2R07 1;  2R1D A;  3ZFG A;  4CPB D;  1F2N A;  1WLW A;  1ND3 B;  5A3M A;  5FY1 A;  2DUQ A;  2I2S A;  1POV 3;  3HPN A;  2GC1 A;  4OZO A;  1XPW A;  3PMS A;  5CKN A;  1JHJ A;  1LJ7 A;  1HW5 A;  5A6X A;  3WW2 A;  1DFQ A;  2XUM A;  4RR3 A;  1RL3 A;  1HQW A;  1S2K A;  1SBD A;  1HRV 2;  2WL1 A;  4JGZ C;  4LOS A;  3ZSE A;  4BOW A;  1AR7 1;  3ZYH A;  2RE9 A;  5CKM A;  4E8C A;  3WUD A;  4CEY C;  4NHX A;  3UGH A;  4J25 A;  3AYD A;  2QQU A;  4BQ5 A;  2JB8 A;  2WA3 A;  3FHA A;  1V6L A;  4PCR A;  3BTX A;  3AKT A;  1DHK B;  1WME A;  2D6N A;  3LAG A;  5DXD A;  2PEL A;  3MYX A;  3OGV A;  1LCL A;  4NPL A;  2BUK A;  3NV2 A;  2C4X A;  3ABZ A;  4W65 A;  5LEJ A;  1OQ1 A;  3IMM A;  5LRR A;  3R6S A;  4HAN A;  2Y6J A;  3ZFF B;  5IK4 A;  1JOB A;  1HQN A;  3GGL A;  1UNB A;  4GWI A;  3GBW A;  3TEW A;  1MZ6 A;  1WD4 A;  2A6Z A;  3SHR A;  1FPN 2;  5HCA A;  1X8E A;  3G7D A;  1FNZ A;  3KT1 A;  4QXB A;  1OHF A;  1TME 1;  4LUL A;  1WMD A;  2D40 A;  4XDQ A;  5KC5 A;  3I4I A;  4Q26 A;  3FE5 A;  3LA3 A;  4YZ1 A;  2VMI A;  4MSV A;  3I3D A;  4Y4Y A;  2PLV 3;  2CAU A;  2GMM A;  4RR3 B;  2BOJ A;  2IXI A;  4GMP 1;  2C5D A;  4K8R B;  4IGO A;  2C1F A;  3WP3 A;  3TOJ A;  4BXF A;  4MGI E;  4PF5 A;  4LO7 A;  4NR1 A;  4AHX A;  1ZVF A;  5EIY B;  1ZZ6 A;  1OVS A;  5F1R A;  1XC6 A;  2XDV A;  2XJT A;  3KGZ A;  2Y60 A;  5FYM A;  5J98 B;  5IVJ A;  1Q8S A;  4IER A;  2UUR A;  1DYP A;  4TLG A;  5FTT C;  1HDK A;  2KR2 A;  5CFC C;  4IEW A;  3HJR A;  2QQL A;  3M8L A;  3RG0 A;  4DY5 A;  1GBG A;  2ZX0 A;  2LRP A;  4QQP A;  1EAH 1;  3VZJ A;  4BA6 A;  4UW6 A;  2F4P A;  1ZZ7 A;  1QJU 3;  1UYP A;  1OOP A;  1QJE A;  1RUF 1;  3NO8 A;  1SDW A;  1N1S A;  3A23 A;  4IDZ A;  4LIU A;  1GWL A;  1MQT C;  2QQP A;  4A6O A;  4MLO A;  4WZC A;  3JD7 3;  3OGR A;  4DY3 A;  1VP6 A;  1RMU 2;  1DU3 D;  1XRU A;  1LU1 A;  1AXZ A;  1S0E A;  2PHR A;  4E2S A;  2Z5W A;  1FX5 A;  1REF A;  1W9S A;  3ECQ A;  5GLT A;  2BZD A;  2PHU A;  2YRO A;  1PVC 1;  4IV3 A;  1LU2 A;  4CE8 A;  2QQO A;  3TAY A;  4BPZ A;  4XAB A;  3SNM A;  2YBS A;  3OD0 A;  3OEA A;  3BIE A;  2BW8 A;  5F3G A;  4JZR A;  3ZN6 A;  1V6N A;  1WKY A;  4LIT A;  4DEV A;  3C3V A;  4BU2 A;  1AYN 2;  1PGW 2;  4FOQ A;  4YW7 A;  4OMC A;  5FZ4 A;  1TQ5 A;  4ISQ A;  3RSJ A;  4KBZ A;  3WZ1 A;  2D6M A;  2ZTN A;  1LOD A;  4H2A A;  1N3O A;  3MHZ A;  3N7K A;  1F5J A;  1UU6 A;  3CQO A;  2WWJ A;  3D6E A;  2XPJ A;  1D4M 1;  1XNA A;  4G3Y C;  5IVY A;  3KCY A;  2XQR A;  1SPP B;  1YFX A;  2DUO A;  1G9B A;  2RMU 2;  3ES1 A;  3INA A;  3QCW A;  1S0B A;  2PN5 A; 
#chains in the Genus database with same CATH homology
 2VQU A;  4QDR A;  5EJZ B;  5JMO A;  3WF1 A;  1UY1 A;  4FI9 A;  3C7F A;  2VCB A;  3OGS A;  1JZ4 A;  4P02 B;  1GMM A;  1SHW B;  1UXZ A;  4L0P A;  3MO4 A;  4XUQ A;  5JXH A;  1TG7 A;  2Y6L A;  3T0D A;  2KD7 A;  3A7Q A;  3AC0 A;  3NJX A;  2ID4 A;  3WNP A;  4CU7 A;  3LQC A;  2PQS A;  2X05 A;  3MV0 1;  4DXT A;  2ZEZ A;  5HXM A;  2WDB A;  1UYZ A;  4QB6 A;  4QAW A;  4A45 A;  2J1V A;  1W0N A;  5C70 A;  3SEP A;  2J1U A;  2VJX A;  4JKK A;  4AAX A;  4LQR A;  2W91 A;  5IFP A;  3VDB A;  4OMD A;  2V4V A;  4UAP A;  1H6X A;  3EB7 A;  4ARY A;  1NX9 A;  3FHQ A;  4ZXE A;  2VZP A;  2J1T A;  4XUT A;  1UWW A;  3ACH A;  1UYX A;  1T2X A;  4A41 A;  2W3J A;  1OH4 A;  1UX7 A;  1GUI A;  1K12 A;  2W46 A;  3T0B A;  1UYY A;  5JXG A;  1L7R A;  4QPW A;  5J1X A;  2ORX A;  1L7Q A;  5G04 L;  1UMI A;  3SEE A;  3IAP A;  5IHR A;  2B9V A;  3K4D A;  5IJR A;  2WBK A;  4W50 A;  3BN6 A;  1J84 A;  3I3E A;  1I5P A;  2CDP A;  2VMC A;  4QX2 A;  4CUB A;  2RVA A;  3NJV A;  4OUE A;  4DUX A;  4XUN A;  3LEG A;  3NRU A;  4MGQ A;  4ZY9 A;  1GU3 A;  3WF2 A;  2QBX A;  1NAE A;  2BGP A;  1CIY A;  3OBA A;  5DMY A;  4UI9 L;  4M4R A;  4QDS A;  3HOB A;  2W47 A;  4P08 A;  1DP0 A;  2X09 A;  2WYS A;  5HPO A;  1DLC A;  1KGY A;  4KI5 M;  3I2J A;  3CIH A;  2VQT A;  3DYO A;  4DEQ A;  2E33 A;  2R7E B;  2YB7 A;  3K4Z A;  4BXS V;  4LPL A;  2VZV A;  1H6Y A;  3THC A;  4CUC A;  4BK5 A;  4P5Y A;  3ACI A;  3D3A A;  2ZEX A;  3I2G A;  4A42 A;  1UY0 A;  2VZO A;  4QX3 A;  1R64 A;  2QQN A;  1GOF A;  3I3B A;  1JZ3 A;  4A4A A;  2W9X A;  2EIB A;  3CMG A;  2DCK A;  5JUV A;  2VCA A;  3WF3 A;  1BHG A;  1W8N A;  2XHN A;  1K3I A;  1YQ2 A;  3ACG A;  4P00 B;  2J1S A;  2ZEY A;  4QB2 A;  4MGS A;  3HNY M;  2WO3 A;  1JU3 A;  5DPN A;  2V72 A;  3GDB A;  2DDU A;  2VZ1 A;  4XUR A;  2VZR A;  2RV9 A;  3WNN A;  1TVG A;  3K46 A;  1JYX A;  3T2Q A;  4QB1 A;  3C7E A;  4JKL A;  2XON A;  3GXU A;  2Y6H A;  1XNT A;  2QQM A;  1HN1 A;  2BER A;  5B4X A;  4QX0 A;  3III A;  5LA0 A;  3W5M A;  2ZXQ A;  4TTG A;  1O8P A;  4DUV A;  3FL7 A;  1JYW A;  4ZZ8 A;  3VD5 A;  3C7O A;  4XUO A;  2VMF A;  3SKV A;  4IUG A;  1US2 A;  4W8J A;  3WSO A;  3FN9 A;  1EUT A;  2ORZ A;  2EIE A;  2W87 A;  2VM9 A;  3IDA A;  3OEB A;  4CU9 A;  2VZT A;  3HNM A;  1JYN A;  2WN3 A;  3J7H A;  4JKM A;  4CVU A;  2HYX A;  4PT6 A;  3UET A;  3WF4 A;  4ARX A;  4JX0 A;  5G05 L;  2XQX A;  4UOJ A;  3I2H A;  3VDA A;  5JXI A;  3WQB A;  1JI6 A;  5DN2 A;  3LEI A;  5FUI A;  1SG3 A;  2JE8 A;  4RYD A;  1OT5 A;  5JXJ A;  2L9L A;  2LS6 A;  1ULO A;  1OF3 A;  2JKX A;  3CZJ A;  1PMH X;  3NNG A;  1CZS A;  3UNP A;  1P8J A;  2Y6G A;  2VL4 A;  3IAQ A;  3JXS A;  2VO5 A;  4A44 A;  3CZU A;  2J1R A;  3I2I A;  5IFT A;  5F7U A;  2YC2 A;  3OG2 A;  1W8O A;  4RN5 A;  4Z2A A;  3U37 A;  2EID A;  4LHS A;  2XOM A;  2VMD A;  2LW8 A;  2CDO A;  3K77 A;  1DYO A;  3W5N A;  2YFU A;  3MV1 1;  1JYV A;  2ZEW A;  2VOT A;  3WNK A;  2W5F A;  1O59 A;  3I2F A;  3MBW A;  3GM8 A;  2YC4 A;  3T0A A;  3VD9 A;  3WNL A;  1CZT A;  1GOG A;  1PMJ X;  1K42 A;  5DQ0 A;  1SDD B;  2WO1 A;  4LKS A;  4ET7 A;  3VDC A;  1CZV A;  3T2O A;  3ETP A;  3THD A;  2J1E A;  3ACF A;  4BDV B;  1K45 A;  2B4K A;  4JHZ A;  1JZ7 A;  2YFZ A;  1JU4 A;  3BGA A;  3VD7 A;  2W95 A;  4KWU A;  2J22 A;  4D8M A;  1UY2 A;  4DUW A;  2E32 A;  1F4A A;  3T09 A;  4QDQ A;  3NQH A;  2JD9 A;  2J1A A;  3A21 A;  1J83 A;  3C7G A;  5LCW L;  1CX1 A;  3MUY 1;  2WAA A;  3HEI A;  2JDA A;  3LE0 A;  4HG6 B;  4XUP A;  4CU8 A;  3A22 A;  3PUI A;  1O8S A;  3I2K A;  2WAB A;  1JZ6 A;  4GZ9 A;  5IYY A;  4ZZ5 A;  1F4H A;  2BBA A;  1KEX A;  1LNS A;  2VTF A;  2E31 A;  3LEK A;  4PQQ A;  2VZS A;  1OD3 A;  3PUH A;  2C26 A;  1MPX A;  2W1W A;  1GQP A;  4A3Z A;  1EUU A;  2V5D A;  2QQJ A;  2VZ3 A;  2WZ8 A;  4TXW A;  2DCJ A;  3K75 B;  1WCQ A;  4DXR A;  4MO3 M;  2WN2 A;  1PX3 A;  2VME A;  1W9W A;  3T2P A;  2C9K A;  4XVH A;  2W1S A;  4D0Q A;  3LPG A;  3HPN A;  4OZO A;  1XPW A;  1JHJ A;  1OF4 A;  2WZE A;  2OKX A;  3OB8 A;  1UY4 A;  4W4Z A;  4XZU G;  5JR2 A;  2W92 A;  2E26 A;  4MOA A;  1W99 A;  4AG4 A;  4E8C A;  1PX4 A;  1GOH A;  3C8X A;  2QQI A;  3LPF A;  4M4P A;  3E1F 1;  3CKH A;  2W94 A;  3DEC A;  3FHA A;  5LA2 A;  2WAO A;  3OGV A;  2W1Q A;  2C4X A;  3ABZ A;  2QQK A;  2Y6J A;  1UY3 A;  3GGL A;  2X10 A;  4GWI A;  3EYP A;  2Y6K A;  4YPJ A;  5B4N A;  1GNY A;  3WEZ A;  2J7M A;  2HLE A;  3F2Z A;  3IB3 A;  1UMH A;  4E8D A;  3K4A A;  2VR4 A;  3I3D A;  2VCC A;  2EIC A;  5I0D A;  1US3 A;  5C7G A;  1JZ8 A;  3I97 A;  2Z4F A;  3WNM A;  2YG0 A;  5EIY B;  3CDZ B;  1XC6 A;  5C71 A;  5EJ1 B;  3VD3 A;  1JZ2 A;  1ULP A;  3WF0 A;  3C7H A;  1UZ0 A;  2WQ8 A;  3HJR A;  2QQL A;  3VD4 A;  2Y64 A;  4BK4 A;  3SKJ E;  2WO2 A;  2VZQ A;  3HN3 A;  3P1I A;  4KMQ A;  5LA1 A;  1UXX X;  2W1U A;  5A1A A;  3A23 A;  1RYY A;  4A6O A;  2VC9 A;  5CYY A;  1IQD C;  3OGR A;  1JZ5 A;  1W9T A;  1NKG A;  3ECQ A;  1W9S A;  3T08 A;  2BZD A;  1NUK A;  2QQO A;  3HNB M;  3MUZ 1;  4CUA A;  2BGO A;  3OEA A;  4DEV A;  1WKY A;  2WUH A;  3ZM8 A;  1D7P M;  2RJ2 A;  4OMC A;  5CZK A;  3UES A;  4DXS A;  3P6B A;  2Y8K A;  3DYM A;  4OYU A;  4QX1 A;  4MAD A;  3CQO A;  3DYP A;  1XNA A;  4PF1 A;  4CU6 A;  4BJ0 A;  2VZU A;  4GWJ A;  3WNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...