4MO3M

Crystal structure of porcine c2 domain of blood coagulation factor viii
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
156
structure length
156
Chain Sequence
SCSMPLGMQNKAISDSQITASSHLSNIFATWSPSQARLHLQGRTNAWRPRVSSAEEWLQVDLQKTVKVTGITTQGVKSLLSSMYVKEFLVSSSQDGRRWTLFLQDGHTKVFQGNQDSSTPVVNALDPPLFTRYLRIHPTSWAQHIALRLEVLGCEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Porcine C2 Domain of Blood Coagulation Factor VIII (FoldIt Target)
rcsb
source organism Sus scrofa
molecule tags Blood clotting
molecule keywords Coagulation factor VIII
total genus 35
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4mo3M00
1JHJA 1US3A 2WDBA 3MV11 1CZTA 2JDAA 4ZXEA 3LPGA 2QBXA 2J7MA 5G05L 4D0QA 1JI6A 4CU6A 3UESA 3MV01 1R64A 3VD4A 2DCKA 3P1IA 3MO4A 2BGPA 4P5YA 4JX0A 3HJRA 3HOBA 2LW8A 2WQ8A 2W5FA 3W5NA 3OGRA 1RYYA 2ZEZA 3WF2A 1JZ2A 4MGSA 1GOGA 1UZ0A 2W94A 4ZZ5A 2VL4A 2BGOA 1PMJX 5A1AA 2Y64A 3I3BA 1UXXX 3PUIA 3HPNA 3OGSA 4CUAA 3ETPA 2X10A 1JZ6A 4GWJA 3WEZA 4OMCA 1F4AA 2W92A 1NX9A 4QX0A 2BBAA 3NRUA 2OKXA 1W9TA 4CU7A 5IFTA 1UXZA 1UY1A 2B9VA 3IIIA 2VZ1A 2W95A 3OB8A 4MOAA 2VZVA 1ULOA 3K77A 5JR2A 2XONA 2VZ3A 4IUGA 4GZ9A 4XZUG 3T0AA 3WNKA 1NAEA 2VZPA 2CDPA 2YB7A 3WNPA 4TTGA 4JHZA 3OGVA 3LEIA 1GQPA 3C8XA 4BXSV 2ZEWA 3I97A 1OF4A 1MPXA 1EUTA 4CUBA 4QAWA 3WF1A 2WN3A 1JYNA 2BERA 4DXRA 2X09A 1UWWA 3GGLA 3A21A 4A44A 2CDOA 4E8DA 4BK5A 1SDDB 1T2XA 4DEQA 1L7QA 1GMMA 3T2PA 1JZ8A 3DECA 2JKXA 3HNYM 2KD7A 5C7GA 1SG3A 3A23A 3I2KA 4ET7A 5LA2A 5JXHA 1K12A 3VD9A 5JXJA 2W47A 3FN9A 2VZRA 4XURA 1KGYA 4XUQA 2WZ8A 1GOFA 4A42A 2WO3A 2XQXA 2VM9A 1GOHA 1UYYA 3ECQA 3UNPA 5DN2A 1XPWA 3IDAA 1JZ5A 2QQKA 1BHGA 3VD3A 2J1UA 2VZSA 2VMFA 4P08A 4A4AA 3WNMA 4LHSA 2Y6HA 3D3AA 4QB2A 3K46A 1GNYA 3CIHA 3ABZA 4YPJA 3U37A 1W9WA 5CZKA 2VQTA 3UETA 1OH4A 2X05A 2YC2A 3GXUA 4A45A 2Y6KA 3BN6A 2VTFA 1O59A 2HLEA 4CVUA 3SKJE 3ACGA 5F7UA 4PT6A 2WO1A 4W4ZA 3GDBA 4MO3M 3F2ZA 1UYXA 2E26A 4AG4A 1W8NA 4P00B 4BDVB 3DYPA 5J1XA 5JXIA 3K75B 2L9LA 4BK4A 3JXSA 3MBWA 2E33A 4DUVA 3FL7A 3THDA 1JU4A 3VD7A 4DEVA 4XUOA 2YG0A 1CZSA 2QQIA 1UY4A 3I2IA 1XNTA 5JXGA 1JYVA 4A41A 3VDAA 4JKLA 3LQCA 4W8JA 2WO2A 4QB1A 1H6XA 3T2OA 5IJRA 3K4AA 5HXMA 3HEIA 1W0NA 2ORXA 3C7OA 1JYWA 5DPNA 3LEGA 3A22A 4UI9L 4QDSA 4ARYA 1OD3A 2ZEYA 4GWIA 2Y6GA 2RV9A 3VDCA 3K4ZA 3E1F1 3AC0A 3LPFA 5DQ0A 1UY3A 3I2JA 3WSOA 2B4KA 2LS6A 3IAPA 1WCQA 3T09A 4ARXA 2W87A 5LA1A 2J1SA 3NJXA 2QQNA 3SEPA 2VCAA 5IYYA 4LQRA 3ACFA 4OYUA 2QQOA 1F4HA 1UYZA 2V72A 4HG6B 3I2HA 4A3ZA 1HN1A 1P8JA 1SHWB 3NQHA 3SEEA 3HNMA 3OEAA 3C7EA 3EB7A 4LKSA 5CYYA 2YC4A 3HN3A 4BJ0A 3HNBM 3FHQA 3T0DA 1JZ4A 1W99A 2J1RA 2DCJA 2W3JA 2EIBA 2J1TA 2R7EB 3BGAA 4QX1A 1JU3A 4RYDA 1DLCA 3DYMA 2E32A 4E8CA 5LA0A 1XNAA 1ULPA 3ACIA 1GUIA 1PMHX 3IB3A 2VOTA 4QB6A 1W8OA 2EIEA 1TVGA 2VZTA 2C26A 4XUNA 3WNNA 4RN5A 5IFPA 2C4XA 2W9XA 2VQUA 1JZ3A 3P6BA 3VDBA 2VCBA 3WF4A 1J84A 2YFZA 4OZOA 4XUPA 2W1WA 3WF0A 2VJXA 4KI5M 5DMYA 2RVAA 1JZ7A 4PQQA 2JD9A 2XHNA 4DUXA 2EIDA 2Z4FA 3MUY1 4ZZ8A 1PX3A 1J83A 1UMIA 2W46A 4ZY9A 4L0PA 4QDQA 4D8MA 5LCWL 1EUUA 2Y6JA 4OMDA 4CUCA 4P02B 3NJVA 1L7RA 3T0BA 3IAQA 3PUHA 5JMOA 1UX7A 1I5PA 1CIYA 2V4VA 3THCA 1W9SA 2HYXA 2VMDA 3ACHA 5EJ1B 1K42A 3GM8A 4XVHA 5B4XA 2J1VA 3EYPA 3OG2A 2J1AA 2J22A 3ZM8A 2ZEXA 3WQBA 3WNOA 1XC6A 2BZDA 4KWUA 2WN2A 4DXTA 3I2FA 3CDZB 3VD5A 2WYSA 2QQJA 2WZEA 2C9KA 4M4PA 3T2QA 2WUHA 1UY2A 4MGQA 1US2A 2W1SA 2VC9A 2W1UA 2VZQA 2VR4A 3C7GA 4QX2A 3WF3A 5JUVA 5I0DA 2VO5A 5B4NA 1IQDC 4QDRA 1CX1A 4TXWA 2J1EA 1JYXA 4JKMA 2VMCA 2WBKA 1NKGA 2VMEA 4UAPA 4QX3A 3K4DA 3W5MA 4KMQA 3CKHA 4OUEA 3LE0A 2RJ2A 4DUWA 4Z2AA 2EICA 1LNSA 1KEXA 2QQLA 5C71A 3I3DA 1DYOA 3C7HA 4UOJA 5HPOA 2DDUA 2Y8KA 4FI9A 3J7HA 1PX4A 3OEBA 5EJZB 2W91A 4W50A 1UY0A 2YFUA 4QPWA 2XOMA 4A6OA 2QQMA 3DYOA 4CU9A 1UMHA 4AAXA 3FHAA 2WAAA 5G04L 3CZJA 4M4RA 1WKYA 1TG7A 1K3IA 2Y6LA 2VCCA 3CZUA 4MADA 2JE8A 1O8PA 1D7PM 3I2GA 2W1QA 2E31A 2V5DA 1NUKA 5IHRA 1CZVA 3A7QA 1YQ2A 3I3EA 3WNLA 4JKKA 4PF1A 3NNGA 2VZUA 3CMGA 4DXSA 1DP0A 1O8SA 1GU3A 4CU8A 1OT5A 3T08A 2ID4A 2VZOA 2ORZA 2WAOA 3MUZ1 1OF3A 3LEKA 2PQSA 1H6YA 3CQOA 3C7FA 5C70A 2WABA 3SKVA 1K45A 4XUTA 5EIYB 3OBAA 5FUIA 2ZXQA 4LPLA
chains in the Genus database with same CATH superfamily
1VBD2 3O0VA 2VY0A 1MS9A 2JDAA 3MV11 5F3CA 2HJIA 4IEYA 3PLQA 4IE4A 5BNNC 4ZXEA 1QWRA 5FYYA 2J7MA 3NNJA 3VV1A 4IV1A 2XMLA 3ZXGA 1R1A1 5GLTA 3M3IA 4G4FA 4I02A 3MV01 1PNFA 4X6RB 5CISA 4NRPA 2C24A 3OD4A 2A6YA 5FJKA 3IDCB 4DPNA 5J7MA 4Z92B 5CFDC 3P1IA 1H1IA 1GYKA 1B35C 2WKKA 4EE2A 1WW6A 4TZDA 4CP0A 2YGMA 1XNDA 5LBEA 4AQSA 4I30A 2HWD2 3LFMA 5A3NA 5FPUA 1RUI3 2D6KA 4IDZA 1NLQA 3SNMA 3VLBB 3W5NA 1WW4A 4L99A 4IERA 2A70A 1VBA1 3WF2A 1FOD3 4C91A 1YJKA 4Y5TA 2ES3A 4MGSA 1ULEA 2O8OA 3BPZA 3ASIA 3NVCA 4R9AA 1U5XA 4XDPA 3M70A 2VVFA 3T3YA 2D7FA 4BZ4A 3WR0A 5EPAA 5CVRA 1KRIA 4MZUA 4AHXA 3V65A 5FYTA 1N3PA 5BY5A 3RDIA 2HWB1 4Q8KA 3O0XA 3VBHA 3OBZA 3OPTA 3ILRA 3PUIA 4ZU7A 4CUAA 3BODA 1G9AA 2NQYA 1JZ6A 3WEZA 1Q8PA 1UD1A 2EALA 1F4AA 2P37A 5A7OA 1GV9A 2WNVC 5C3QA 3U0ZA 4QX5A 4C1WA 4TWTA 1OUXA 3GZEA 4QX0A 2BBAA 4MLOA 2GMMA 4L9BA 1O4ZA 1W9TA 2Q30A 3LZZA 4CU7A 2GP5A 2VH9A 1OQEA 3IIIA 4HONA 3MF9A 4Q4X1 4L2NA 1DGWX 1VBA2 1HV0A 1VE0A 4CCJA 4FXKB 4QMAA 5HCAA 1AL21 3WV6A 4LBQD 2VZ3A 4IUGA 3S7IA 1Y9MA 3T0AA 5FZ9A 3WNKA 1NAEA 3WNPA 2CDPA 4GMP1 4XPVA 4JHZA 3POYA 1DLLA 5EV7A 5JPNB 1RUD1 3A0NA 1MS0A 4CUBA 1F35A 5A1LA 4QAWA 1ZBE3 3ETQA 4CTEA 5DDJ2 3GGLA 3WCRA 1TE1B 4BK5A 2XWBB 1T2XA 2WNVA 4HKWA 2BOIA 3ZFGA 2H0BA 5FWEA 1APNA 4EV0A 2FDIA 1S0IA 2NYYA 1YNAA 1NQDA 1AL0G 2VE1A 1RUF1 2VQAA 3D5OA 5ABJC 3NJZA 5F32A 3PDQA 4QXHA 5EYXA 4DY5A 3AMHA 3DPRB 4JV4A 4ET7A 1HQNA 5JZGB 5F3IA 2VZRA 1ZBE1 4E2QA 3ENRA 1O6UA 2RM23 4XUQA 5CA6A 3V56A 2FDJA 1QXPA 1LOFC 1XNCA 2GMEA 3PTYA 4Y33A 5HCHA 3I49A 2D6PA 4TSVA 2GP3A 2ZGUA 2TUNA 4EQVA 3WP6A 3PIGA 3UK9A 2AENA 4LBOA 1Q8VA 4XACA 5D8AC 1HRV1 4OI4A 4NR1A 5APAA 4B29A 4IE7A 4K3UA 5K0UC 2R0FA 3UNPA 1F31A 1XPWA 4LXLA 5FWJA 2DVBA 4JQTA 3H3UA 1JZ5A 1BHGA 3J7LA 1CAVA 4NHKA 2EVXA 2JENA 1ZZCA 4M3CB 4LUMA 4N43A 1VPHA 2VZSA 2QJVA 1OOPC 3Q8BA 1V6MA 4MH0E 5C33A 1COV3 3PL0A 2JB8A 4LHSA 4JGYB 1G7YA 4UF0B 5FZMA 2Q8DA 1BMV1 5JOYA 3KGLA 5CKQA 2BP6A 2IWGB 2RS12 2BNNA 3JB8A 5FUNA 3GJBA 1X9PA 3R4SA 4NHMA 1RVF2 2VOXA 4N7IA 3SMHA 3WXPA 4D6RA 1W9WA 2IXJA 1QDCA 2HWF2 3OSDA 1O4YA 1ZZ7A 2A1XA 3LFIA 3J26N 1DBNA 4YG0A 1Z7S3 3TEWA 1W2OA 5FZ3A 3BN6A 1YFXA 5D2AA 3H0OA 4OUMA 3ROUA 1LU2A 4Q4Y3 3F95A 1LU1A 3SKJE 5J36A 1W8HA 1DGRN 4S2FA 4CDUA 1R091 3GDBA 2WNEA 3MIBA 2PFWA 1LHVA 2WT1A 4LBQA 2ZGLA 4YZ2A 4QQLA 4IL7A 1EAH1 2E26A 4P00B 2PHXA 3DYPA 4K40A 5A3MA 1AR61 4QKNA 3WP5A 1JUIA 1VBE2 3KQ4B 3KV4A 2L9LA 1A3KA 4JVAA 3JXSA 1SCSA 1CWPA 3ZMOA 2ZMKA 2EAKA 2ENRA 3DUIA 5IT6A 2RJLA 2TEPA 4QPGB 4RS5C 3THDA 1DZRA 3LOIA 4OZXA 3RRDA 1JU4A 1JS9A 2ADDA 2VOKA 4XHXA 2JG8C 4XUOA 1ZYBA 3MIFA 4AXOA 2YG0A 3AB0A 4YW2A 3N9MA 5HBAA 3OCPA 5FO8B 3O1RA 3NL1A 1RXGA 3WNXA 2O1QA 3G7DA 3OGJA 1FMD1 3TRSB 4CCEA 2Z79A 2A6ZA 2W39A 3LQCA 2FCVA 5F3EA 4CCKA 3P3NA 4DFSA 4H55A 4AWDA 5T5PA 3KCXA 4Z1VA 1W3VA 1YIPA 2FMDA 4B4RA 5A3OA 4OI2A 5T50A 4DMIA 5AFBA 2ZAAA 2HBUA 1SLAA 4ZS3A 2XXZA 3HEIA 4I0BA 4M3CE 1H1AA 1REEA 3OUHA 1GQHA 2RM22 5DPNA 1XB9A 3DF0A 3M3QA 2WRAA 4GWNA 1ZRDA 3ZN5A 5LEJA 2I74A 4KU8A 1HW5A 5FKCA 4XYXA 3OJBA 2HEWF 3ES4A 3W58A 3MYXA 1SZBA 1X36A 3K4ZA 3OGGA 2XUEA 4BHPA 4JGZA 1CAWA 1UY3A 3I2JA 4MXWA 3KQRA 1LGNA 1ZNPA 3DL3A 4K8RB 4XFFA 4CCLA 2JECA 1ODMA 1XE7A 1WCQA 5FIXA 2W87A 5LA1A 4C0HA 1D2QA 5H9PA 5I8YA 2P3YA 1DQ4A 5AC91 4QKDA 4EN9B 2VMIA 2VECA 5A1FA 1FATA 4QX8A 4XJ8A 5JVVA 1BXHA 4LIVA 1VMHA 4LKFA 4LOTA 2ZHNA 3H1YA 5A7PA 5I8TA 1XQNA 2WZR2 1TME2 3KB5A 4EZHA 1TEIA 4Q0SA 2OZJA 3AL6A 4V1PA 1ZBE2 2ZS6B 2XJPA 4PHZA 2EXIA 2N7GA 1P8JA 1SHWB 3JB4C 3SEEA 1W6OB 3OEAA 3BVCA 5L7OB 5JPMB 2D93A 5E89A 4H2AA 2BJSA 1UW8A 4TN7A 1Y43B 1W03A 4OLLA 2GALA 1LENA 4Y4RA 1UQXA 3HNBM 1DGLA 3LDBA 2VUDA 3K3OA 2FCTA 1W99A 3V0AB 5KXBA 2DCJA 4QPIB 5L9BA 2B39A 3N9QA 1PK6C 4FOWA 3DKQA 2J1TA 4PIXA 4B7EA 3FMGA 1YYNA 3JZVA 5FMOL 1ALYA 1O3TA 4H7LA 1NCRA 5FZFA 1KXGA 1GZCA 3PNAA 4YVWC 3WQ1A 5M0TA 1W2UA 2E32A 4E8CA 1ULPA 2WLQA 1N1TA 1GUIA 1DGWA 3I59A 3N9PA 3WG2A 2CAUA 3LIGA 1IOAA 3ATGA 1YFWA 3LDRA 4YGCA 4M3CA 4XF4A 1VBA3 4BB3A 3K2OA 5A70A 2P2KA 2VOWA 2C26A 1OFNA 2D97A 4HL0A 1KJLA 2JG8A 3NAPC 3WW1A 1UU5A 1UPIA 2XKOA 4CEYB 1ND3C 1UZVA 4AQ2A 5H9SA 1Y9GA 3VZKA 3SH4A 4UFMA 3AP4A 3VZLA 2FD8A 4NRMA 3QOPA 4ZPIA 1ZRRA 2JDUA 4GALA 5F5AA 4AW7A 1C4RA 4B1LA 3BTAA 2G9GA 5ISLA 5ANQA 4YGDA 1QHDA 4DINB 5JAXA 4XFGA 1ZM1A 5JOZA 1BBT2 3VBSA 5JLVA 3Q9OA 4YW4A 2RVAA 4PQQA 4ZKTB 3JQXA 2OA2A 2XHNA 4HK8A 1PNGA 5A6ZA 2Z4FA 2XR4A 4N43C 2X53S 3BPSA 1VBC1 1GZWA 4LULA 4RGGA 5I93A 5KBFA 1J83A 1UMIA 3H3ZA 2ILMA 2GN3A 3VZNA 1D4M1 3AZZA 1RINA 2DU1A 1DYKA 3LAGA 2VUAA 4QDQA 3O1VA 5FXVA 5LCWL 1O4TA 2QQWA 4FPLA 2OZ6A 3BOPA 3OOXA 2Z5WA 4P02B 2C5DA 1QJEA 1L7RA 4NUBA 2WC2A 3POWA 2BFUS 5T5LA 3PUHA 5C4WC 4FXGB 3J7MA 3GBFA 4CXXA 2ZMLA 4RGAA 5C3PA 1OLQA 4NVPA 4RFT0 4WM8A 3TB0A 1SFPA 1M4WA 3QH7A 1AYM2 4IEWA 5L73A 1X50A 2ZGQA 2UY8A 2DFBA 1OI6A 4AVTA 2RR11 2PHTA 3GZAA 5JIAA 5EJ1B 1UF2C 4UT5A 1K42A 3GM8A 3IM0A 3EYPA 1XNKA 1JW6A 1MQTB 2J1AA 3N3HA 4FT8A 3ZM8A 1L7LA 2B42B 2NMOA 2BZDA 4LBJA 1B09A 2ZGRA 4RQPA 1U5ZA 3I2DA 2JDYA 4DB5A 4DXTA 5GZGA 1XRUA 4MYEA 1W6QB 1KFXL 4XMIA 5JR7B 3SHRA 4IGPA 1FT9A 1LRHA 2VBDA 2WYSA 5A7NA 4NPRA 3T2QA 4FOQA 1RITA 4ZXKA 1Z7S1 3ZXDA 3VZMA 4AVSA 1JYTA 1MS1A 2C9AA 3IMNA 5FKBA 5LK5A 3S7EA 1H9WA 3ORJA 2D98A 1J59A 4OFGA 1DFQA 3AVRA 2LTNA 1OLRA 3AMQA 1IQDC 4QDRA 3SISA 1CX1A 2JEMA 1FOD2 3RSJA 4XCBA 3MHZA 4AOCA 1JUHA 4TXWA 2F6BA 1HLCA 4B8EA 4Y1VA 4FPGA 2GMPA 1HQWA 4GULA 1W9FA 1C1LA 2WBKA 1BVP1 1V00A 2ZX1A 3HAGA 2JB4A 2Y0OA 3JD73 5HCBA 3RMYA 3THPA 1OBNA 2IZWA 4YGBA 4FPHA 2EAAA 1NXD1 3ZXLA 1MS8A 4AI8A 3AXDA 1PVC2 4J1XA 3HT1A 3RZZA 2VUCA 3I54A 3B02A 4LBKA 4FAGA 2W2IA 3I3QA 5GLVA 1PHMA 3SH5A 4HN1A 1LOEA 4KQ7A 5AVPA 3S5QA 3U75A 5A3TA 1POV3 1LNSA 3VZJA 3H7YA 5FJHA 3AP9A 3ST7A 1RUJ3 4UOJA 2IXIA 4K1YA 1G9CA 2GH8A 1Q5OA 1VB4A 2D43A 3AKTA 5ANNA 3LOBA 4MV2A 1AJKA 1TNRA 2GDFA 3J7HA 1AYN3 5TSWA 3J9SA 1UZWA 4MXWB 4K8FA 1C8NA 3OEBA 2W91A 2WNUC 5FP9A 1JTZX 2ZX0A 1S2KA 2E53A 4UFIA 4CU9A 4AAXA 4WVMA 3JBG1 4NOTA 1T6GC 3B00A 4QM9A 5GLUA 3MFCA 5FPVA 5CFCA 1HX6A 1W90A 2WAAA 5FZLA 3CHXA 3B93A 1GLHA 2X29A 3TBDA 1O7FA 4S2GA 1N1SA 4RHV1 1DCSA 4HPKB 3IMMA 4M4RA 4RD7A 4X6QB 5E88A 2R16A 4Q26A 3POFA 1WKYA 1XU1A 4P5HA 3RWKX 2VCCA 1VMJA 4AEDC 4KG8A 4MADA 3FLRA 1B35B 3LSDA 2IFRA 2JE8A 3VKNA 1O8PA 3VBFB 3NWKA 2E31A 3USUB 4E2GA 1KFUL 1W0PA 3WW3A 4GH4B 3POSA 4A3XA 1HN0A 1NZCA 4WM7A 5CU1A 5KXDA 3WNLA 4D7SA 4HN0A 3RG0A 4YM2A 5IVJA 3CMGA 2XBO2 3CLPA 4JGZB 2QFEA 2WR9A 4DXSA 1O3SA 2HEYF 4WM8C 4GAZA 3U11A 5L9VA 4CU8A 2P17A 5J37A 1IS4A 3T08A 2C1FA 2WNUA 1NE4A 2DCTA 2PELA 1ST8A 4H3WA 1JHNA 3MUZ1 5DDJ1 5F9TA 1K5JA 3LEKA 4KNCA 4F7ZA 5FK8A 3VBOC 4Y3OA 1SCRA 5C70A 1C8M1 2Z42A 1FPN2 2R1BA 1S1AA 5FYHA 3SQOA 5FY8A 1XYOA 2A73B 2Y6FA 3ZKYA 1WA4A 3U4SA 2K2SA 5ACA1 1HKDA 1Q3EA 4IESA 2ZBJA 4D0QA 3LDKA 4CU6A 5H9RA 3PIJA 1AYM1 3FFZA 4IE6A 4N9IA 3VDDB 1VBB2 3PTRB 4YFWA 5J98B 3OUIA 4Q4V2 3O1OA 3VD4A 1FNYA 2YU1A 2ZA9A 3MO4A 5JMCA 3HJRA 3HOBA 1LECA 1FNZA 2LW8A 2RMU1 1ND2B 3PUQA 3THTA 3ZR6A 4IEPA 4I01A 1XYNA 4NHXA 4QPIA 1XSRA 2WIIB 1LOFA 3TN93 3N9NA 2JXAA 2WSVA 1RUNA 4XCAA 3U14A 2NMNA 2G4IA 3ZFFB 1MS3A 2VL4A 1NA1B 2BGOA 3I7DA 2AR6A 4RQPB 1QDOA 3DPRC 4K21A 1AX2A 1VBD3 1UXXX 3ETPA 2X10A 3DV8A 2P1BA 4GXLA 1SLTA 4MGKE 2RDSA 5GZDA 3RJRA 2OVUA 3M1HA 4RA0A 2YC0A 1RB8G 1NX9A 4FPEA 2OKXA 5K0UB 2LALA 2B9VA 2ZABA 4I0AA 4K9SA 2YBKA 2W95A 1OPMA 1UU6A 2IFWA 2FZ2A 4YWAA 1M06G 4BLIA 2E63A 3K77A 5JOXA 4C8DA 4XZUG 4D6QA 1YEWA 3MEPA 4FOVA 1LR5A 1WLDA 3LEIA 4CDUB 1OOPB 5GLZA 4TLGA 1G9FA 2XGXA 3I97A 4UF0A 2QTWB 2EA7A 4QM8A 4B4PA 2ZHMA 2VBBA 4EROA 4LK7A 3S30A 5FDBA 2P3JA 2WFF3 3BOWA 1SEFA 2XL7A 2X09A 1UWWA 3ILFA 3RVHA 1GWKA 1W2TA 4A44A 3SCHA 3E5XA 2ZX3A 1R081 4XEZA 2QQVA 2ZX2A 3KV9A 3ZXJA 1CAUA 1QOOA 1IPKA 1QJX2 2AUYA 3H3LA 3T2PA 3VHNA 1OC1A 3GYDA 4ONUA 2JKXA 4YYOA 4QQHA 2WSUA 2W68A 4FPYA 1U12A 5FZHA 3WUDA 5FZCA 2NM1A 1WD4A 4N90A 3VBUA 3ZXEA 4EYUA 1WBLA 1GZTA 1XJAA 2YV8A 4BQXA 4DXZA 4JAAA 1YFYA 1KGYA 2WZ8A 4MXVA 2RS33 1I9RA 1GICA 1GOFA 4A42A 3ZYGA 3ZO0B 4LNVA 1CESA 2QKDA 3EQEA 3UGFA 1YXWA 1V6LA 1C57A 1MQTA 2UY9A 4ZU5A 2VM9A 2PHDA 5GJ6A 3VBUB 1RUC2 2E7QA 2Q1ZB 3BIWE 5T3NA 4U2AA 5T54A 1PO22 5FLIA 2RG4A 5K0UA 3C3VA 1COV2 3MF6A 5FAXA 2GN7A 1MEC2 4XIOA 3GJAA 3IDAA 1W6MB 3KGZA 4LE3A 5AVAA 4BM8A 1MZEA 1SLLA 3VD3A 2J1UA 3TEZA 5KHKA 3T30A 4HBNA 1AR93 1VMFA 3GHMA 2P6CA 2YZ4A 4P08A 5K7PA 3BUCA 1ULCA 4QHZA 2FZ1A 2GNMA 2Y6HA 3D3AA 4HOOA 3UJOA 3GHNA 4QB2A 3KD4A 2YMZA 1KITA 4O9EA 1W2AX 3MZHA 2PHLA 3TN91 1HXS3 2IXCA 5CFCC 3KM5A 3AP7A 3MW4A 5IVEA 2FBEA 3JU9A 5F3GA 2FDKA 1WCUA 3QD6A 1D0HA 3UETA 1UN1A 5IK4A 4M3CF 4P9YA 5D21A 5KXCA 1W6PB 1WBFA 2CWSA 3GXUA 2CTVA 1F9KA 2Y33A 5FP8A 2HEVF 4CVUA 1NQJA 1KDMA 3ACGA 4KBBA 5T5JA 3ZSEA 2FCUA 2V09A 1WD3A 4NN0A 1UKRA 1X9TA 3SC7X 1AXZA 4K7JA 5FMOS 3V0AA 1RUE2 2HWF1 1LGBA 3H9AA 3QBQA 4WM7B 1UIKA 1LODA 3NNMA 4PIYA 2PYTA 2D3RA 1JBCA 4Q8LA 4DO0A 2BVVA 4W6WA 4BK4A 3MBWA 2VTXA 2HH9A 5FV3A 3VBOA 4UW5A 3FL7A 2C0ZA 2HWB3 5E6HA 3KT1A 5EQUA 3ZSKA 3MFAA 3DXUA 4D7TA 3M2MA 4QWNA 5FYIA 5IAVA 1A8MA 1OURA 4YVSC 1TQ5A 3I2IA 1XNTA 3RYRA 1URXA 2G1MA 3FBYA 3VUOA 2WS91 1UOGA 2GNTA 4JGYC 2MEV3 2YU2A 4JKLA 1XE8A 4H14A 2D5FA 1CPNA 1UX6A 1HIXA 1R092 2WO2A 2K0GA 5IVVA 1KJRA 5DG1A 4QB1A 3T2OA 4IEQA 4DQAA 5L7OC 3O1MA 3KHCA 4UFLA 2Q8OA 1LULA 1ZVFA 1NA1A 2CGNA 4GJZA 3USUA 3HQUA 2EXHA 3VL8A 2ORXA 1O5UA 1JYWA 5EWSA 5FZIA 3EMRA 4Q29A 1OD3A 1AR83 1WLTA 2AZ5A 2XJTA 4GWIA 2WZPP 3VDCA 4QPIC 3R4DB 5CG9A 1PK6B 2X5IA 4YVSA 3V0BB 1IS5A 3E1F1 3ZN6B 3LPFA 2WT0A 4G9SB 1PGL2 4QQ2A 2BNMA 2HKXA 3WSOA 2KA3A 4BPZA 1Z78A 4FOYA 4DY3A 3FHIB 4XBQA 1IHMA 2VBPA 4N7UA 4LJHA 4Y20B 3RI8A 4DRRA 4RFRB 5IK5A 1CX4A 1ENSA 2XVKA 3T09A 3N7LA 1NLRA 5FZ7A 2J1SA 4E4DX 3NJXA 1AXYA 5J09A 2YXSA 4GB32 3VBOB 1RUG3 3D4KA 3B7MA 1STMA 1GZWB 4J25A 1ZZ8A 2JG8B 1ULFA 4BQ4A 5C8CC 4Y20A 2DUOA 2WQ4A 5BNNB 4OYUA 1CGPA 2QQOA 1PO13 4HLTA 2OPKA 1UYZA 3UGHA 1UU4A 5FBZA 3VHOA 5ABJA 2P3IA 1BZWA 4A3ZA 1VALA 3EHKA 4YZ1A 4XMAA 2WFF2 3LF7A 2ZGNA 2ZACA 1U5IA 5CFDB 4LBQB 3CJIC 3WDXA 4XHBA 3OYWA 1OD5A 5FYMA 1RUH3 4Q4Y2 1CJPA 4PDWA 4LKSA 3ZN4A 1BYHA 3HR9A 2YC4A 1S2BA 3SCFA 3VHRA 3IBMA 4CEWB 1COV1 3FHQA 4LKEA 2HWC2 3DGTA 1JZ4A 2DUQA 3T0DA 1S0DA 3FLPA 2J1RA 2QVSB 2VD7A 2XJSA 2JDMA 3BTXA 3JBG2 5IW0A 3S5AA 1KQRA 5FQ0A 3M3EA 3MGUA 4GWMA 2ARXA 4BH9A 3BGAA 1V9U3 4QX1A 2PHFA 3DYMA 4XBLA 1EPZA 4UBHA 4XDQA 4ZU4A 3IB3A 1IPJA 3NKGA 4PQ9A 3UKTA 1SPPB 1CVNA 1ENQA 2W52A 2PXJA 3UKNA 4Q4V1 1MQTC 2VZTA 4PIZA 1D0GA 5IVCA 4E27A 3R0RA 1JMUB 3FE5A 1R1A2 2BEOA 2VAUA 2ZKNA 3P5BA 4AGGA 2R041 3CJIA 5IAXA 3HQRA 5H9QA 5IFPA 3RWNA 5KHHA 1J3RA 4V2WA 1L3JA 5LEKA 3P6BA 5DG2A 3RNSA 1NT0A 1OA3A 2YFZA 4BIOA 3S0MA 2PHRA 1LHUA 5F1RA 4AZZA 2DV9A 3M3CA 4KI5M 4ASMB 1GP5A 2XWJB 3BYWA 5FY9A 5A80A 3LWCA 4DUXA 4XFIA 2TNFA 4CPBA 5T52A 4KL1A 4ZY9A 1RXFA 4UXAA 4E4SA 2YBPA 4GD4A 2Y6JA 1DDLA 4OMDA 3VL9A 1WZXA 3IPVB 3IAQA 4LBMA 1S0CA 1NCQA 1HB2A 5FZ6A 3RGBA 3TNQA 1RUF2 1LHNA 4K6BA 1YRZA 4HT1T 4AYUA 1S0FA 3RFRA 1PIV2 1QH6A 3X29B 1ONAA 1CIYA 1W6NA 1DGRA 5LATA 4JC1A 3THCA 4FP3A 1W9SA 4HPKA 2MPFA 3PVOA 3CU7A 4XOGA 5FPZA 5F5CA 5LZ6A 4YGEA 3ZSJA 3POIA 2VTXJ 3WW4A 3J7NA 5EP9A 5KXEA 2P4EA 2J1VA 1IQAA 2CAVA 3OG2A 4RSUA 3V64A 3AMMA 2G9FA 5DABA 5FR3A 1S0GA 5FY1A 3UV9A 3WQBA 1XC6A 2JG9B 3NW4A 4R8HA 1N3QA 3WNOA 2LUWA 4AFBA 4R4XA 1EYBA 2CNAA 2D5HA 3D6EA 2WNUB 1DQ6A 4COVA 1PZ7A 4AHZA 1RVF1 1RJ8A 3AL5A 4ISQA 4J6GA 4LO6B 1RMU3 4YM1A 3TYJA 4IQPA 4PCRA 2X8KA 3J8F3 2ZGKA 3W20A 3NV1A 3C7GA 4BQYA 2JG9A 2NZ9A 1NCQC 3DPRA 5CB7A 5FPAA 5SV5A 5I0DA 2A3YA 3H1MA 1UCXA 1OMIA 4O7XA 2DUPA 2J1EA 4URTA 2CY6A 3OPZA 1YJLA 5F8PA 4JKMA 3R05A 2XLAA 5C9AB 2P3KA 1B35A 3WHUA 3WOGA 1G6NA 2BBVA 4GB31 3HIFA 5A6QA 3B3QE 5AC92 1NKGA 2NN8A 1RHI1 2PLV3 3ZXKA 1CAXA 3IZOA 5CKNA 3W5MA 3KSCA 4GA9A 4GH4C 2R042 4CP9B 4FFGA 4DIQA 3CKHA 1Q8OA 4OUEA 3KF5A 3IPVA 2WQZC 5JSPA 2K9ZA 4GIQA 1QU0A 4Y1UA 5DUUA 2JDHA 4ES9A 1HRI3 1KS5A 1GP6A 2DU0A 4KG0A 4BA6A 5BNOC 2GNBA 4UW4A 1UIJA 1JOPA 3I59B 1K5MC 4Y22B 3MLKA 4CP2A 4D3WA 4CDWA 1DYOA 4PI2A 3H1WA 5HPOA 4GB33 5A7WB 2DDUA 3FUQA 4HMZA 3WQ0A 2R49A 2NP0A 3AYEA 3O1SA 1SACA 1ZA4A 3B69A 2UYBA 4W50A 4KH9A 1BEV1 1V0AA 2DWRA 4OHZA 2YGLA 5HV4A 1AR73 5IVBA 1FAYA 1G9DA 1AF9A 4A7KA 5G04L 5F2WA 1POQA 1E5HA 3LIHA 3I2OA 1RUH2 3CZJA 1PM4A 1QNYA 5FREA 1LGCA 2DTYA 3B5LB 5IUQA 2R32A 4OHWA 1N1YA 1AX1A 5KR7A 1RUF3 1NXMA 3CZUA 4E2SA 1AR71 4LBLA 4S2DA 1NCRB 2V5DA 2WZR1 1ND2C 3L2HA 4CDXA 1POV1 4FPKA 4L8QA 5A6YA 2QQPA 3ZKUA 1Q43A 1ZRIA 4PF1A 4AK3A 3USSA 2XKPA 3OYWB 4FPFA 4XFHA 1H30A 5FZ8A 3KS7A 3ZYPA 2DVGA 3AKQA 4YW1A 2HWD3 1HV1A 4Z8BA 1IG3A 3S6PA 1GU3A 1WA6X 4Q4W1 5GZCA 3LEMA 4CEWA 3WW2A 1CQ9A 2BFUL 3WT3A 4LBNA 4N53C 1A6CA 2ORZA 1V70A 5A3PA 1GR3A 4CZSA 4META 3BTZA 1VBC2 3N36A 3U10A 4NWVA 1XBFA 2PQSA 3HD8B 1H6YA 3CQOA 1QJU2 1ULGA 2Q4SA 2WWJA 3C7FA 1KS4A 5T55A 1IPSA 2WABA 1F5JA 3BALA 1AR91 1K45A 4O9GA 1RHI2 4XUTA 2ERFA 3MPPG 3OBAA 5FUIA 5IVYA 3HWJA 1JHJA 2WDBA 4FQ4A 5T5OA 5C8CB 4K1ZA 4UYBA 1PGSA 4NIHA 2GAUA 1GWMA 3VBSB 3ITQA 4LHKA 1TNFA 2UU8A 5G05L 5CADA 2I45A 1WMFA 1JI6A 3MIDA 4LTAA 2XPJA 2DTWA 2H0VA 2PHUA 3POJA 3POGA 5FYBA 4GKYA 3UESA 4M0NA 4FPOB 3P3PA 4INDA 4YM0A 4AEKA 4BYYA 5IK8A 4P9IA 1AR81 4AI9A 1AYN1 2DCKA 3CJIB 2CHHA 4RR3A 2BGPA 1Q56A 1XNBA 2F4PA 2VVDA 4JX0A 4P5YA 5KC6A 3AYCA 4NIDA 2A3XA 3I3MA 3U4XA 3IKWA 4AEMA 1HRV2 5JDBA 2UWBA 3QLQA 3JCIA 3OGRA 3KV6A 2JIGA 2TBVA 2ARAA 2AGSA 2WA4A 1IG0A 1SLBA 2G9ZA 4XF9A 1WUVA 4NWWA 3POEA 4NRQA 1ENRA 1GOGA 1UZ0A 2W94A 3AZWA 3HBKA 4JGZC 1QXRA 1W6MA 4MGYE 3VGIA 3AVSA 3GCWA 1G9BA 2YHJA 2RDNA 3H42B 1AJOA 3DCQA 1R083 1A8DA 1PMJX 2ZGTA 4IV3A 4ORFA 1UPSA 2YPJA 4Q5OA 1RUH1 3AP5A 4OULA 1EP0A 5F39A 4L97A 4QGMA 3OGSA 2Q8CA 4YFZA 5LY2A 4QXBA 4OMCA 3CJXA 4AVVA 3PURA 4Y24A 4M00A 4BU2A 2W92A 4QXCA 5FYVA 1MS4A 3J4UH 2A3WA 2A7AA 5A3UA 3GBGA 5DZFA 3LA3A 1JODA 1RMU2 1YHFA 2AC1A 3GNEA 4XJUA 1VBB3 5IFTA 2MEV1 4B1MA 2ET1A 1UXZA 3ILNA 4EZ4A 2VZ1A 1AR63 3OB8A 3KCYA 3RZHA 4YG6A 2VZVA 4RS5A 1CPMA 4BQ3A 1C28A 1W0OA 3TAYA 4COYA 5JR2A 4FO9A 2YB7A 2VZPA 3CO2A 4QQOA 3ACLA 4P14A 4TTGA 1LHOA 3OGVA 4BXSV 1GQPA 3C8XA 4Q4Y1 2VCMA 3ZYFA 4AI2A 4CEYA 3T4VA 1FI2A 4XFBA 1MPXA 1AR82 3E6DA 4CP9A 1EUTA 3VKFC 1VRH1 3O1TA 1POV0 1F8VA 2D3PA 3WF1A 4N43B 2WN3A 4NROA 2BERA 1JYNA 1RIRA 2Z69A 1FMD3 3A21A 1HB4A 2QZ3A 2PAEA 2CDOA 4E8DA 2Z2SB 4OHVA 1SDDB 5JI7A 4FBFA 3MW2A 1L7QA 3D0JA 4QPYA 3PJYA 2CSGA 3E5QA 1MZ5A 4Z2WA 1JZ8A 3ZYRA 3DECA 2VW2A 3HNYM 2KD7A 5FPXA 5C7GA 3A23A 3I2KA 3ZFFC 1CN1A 2ZCWA 3ZOIA 3KMHA 2CGOA 3RYPA 5LY1A 2AEZA 5LA2A 3AKSA 1K12A 5JXHA 3VD9A 5DUXA 3T1LA 2GSYA 2W47A 3FN9A 4AAPA 4XURA 4PI0A 2OQ6A 3NO8A 4IEXA 1VJ2A 1RUI2 1UOBA 2IXLA 2BWCA 4WM7C 5C8WA 2WO3A 2XQXA 1PVC1 4BLJA 5I0UA 1BBT1 2HBTA 1IS3A 1QKQA 2RHPA 1AZDA 1UYYA 3ECQA 3H8UA 2BOJA 2EXJA 3I4IA 1C3HA 4B7KA 1FX5A 5DN2A 4FTSA 2WFPA 1UYPA 4XETA 3WG4A 3FZ3A 3HBZA 4W6XA 1VBE3 4OQ8A 1ASJ1 2D44A 4R9DA 2A6XA 1QJU3 5GM0A 4YVSB 2B5HA 3NNLA 2H6CA 2DCZA 3NNFA 3CNAA 4FPJA 4ZHNA 1W8TA 1MS5A 1QJX3 4FP2A 1BVVA 4LIUA 3OTFA 2K46A 4C90A 5A3LA 1JOBA 3ABZA 3CIHA 5E16A 4YPJA 2VNOA 1JOJA 3AK0A 1DQ0A 1YCIA 3MPBA 1V9U2 1V9U1 2ARBA 1J58A 4HXCA 3ZX7A 3MLLA 3JUUA 4XAEA 2J42A 2PAMA 1OH4A 4IV3C 2X05A 3WDWA 3LB9A 4Q4X2 1GANA 2Y6KA 5L36A 1SLCA 1GSLA 5BV6A 2A75A 4W6YA 1CIWA 4XABA 3E6CC 2HLEA 4XILA 1W06A 2Y0IA 3TEXA 2FDFA 5F7UA 5JUVA 1TMF2 2WO1A 4W4ZA 4XTPA 4FTEA 1ASJ2 1V6KA 4MO3M 3F2ZA 2WA3A 5C3SA 1MACA 5IATA 1W05A 3EJKA 4URAA 1W8WA 1MEC3 4BISA 1R1A3 2IVIB 4QU2A 2JD4A 3AJZA 5J1XA 1W8ZA 4N53A 3WCSA 5FY7A 1IS6A 4F83A 2WL1A 1XSQA 1BK1A 4PDWB 5A7QA 1QJU1 2GC2A 2E33A 2XL9A 4DUVA 2UWAA 3IDBB 4MVTA 2IC1A 3ZYIB 4D6SA 1ZA7A 4W65A 4XJ9A 4A7YA 4DEVA 4BXFA 4F8AA 4BQWA 1REFA 2HWC3 2OUJA 2D40A 2QQIA 5FPBA 1UY4A 2Q1MA 4EN6B 2BPA2 5JXGA 4UFKA 3AM2A 2HWE1 4N8MA 1I1EA 1BLZA 1HJGA 4A41A 4CSWA 3HN1A 4CXYA 3TN92 3ZFEB 1JZ2A 2WS92 3AMPA 2E9QA 3H50A 4W8JA 5CFDA 1BMV2 4IEVA 1OKOA 1NG0A 2D3SA 4KGGA 3WDUA 2WJSA 1SQ4A 1XOYA 4KGQA 1Q8QA 2XJQA 1IZ3A 1PMIA 2RDRA 2W08A 1WW7A 1X8MA 3KV5A 1AXKA 1W0NA 1DQ1A 5FFOC 5FYSA 3ZFFA 4EN7B 4UI9L 1W6OA 3HVDA 5L7OA 4QDSA 4Y5Z0 4ARYA 1LB2A 5LA9A 2Y6GA 2RV9A 3BU0A 4P9GA 5CG8A 4Y1XA 3VBRB 4CCCA 5BNPB 2BV4A 3L2YA 1J1LA 4JHTA 5FLHA 3AC0A 3RPQA 4Q2FA 1EAH2 2F17A 5CIRA 1S4CA 3INAA 3ZYHA 4E4HA 1FXZA 5FK7A 2B4KA 2LS6A 4HANA 1V6OA 1RJ7A 2JE7A 1GZ9A 4COUA 4N53B 4ZONA 1YQCA 4ARXA 4EWAA 4COWA 3KT4A 3KWVA 1NE6A 3SH3A 4O61A 2PHWA 2R1DA 4CXWA 5JSOA 2OT7A 4NE9A 3SEPA 1ZRFA 4NHLA 2VCAA 5C3OA 2ZHLA 2ZGSA 1S2EA 4IV1B 4LQRA 4AEJA 5JSRA 2VVEA 5BUVA 4ATEA 4XJAA 5K9YA 3ACFA 4I0WB 2RR13 4GH4A 4CCMA 5C8CA 4PLOA 1PGW1 1F4HA 2R063 4HG6B 3OY8A 4AI3A 1W6PA 4HKOA 1HXS1 3MIGA 3VDDC 1T6BX 4LA2A 3RZJA 1SFNA 2OPWA 5LRRA 3O12A 4LHNA 2ZHKA 1VBE1 2WO7A 3C7EA 5SV8A 2AH2A 1FV2A 5CYYA 2RS31 5A33B 4HVRA 1ODNA 4X8NA 1ZZBA 3HN3A 5DXDA 3KCCA 4BJ0A 5KHJA 1K5MA 4OHYA 4P9XA 1Q8SA 3UL2A 4DOUA 2DVDA 1S55A 5FXXA 4CCDA 2IXKA 3AZVA 5BNPA 4MG2A 2EIBA 1BEV2 4G3YC 4RHV3 5C9AA 1N3OA 3MW3A 1NA1C 2D6OX 1LKNA 1JU3A 2ADEA 4RYDA 4XTMA 2O0OA 1D4M3 5FZ4A 1GP4A 4P9JA 4Y1YA 4ISRA 1G8WA 1PVXA 1PMHX 4HSJA 3LD8A 3POBA 3PJQA 2VOVA 1AR92 1QQP1 1IKPA 2RS51 2WZR3 2VOTA 3TWIA 1TME3 1C8M2 1CD3G 1W9YA 1W8OA 1X33A 1WGPA 1X82A 3VHPA 3ZLIA 2EIEA 2FHRA 2WS93 4NHYA 3LGRA 1AYM3 2JG9C 4XUNA 5LWBA 3WNNA 3KVAA 1J3PA 3ZMNA 3EBRA 5A7WA 3T4HB 1BQPA 2C4XA 2W9XA 1PIV1 2XQRA 4MGIE 5A6XA 3WD5A 3DEMA 1ZBA2 5FCCA 4Q4W2 4R9BA 2XLGA 2CV6A 1WLCA 3K48A 2XBO1 1H8TA 1IKQA 2A6VA 4OZOA 4XUPA 1VAVA 1F15A 2W1WA 4YW6A 1SFYA 2VQ0A 2VJXA 4XXPA 1DG6A 1FOD1 3ZIXA 1YWKA 1JZ7A 5A32A 1OLME 4D94A 1GNZA 2JD9A 4CEWC 2EIDA 3MUY1 3WVJA 2V73A 5FP4A 1DIWA 3KZ4C 4ATFA 1E57A 3B9CA 1OA4A 2W46A 3E5UA 1MZFA 3B9IA 1PM7A 3NV2A 4L0PA 4D8MA 1BBT3 4PLMA 1EUUA 2QDRA 4CUCA 3HQXA 3E6BA 4WV8A 4BQ2A 3NJVA 5J96B 2QZ2A 3T0BA 1OXCA 5JMOA 1LTEA 2I07B 3M4FA 1NY71 5ABJB 2RJKA 4FSJA 1UX7A 1I5PA 4AGVA 3EXUA 5I0SA 4MGTA 3APBA 4AVCA 2EIGA 2QQUA 2V4VA 1CONA 1XU2A 1QIQA 2VMDA 4ES8A 4HVOA 5J48A 3ACHA 4AFCA 3OBTA 4BQ1A 4XVHA 1W2NA 3N9LA 3ME2A 3IWZA 3Q8CA 4XDOA 3BIEA 4XQ4A 4MX3A 1H2KA 3AX4A 2JDNA 3R4UA 4M0HA 3I2FA 5FXZA 1PO21 3KF3A 4Y26A 3CDZB 2DVAA 5C6CA 2BTVC 4OVEA 1GKBA 4NAOA 1VRH3 5DUVA 5A3WA 5FQ0B 2UYAA 5BNQA 5K8SA 2WUHA 5HXVA 3RZMA 2W1SA 2VC9A 2BDRA 3KHBA 4UWDA 2R072 2VZQA 1YUDA 2ZOEB 5FRAA 4QX2A 3WF3A 4DS0A 4COZA 1H0BA 2A5ZA 3AZXA 1ND2A 3FBMA 1H2NA 3IDEA 1ULDA 4IETA 4PBOA 5DAVA 4CDXC 5B4NA 4IEUA 4Q0PA 5CFCB 5F2SA 1JYXA 3NKTA 1R1ZA 1QJZA 2ZGPA 5JCTA 4XJZA 3ZSLA 2WYFA 2OW4A 2P6HA 4FAHA 1NYWA 1SBFA 2VMEA 4UAPA 3VBHC 2GH2A 1FPN1 4FFIA 3K4DA 2EF6A 3LA7A 4QX3A 1ASJ3 4OQ9A 4IE5A 4KMQA 1ZREA 2E6VA 5FO7B 4RR3B 1WCKA 1RUG2 2VPVA 3LE0A 2RJ2A 2QUOA 4XC9A 2XB6C 3RS6A 5BNOA 4NIGA 3NV3A 3ZFGB 1Z7S2 2XH6A 3GALA 2OYZA 5FY0A 4AVAA 1KEXA 3UKVA 3UJQA 5CEHA 3OUJA 5LBCA 3I3DA 3ZDSA 4N9HA 2B45X 5FOJB 2RE9A 1QGLA 4LOSA 4UFHA 1EY2A 4FI9A 2PLV1 3J8F2 1SPPA 3PVNA 5CNAA 1OLMA 2O8QA 3D8CA 4LLFA 4CDWC 1PO12 5EJZB 5FZOB 2AACA 1GFF2 4QPWA 4A6OA 1WCSA 2RMU3 1ND3A 3DYOA 1UMHA 4ASLA 4WVZA 3I8TA 2A71A 3AKPA 5FY4A 3Q8AA 3KLSA 1H2LA 5JOWA 2P5BA 5A33A 1C8M3 3UGGA 2WINB 4EN0A 1FMD2 1RUD2 1GWLA 1NLSA 4IEZA 4QU1A 5JWPA 4L11A 2R043 4JRLA 2G19A 5F5QA 3WY6A 3ZFEC 1TG7A 2EXKA 3SXWA 1D4M2 5EXOA 5HI0A 2BUKA 1OA2A 4SBVA 3VB9A 1HRI2 1MR5A 2KR2A 4QKFA 2XBO3 2W1QA 3I2GA 4OI1A 1QQP3 2RS53 2A6WA 2YPDA 3B01A 1BCXA 3UT0A 3WG1A 3ZYJB 5IHRA 1O91A 3A7QA 1YQ2A 2WNOA 4E4ZA 4Q4V3 4IEOA 1VR3A 4JKKA 1MEC1 5FTTC 4CP1A 4JCKA 2W0XA 2XVLA 2VNRA 1ENXA 4QKBA 4AE2A 1SBEA 3Q8FA 5FP7A 1DP0A 5BNOB 1AYN2 4XBNA 1O8SA 2B46X 2DF7A 5FZ0A 5B2GB 1K5MB 1PZ8A 2GNDA 1W8FA 5GLWA 5DAPA 2BGCA 1LOCA 1VAMA 1AR72 4IGQA 1C5HA 1BK0A 1OF3A 2YROA 3AZYA 1SLIA 1OFSA 4BMEA 3CBNA 3BB6A 4Y1ZA 4AEDA 4BE3A 4AVBA 2WNVB 3WP4A 3SKVA 1DHKB 2VU9A 1N47A 3CEWA 2NPIA 2MHFA 4LA3A 5EIYB 2OUHA 1US3A 1CZTA 4Q1RA 2JDPA 5J3UA 2HWD1 1QJX1 3OY8B 2LROA 2QBXA 3LPGA 1YI7A 4QXKA 2BW8A 1H8TC 2O14A 3VKLA 3MICA 4PJYA 5C5TA 5IVFA 3ZN6A 1YI9A 2LRPA 2QE3A 4AHYA 3QACA 1WMEA 1LOGA 5DZEA 4IGOA 2R30A 4KBZA 2GZWA 1R64A 1OVPA 4FVVA 1OPOA 4LMFA 1BKZA 2XVGA 4D7YA 1EV11 4YW3A 2WWUA 4BMBA 2Q0AA 2ZKLA 3ES1A 2GC1A 3C2UA 3FX3A 4JTOA 3RI9A 4AFMA 5FPLA 1AVBA 2WQ8A 5GALA 2XG3A 2W5FA 3ZR5A 4MUVA 1RYYA 1VP6A 3AFKA 5DAQA 4CDQC 1REDA 5BYNA 2ZEZA 2ZTNA 1CAVB 5EHDA 4P9WA 5LW9A 5FYCA 2CL2A 5DZGA 2FDGA 1PO23 1HB3A 3O1PA 1V6IA 5F6KA 2RS13 2Y60A 2GC0A 3FLTA 4PLNA 4ZZ5A 4BWOA 1JH5A 2ZGOA 5BXXA 1UNBA 4AFAA 1DZTA 1W04A 2Y64A 5A1AA 1V6JA 3QH6A 3DXTA 4Y22A 3I3BA 5JZGC 3IT8A 3SCGA 1OVSA 3HPNA 5DAWA 3VKMA 3DKWA 4GWJA 4CYDA 3N35A 1RUD3 2YY1A 3NRUA 5KHGA 4HETA 4XF3A 3GZUC 4JZRA 1NZIA 1YLLA 3LCPA 5D8AB 5E8AA 5FZKA 3W9AA 4CDQA 2XLFA 3AMNA 1Y9QA 3BU7A 4LO7A 1RGSA 3MDPA 1UY1A 4LT5A 3OBRA 1LOAA 1QOSA 3CF6E 4MOAA 4Z07A 1TZOA 4CEYC 1U5YA 4LITA 4LORA 1ULOA 3FUOA 2XONA 4AR2A 4EJRA 1QJFA 3G6JB 4GZ9A 4LO4B 1PGL1 1LESA 2DCYA 5I0TA 1U0AA 4KWLA 2VGDA 5FLJA 2ZEWA 4PBPA 2GC3A 2PA7A 4GMP0 1LCLA 4AGRA 1OF4A 4FTBA 5AC93 3NAPA 3PHMA 5A32B 2RM21 4YW7A 5EJ3A 2B7YA 4K20A 4LLOA 1H4HA 4DXRA 3RQ0A 3V0BA 3A0KA 2XJUA 4DEQA 5F5IA 1D4VB 1QH7A 2R061 1GMMA 1PZ9A 1Y4WA 3H8RA 3RZGA 5LASA 2JKBA 4WVWA 1NY72 2ZAHA 1UOJA 2HWB2 5DDJ3 4XQDA 1SG3A 2FDHA 1LAJA 1RVF3 1JN2P 2R0HA 2VNGA 4CRQA 5JXJA 4Q0VA 1W28A 4IW3A 4QX7A 1AHSA 2B8MA 4QHBA 1O5LA 2WFF1 2X5IC 3S57A 4YARA 3JQWA 2VUJA 5JI9A 3AYAA 3VBRA 2MEV2 4OI0A 3AYDA 4AF9A 2ZMNA 2JICA 3LA2A 4Y5SA 2VG9A 1PGW2 3D82A 3VZOA 1GOHA 1KD7A 1RC6A 5C4WA 5D8AA 5L9RA 3U07A 3W21A 3N7JA 4NIAA 2OQ7A 5GKAC 4XFCA 5I8SA 1W39A 1XE0A 2BRTA 3M7AA 1IGOA 2Q5TA 4QPGC 5FO9B 1OOPA 3MIEA 5HV0A 1FYUA 3AJYA 2QQKA 1UZZA 5GZFA 5FZGA 1CAWB 1CJDA 2YBSA 4XF1A 3OPWA 2ETEA 3O1UA 4NPMA 5FYZA 2LM3A 1NCQB 1FV3A 1GQGA 1YQ8A 2VMFA 4A4AA 3WNMA 1Y7BA 3FC0A 4HZFA 5IWFA 2D6NA 1DF0A 3O7OA 2C6SA 4CDXB 2XHKA 4LKDA 3T2TA 4YZ4A 2PLV2 1OHFA 3K46A 5C9AC 4B4QA 1GNYA 1QQP2 2RS52 4NJ4A 4D69A 3U37A 4RHV2 3ZVXA 1BJQA 3TOJA 5CZKA 5FZDA 5FUPA 3O14A 1VRBA 2V5YA 2VQTA 4GQ7A 4QGLA 4GKXA 3VBHB 2YC2A 5FZBA 1HJFA 4A45A 2VTFA 1O59A 4RL7A 3KVBA 4I09A 1O3QA 2DBIA 5DAXA 1CR7A 4EWEA 1I6XA 4PT6A 3U78A 5KHIA 5E1RA 3BTYA 4Y4YA 5EFUA 3ZFGC 4L92A 2ZZJA 1AR62 2ATFA 1UYXA 4AG4A 4BDVB 1W8NA 4NIIA 1UOFA 1A78A 1DQ5A 2AEYA 3N7KA 5JIUA 1LEMA 3FFQA 5CKMA 5JXIA 4R4ZA 3DN7A 2JDKA 4HK9A 3VBFA 3K75B 1RUC1 1X8EA 1ZBA3 3LKJA 4QGNA 5GZEA 2R6QA 2XJRA 4DNYA 1QY4A 1ZRCA 1QOTA 5FYUA 1RUE3 4CDWB 1SMVA 2IUWA 4YRDA 4IE0A 3VD7A 4CCOA 5LBBA 3ALQA 2JWPA 1CZSA 2KXLA 3U1XA 3ZSMA 5C5UA 2ARCA 5KC5A 4WBBA 1JYVA 3K51A 2WLPA 5I91A 3VDAA 2IXHA 2OXBA 3EO6A 4FPCA 2RS11 3WDVA 4UFJA 3WZ1A 1H8VA 1NOVA 2QNKA 1QEXA 1WMXA 3A4UA 1RUC3 1ZBA1 1HRV3 4YM3A 1H6XA 4JDNA 1R082 4Q0UA 5IJRA 3K4AA 2MNGA 4MGZE 4YLZA 1C5IA 2UURA 1NCRC 2PQQA 2D6MA 2Q8EA 3WQ7A 4AEDB 5HXMA 4TLFA 1WWYA 2BU9A 1WLWA 3C7OA 4XXAA 5FMDA 3VBFC 3LEGA 3A22A 4IV3B 2HWC1 5ACA2 4AI0A 2H6BA 2ZEYA 4CE8A 3PVEA 1EV13 1LHWA 2XJVA 2WWSA 3JD72 5FXWA 1C1FA 1OQ1A 2B9UA 4JTNA 4AQTA 4I3PA 2ZGMA 5DQ0A 2PTMA 3T1MA 4F3JA 3H8OA 4B3NA 1PVC3 3MI8A 4V2VA 2PAKA 2E7TA 4WM8B 1WCDJ 3TEYA 1H9PA 4R9CA 3E97A 2I2SA 3IAPA 4J1WA 2ZZQA 2ZX4A 1QJY1 1Y3TA 2D6LX 3WHTA 3Q8EA 1E5IA 3BCWA 4MSVA 4PDWC 2SBAA 3AFGA 2YYOA 1F5FA 2QQNA 3OD0A 1WMDA 1GBGA 4RS5B 4JQRA 4AL9A 4ZS2A 5IYYA 1I5ZA 5L19A 2BVBA 4P9LA 4Q1PA 3IN9A 2HWE2 5BPXA 3VBSC 1ZZ6A 3NAPB 4YG3A 2V72A 1F2NA 5CBLA 1QMJA 1S0EA 4XQWA 3ELNA 5FZEA 3I2HA 2VW1A 1VIWB 4TYSA 4UW6A 5FP3A 5AFEA 3GBWA 1H8TB 2BYVE 3OF1A 4AI1A 2JIJA 1LOBA 1OQDA 5C3RA 1HN1A 1SDWA 2VMHA 3NSTA 4C0BA 4H7MA 5FZ1A 3NQHA 4YNIA 3HNMA 5FMCA 2Q1FA 3PMSA 1KDKA 3EB7A 5LK7B 4WZFA 5EYYA 1DQ2A 1TMF3 1BEV3 5EZWA 2E7AA 1JXNA 2UWCA 4LR4A 1AL22 2DFCA 3N9OA 4BIFA 1W8UA 2OX0A 5BNPC 4LO5B 3D0SA 2W3JA 3WINE 1VBB1 1RUJ1 3PU3A 4LE4A 1OUSA 2R7EB 3O0WA 4YVWA 5FMBA 1HQLA 4LO8A 5C4WB 1DLCA 1ACCA 3CL1A 5I0RA 5LA0A 1XNAA 3ACIA 3ON7A 1H2MA 4RQPC 1HDKA 1YQ5A 4RGKA 2DURA 1AX0A 2R073 1DZQA 1ZZ9A 2XDVA 3NV4A 5CAZA 4OHXA 4ITCA 4IV1C 4QB6A 2F4LA 4YW5A 3ZPOA 1W6NB 1TVGA 4KWJA 3TNPB 2CGPA 1EPWA 4UBGA 2JE9A 2VNVA 1A34A 4R52A 2ET7A 5FOBB 3SITA 4RN5A 4WVMB 1FPN3 1ZX5A 1QF3A 3MIHA 4E9KA 1G86A 2VQUA 2VMGA 1JZ3A 2YDEA 3WDTA 2IVJA 3VDBA 1SBDA 1J3QA 2VCBA 3WF4A 1YIFA 1J84A 1RUE1 3R6SA 1YFUA 4MHUA 2Y38A 3WF0A 1EV12 1LJ7A 3ZPYA 3ZYBA 3JBG3 5K4LA 1DU3D 4BOWA 1W3XA 4GJYA 4OUSA 4CDUC 1H4GA 5DMYA 1MVEA 2RDQA 2WT2A 1J1TA 5IK7A 4ASKA 4ZZ8A 1H1MA 2CU5A 1PX3A 2QCSB 3PUSA 2NLRA 4IXLA 4Q4X3 1S0JA 2ZJCA 4UW3A 3W59A 1PIV3 3MLJA 5KWRA 5FZOA 4XW3A 1VBD1 5F37A 2VULA 4SLIA 4XIKA 2JX9A 4YVWB 1CAXB 1V6NA 3PU8A 4YSFA 2PMWB 3UYJA 4DZGA 1RUG1 1XXNA 3AKRA 4QT6A 3WDYA 2RR12 4FQZA 2HWE3 5DUWA 1YO8A 1TMF1 5F6LB 1PK6A 2X5IB 1OH3A 2VXRA 2HYXA 3H7JA 5FBJA 4EN8B 3N4MA 4HVQA 4CCNA 5B4XA 2GU9A 2Y26A 1VRH2 2BQPA 1E5SA 2XUMA 4Q4W3 3LSEA 2J22A 3GCXA 2ZEXA 3VBUC 1MVQA 3WX5A 5LRSA 4FFHA 2RS32 3PVBB 4KWUA 2WN2A 4Q0QA 4WVVA 2OS2A 1ND3B 3FWEA 3JD71 1QJY3 2DYCA 3VD5A 2VXJA 2BWAA 2QQJA 2WZEA 3ZXFA 2C9KA 4NO4A 4M4PA 3HT2A 1UY2A 4MGQA 1UKGA 1US2A 3RMXA 2W1UA 4YZ3A 1JYCA 4FFFA 4M01A 3ZIWA 5JZGA 2VR4A 3RZKA 2VO5A 3WUCA 1PO11 1LEDA 2JDZA 1GNHA 2YUEA 2P34A 4LEJA 3M3OA 5ERLA 2CYFA 3K3NA 5LB6A 3RZLA 1EAH3 2CWMA 3PUAA 2SLIA 4JRAA 2PN5A 3GF6A 2VMCA 1RUOA 4QQPA 3RYKA 1HB1A 1JYIA 4AHWA 3URFA 3GZTB 4PF5A 4NAMA 3BKZA 4XZPA 4A7ZA 3H8XA 4NMIA 4XE9A 5D1IA 1VAKA 1RUI1 5FZAA 1S0BA 1AUYA 2ZPXA 3WG3A 4DUWA 3VDDA 1TME1 2DVFA 3KT7A 3O5SA 4Z2AA 2EICA 2AREA 2QQLA 3FJSA 1UO9A 1YC61 2Y34A 3VN4A 5C71A 3HMYA 5LBFA 3BI3A 4HSLA 2RMU2 3C7HA 4CPBD 3NMBA 2Y8KA 4C1XA 1O3RA 4JDOA 2QDNA 1E5RA 1RL3A 1PX4A 1WW5A 3AP6A 4AFDA 2R062 4GMP3 1UAIA 1UY0A 2YFUA 1VB2A 2XOMA 2QQMA 1I3HA 3IIAA 1RUJ2 4S2HA 4WZCA 1N1VA 2R071 1Z0HA 3NJYA 1HRI1 1X7NA 1D2SA 2V4AA 4LHLA 4NPLA 4XF0A 3FHAA 5A7SA 3VKOA 3RJ2X 2FQPA 5HCFA 2JJ6A 1UMZA 4KU7A 3M8LA 4BQ5A 4Q27A 1OKQA 4BCUA 1QNWA 1RHI3 4A6SA 3SLIA 2BNOA 1K3IA 3QCWA 1QXJA 2Y6LA 4XJWA 2AYHA 4OCTA 4CUGA 1AL23 5ACA3 1UL9A 4JDMA 4XAAA 4EWDA 3B94A 1D7PM 3ZFEA 4HKLA 1R093 1HXS2 1NUKA 4Z82A 1RMU1 1RTVA 5BNNA 1CZVA 4JGYA 1CAUB 4KWKA 3VBRC 3I3EA 4RR3C 4CDQB 3J8F1 2HWF3 3NNGA 2VW0A 3ZXAC 1OSGA 1MZ6A 3WP3A 2DBNA 1XYPA 2VZUA 3PMEA 4QHOA 3ZDVA 4LUKA 4YZ5A 2E51A 1DYPA 4X8PA 4HFSA 2OIIA 4AQ6A 4FCAA 1OT5A 2HYKA 4MHRA 4QD2A 4QPGA 2ID4A 1QJY2 1W6QA 2VZOA 3AXEA 4I2OA 2WAOA 2KM2A 4CA9A 1VLNA 1YQ6A 4A2UA 4LK6A 1UZYA 5FY5A 2FMYA 4O65A 4XFAA 4I3GA 4U36A 3N7MA 4DRVA 3WLUA 2ZXQA 1VBC3 3L9JT 4LPLA
chains in the Genus database with same CATH topology
1JHJA 1US3A 2WDBA 3MV11 1CZTA 2JDAA 4ZXEA 3LPGA 2QBXA 2J7MA 5G05L 4D0QA 1JI6A 4CU6A 3UESA 3MV01 1R64A 3VD4A 2DCKA 3P1IA 3MO4A 2BGPA 4P5YA 4JX0A 3HJRA 3HOBA 2LW8A 2WQ8A 2W5FA 3W5NA 3OGRA 1RYYA 2ZEZA 3WF2A 1JZ2A 4MGSA 1GOGA 1UZ0A 2W94A 4ZZ5A 2VL4A 2BGOA 1PMJX 5A1AA 2Y64A 3I3BA 1UXXX 3PUIA 3HPNA 3OGSA 4CUAA 3ETPA 2X10A 1JZ6A 4GWJA 3WEZA 4OMCA 1F4AA 2W92A 1NX9A 4QX0A 2BBAA 3NRUA 2OKXA 1W9TA 4CU7A 5IFTA 1UXZA 1UY1A 2B9VA 3IIIA 2VZ1A 2W95A 3OB8A 4MOAA 2VZVA 1ULOA 3K77A 5JR2A 2XONA 2VZ3A 4IUGA 4GZ9A 4XZUG 3T0AA 3WNKA 1NAEA 2VZPA 2CDPA 2YB7A 3WNPA 4TTGA 4JHZA 3OGVA 3LEIA 1GQPA 3C8XA 4BXSV 2ZEWA 3I97A 1OF4A 1MPXA 1EUTA 4CUBA 4QAWA 3WF1A 2WN3A 1JYNA 2BERA 4DXRA 2X09A 1UWWA 3GGLA 3A21A 4A44A 2CDOA 4E8DA 4BK5A 1SDDB 1T2XA 4DEQA 1L7QA 1GMMA 3T2PA 1JZ8A 3DECA 2JKXA 3HNYM 2KD7A 5C7GA 1SG3A 3A23A 3I2KA 4ET7A 5LA2A 5JXHA 1K12A 3VD9A 5JXJA 2W47A 3FN9A 2VZRA 4XURA 1KGYA 4XUQA 2WZ8A 1GOFA 4A42A 2WO3A 2XQXA 2VM9A 1GOHA 1UYYA 3ECQA 3UNPA 5DN2A 1XPWA 3IDAA 1JZ5A 2QQKA 1BHGA 3VD3A 2J1UA 2VZSA 2VMFA 4P08A 4A4AA 3WNMA 4LHSA 2Y6HA 3D3AA 4QB2A 3K46A 1GNYA 3CIHA 3ABZA 4YPJA 3U37A 1W9WA 5CZKA 2VQTA 3UETA 1OH4A 2X05A 2YC2A 3GXUA 4A45A 2Y6KA 3BN6A 2VTFA 1O59A 2HLEA 4CVUA 3SKJE 3ACGA 5F7UA 4PT6A 2WO1A 4W4ZA 3GDBA 4MO3M 3F2ZA 1UYXA 2E26A 4AG4A 1W8NA 4P00B 4BDVB 3DYPA 5J1XA 5JXIA 3K75B 2L9LA 4BK4A 3JXSA 3MBWA 2E33A 4DUVA 3FL7A 3THDA 1JU4A 3VD7A 4DEVA 4XUOA 2YG0A 1CZSA 2QQIA 1UY4A 3I2IA 1XNTA 5JXGA 1JYVA 4A41A 3VDAA 4JKLA 3LQCA 4W8JA 2WO2A 4QB1A 1H6XA 3T2OA 5IJRA 3K4AA 5HXMA 3HEIA 1W0NA 2ORXA 3C7OA 1JYWA 5DPNA 3LEGA 3A22A 4UI9L 4QDSA 4ARYA 1OD3A 2ZEYA 4GWIA 2Y6GA 2RV9A 3VDCA 3K4ZA 3E1F1 3AC0A 3LPFA 5DQ0A 1UY3A 3I2JA 3WSOA 2B4KA 2LS6A 3IAPA 1WCQA 3T09A 4ARXA 2W87A 5LA1A 2J1SA 3NJXA 2QQNA 3SEPA 2VCAA 5IYYA 4LQRA 3ACFA 4OYUA 2QQOA 1F4HA 1UYZA 2V72A 4HG6B 3I2HA 4A3ZA 1HN1A 1P8JA 1SHWB 3NQHA 3SEEA 3HNMA 3OEAA 3C7EA 3EB7A 4LKSA 5CYYA 2YC4A 3HN3A 4BJ0A 3HNBM 3FHQA 3T0DA 1JZ4A 1W99A 2J1RA 2DCJA 2W3JA 2EIBA 2J1TA 2R7EB 3BGAA 4QX1A 1JU3A 4RYDA 1DLCA 3DYMA 2E32A 4E8CA 5LA0A 1XNAA 1ULPA 3ACIA 1GUIA 1PMHX 3IB3A 2VOTA 4QB6A 1W8OA 2EIEA 1TVGA 2VZTA 2C26A 4XUNA 3WNNA 4RN5A 5IFPA 2C4XA 2W9XA 2VQUA 1JZ3A 3P6BA 3VDBA 2VCBA 3WF4A 1J84A 2YFZA 4OZOA 4XUPA 2W1WA 3WF0A 2VJXA 4KI5M 5DMYA 2RVAA 1JZ7A 4PQQA 2JD9A 2XHNA 4DUXA 2EIDA 2Z4FA 3MUY1 4ZZ8A 1PX3A 1J83A 1UMIA 2W46A 4ZY9A 4L0PA 4QDQA 4D8MA 5LCWL 1EUUA 2Y6JA 4OMDA 4CUCA 4P02B 3NJVA 1L7RA 3T0BA 3IAQA 3PUHA 5JMOA 1UX7A 1I5PA 1CIYA 2V4VA 3THCA 1W9SA 2HYXA 2VMDA 3ACHA 5EJ1B 1K42A 3GM8A 4XVHA 5B4XA 2J1VA 3EYPA 3OG2A 2J1AA 2J22A 3ZM8A 2ZEXA 3WQBA 3WNOA 1XC6A 2BZDA 4KWUA 2WN2A 4DXTA 3I2FA 3CDZB 3VD5A 2WYSA 2QQJA 2WZEA 2C9KA 4M4PA 3T2QA 2WUHA 1UY2A 4MGQA 1US2A 2W1SA 2VC9A 2W1UA 2VZQA 2VR4A 3C7GA 4QX2A 3WF3A 5JUVA 5I0DA 2VO5A 5B4NA 1IQDC 4QDRA 1CX1A 4TXWA 2J1EA 1JYXA 4JKMA 2VMCA 2WBKA 1NKGA 2VMEA 4UAPA 4QX3A 3K4DA 3W5MA 4KMQA 3CKHA 4OUEA 3LE0A 2RJ2A 4DUWA 4Z2AA 2EICA 1LNSA 1KEXA 2QQLA 5C71A 3I3DA 1DYOA 3C7HA 4UOJA 5HPOA 2DDUA 2Y8KA 4FI9A 3J7HA 1PX4A 3OEBA 5EJZB 2W91A 4W50A 1UY0A 2YFUA 4QPWA 2XOMA 4A6OA 2QQMA 3DYOA 4CU9A 1UMHA 4AAXA 3FHAA 2WAAA 5G04L 3CZJA 4M4RA 1WKYA 1TG7A 1K3IA 2Y6LA 2VCCA 3CZUA 4MADA 2JE8A 1O8PA 1D7PM 3I2GA 2W1QA 2E31A 2V5DA 1NUKA 5IHRA 1CZVA 3A7QA 1YQ2A 3I3EA 3WNLA 4JKKA 4PF1A 3NNGA 2VZUA 3CMGA 4DXSA 1DP0A 1O8SA 1GU3A 4CU8A 1OT5A 3T08A 2ID4A 2VZOA 2ORZA 2WAOA 3MUZ1 1OF3A 3LEKA 2PQSA 1H6YA 3CQOA 3C7FA 5C70A 2WABA 3SKVA 1K45A 4XUTA 5EIYB 3OBAA 5FUIA 2ZXQA 4LPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JHJ A;  1US3 A;  2WDB A;  3MV1 1;  1CZT A;  2JDA A;  4ZXE A;  3LPG A;  2QBX A;  2J7M A;  5G05 L;  4D0Q A;  1JI6 A;  4CU6 A;  3UES A;  3MV0 1;  1R64 A;  3VD4 A;  2DCK A;  3P1I A;  3MO4 A;  2BGP A;  4P5Y A;  4JX0 A;  3HJR A;  3HOB A;  2LW8 A;  2WQ8 A;  2W5F A;  3W5N A;  3OGR A;  1RYY A;  2ZEZ A;  3WF2 A;  1JZ2 A;  4MGS A;  1GOG A;  1UZ0 A;  2W94 A;  4ZZ5 A;  2VL4 A;  2BGO A;  1PMJ X;  5A1A A;  2Y64 A;  3I3B A;  1UXX X;  3PUI A;  3HPN A;  3OGS A;  4CUA A;  3ETP A;  2X10 A;  1JZ6 A;  4GWJ A;  3WEZ A;  4OMC A;  1F4A A;  2W92 A;  1NX9 A;  4QX0 A;  2BBA A;  3NRU A;  2OKX A;  1W9T A;  4CU7 A;  5IFT A;  1UXZ A;  1UY1 A;  2B9V A;  3III A;  2VZ1 A;  2W95 A;  3OB8 A;  4MOA A;  2VZV A;  1ULO A;  3K77 A;  5JR2 A;  2XON A;  2VZ3 A;  4IUG A;  4GZ9 A;  4XZU G;  3T0A A;  3WNK A;  1NAE A;  2VZP A;  2CDP A;  2YB7 A;  3WNP A;  4TTG A;  4JHZ A;  3OGV A;  3LEI A;  1GQP A;  3C8X A;  4BXS V;  2ZEW A;  3I97 A;  1OF4 A;  1MPX A;  1EUT A;  4CUB A;  4QAW A;  3WF1 A;  2WN3 A;  1JYN A;  2BER A;  4DXR A;  2X09 A;  1UWW A;  3GGL A;  3A21 A;  4A44 A;  2CDO A;  4E8D A;  4BK5 A;  1SDD B;  1T2X A;  4DEQ A;  1L7Q A;  1GMM A;  3T2P A;  1JZ8 A;  3DEC A;  2JKX A;  3HNY M;  2KD7 A;  5C7G A;  1SG3 A;  3A23 A;  3I2K A;  4ET7 A;  5LA2 A;  5JXH A;  1K12 A;  3VD9 A;  5JXJ A;  2W47 A;  3FN9 A;  2VZR A;  4XUR A;  1KGY A;  4XUQ A;  2WZ8 A;  1GOF A;  4A42 A;  2WO3 A;  2XQX A;  2VM9 A;  1GOH A;  1UYY A;  3ECQ A;  3UNP A;  5DN2 A;  1XPW A;  3IDA A;  1JZ5 A;  2QQK A;  1BHG A;  3VD3 A;  2J1U A;  2VZS A;  2VMF A;  4P08 A;  4A4A A;  3WNM A;  4LHS A;  2Y6H A;  3D3A A;  4QB2 A;  3K46 A;  1GNY A;  3CIH A;  3ABZ A;  4YPJ A;  3U37 A;  1W9W A;  5CZK A;  2VQT A;  3UET A;  1OH4 A;  2X05 A;  2YC2 A;  3GXU A;  4A45 A;  2Y6K A;  3BN6 A;  2VTF A;  1O59 A;  2HLE A;  4CVU A;  3SKJ E;  3ACG A;  5F7U A;  4PT6 A;  2WO1 A;  4W4Z A;  3GDB A;  4MO3 M;  3F2Z A;  1UYX A;  2E26 A;  4AG4 A;  1W8N A;  4P00 B;  4BDV B;  3DYP A;  5J1X A;  5JXI A;  3K75 B;  2L9L A;  4BK4 A;  3JXS A;  3MBW A;  2E33 A;  4DUV A;  3FL7 A;  3THD A;  1JU4 A;  3VD7 A;  4DEV A;  4XUO A;  2YG0 A;  1CZS A;  2QQI A;  1UY4 A;  3I2I A;  1XNT A;  5JXG A;  1JYV A;  4A41 A;  3VDA A;  4JKL A;  3LQC A;  4W8J A;  2WO2 A;  4QB1 A;  1H6X A;  3T2O A;  5IJR A;  3K4A A;  5HXM A;  3HEI A;  1W0N A;  2ORX A;  3C7O A;  1JYW A;  5DPN A;  3LEG A;  3A22 A;  4UI9 L;  4QDS A;  4ARY A;  1OD3 A;  2ZEY A;  4GWI A;  2Y6G A;  2RV9 A;  3VDC A;  3K4Z A;  3E1F 1;  3AC0 A;  3LPF A;  5DQ0 A;  1UY3 A;  3I2J A;  3WSO A;  2B4K A;  2LS6 A;  3IAP A;  1WCQ A;  3T09 A;  4ARX A;  2W87 A;  5LA1 A;  2J1S A;  3NJX A;  2QQN A;  3SEP A;  2VCA A;  5IYY A;  4LQR A;  3ACF A;  4OYU A;  2QQO A;  1F4H A;  1UYZ A;  2V72 A;  4HG6 B;  3I2H A;  4A3Z A;  1HN1 A;  1P8J A;  1SHW B;  3NQH A;  3SEE A;  3HNM A;  3OEA A;  3C7E A;  3EB7 A;  4LKS A;  5CYY A;  2YC4 A;  3HN3 A;  4BJ0 A;  3HNB M;  3FHQ A;  3T0D A;  1JZ4 A;  1W99 A;  2J1R A;  2DCJ A;  2W3J A;  2EIB A;  2J1T A;  2R7E B;  3BGA A;  4QX1 A;  1JU3 A;  4RYD A;  1DLC A;  3DYM A;  2E32 A;  4E8C A;  5LA0 A;  1XNA A;  1ULP A;  3ACI A;  1GUI A;  1PMH X;  3IB3 A;  2VOT A;  4QB6 A;  1W8O A;  2EIE A;  1TVG A;  2VZT A;  2C26 A;  4XUN A;  3WNN A;  4RN5 A;  5IFP A;  2C4X A;  2W9X A;  2VQU A;  1JZ3 A;  3P6B A;  3VDB A;  2VCB A;  3WF4 A;  1J84 A;  2YFZ A;  4OZO A;  4XUP A;  2W1W A;  3WF0 A;  2VJX A;  4KI5 M;  5DMY A;  2RVA A;  1JZ7 A;  4PQQ A;  2JD9 A;  2XHN A;  4DUX A;  2EID A;  2Z4F A;  3MUY 1;  4ZZ8 A;  1PX3 A;  1J83 A;  1UMI A;  2W46 A;  4ZY9 A;  4L0P A;  4QDQ A;  4D8M A;  5LCW L;  1EUU A;  2Y6J A;  4OMD A;  4CUC A;  4P02 B;  3NJV A;  1L7R A;  3T0B A;  3IAQ A;  3PUH A;  5JMO A;  1UX7 A;  1I5P A;  1CIY A;  2V4V A;  3THC A;  1W9S A;  2HYX A;  2VMD A;  3ACH A;  5EJ1 B;  1K42 A;  3GM8 A;  4XVH A;  5B4X A;  2J1V A;  3EYP A;  3OG2 A;  2J1A A;  2J22 A;  3ZM8 A;  2ZEX A;  3WQB A;  3WNO A;  1XC6 A;  2BZD A;  4KWU A;  2WN2 A;  4DXT A;  3I2F A;  3CDZ B;  3VD5 A;  2WYS A;  2QQJ A;  2WZE A;  2C9K A;  4M4P A;  3T2Q A;  2WUH A;  1UY2 A;  4MGQ A;  1US2 A;  2W1S A;  2VC9 A;  2W1U A;  2VZQ A;  2VR4 A;  3C7G A;  4QX2 A;  3WF3 A;  5JUV A;  5I0D A;  2VO5 A;  5B4N A;  1IQD C;  4QDR A;  1CX1 A;  4TXW A;  2J1E A;  1JYX A;  4JKM A;  2VMC A;  2WBK A;  1NKG A;  2VME A;  4UAP A;  4QX3 A;  3K4D A;  3W5M A;  4KMQ A;  3CKH A;  4OUE A;  3LE0 A;  2RJ2 A;  4DUW A;  4Z2A A;  2EIC A;  1LNS A;  1KEX A;  2QQL A;  5C71 A;  3I3D A;  1DYO A;  3C7H A;  4UOJ A;  5HPO A;  2DDU A;  2Y8K A;  4FI9 A;  3J7H A;  1PX4 A;  3OEB A;  5EJZ B;  2W91 A;  4W50 A;  1UY0 A;  2YFU A;  4QPW A;  2XOM A;  4A6O A;  2QQM A;  3DYO A;  4CU9 A;  1UMH A;  4AAX A;  3FHA A;  2WAA A;  5G04 L;  3CZJ A;  4M4R A;  1WKY A;  1TG7 A;  1K3I A;  2Y6L A;  2VCC A;  3CZU A;  4MAD A;  2JE8 A;  1O8P A;  1D7P M;  3I2G A;  2W1Q A;  2E31 A;  2V5D A;  1NUK A;  5IHR A;  1CZV A;  3A7Q A;  1YQ2 A;  3I3E A;  3WNL A;  4JKK A;  4PF1 A;  3NNG A;  2VZU A;  3CMG A;  4DXS A;  1DP0 A;  1O8S A;  1GU3 A;  4CU8 A;  1OT5 A;  3T08 A;  2ID4 A;  2VZO A;  2ORZ A;  2WAO A;  3MUZ 1;  1OF3 A;  3LEK A;  2PQS A;  1H6Y A;  3CQO A;  3C7F A;  5C70 A;  2WAB A;  3SKV A;  1K45 A;  4XUT A;  5EIY B;  3OBA A;  5FUI A;  2ZXQ A;  4LPL A; 
#chains in the Genus database with same CATH topology
 1VBD 2;  3O0V A;  2VY0 A;  1MS9 A;  2JDA A;  3MV1 1;  5F3C A;  2HJI A;  4IEY A;  3PLQ A;  4IE4 A;  5BNN C;  4ZXE A;  1QWR A;  5FYY A;  2J7M A;  3NNJ A;  3VV1 A;  4IV1 A;  2XML A;  3ZXG A;  1R1A 1;  5GLT A;  3M3I A;  4G4F A;  4I02 A;  3MV0 1;  1PNF A;  4X6R B;  5CIS A;  4NRP A;  2C24 A;  3OD4 A;  2A6Y A;  5FJK A;  3IDC B;  4DPN A;  5J7M A;  4Z92 B;  5CFD C;  3P1I A;  1H1I A;  1GYK A;  1B35 C;  2WKK A;  4EE2 A;  1WW6 A;  4TZD A;  4CP0 A;  2YGM A;  1XND A;  5LBE A;  4AQS A;  4I30 A;  2HWD 2;  3LFM A;  5A3N A;  5FPU A;  1RUI 3;  2D6K A;  4IDZ A;  1NLQ A;  3SNM A;  3VLB B;  3W5N A;  1WW4 A;  4L99 A;  4IER A;  2A70 A;  1VBA 1;  3WF2 A;  1FOD 3;  4C91 A;  1YJK A;  4Y5T A;  2ES3 A;  4MGS A;  1ULE A;  2O8O A;  3BPZ A;  3ASI A;  3NVC A;  4R9A A;  1U5X A;  4XDP A;  3M70 A;  2VVF A;  3T3Y A;  2D7F A;  4BZ4 A;  3WR0 A;  5EPA A;  5CVR A;  1KRI A;  4MZU A;  4AHX A;  3V65 A;  5FYT A;  1N3P A;  5BY5 A;  3RDI A;  2HWB 1;  4Q8K A;  3O0X A;  3VBH A;  3OBZ A;  3OPT A;  3ILR A;  3PUI A;  4ZU7 A;  4CUA A;  3BOD A;  1G9A A;  2NQY A;  1JZ6 A;  3WEZ A;  1Q8P A;  1UD1 A;  2EAL A;  1F4A A;  2P37 A;  5A7O A;  1GV9 A;  2WNV C;  5C3Q A;  3U0Z A;  4QX5 A;  4C1W A;  4TWT A;  1OUX A;  3GZE A;  4QX0 A;  2BBA A;  4MLO A;  2GMM A;  4L9B A;  1O4Z A;  1W9T A;  2Q30 A;  3LZZ A;  4CU7 A;  2GP5 A;  2VH9 A;  1OQE A;  3III A;  4HON A;  3MF9 A;  4Q4X 1;  4L2N A;  1DGW X;  1VBA 2;  1HV0 A;  1VE0 A;  4CCJ A;  4FXK B;  4QMA A;  5HCA A;  1AL2 1;  3WV6 A;  4LBQ D;  2VZ3 A;  4IUG A;  3S7I A;  1Y9M A;  3T0A A;  5FZ9 A;  3WNK A;  1NAE A;  3WNP A;  2CDP A;  4GMP 1;  4XPV A;  4JHZ A;  3POY A;  1DLL A;  5EV7 A;  5JPN B;  1RUD 1;  3A0N A;  1MS0 A;  4CUB A;  1F35 A;  5A1L A;  4QAW A;  1ZBE 3;  3ETQ A;  4CTE A;  5DDJ 2;  3GGL A;  3WCR A;  1TE1 B;  4BK5 A;  2XWB B;  1T2X A;  2WNV A;  4HKW A;  2BOI A;  3ZFG A;  2H0B A;  5FWE A;  1APN A;  4EV0 A;  2FDI A;  1S0I A;  2NYY A;  1YNA A;  1NQD A;  1AL0 G;  2VE1 A;  1RUF 1;  2VQA A;  3D5O A;  5ABJ C;  3NJZ A;  5F32 A;  3PDQ A;  4QXH A;  5EYX A;  4DY5 A;  3AMH A;  3DPR B;  4JV4 A;  4ET7 A;  1HQN A;  5JZG B;  5F3I A;  2VZR A;  1ZBE 1;  4E2Q A;  3ENR A;  1O6U A;  2RM2 3;  4XUQ A;  5CA6 A;  3V56 A;  2FDJ A;  1QXP A;  1LOF C;  1XNC A;  2GME A;  3PTY A;  4Y33 A;  5HCH A;  3I49 A;  2D6P A;  4TSV A;  2GP3 A;  2ZGU A;  2TUN A;  4EQV A;  3WP6 A;  3PIG A;  3UK9 A;  2AEN A;  4LBO A;  1Q8V A;  4XAC A;  5D8A C;  1HRV 1;  4OI4 A;  4NR1 A;  5APA A;  4B29 A;  4IE7 A;  4K3U A;  5K0U C;  2R0F A;  3UNP A;  1F31 A;  1XPW A;  4LXL A;  5FWJ A;  2DVB A;  4JQT A;  3H3U A;  1JZ5 A;  1BHG A;  3J7L A;  1CAV A;  4NHK A;  2EVX A;  2JEN A;  1ZZC A;  4M3C B;  4LUM A;  4N43 A;  1VPH A;  2VZS A;  2QJV A;  1OOP C;  3Q8B A;  1V6M A;  4MH0 E;  5C33 A;  1COV 3;  3PL0 A;  2JB8 A;  4LHS A;  4JGY B;  1G7Y A;  4UF0 B;  5FZM A;  2Q8D A;  1BMV 1;  5JOY A;  3KGL A;  5CKQ A;  2BP6 A;  2IWG B;  2RS1 2;  2BNN A;  3JB8 A;  5FUN A;  3GJB A;  1X9P A;  3R4S A;  4NHM A;  1RVF 2;  2VOX A;  4N7I A;  3SMH A;  3WXP A;  4D6R A;  1W9W A;  2IXJ A;  1QDC A;  2HWF 2;  3OSD A;  1O4Y A;  1ZZ7 A;  2A1X A;  3LFI A;  3J26 N;  1DBN A;  4YG0 A;  1Z7S 3;  3TEW A;  1W2O A;  5FZ3 A;  3BN6 A;  1YFX A;  5D2A A;  3H0O A;  4OUM A;  3ROU A;  1LU2 A;  4Q4Y 3;  3F95 A;  1LU1 A;  3SKJ E;  5J36 A;  1W8H A;  1DGR N;  4S2F A;  4CDU A;  1R09 1;  3GDB A;  2WNE A;  3MIB A;  2PFW A;  1LHV A;  2WT1 A;  4LBQ A;  2ZGL A;  4YZ2 A;  4QQL A;  4IL7 A;  1EAH 1;  2E26 A;  4P00 B;  2PHX A;  3DYP A;  4K40 A;  5A3M A;  1AR6 1;  4QKN A;  3WP5 A;  1JUI A;  1VBE 2;  3KQ4 B;  3KV4 A;  2L9L A;  1A3K A;  4JVA A;  3JXS A;  1SCS A;  1CWP A;  3ZMO A;  2ZMK A;  2EAK A;  2ENR A;  3DUI A;  5IT6 A;  2RJL A;  2TEP A;  4QPG B;  4RS5 C;  3THD A;  1DZR A;  3LOI A;  4OZX A;  3RRD A;  1JU4 A;  1JS9 A;  2ADD A;  2VOK A;  4XHX A;  2JG8 C;  4XUO A;  1ZYB A;  3MIF A;  4AXO A;  2YG0 A;  3AB0 A;  4YW2 A;  3N9M A;  5HBA A;  3OCP A;  5FO8 B;  3O1R A;  3NL1 A;  1RXG A;  3WNX A;  2O1Q A;  3G7D A;  3OGJ A;  1FMD 1;  3TRS B;  4CCE A;  2Z79 A;  2A6Z A;  2W39 A;  3LQC A;  2FCV A;  5F3E A;  4CCK A;  3P3N A;  4DFS A;  4H55 A;  4AWD A;  5T5P A;  3KCX A;  4Z1V A;  1W3V A;  1YIP A;  2FMD A;  4B4R A;  5A3O A;  4OI2 A;  5T50 A;  4DMI A;  5AFB A;  2ZAA A;  2HBU A;  1SLA A;  4ZS3 A;  2XXZ A;  3HEI A;  4I0B A;  4M3C E;  1H1A A;  1REE A;  3OUH A;  1GQH A;  2RM2 2;  5DPN A;  1XB9 A;  3DF0 A;  3M3Q A;  2WRA A;  4GWN A;  1ZRD A;  3ZN5 A;  5LEJ A;  2I74 A;  4KU8 A;  1HW5 A;  5FKC A;  4XYX A;  3OJB A;  2HEW F;  3ES4 A;  3W58 A;  3MYX A;  1SZB A;  1X36 A;  3K4Z A;  3OGG A;  2XUE A;  4BHP A;  4JGZ A;  1CAW A;  1UY3 A;  3I2J A;  4MXW A;  3KQR A;  1LGN A;  1ZNP A;  3DL3 A;  4K8R B;  4XFF A;  4CCL A;  2JEC A;  1ODM A;  1XE7 A;  1WCQ A;  5FIX A;  2W87 A;  5LA1 A;  4C0H A;  1D2Q A;  5H9P A;  5I8Y A;  2P3Y A;  1DQ4 A;  5AC9 1;  4QKD A;  4EN9 B;  2VMI A;  2VEC A;  5A1F A;  1FAT A;  4QX8 A;  4XJ8 A;  5JVV A;  1BXH A;  4LIV A;  1VMH A;  4LKF A;  4LOT A;  2ZHN A;  3H1Y A;  5A7P A;  5I8T A;  1XQN A;  2WZR 2;  1TME 2;  3KB5 A;  4EZH A;  1TEI A;  4Q0S A;  2OZJ A;  3AL6 A;  4V1P A;  1ZBE 2;  2ZS6 B;  2XJP A;  4PHZ A;  2EXI A;  2N7G A;  1P8J A;  1SHW B;  3JB4 C;  3SEE A;  1W6O B;  3OEA A;  3BVC A;  5L7O B;  5JPM B;  2D93 A;  5E89 A;  4H2A A;  2BJS A;  1UW8 A;  4TN7 A;  1Y43 B;  1W03 A;  4OLL A;  2GAL A;  1LEN A;  4Y4R A;  1UQX A;  3HNB M;  1DGL A;  3LDB A;  2VUD A;  3K3O A;  2FCT A;  1W99 A;  3V0A B;  5KXB A;  2DCJ A;  4QPI B;  5L9B A;  2B39 A;  3N9Q A;  1PK6 C;  4FOW A;  3DKQ A;  2J1T A;  4PIX A;  4B7E A;  3FMG A;  1YYN A;  3JZV A;  5FMO L;  1ALY A;  1O3T A;  4H7L A;  1NCR A;  5FZF A;  1KXG A;  1GZC A;  3PNA A;  4YVW C;  3WQ1 A;  5M0T A;  1W2U A;  2E32 A;  4E8C A;  1ULP A;  2WLQ A;  1N1T A;  1GUI A;  1DGW A;  3I59 A;  3N9P A;  3WG2 A;  2CAU A;  3LIG A;  1IOA A;  3ATG A;  1YFW A;  3LDR A;  4YGC A;  4M3C A;  4XF4 A;  1VBA 3;  4BB3 A;  3K2O A;  5A70 A;  2P2K A;  2VOW A;  2C26 A;  1OFN A;  2D97 A;  4HL0 A;  1KJL A;  2JG8 A;  3NAP C;  3WW1 A;  1UU5 A;  1UPI A;  2XKO A;  4CEY B;  1ND3 C;  1UZV A;  4AQ2 A;  5H9S A;  1Y9G A;  3VZK A;  3SH4 A;  4UFM A;  3AP4 A;  3VZL A;  2FD8 A;  4NRM A;  3QOP A;  4ZPI A;  1ZRR A;  2JDU A;  4GAL A;  5F5A A;  4AW7 A;  1C4R A;  4B1L A;  3BTA A;  2G9G A;  5ISL A;  5ANQ A;  4YGD A;  1QHD A;  4DIN B;  5JAX A;  4XFG A;  1ZM1 A;  5JOZ A;  1BBT 2;  3VBS A;  5JLV A;  3Q9O A;  4YW4 A;  2RVA A;  4PQQ A;  4ZKT B;  3JQX A;  2OA2 A;  2XHN A;  4HK8 A;  1PNG A;  5A6Z A;  2Z4F A;  2XR4 A;  4N43 C;  2X53 S;  3BPS A;  1VBC 1;  1GZW A;  4LUL A;  4RGG A;  5I93 A;  5KBF A;  1J83 A;  1UMI A;  3H3Z A;  2ILM A;  2GN3 A;  3VZN A;  1D4M 1;  3AZZ A;  1RIN A;  2DU1 A;  1DYK A;  3LAG A;  2VUA A;  4QDQ A;  3O1V A;  5FXV A;  5LCW L;  1O4T A;  2QQW A;  4FPL A;  2OZ6 A;  3BOP A;  3OOX A;  2Z5W A;  4P02 B;  2C5D A;  1QJE A;  1L7R A;  4NUB A;  2WC2 A;  3POW A;  2BFU S;  5T5L A;  3PUH A;  5C4W C;  4FXG B;  3J7M A;  3GBF A;  4CXX A;  2ZML A;  4RGA A;  5C3P A;  1OLQ A;  4NVP A;  4RFT 0;  4WM8 A;  3TB0 A;  1SFP A;  1M4W A;  3QH7 A;  1AYM 2;  4IEW A;  5L73 A;  1X50 A;  2ZGQ A;  2UY8 A;  2DFB A;  1OI6 A;  4AVT A;  2RR1 1;  2PHT A;  3GZA A;  5JIA A;  5EJ1 B;  1UF2 C;  4UT5 A;  1K42 A;  3GM8 A;  3IM0 A;  3EYP A;  1XNK A;  1JW6 A;  1MQT B;  2J1A A;  3N3H A;  4FT8 A;  3ZM8 A;  1L7L A;  2B42 B;  2NMO A;  2BZD A;  4LBJ A;  1B09 A;  2ZGR A;  4RQP A;  1U5Z A;  3I2D A;  2JDY A;  4DB5 A;  4DXT A;  5GZG A;  1XRU A;  4MYE A;  1W6Q B;  1KFX L;  4XMI A;  5JR7 B;  3SHR A;  4IGP A;  1FT9 A;  1LRH A;  2VBD A;  2WYS A;  5A7N A;  4NPR A;  3T2Q A;  4FOQ A;  1RIT A;  4ZXK A;  1Z7S 1;  3ZXD A;  3VZM A;  4AVS A;  1JYT A;  1MS1 A;  2C9A A;  3IMN A;  5FKB A;  5LK5 A;  3S7E A;  1H9W A;  3ORJ A;  2D98 A;  1J59 A;  4OFG A;  1DFQ A;  3AVR A;  2LTN A;  1OLR A;  3AMQ A;  1IQD C;  4QDR A;  3SIS A;  1CX1 A;  2JEM A;  1FOD 2;  3RSJ A;  4XCB A;  3MHZ A;  4AOC A;  1JUH A;  4TXW A;  2F6B A;  1HLC A;  4B8E A;  4Y1V A;  4FPG A;  2GMP A;  1HQW A;  4GUL A;  1W9F A;  1C1L A;  2WBK A;  1BVP 1;  1V00 A;  2ZX1 A;  3HAG A;  2JB4 A;  2Y0O A;  3JD7 3;  5HCB A;  3RMY A;  3THP A;  1OBN A;  2IZW A;  4YGB A;  4FPH A;  2EAA A;  1NXD 1;  3ZXL A;  1MS8 A;  4AI8 A;  3AXD A;  1PVC 2;  4J1X A;  3HT1 A;  3RZZ A;  2VUC A;  3I54 A;  3B02 A;  4LBK A;  4FAG A;  2W2I A;  3I3Q A;  5GLV A;  1PHM A;  3SH5 A;  4HN1 A;  1LOE A;  4KQ7 A;  5AVP A;  3S5Q A;  3U75 A;  5A3T A;  1POV 3;  1LNS A;  3VZJ A;  3H7Y A;  5FJH A;  3AP9 A;  3ST7 A;  1RUJ 3;  4UOJ A;  2IXI A;  4K1Y A;  1G9C A;  2GH8 A;  1Q5O A;  1VB4 A;  2D43 A;  3AKT A;  5ANN A;  3LOB A;  4MV2 A;  1AJK A;  1TNR A;  2GDF A;  3J7H A;  1AYN 3;  5TSW A;  3J9S A;  1UZW A;  4MXW B;  4K8F A;  1C8N A;  3OEB A;  2W91 A;  2WNU C;  5FP9 A;  1JTZ X;  2ZX0 A;  1S2K A;  2E53 A;  4UFI A;  4CU9 A;  4AAX A;  4WVM A;  3JBG 1;  4NOT A;  1T6G C;  3B00 A;  4QM9 A;  5GLU A;  3MFC A;  5FPV A;  5CFC A;  1HX6 A;  1W90 A;  2WAA A;  5FZL A;  3CHX A;  3B93 A;  1GLH A;  2X29 A;  3TBD A;  1O7F A;  4S2G A;  1N1S A;  4RHV 1;  1DCS A;  4HPK B;  3IMM A;  4M4R A;  4RD7 A;  4X6Q B;  5E88 A;  2R16 A;  4Q26 A;  3POF A;  1WKY A;  1XU1 A;  4P5H A;  3RWK X;  2VCC A;  1VMJ A;  4AED C;  4KG8 A;  4MAD A;  3FLR A;  1B35 B;  3LSD A;  2IFR A;  2JE8 A;  3VKN A;  1O8P A;  3VBF B;  3NWK A;  2E31 A;  3USU B;  4E2G A;  1KFU L;  1W0P A;  3WW3 A;  4GH4 B;  3POS A;  4A3X A;  1HN0 A;  1NZC A;  4WM7 A;  5CU1 A;  5KXD A;  3WNL A;  4D7S A;  4HN0 A;  3RG0 A;  4YM2 A;  5IVJ A;  3CMG A;  2XBO 2;  3CLP A;  4JGZ B;  2QFE A;  2WR9 A;  4DXS A;  1O3S A;  2HEY F;  4WM8 C;  4GAZ A;  3U11 A;  5L9V A;  4CU8 A;  2P17 A;  5J37 A;  1IS4 A;  3T08 A;  2C1F A;  2WNU A;  1NE4 A;  2DCT A;  2PEL A;  1ST8 A;  4H3W A;  1JHN A;  3MUZ 1;  5DDJ 1;  5F9T A;  1K5J A;  3LEK A;  4KNC A;  4F7Z A;  5FK8 A;  3VBO C;  4Y3O A;  1SCR A;  5C70 A;  1C8M 1;  2Z42 A;  1FPN 2;  2R1B A;  1S1A A;  5FYH A;  3SQO A;  5FY8 A;  1XYO A;  2A73 B;  2Y6F A;  3ZKY A;  1WA4 A;  3U4S A;  2K2S A;  5ACA 1;  1HKD A;  1Q3E A;  4IES A;  2ZBJ A;  4D0Q A;  3LDK A;  4CU6 A;  5H9R A;  3PIJ A;  1AYM 1;  3FFZ A;  4IE6 A;  4N9I A;  3VDD B;  1VBB 2;  3PTR B;  4YFW A;  5J98 B;  3OUI A;  4Q4V 2;  3O1O A;  3VD4 A;  1FNY A;  2YU1 A;  2ZA9 A;  3MO4 A;  5JMC A;  3HJR A;  3HOB A;  1LEC A;  1FNZ A;  2LW8 A;  2RMU 1;  1ND2 B;  3PUQ A;  3THT A;  3ZR6 A;  4IEP A;  4I01 A;  1XYN A;  4NHX A;  4QPI A;  1XSR A;  2WII B;  1LOF A;  3TN9 3;  3N9N A;  2JXA A;  2WSV A;  1RUN A;  4XCA A;  3U14 A;  2NMN A;  2G4I A;  3ZFF B;  1MS3 A;  2VL4 A;  1NA1 B;  2BGO A;  3I7D A;  2AR6 A;  4RQP B;  1QDO A;  3DPR C;  4K21 A;  1AX2 A;  1VBD 3;  1UXX X;  3ETP A;  2X10 A;  3DV8 A;  2P1B A;  4GXL A;  1SLT A;  4MGK E;  2RDS A;  5GZD A;  3RJR A;  2OVU A;  3M1H A;  4RA0 A;  2YC0 A;  1RB8 G;  1NX9 A;  4FPE A;  2OKX A;  5K0U B;  2LAL A;  2B9V A;  2ZAB A;  4I0A A;  4K9S A;  2YBK A;  2W95 A;  1OPM A;  1UU6 A;  2IFW A;  2FZ2 A;  4YWA A;  1M06 G;  4BLI A;  2E63 A;  3K77 A;  5JOX A;  4C8D A;  4XZU G;  4D6Q A;  1YEW A;  3MEP A;  4FOV A;  1LR5 A;  1WLD A;  3LEI A;  4CDU B;  1OOP B;  5GLZ A;  4TLG A;  1G9F A;  2XGX A;  3I97 A;  4UF0 A;  2QTW B;  2EA7 A;  4QM8 A;  4B4P A;  2ZHM A;  2VBB A;  4ERO A;  4LK7 A;  3S30 A;  5FDB A;  2P3J A;  2WFF 3;  3BOW A;  1SEF A;  2XL7 A;  2X09 A;  1UWW A;  3ILF A;  3RVH A;  1GWK A;  1W2T A;  4A44 A;  3SCH A;  3E5X A;  2ZX3 A;  1R08 1;  4XEZ A;  2QQV A;  2ZX2 A;  3KV9 A;  3ZXJ A;  1CAU A;  1QOO A;  1IPK A;  1QJX 2;  2AUY A;  3H3L A;  3T2P A;  3VHN A;  1OC1 A;  3GYD A;  4ONU A;  2JKX A;  4YYO A;  4QQH A;  2WSU A;  2W68 A;  4FPY A;  1U12 A;  5FZH A;  3WUD A;  5FZC A;  2NM1 A;  1WD4 A;  4N90 A;  3VBU A;  3ZXE A;  4EYU A;  1WBL A;  1GZT A;  1XJA A;  2YV8 A;  4BQX A;  4DXZ A;  4JAA A;  1YFY A;  1KGY A;  2WZ8 A;  4MXV A;  2RS3 3;  1I9R A;  1GIC A;  1GOF A;  4A42 A;  3ZYG A;  3ZO0 B;  4LNV A;  1CES A;  2QKD A;  3EQE A;  3UGF A;  1YXW A;  1V6L A;  1C57 A;  1MQT A;  2UY9 A;  4ZU5 A;  2VM9 A;  2PHD A;  5GJ6 A;  3VBU B;  1RUC 2;  2E7Q A;  2Q1Z B;  3BIW E;  5T3N A;  4U2A A;  5T54 A;  1PO2 2;  5FLI A;  2RG4 A;  5K0U A;  3C3V A;  1COV 2;  3MF6 A;  5FAX A;  2GN7 A;  1MEC 2;  4XIO A;  3GJA A;  3IDA A;  1W6M B;  3KGZ A;  4LE3 A;  5AVA A;  4BM8 A;  1MZE A;  1SLL A;  3VD3 A;  2J1U A;  3TEZ A;  5KHK A;  3T30 A;  4HBN A;  1AR9 3;  1VMF A;  3GHM A;  2P6C A;  2YZ4 A;  4P08 A;  5K7P A;  3BUC A;  1ULC A;  4QHZ A;  2FZ1 A;  2GNM A;  2Y6H A;  3D3A A;  4HOO A;  3UJO A;  3GHN A;  4QB2 A;  3KD4 A;  2YMZ A;  1KIT A;  4O9E A;  1W2A X;  3MZH A;  2PHL A;  3TN9 1;  1HXS 3;  2IXC A;  5CFC C;  3KM5 A;  3AP7 A;  3MW4 A;  5IVE A;  2FBE A;  3JU9 A;  5F3G A;  2FDK A;  1WCU A;  3QD6 A;  1D0H A;  3UET A;  1UN1 A;  5IK4 A;  4M3C F;  4P9Y A;  5D21 A;  5KXC A;  1W6P B;  1WBF A;  2CWS A;  3GXU A;  2CTV A;  1F9K A;  2Y33 A;  5FP8 A;  2HEV F;  4CVU A;  1NQJ A;  1KDM A;  3ACG A;  4KBB A;  5T5J A;  3ZSE A;  2FCU A;  2V09 A;  1WD3 A;  4NN0 A;  1UKR A;  1X9T A;  3SC7 X;  1AXZ A;  4K7J A;  5FMO S;  3V0A A;  1RUE 2;  2HWF 1;  1LGB A;  3H9A A;  3QBQ A;  4WM7 B;  1UIK A;  1LOD A;  3NNM A;  4PIY A;  2PYT A;  2D3R A;  1JBC A;  4Q8L A;  4DO0 A;  2BVV A;  4W6W A;  4BK4 A;  3MBW A;  2VTX A;  2HH9 A;  5FV3 A;  3VBO A;  4UW5 A;  3FL7 A;  2C0Z A;  2HWB 3;  5E6H A;  3KT1 A;  5EQU A;  3ZSK A;  3MFA A;  3DXU A;  4D7T A;  3M2M A;  4QWN A;  5FYI A;  5IAV A;  1A8M A;  1OUR A;  4YVS C;  1TQ5 A;  3I2I A;  1XNT A;  3RYR A;  1URX A;  2G1M A;  3FBY A;  3VUO A;  2WS9 1;  1UOG A;  2GNT A;  4JGY C;  2MEV 3;  2YU2 A;  4JKL A;  1XE8 A;  4H14 A;  2D5F A;  1CPN A;  1UX6 A;  1HIX A;  1R09 2;  2WO2 A;  2K0G A;  5IVV A;  1KJR A;  5DG1 A;  4QB1 A;  3T2O A;  4IEQ A;  4DQA A;  5L7O C;  3O1M A;  3KHC A;  4UFL A;  2Q8O A;  1LUL A;  1ZVF A;  1NA1 A;  2CGN A;  4GJZ A;  3USU A;  3HQU A;  2EXH A;  3VL8 A;  2ORX A;  1O5U A;  1JYW A;  5EWS A;  5FZI A;  3EMR A;  4Q29 A;  1OD3 A;  1AR8 3;  1WLT A;  2AZ5 A;  2XJT A;  4GWI A;  2WZP P;  3VDC A;  4QPI C;  3R4D B;  5CG9 A;  1PK6 B;  2X5I A;  4YVS A;  3V0B B;  1IS5 A;  3E1F 1;  3ZN6 B;  3LPF A;  2WT0 A;  4G9S B;  1PGL 2;  4QQ2 A;  2BNM A;  2HKX A;  3WSO A;  2KA3 A;  4BPZ A;  1Z78 A;  4FOY A;  4DY3 A;  3FHI B;  4XBQ A;  1IHM A;  2VBP A;  4N7U A;  4LJH A;  4Y20 B;  3RI8 A;  4DRR A;  4RFR B;  5IK5 A;  1CX4 A;  1ENS A;  2XVK A;  3T09 A;  3N7L A;  1NLR A;  5FZ7 A;  2J1S A;  4E4D X;  3NJX A;  1AXY A;  5J09 A;  2YXS A;  4GB3 2;  3VBO B;  1RUG 3;  3D4K A;  3B7M A;  1STM A;  1GZW B;  4J25 A;  1ZZ8 A;  2JG8 B;  1ULF A;  4BQ4 A;  5C8C C;  4Y20 A;  2DUO A;  2WQ4 A;  5BNN B;  4OYU A;  1CGP A;  2QQO A;  1PO1 3;  4HLT A;  2OPK A;  1UYZ A;  3UGH A;  1UU4 A;  5FBZ A;  3VHO A;  5ABJ A;  2P3I A;  1BZW A;  4A3Z A;  1VAL A;  3EHK A;  4YZ1 A;  4XMA A;  2WFF 2;  3LF7 A;  2ZGN A;  2ZAC A;  1U5I A;  5CFD B;  4LBQ B;  3CJI C;  3WDX A;  4XHB A;  3OYW A;  1OD5 A;  5FYM A;  1RUH 3;  4Q4Y 2;  1CJP A;  4PDW A;  4LKS A;  3ZN4 A;  1BYH A;  3HR9 A;  2YC4 A;  1S2B A;  3SCF A;  3VHR A;  3IBM A;  4CEW B;  1COV 1;  3FHQ A;  4LKE A;  2HWC 2;  3DGT A;  1JZ4 A;  2DUQ A;  3T0D A;  1S0D A;  3FLP A;  2J1R A;  2QVS B;  2VD7 A;  2XJS A;  2JDM A;  3BTX A;  3JBG 2;  5IW0 A;  3S5A A;  1KQR A;  5FQ0 A;  3M3E A;  3MGU A;  4GWM A;  2ARX A;  4BH9 A;  3BGA A;  1V9U 3;  4QX1 A;  2PHF A;  3DYM A;  4XBL A;  1EPZ A;  4UBH A;  4XDQ A;  4ZU4 A;  3IB3 A;  1IPJ A;  3NKG A;  4PQ9 A;  3UKT A;  1SPP B;  1CVN A;  1ENQ A;  2W52 A;  2PXJ A;  3UKN A;  4Q4V 1;  1MQT C;  2VZT A;  4PIZ A;  1D0G A;  5IVC A;  4E27 A;  3R0R A;  1JMU B;  3FE5 A;  1R1A 2;  2BEO A;  2VAU A;  2ZKN A;  3P5B A;  4AGG A;  2R04 1;  3CJI A;  5IAX A;  3HQR A;  5H9Q A;  5IFP A;  3RWN A;  5KHH A;  1J3R A;  4V2W A;  1L3J A;  5LEK A;  3P6B A;  5DG2 A;  3RNS A;  1NT0 A;  1OA3 A;  2YFZ A;  4BIO A;  3S0M A;  2PHR A;  1LHU A;  5F1R A;  4AZZ A;  2DV9 A;  3M3C A;  4KI5 M;  4ASM B;  1GP5 A;  2XWJ B;  3BYW A;  5FY9 A;  5A80 A;  3LWC A;  4DUX A;  4XFI A;  2TNF A;  4CPB A;  5T52 A;  4KL1 A;  4ZY9 A;  1RXF A;  4UXA A;  4E4S A;  2YBP A;  4GD4 A;  2Y6J A;  1DDL A;  4OMD A;  3VL9 A;  1WZX A;  3IPV B;  3IAQ A;  4LBM A;  1S0C A;  1NCQ A;  1HB2 A;  5FZ6 A;  3RGB A;  3TNQ A;  1RUF 2;  1LHN A;  4K6B A;  1YRZ A;  4HT1 T;  4AYU A;  1S0F A;  3RFR A;  1PIV 2;  1QH6 A;  3X29 B;  1ONA A;  1CIY A;  1W6N A;  1DGR A;  5LAT A;  4JC1 A;  3THC A;  4FP3 A;  1W9S A;  4HPK A;  2MPF A;  3PVO A;  3CU7 A;  4XOG A;  5FPZ A;  5F5C A;  5LZ6 A;  4YGE A;  3ZSJ A;  3POI A;  2VTX J;  3WW4 A;  3J7N A;  5EP9 A;  5KXE A;  2P4E A;  2J1V A;  1IQA A;  2CAV A;  3OG2 A;  4RSU A;  3V64 A;  3AMM A;  2G9F A;  5DAB A;  5FR3 A;  1S0G A;  5FY1 A;  3UV9 A;  3WQB A;  1XC6 A;  2JG9 B;  3NW4 A;  4R8H A;  1N3Q A;  3WNO A;  2LUW A;  4AFB A;  4R4X A;  1EYB A;  2CNA A;  2D5H A;  3D6E A;  2WNU B;  1DQ6 A;  4COV A;  1PZ7 A;  4AHZ A;  1RVF 1;  1RJ8 A;  3AL5 A;  4ISQ A;  4J6G A;  4LO6 B;  1RMU 3;  4YM1 A;  3TYJ A;  4IQP A;  4PCR A;  2X8K A;  3J8F 3;  2ZGK A;  3W20 A;  3NV1 A;  3C7G A;  4BQY A;  2JG9 A;  2NZ9 A;  1NCQ C;  3DPR A;  5CB7 A;  5FPA A;  5SV5 A;  5I0D A;  2A3Y A;  3H1M A;  1UCX A;  1OMI A;  4O7X A;  2DUP A;  2J1E A;  4URT A;  2CY6 A;  3OPZ A;  1YJL A;  5F8P A;  4JKM A;  3R05 A;  2XLA A;  5C9A B;  2P3K A;  1B35 A;  3WHU A;  3WOG A;  1G6N A;  2BBV A;  4GB3 1;  3HIF A;  5A6Q A;  3B3Q E;  5AC9 2;  1NKG A;  2NN8 A;  1RHI 1;  2PLV 3;  3ZXK A;  1CAX A;  3IZO A;  5CKN A;  3W5M A;  3KSC A;  4GA9 A;  4GH4 C;  2R04 2;  4CP9 B;  4FFG A;  4DIQ A;  3CKH A;  1Q8O A;  4OUE A;  3KF5 A;  3IPV A;  2WQZ C;  5JSP A;  2K9Z A;  4GIQ A;  1QU0 A;  4Y1U A;  5DUU A;  2JDH A;  4ES9 A;  1HRI 3;  1KS5 A;  1GP6 A;  2DU0 A;  4KG0 A;  4BA6 A;  5BNO C;  2GNB A;  4UW4 A;  1UIJ A;  1JOP A;  3I59 B;  1K5M C;  4Y22 B;  3MLK A;  4CP2 A;  4D3W A;  4CDW A;  1DYO A;  4PI2 A;  3H1W A;  5HPO A;  4GB3 3;  5A7W B;  2DDU A;  3FUQ A;  4HMZ A;  3WQ0 A;  2R49 A;  2NP0 A;  3AYE A;  3O1S A;  1SAC A;  1ZA4 A;  3B69 A;  2UYB A;  4W50 A;  4KH9 A;  1BEV 1;  1V0A A;  2DWR A;  4OHZ A;  2YGL A;  5HV4 A;  1AR7 3;  5IVB A;  1FAY A;  1G9D A;  1AF9 A;  4A7K A;  5G04 L;  5F2W A;  1POQ A;  1E5H A;  3LIH A;  3I2O A;  1RUH 2;  3CZJ A;  1PM4 A;  1QNY A;  5FRE A;  1LGC A;  2DTY A;  3B5L B;  5IUQ A;  2R32 A;  4OHW A;  1N1Y A;  1AX1 A;  5KR7 A;  1RUF 3;  1NXM A;  3CZU A;  4E2S A;  1AR7 1;  4LBL A;  4S2D A;  1NCR B;  2V5D A;  2WZR 1;  1ND2 C;  3L2H A;  4CDX A;  1POV 1;  4FPK A;  4L8Q A;  5A6Y A;  2QQP A;  3ZKU A;  1Q43 A;  1ZRI A;  4PF1 A;  4AK3 A;  3USS A;  2XKP A;  3OYW B;  4FPF A;  4XFH A;  1H30 A;  5FZ8 A;  3KS7 A;  3ZYP A;  2DVG A;  3AKQ A;  4YW1 A;  2HWD 3;  1HV1 A;  4Z8B A;  1IG3 A;  3S6P A;  1GU3 A;  1WA6 X;  4Q4W 1;  5GZC A;  3LEM A;  4CEW A;  3WW2 A;  1CQ9 A;  2BFU L;  3WT3 A;  4LBN A;  4N53 C;  1A6C A;  2ORZ A;  1V70 A;  5A3P A;  1GR3 A;  4CZS A;  4MET A;  3BTZ A;  1VBC 2;  3N36 A;  3U10 A;  4NWV A;  1XBF A;  2PQS A;  3HD8 B;  1H6Y A;  3CQO A;  1QJU 2;  1ULG A;  2Q4S A;  2WWJ A;  3C7F A;  1KS4 A;  5T55 A;  1IPS A;  2WAB A;  1F5J A;  3BAL A;  1AR9 1;  1K45 A;  4O9G A;  1RHI 2;  4XUT A;  2ERF A;  3MPP G;  3OBA A;  5FUI A;  5IVY A;  3HWJ A;  1JHJ A;  2WDB A;  4FQ4 A;  5T5O A;  5C8C B;  4K1Z A;  4UYB A;  1PGS A;  4NIH A;  2GAU A;  1GWM A;  3VBS B;  3ITQ A;  4LHK A;  1TNF A;  2UU8 A;  5G05 L;  5CAD A;  2I45 A;  1WMF A;  1JI6 A;  3MID A;  4LTA A;  2XPJ A;  2DTW A;  2H0V A;  2PHU A;  3POJ A;  3POG A;  5FYB A;  4GKY A;  3UES A;  4M0N A;  4FPO B;  3P3P A;  4IND A;  4YM0 A;  4AEK A;  4BYY A;  5IK8 A;  4P9I A;  1AR8 1;  4AI9 A;  1AYN 1;  2DCK A;  3CJI B;  2CHH A;  4RR3 A;  2BGP A;  1Q56 A;  1XNB A;  2F4P A;  2VVD A;  4JX0 A;  4P5Y A;  5KC6 A;  3AYC A;  4NID A;  2A3X A;  3I3M A;  3U4X A;  3IKW A;  4AEM A;  1HRV 2;  5JDB A;  2UWB A;  3QLQ A;  3JCI A;  3OGR A;  3KV6 A;  2JIG A;  2TBV A;  2ARA A;  2AGS A;  2WA4 A;  1IG0 A;  1SLB A;  2G9Z A;  4XF9 A;  1WUV A;  4NWW A;  3POE A;  4NRQ A;  1ENR A;  1GOG A;  1UZ0 A;  2W94 A;  3AZW A;  3HBK A;  4JGZ C;  1QXR A;  1W6M A;  4MGY E;  3VGI A;  3AVS A;  3GCW A;  1G9B A;  2YHJ A;  2RDN A;  3H42 B;  1AJO A;  3DCQ A;  1R08 3;  1A8D A;  1PMJ X;  2ZGT A;  4IV3 A;  4ORF A;  1UPS A;  2YPJ A;  4Q5O A;  1RUH 1;  3AP5 A;  4OUL A;  1EP0 A;  5F39 A;  4L97 A;  4QGM A;  3OGS A;  2Q8C A;  4YFZ A;  5LY2 A;  4QXB A;  4OMC A;  3CJX A;  4AVV A;  3PUR A;  4Y24 A;  4M00 A;  4BU2 A;  2W92 A;  4QXC A;  5FYV A;  1MS4 A;  3J4U H;  2A3W A;  2A7A A;  5A3U A;  3GBG A;  5DZF A;  3LA3 A;  1JOD A;  1RMU 2;  1YHF A;  2AC1 A;  3GNE A;  4XJU A;  1VBB 3;  5IFT A;  2MEV 1;  4B1M A;  2ET1 A;  1UXZ A;  3ILN A;  4EZ4 A;  2VZ1 A;  1AR6 3;  3OB8 A;  3KCY A;  3RZH A;  4YG6 A;  2VZV A;  4RS5 A;  1CPM A;  4BQ3 A;  1C28 A;  1W0O A;  3TAY A;  4COY A;  5JR2 A;  4FO9 A;  2YB7 A;  2VZP A;  3CO2 A;  4QQO A;  3ACL A;  4P14 A;  4TTG A;  1LHO A;  3OGV A;  4BXS V;  1GQP A;  3C8X A;  4Q4Y 1;  2VCM A;  3ZYF A;  4AI2 A;  4CEY A;  3T4V A;  1FI2 A;  4XFB A;  1MPX A;  1AR8 2;  3E6D A;  4CP9 A;  1EUT A;  3VKF C;  1VRH 1;  3O1T A;  1POV 0;  1F8V A;  2D3P A;  3WF1 A;  4N43 B;  2WN3 A;  4NRO A;  2BER A;  1JYN A;  1RIR A;  2Z69 A;  1FMD 3;  3A21 A;  1HB4 A;  2QZ3 A;  2PAE A;  2CDO A;  4E8D A;  2Z2S B;  4OHV A;  1SDD B;  5JI7 A;  4FBF A;  3MW2 A;  1L7Q A;  3D0J A;  4QPY A;  3PJY A;  2CSG A;  3E5Q A;  1MZ5 A;  4Z2W A;  1JZ8 A;  3ZYR A;  3DEC A;  2VW2 A;  3HNY M;  2KD7 A;  5FPX A;  5C7G A;  3A23 A;  3I2K A;  3ZFF C;  1CN1 A;  2ZCW A;  3ZOI A;  3KMH A;  2CGO A;  3RYP A;  5LY1 A;  2AEZ A;  5LA2 A;  3AKS A;  1K12 A;  5JXH A;  3VD9 A;  5DUX A;  3T1L A;  2GSY A;  2W47 A;  3FN9 A;  4AAP A;  4XUR A;  4PI0 A;  2OQ6 A;  3NO8 A;  4IEX A;  1VJ2 A;  1RUI 2;  1UOB A;  2IXL A;  2BWC A;  4WM7 C;  5C8W A;  2WO3 A;  2XQX A;  1PVC 1;  4BLJ A;  5I0U A;  1BBT 1;  2HBT A;  1IS3 A;  1QKQ A;  2RHP A;  1AZD A;  1UYY A;  3ECQ A;  3H8U A;  2BOJ A;  2EXJ A;  3I4I A;  1C3H A;  4B7K A;  1FX5 A;  5DN2 A;  4FTS A;  2WFP A;  1UYP A;  4XET A;  3WG4 A;  3FZ3 A;  3HBZ A;  4W6X A;  1VBE 3;  4OQ8 A;  1ASJ 1;  2D44 A;  4R9D A;  2A6X A;  1QJU 3;  5GM0 A;  4YVS B;  2B5H A;  3NNL A;  2H6C A;  2DCZ A;  3NNF A;  3CNA A;  4FPJ A;  4ZHN A;  1W8T A;  1MS5 A;  1QJX 3;  4FP2 A;  1BVV A;  4LIU A;  3OTF A;  2K46 A;  4C90 A;  5A3L A;  1JOB A;  3ABZ A;  3CIH A;  5E16 A;  4YPJ A;  2VNO A;  1JOJ A;  3AK0 A;  1DQ0 A;  1YCI A;  3MPB A;  1V9U 2;  1V9U 1;  2ARB A;  1J58 A;  4HXC A;  3ZX7 A;  3MLL A;  3JUU A;  4XAE A;  2J42 A;  2PAM A;  1OH4 A;  4IV3 C;  2X05 A;  3WDW A;  3LB9 A;  4Q4X 2;  1GAN A;  2Y6K A;  5L36 A;  1SLC A;  1GSL A;  5BV6 A;  2A75 A;  4W6Y A;  1CIW A;  4XAB A;  3E6C C;  2HLE A;  4XIL A;  1W06 A;  2Y0I A;  3TEX A;  2FDF A;  5F7U A;  5JUV A;  1TMF 2;  2WO1 A;  4W4Z A;  4XTP A;  4FTE A;  1ASJ 2;  1V6K A;  4MO3 M;  3F2Z A;  2WA3 A;  5C3S A;  1MAC A;  5IAT A;  1W05 A;  3EJK A;  4URA A;  1W8W A;  1MEC 3;  4BIS A;  1R1A 3;  2IVI B;  4QU2 A;  2JD4 A;  3AJZ A;  5J1X A;  1W8Z A;  4N53 A;  3WCS A;  5FY7 A;  1IS6 A;  4F83 A;  2WL1 A;  1XSQ A;  1BK1 A;  4PDW B;  5A7Q A;  1QJU 1;  2GC2 A;  2E33 A;  2XL9 A;  4DUV A;  2UWA A;  3IDB B;  4MVT A;  2IC1 A;  3ZYI B;  4D6S A;  1ZA7 A;  4W65 A;  4XJ9 A;  4A7Y A;  4DEV A;  4BXF A;  4F8A A;  4BQW A;  1REF A;  2HWC 3;  2OUJ A;  2D40 A;  2QQI A;  5FPB A;  1UY4 A;  2Q1M A;  4EN6 B;  2BPA 2;  5JXG A;  4UFK A;  3AM2 A;  2HWE 1;  4N8M A;  1I1E A;  1BLZ A;  1HJG A;  4A41 A;  4CSW A;  3HN1 A;  4CXY A;  3TN9 2;  3ZFE B;  1JZ2 A;  2WS9 2;  3AMP A;  2E9Q A;  3H50 A;  4W8J A;  5CFD A;  1BMV 2;  4IEV A;  1OKO A;  1NG0 A;  2D3S A;  4KGG A;  3WDU A;  2WJS A;  1SQ4 A;  1XOY A;  4KGQ A;  1Q8Q A;  2XJQ A;  1IZ3 A;  1PMI A;  2RDR A;  2W08 A;  1WW7 A;  1X8M A;  3KV5 A;  1AXK A;  1W0N A;  1DQ1 A;  5FFO C;  5FYS A;  3ZFF A;  4EN7 B;  4UI9 L;  1W6O A;  3HVD A;  5L7O A;  4QDS A;  4Y5Z 0;  4ARY A;  1LB2 A;  5LA9 A;  2Y6G A;  2RV9 A;  3BU0 A;  4P9G A;  5CG8 A;  4Y1X A;  3VBR B;  4CCC A;  5BNP B;  2BV4 A;  3L2Y A;  1J1L A;  4JHT A;  5FLH A;  3AC0 A;  3RPQ A;  4Q2F A;  1EAH 2;  2F17 A;  5CIR A;  1S4C A;  3INA A;  3ZYH A;  4E4H A;  1FXZ A;  5FK7 A;  2B4K A;  2LS6 A;  4HAN A;  1V6O A;  1RJ7 A;  2JE7 A;  1GZ9 A;  4COU A;  4N53 B;  4ZON A;  1YQC A;  4ARX A;  4EWA A;  4COW A;  3KT4 A;  3KWV A;  1NE6 A;  3SH3 A;  4O61 A;  2PHW A;  2R1D A;  4CXW A;  5JSO A;  2OT7 A;  4NE9 A;  3SEP A;  1ZRF A;  4NHL A;  2VCA A;  5C3O A;  2ZHL A;  2ZGS A;  1S2E A;  4IV1 B;  4LQR A;  4AEJ A;  5JSR A;  2VVE A;  5BUV A;  4ATE A;  4XJA A;  5K9Y A;  3ACF A;  4I0W B;  2RR1 3;  4GH4 A;  4CCM A;  5C8C A;  4PLO A;  1PGW 1;  1F4H A;  2R06 3;  4HG6 B;  3OY8 A;  4AI3 A;  1W6P A;  4HKO A;  1HXS 1;  3MIG A;  3VDD C;  1T6B X;  4LA2 A;  3RZJ A;  1SFN A;  2OPW A;  5LRR A;  3O12 A;  4LHN A;  2ZHK A;  1VBE 1;  2WO7 A;  3C7E A;  5SV8 A;  2AH2 A;  1FV2 A;  5CYY A;  2RS3 1;  5A33 B;  4HVR A;  1ODN A;  4X8N A;  1ZZB A;  3HN3 A;  5DXD A;  3KCC A;  4BJ0 A;  5KHJ A;  1K5M A;  4OHY A;  4P9X A;  1Q8S A;  3UL2 A;  4DOU A;  2DVD A;  1S55 A;  5FXX A;  4CCD A;  2IXK A;  3AZV A;  5BNP A;  4MG2 A;  2EIB A;  1BEV 2;  4G3Y C;  4RHV 3;  5C9A A;  1N3O A;  3MW3 A;  1NA1 C;  2D6O X;  1LKN A;  1JU3 A;  2ADE A;  4RYD A;  4XTM A;  2O0O A;  1D4M 3;  5FZ4 A;  1GP4 A;  4P9J A;  4Y1Y A;  4ISR A;  1G8W A;  1PVX A;  1PMH X;  4HSJ A;  3LD8 A;  3POB A;  3PJQ A;  2VOV A;  1AR9 2;  1QQP 1;  1IKP A;  2RS5 1;  2WZR 3;  2VOT A;  3TWI A;  1TME 3;  1C8M 2;  1CD3 G;  1W9Y A;  1W8O A;  1X33 A;  1WGP A;  1X82 A;  3VHP A;  3ZLI A;  2EIE A;  2FHR A;  2WS9 3;  4NHY A;  3LGR A;  1AYM 3;  2JG9 C;  4XUN A;  5LWB A;  3WNN A;  3KVA A;  1J3P A;  3ZMN A;  3EBR A;  5A7W A;  3T4H B;  1BQP A;  2C4X A;  2W9X A;  1PIV 1;  2XQR A;  4MGI E;  5A6X A;  3WD5 A;  3DEM A;  1ZBA 2;  5FCC A;  4Q4W 2;  4R9B A;  2XLG A;  2CV6 A;  1WLC A;  3K48 A;  2XBO 1;  1H8T A;  1IKQ A;  2A6V A;  4OZO A;  4XUP A;  1VAV A;  1F15 A;  2W1W A;  4YW6 A;  1SFY A;  2VQ0 A;  2VJX A;  4XXP A;  1DG6 A;  1FOD 1;  3ZIX A;  1YWK A;  1JZ7 A;  5A32 A;  1OLM E;  4D94 A;  1GNZ A;  2JD9 A;  4CEW C;  2EID A;  3MUY 1;  3WVJ A;  2V73 A;  5FP4 A;  1DIW A;  3KZ4 C;  4ATF A;  1E57 A;  3B9C A;  1OA4 A;  2W46 A;  3E5U A;  1MZF A;  3B9I A;  1PM7 A;  3NV2 A;  4L0P A;  4D8M A;  1BBT 3;  4PLM A;  1EUU A;  2QDR A;  4CUC A;  3HQX A;  3E6B A;  4WV8 A;  4BQ2 A;  3NJV A;  5J96 B;  2QZ2 A;  3T0B A;  1OXC A;  5JMO A;  1LTE A;  2I07 B;  3M4F A;  1NY7 1;  5ABJ B;  2RJK A;  4FSJ A;  1UX7 A;  1I5P A;  4AGV A;  3EXU A;  5I0S A;  4MGT A;  3APB A;  4AVC A;  2EIG A;  2QQU A;  2V4V A;  1CON A;  1XU2 A;  1QIQ A;  2VMD A;  4ES8 A;  4HVO A;  5J48 A;  3ACH A;  4AFC A;  3OBT A;  4BQ1 A;  4XVH A;  1W2N A;  3N9L A;  3ME2 A;  3IWZ A;  3Q8C A;  4XDO A;  3BIE A;  4XQ4 A;  4MX3 A;  1H2K A;  3AX4 A;  2JDN A;  3R4U A;  4M0H A;  3I2F A;  5FXZ A;  1PO2 1;  3KF3 A;  4Y26 A;  3CDZ B;  2DVA A;  5C6C A;  2BTV C;  4OVE A;  1GKB A;  4NAO A;  1VRH 3;  5DUV A;  5A3W A;  5FQ0 B;  2UYA A;  5BNQ A;  5K8S A;  2WUH A;  5HXV A;  3RZM A;  2W1S A;  2VC9 A;  2BDR A;  3KHB A;  4UWD A;  2R07 2;  2VZQ A;  1YUD A;  2ZOE B;  5FRA A;  4QX2 A;  3WF3 A;  4DS0 A;  4COZ A;  1H0B A;  2A5Z A;  3AZX A;  1ND2 A;  3FBM A;  1H2N A;  3IDE A;  1ULD A;  4IET A;  4PBO A;  5DAV A;  4CDX C;  5B4N A;  4IEU A;  4Q0P A;  5CFC B;  5F2S A;  1JYX A;  3NKT A;  1R1Z A;  1QJZ A;  2ZGP A;  5JCT A;  4XJZ A;  3ZSL A;  2WYF A;  2OW4 A;  2P6H A;  4FAH A;  1NYW A;  1SBF A;  2VME A;  4UAP A;  3VBH C;  2GH2 A;  1FPN 1;  4FFI A;  3K4D A;  2EF6 A;  3LA7 A;  4QX3 A;  1ASJ 3;  4OQ9 A;  4IE5 A;  4KMQ A;  1ZRE A;  2E6V A;  5FO7 B;  4RR3 B;  1WCK A;  1RUG 2;  2VPV A;  3LE0 A;  2RJ2 A;  2QUO A;  4XC9 A;  2XB6 C;  3RS6 A;  5BNO A;  4NIG A;  3NV3 A;  3ZFG B;  1Z7S 2;  2XH6 A;  3GAL A;  2OYZ A;  5FY0 A;  4AVA A;  1KEX A;  3UKV A;  3UJQ A;  5CEH A;  3OUJ A;  5LBC A;  3I3D A;  3ZDS A;  4N9H A;  2B45 X;  5FOJ B;  2RE9 A;  1QGL A;  4LOS A;  4UFH A;  1EY2 A;  4FI9 A;  2PLV 1;  3J8F 2;  1SPP A;  3PVN A;  5CNA A;  1OLM A;  2O8Q A;  3D8C A;  4LLF A;  4CDW C;  1PO1 2;  5EJZ B;  5FZO B;  2AAC A;  1GFF 2;  4QPW A;  4A6O A;  1WCS A;  2RMU 3;  1ND3 A;  3DYO A;  1UMH A;  4ASL A;  4WVZ A;  3I8T A;  2A71 A;  3AKP A;  5FY4 A;  3Q8A A;  3KLS A;  1H2L A;  5JOW A;  2P5B A;  5A33 A;  1C8M 3;  3UGG A;  2WIN B;  4EN0 A;  1FMD 2;  1RUD 2;  1GWL A;  1NLS A;  4IEZ A;  4QU1 A;  5JWP A;  4L11 A;  2R04 3;  4JRL A;  2G19 A;  5F5Q A;  3WY6 A;  3ZFE C;  1TG7 A;  2EXK A;  3SXW A;  1D4M 2;  5EXO A;  5HI0 A;  2BUK A;  1OA2 A;  4SBV A;  3VB9 A;  1HRI 2;  1MR5 A;  2KR2 A;  4QKF A;  2XBO 3;  2W1Q A;  3I2G A;  4OI1 A;  1QQP 3;  2RS5 3;  2A6W A;  2YPD A;  3B01 A;  1BCX A;  3UT0 A;  3WG1 A;  3ZYJ B;  5IHR A;  1O91 A;  3A7Q A;  1YQ2 A;  2WNO A;  4E4Z A;  4Q4V 3;  4IEO A;  1VR3 A;  4JKK A;  1MEC 1;  5FTT C;  4CP1 A;  4JCK A;  2W0X A;  2XVL A;  2VNR A;  1ENX A;  4QKB A;  4AE2 A;  1SBE A;  3Q8F A;  5FP7 A;  1DP0 A;  5BNO B;  1AYN 2;  4XBN A;  1O8S A;  2B46 X;  2DF7 A;  5FZ0 A;  5B2G B;  1K5M B;  1PZ8 A;  2GND A;  1W8F A;  5GLW A;  5DAP A;  2BGC A;  1LOC A;  1VAM A;  1AR7 2;  4IGQ A;  1C5H A;  1BK0 A;  1OF3 A;  2YRO A;  3AZY A;  1SLI A;  1OFS A;  4BME A;  3CBN A;  3BB6 A;  4Y1Z A;  4AED A;  4BE3 A;  4AVB A;  2WNV B;  3WP4 A;  3SKV A;  1DHK B;  2VU9 A;  1N47 A;  3CEW A;  2NPI A;  2MHF A;  4LA3 A;  5EIY B;  2OUH A;  1US3 A;  1CZT A;  4Q1R A;  2JDP A;  5J3U A;  2HWD 1;  1QJX 1;  3OY8 B;  2LRO A;  2QBX A;  3LPG A;  1YI7 A;  4QXK A;  2BW8 A;  1H8T C;  2O14 A;  3VKL A;  3MIC A;  4PJY A;  5C5T A;  5IVF A;  3ZN6 A;  1YI9 A;  2LRP A;  2QE3 A;  4AHY A;  3QAC A;  1WME A;  1LOG A;  5DZE A;  4IGO A;  2R30 A;  4KBZ A;  2GZW A;  1R64 A;  1OVP A;  4FVV A;  1OPO A;  4LMF A;  1BKZ A;  2XVG A;  4D7Y A;  1EV1 1;  4YW3 A;  2WWU A;  4BMB A;  2Q0A A;  2ZKL A;  3ES1 A;  2GC1 A;  3C2U A;  3FX3 A;  4JTO A;  3RI9 A;  4AFM A;  5FPL A;  1AVB A;  2WQ8 A;  5GAL A;  2XG3 A;  2W5F A;  3ZR5 A;  4MUV A;  1RYY A;  1VP6 A;  3AFK A;  5DAQ A;  4CDQ C;  1RED A;  5BYN A;  2ZEZ A;  2ZTN A;  1CAV B;  5EHD A;  4P9W A;  5LW9 A;  5FYC A;  2CL2 A;  5DZG A;  2FDG A;  1PO2 3;  1HB3 A;  3O1P A;  1V6I A;  5F6K A;  2RS1 3;  2Y60 A;  2GC0 A;  3FLT A;  4PLN A;  4ZZ5 A;  4BWO A;  1JH5 A;  2ZGO A;  5BXX A;  1UNB A;  4AFA A;  1DZT A;  1W04 A;  2Y64 A;  5A1A A;  1V6J A;  3QH6 A;  3DXT A;  4Y22 A;  3I3B A;  5JZG C;  3IT8 A;  3SCG A;  1OVS A;  3HPN A;  5DAW A;  3VKM A;  3DKW A;  4GWJ A;  4CYD A;  3N35 A;  1RUD 3;  2YY1 A;  3NRU A;  5KHG A;  4HET A;  4XF3 A;  3GZU C;  4JZR A;  1NZI A;  1YLL A;  3LCP A;  5D8A B;  5E8A A;  5FZK A;  3W9A A;  4CDQ A;  2XLF A;  3AMN A;  1Y9Q A;  3BU7 A;  4LO7 A;  1RGS A;  3MDP A;  1UY1 A;  4LT5 A;  3OBR A;  1LOA A;  1QOS A;  3CF6 E;  4MOA A;  4Z07 A;  1TZO A;  4CEY C;  1U5Y A;  4LIT A;  4LOR A;  1ULO A;  3FUO A;  2XON A;  4AR2 A;  4EJR A;  1QJF A;  3G6J B;  4GZ9 A;  4LO4 B;  1PGL 1;  1LES A;  2DCY A;  5I0T A;  1U0A A;  4KWL A;  2VGD A;  5FLJ A;  2ZEW A;  4PBP A;  2GC3 A;  2PA7 A;  4GMP 0;  1LCL A;  4AGR A;  1OF4 A;  4FTB A;  5AC9 3;  3NAP A;  3PHM A;  5A32 B;  2RM2 1;  4YW7 A;  5EJ3 A;  2B7Y A;  4K20 A;  4LLO A;  1H4H A;  4DXR A;  3RQ0 A;  3V0B A;  3A0K A;  2XJU A;  4DEQ A;  5F5I A;  1D4V B;  1QH7 A;  2R06 1;  1GMM A;  1PZ9 A;  1Y4W A;  3H8R A;  3RZG A;  5LAS A;  2JKB A;  4WVW A;  1NY7 2;  2ZAH A;  1UOJ A;  2HWB 2;  5DDJ 3;  4XQD A;  1SG3 A;  2FDH A;  1LAJ A;  1RVF 3;  1JN2 P;  2R0H A;  2VNG A;  4CRQ A;  5JXJ A;  4Q0V A;  1W28 A;  4IW3 A;  4QX7 A;  1AHS A;  2B8M A;  4QHB A;  1O5L A;  2WFF 1;  2X5I C;  3S57 A;  4YAR A;  3JQW A;  2VUJ A;  5JI9 A;  3AYA A;  3VBR A;  2MEV 2;  4OI0 A;  3AYD A;  4AF9 A;  2ZMN A;  2JIC A;  3LA2 A;  4Y5S A;  2VG9 A;  1PGW 2;  3D82 A;  3VZO A;  1GOH A;  1KD7 A;  1RC6 A;  5C4W A;  5D8A A;  5L9R A;  3U07 A;  3W21 A;  3N7J A;  4NIA A;  2OQ7 A;  5GKA C;  4XFC A;  5I8S A;  1W39 A;  1XE0 A;  2BRT A;  3M7A A;  1IGO A;  2Q5T A;  4QPG C;  5FO9 B;  1OOP A;  3MIE A;  5HV0 A;  1FYU A;  3AJY A;  2QQK A;  1UZZ A;  5GZF A;  5FZG A;  1CAW B;  1CJD A;  2YBS A;  4XF1 A;  3OPW A;  2ETE A;  3O1U A;  4NPM A;  5FYZ A;  2LM3 A;  1NCQ B;  1FV3 A;  1GQG A;  1YQ8 A;  2VMF A;  4A4A A;  3WNM A;  1Y7B A;  3FC0 A;  4HZF A;  5IWF A;  2D6N A;  1DF0 A;  3O7O A;  2C6S A;  4CDX B;  2XHK A;  4LKD A;  3T2T A;  4YZ4 A;  2PLV 2;  1OHF A;  3K46 A;  5C9A C;  4B4Q A;  1GNY A;  1QQP 2;  2RS5 2;  4NJ4 A;  4D69 A;  3U37 A;  4RHV 2;  3ZVX A;  1BJQ A;  3TOJ A;  5CZK A;  5FZD A;  5FUP A;  3O14 A;  1VRB A;  2V5Y A;  2VQT A;  4GQ7 A;  4QGL A;  4GKX A;  3VBH B;  2YC2 A;  5FZB A;  1HJF A;  4A45 A;  2VTF A;  1O59 A;  4RL7 A;  3KVB A;  4I09 A;  1O3Q A;  2DBI A;  5DAX A;  1CR7 A;  4EWE A;  1I6X A;  4PT6 A;  3U78 A;  5KHI A;  5E1R A;  3BTY A;  4Y4Y A;  5EFU A;  3ZFG C;  4L92 A;  2ZZJ A;  1AR6 2;  2ATF A;  1UYX A;  4AG4 A;  4BDV B;  1W8N A;  4NII A;  1UOF A;  1A78 A;  1DQ5 A;  2AEY A;  3N7K A;  5JIU A;  1LEM A;  3FFQ A;  5CKM A;  5JXI A;  4R4Z A;  3DN7 A;  2JDK A;  4HK9 A;  3VBF A;  3K75 B;  1RUC 1;  1X8E A;  1ZBA 3;  3LKJ A;  4QGN A;  5GZE A;  2R6Q A;  2XJR A;  4DNY A;  1QY4 A;  1ZRC A;  1QOT A;  5FYU A;  1RUE 3;  4CDW B;  1SMV A;  2IUW A;  4YRD A;  4IE0 A;  3VD7 A;  4CCO A;  5LBB A;  3ALQ A;  2JWP A;  1CZS A;  2KXL A;  3U1X A;  3ZSM A;  5C5U A;  2ARC A;  5KC5 A;  4WBB A;  1JYV A;  3K51 A;  2WLP A;  5I91 A;  3VDA A;  2IXH A;  2OXB A;  3EO6 A;  4FPC A;  2RS1 1;  3WDV A;  4UFJ A;  3WZ1 A;  1H8V A;  1NOV A;  2QNK A;  1QEX A;  1WMX A;  3A4U A;  1RUC 3;  1ZBA 1;  1HRV 3;  4YM3 A;  1H6X A;  4JDN A;  1R08 2;  4Q0U A;  5IJR A;  3K4A A;  2MNG A;  4MGZ E;  4YLZ A;  1C5I A;  2UUR A;  1NCR C;  2PQQ A;  2D6M A;  2Q8E A;  3WQ7 A;  4AED B;  5HXM A;  4TLF A;  1WWY A;  2BU9 A;  1WLW A;  3C7O A;  4XXA A;  5FMD A;  3VBF C;  3LEG A;  3A22 A;  4IV3 B;  2HWC 1;  5ACA 2;  4AI0 A;  2H6B A;  2ZEY A;  4CE8 A;  3PVE A;  1EV1 3;  1LHW A;  2XJV A;  2WWS A;  3JD7 2;  5FXW A;  1C1F A;  1OQ1 A;  2B9U A;  4JTN A;  4AQT A;  4I3P A;  2ZGM A;  5DQ0 A;  2PTM A;  3T1M A;  4F3J A;  3H8O A;  4B3N A;  1PVC 3;  3MI8 A;  4V2V A;  2PAK A;  2E7T A;  4WM8 B;  1WCD J;  3TEY A;  1H9P A;  4R9C A;  3E97 A;  2I2S A;  3IAP A;  4J1W A;  2ZZQ A;  2ZX4 A;  1QJY 1;  1Y3T A;  2D6L X;  3WHT A;  3Q8E A;  1E5I A;  3BCW A;  4MSV A;  4PDW C;  2SBA A;  3AFG A;  2YYO A;  1F5F A;  2QQN A;  3OD0 A;  1WMD A;  1GBG A;  4RS5 B;  4JQR A;  4AL9 A;  4ZS2 A;  5IYY A;  1I5Z A;  5L19 A;  2BVB A;  4P9L A;  4Q1P A;  3IN9 A;  2HWE 2;  5BPX A;  3VBS C;  1ZZ6 A;  3NAP B;  4YG3 A;  2V72 A;  1F2N A;  5CBL A;  1QMJ A;  1S0E A;  4XQW A;  3ELN A;  5FZE A;  3I2H A;  2VW1 A;  1VIW B;  4TYS A;  4UW6 A;  5FP3 A;  5AFE A;  3GBW A;  1H8T B;  2BYV E;  3OF1 A;  4AI1 A;  2JIJ A;  1LOB A;  1OQD A;  5C3R A;  1HN1 A;  1SDW A;  2VMH A;  3NST A;  4C0B A;  4H7M A;  5FZ1 A;  3NQH A;  4YNI A;  3HNM A;  5FMC A;  2Q1F A;  3PMS A;  1KDK A;  3EB7 A;  5LK7 B;  4WZF A;  5EYY A;  1DQ2 A;  1TMF 3;  1BEV 3;  5EZW A;  2E7A A;  1JXN A;  2UWC A;  4LR4 A;  1AL2 2;  2DFC A;  3N9O A;  4BIF A;  1W8U A;  2OX0 A;  5BNP C;  4LO5 B;  3D0S A;  2W3J A;  3WIN E;  1VBB 1;  1RUJ 1;  3PU3 A;  4LE4 A;  1OUS A;  2R7E B;  3O0W A;  4YVW A;  5FMB A;  1HQL A;  4LO8 A;  5C4W B;  1DLC A;  1ACC A;  3CL1 A;  5I0R A;  5LA0 A;  1XNA A;  3ACI A;  3ON7 A;  1H2M A;  4RQP C;  1HDK A;  1YQ5 A;  4RGK A;  2DUR A;  1AX0 A;  2R07 3;  1DZQ A;  1ZZ9 A;  2XDV A;  3NV4 A;  5CAZ A;  4OHX A;  4ITC A;  4IV1 C;  4QB6 A;  2F4L A;  4YW5 A;  3ZPO A;  1W6N B;  1TVG A;  4KWJ A;  3TNP B;  2CGP A;  1EPW A;  4UBG A;  2JE9 A;  2VNV A;  1A34 A;  4R52 A;  2ET7 A;  5FOB B;  3SIT A;  4RN5 A;  4WVM B;  1FPN 3;  1ZX5 A;  1QF3 A;  3MIH A;  4E9K A;  1G86 A;  2VQU A;  2VMG A;  1JZ3 A;  2YDE A;  3WDT A;  2IVJ A;  3VDB A;  1SBD A;  1J3Q A;  2VCB A;  3WF4 A;  1YIF A;  1J84 A;  1RUE 1;  3R6S A;  1YFU A;  4MHU A;  2Y38 A;  3WF0 A;  1EV1 2;  1LJ7 A;  3ZPY A;  3ZYB A;  3JBG 3;  5K4L A;  1DU3 D;  4BOW A;  1W3X A;  4GJY A;  4OUS A;  4CDU C;  1H4G A;  5DMY A;  1MVE A;  2RDQ A;  2WT2 A;  1J1T A;  5IK7 A;  4ASK A;  4ZZ8 A;  1H1M A;  2CU5 A;  1PX3 A;  2QCS B;  3PUS A;  2NLR A;  4IXL A;  4Q4X 3;  1S0J A;  2ZJC A;  4UW3 A;  3W59 A;  1PIV 3;  3MLJ A;  5KWR A;  5FZO A;  4XW3 A;  1VBD 1;  5F37 A;  2VUL A;  4SLI A;  4XIK A;  2JX9 A;  4YVW B;  1CAX B;  1V6N A;  3PU8 A;  4YSF A;  2PMW B;  3UYJ A;  4DZG A;  1RUG 1;  1XXN A;  3AKR A;  4QT6 A;  3WDY A;  2RR1 2;  4FQZ A;  2HWE 3;  5DUW A;  1YO8 A;  1TMF 1;  5F6L B;  1PK6 A;  2X5I B;  1OH3 A;  2VXR A;  2HYX A;  3H7J A;  5FBJ A;  4EN8 B;  3N4M A;  4HVQ A;  4CCN A;  5B4X A;  2GU9 A;  2Y26 A;  1VRH 2;  2BQP A;  1E5S A;  2XUM A;  4Q4W 3;  3LSE A;  2J22 A;  3GCX A;  2ZEX A;  3VBU C;  1MVQ A;  3WX5 A;  5LRS A;  4FFH A;  2RS3 2;  3PVB B;  4KWU A;  2WN2 A;  4Q0Q A;  4WVV A;  2OS2 A;  1ND3 B;  3FWE A;  3JD7 1;  1QJY 3;  2DYC A;  3VD5 A;  2VXJ A;  2BWA A;  2QQJ A;  2WZE A;  3ZXF A;  2C9K A;  4NO4 A;  4M4P A;  3HT2 A;  1UY2 A;  4MGQ A;  1UKG A;  1US2 A;  3RMX A;  2W1U A;  4YZ3 A;  1JYC A;  4FFF A;  4M01 A;  3ZIW A;  5JZG A;  2VR4 A;  3RZK A;  2VO5 A;  3WUC A;  1PO1 1;  1LED A;  2JDZ A;  1GNH A;  2YUE A;  2P34 A;  4LEJ A;  3M3O A;  5ERL A;  2CYF A;  3K3N A;  5LB6 A;  3RZL A;  1EAH 3;  2CWM A;  3PUA A;  2SLI A;  4JRA A;  2PN5 A;  3GF6 A;  2VMC A;  1RUO A;  4QQP A;  3RYK A;  1HB1 A;  1JYI A;  4AHW A;  3URF A;  3GZT B;  4PF5 A;  4NAM A;  3BKZ A;  4XZP A;  4A7Z A;  3H8X A;  4NMI A;  4XE9 A;  5D1I A;  1VAK A;  1RUI 1;  5FZA A;  1S0B A;  1AUY A;  2ZPX A;  3WG3 A;  4DUW A;  3VDD A;  1TME 1;  2DVF A;  3KT7 A;  3O5S A;  4Z2A A;  2EIC A;  2ARE A;  2QQL A;  3FJS A;  1UO9 A;  1YC6 1;  2Y34 A;  3VN4 A;  5C71 A;  3HMY A;  5LBF A;  3BI3 A;  4HSL A;  2RMU 2;  3C7H A;  4CPB D;  3NMB A;  2Y8K A;  4C1X A;  1O3R A;  4JDO A;  2QDN A;  1E5R A;  1RL3 A;  1PX4 A;  1WW5 A;  3AP6 A;  4AFD A;  2R06 2;  4GMP 3;  1UAI A;  1UY0 A;  2YFU A;  1VB2 A;  2XOM A;  2QQM A;  1I3H A;  3IIA A;  1RUJ 2;  4S2H A;  4WZC A;  1N1V A;  2R07 1;  1Z0H A;  3NJY A;  1HRI 1;  1X7N A;  1D2S A;  2V4A A;  4LHL A;  4NPL A;  4XF0 A;  3FHA A;  5A7S A;  3VKO A;  3RJ2 X;  2FQP A;  5HCF A;  2JJ6 A;  1UMZ A;  4KU7 A;  3M8L A;  4BQ5 A;  4Q27 A;  1OKQ A;  4BCU A;  1QNW A;  1RHI 3;  4A6S A;  3SLI A;  2BNO A;  1K3I A;  3QCW A;  1QXJ A;  2Y6L A;  4XJW A;  2AYH A;  4OCT A;  4CUG A;  1AL2 3;  5ACA 3;  1UL9 A;  4JDM A;  4XAA A;  4EWD A;  3B94 A;  1D7P M;  3ZFE A;  4HKL A;  1R09 3;  1HXS 2;  1NUK A;  4Z82 A;  1RMU 1;  1RTV A;  5BNN A;  1CZV A;  4JGY A;  1CAU B;  4KWK A;  3VBR C;  3I3E A;  4RR3 C;  4CDQ B;  3J8F 1;  2HWF 3;  3NNG A;  2VW0 A;  3ZXA C;  1OSG A;  1MZ6 A;  3WP3 A;  2DBN A;  1XYP A;  2VZU A;  3PME A;  4QHO A;  3ZDV A;  4LUK A;  4YZ5 A;  2E51 A;  1DYP A;  4X8P A;  4HFS A;  2OII A;  4AQ6 A;  4FCA A;  1OT5 A;  2HYK A;  4MHR A;  4QD2 A;  4QPG A;  2ID4 A;  1QJY 2;  1W6Q A;  2VZO A;  3AXE A;  4I2O A;  2WAO A;  2KM2 A;  4CA9 A;  1VLN A;  1YQ6 A;  4A2U A;  4LK6 A;  1UZY A;  5FY5 A;  2FMY A;  4O65 A;  4XFA A;  4I3G A;  4U36 A;  3N7M A;  4DRV A;  3WLU A;  2ZXQ A;  1VBC 3;  3L9J T;  4LPL A; 
#chains in the Genus database with same CATH homology
 1JHJ A;  1US3 A;  2WDB A;  3MV1 1;  1CZT A;  2JDA A;  4ZXE A;  3LPG A;  2QBX A;  2J7M A;  5G05 L;  4D0Q A;  1JI6 A;  4CU6 A;  3UES A;  3MV0 1;  1R64 A;  3VD4 A;  2DCK A;  3P1I A;  3MO4 A;  2BGP A;  4P5Y A;  4JX0 A;  3HJR A;  3HOB A;  2LW8 A;  2WQ8 A;  2W5F A;  3W5N A;  3OGR A;  1RYY A;  2ZEZ A;  3WF2 A;  1JZ2 A;  4MGS A;  1GOG A;  1UZ0 A;  2W94 A;  4ZZ5 A;  2VL4 A;  2BGO A;  1PMJ X;  5A1A A;  2Y64 A;  3I3B A;  1UXX X;  3PUI A;  3HPN A;  3OGS A;  4CUA A;  3ETP A;  2X10 A;  1JZ6 A;  4GWJ A;  3WEZ A;  4OMC A;  1F4A A;  2W92 A;  1NX9 A;  4QX0 A;  2BBA A;  3NRU A;  2OKX A;  1W9T A;  4CU7 A;  5IFT A;  1UXZ A;  1UY1 A;  2B9V A;  3III A;  2VZ1 A;  2W95 A;  3OB8 A;  4MOA A;  2VZV A;  1ULO A;  3K77 A;  5JR2 A;  2XON A;  2VZ3 A;  4IUG A;  4GZ9 A;  4XZU G;  3T0A A;  3WNK A;  1NAE A;  2VZP A;  2CDP A;  2YB7 A;  3WNP A;  4TTG A;  4JHZ A;  3OGV A;  3LEI A;  1GQP A;  3C8X A;  4BXS V;  2ZEW A;  3I97 A;  1OF4 A;  1MPX A;  1EUT A;  4CUB A;  4QAW A;  3WF1 A;  2WN3 A;  1JYN A;  2BER A;  4DXR A;  2X09 A;  1UWW A;  3GGL A;  3A21 A;  4A44 A;  2CDO A;  4E8D A;  4BK5 A;  1SDD B;  1T2X A;  4DEQ A;  1L7Q A;  1GMM A;  3T2P A;  1JZ8 A;  3DEC A;  2JKX A;  3HNY M;  2KD7 A;  5C7G A;  1SG3 A;  3A23 A;  3I2K A;  4ET7 A;  5LA2 A;  5JXH A;  1K12 A;  3VD9 A;  5JXJ A;  2W47 A;  3FN9 A;  2VZR A;  4XUR A;  1KGY A;  4XUQ A;  2WZ8 A;  1GOF A;  4A42 A;  2WO3 A;  2XQX A;  2VM9 A;  1GOH A;  1UYY A;  3ECQ A;  3UNP A;  5DN2 A;  1XPW A;  3IDA A;  1JZ5 A;  2QQK A;  1BHG A;  3VD3 A;  2J1U A;  2VZS A;  2VMF A;  4P08 A;  4A4A A;  3WNM A;  4LHS A;  2Y6H A;  3D3A A;  4QB2 A;  3K46 A;  1GNY A;  3CIH A;  3ABZ A;  4YPJ A;  3U37 A;  1W9W A;  5CZK A;  2VQT A;  3UET A;  1OH4 A;  2X05 A;  2YC2 A;  3GXU A;  4A45 A;  2Y6K A;  3BN6 A;  2VTF A;  1O59 A;  2HLE A;  4CVU A;  3SKJ E;  3ACG A;  5F7U A;  4PT6 A;  2WO1 A;  4W4Z A;  3GDB A;  4MO3 M;  3F2Z A;  1UYX A;  2E26 A;  4AG4 A;  1W8N A;  4P00 B;  4BDV B;  3DYP A;  5J1X A;  5JXI A;  3K75 B;  2L9L A;  4BK4 A;  3JXS A;  3MBW A;  2E33 A;  4DUV A;  3FL7 A;  3THD A;  1JU4 A;  3VD7 A;  4DEV A;  4XUO A;  2YG0 A;  1CZS A;  2QQI A;  1UY4 A;  3I2I A;  1XNT A;  5JXG A;  1JYV A;  4A41 A;  3VDA A;  4JKL A;  3LQC A;  4W8J A;  2WO2 A;  4QB1 A;  1H6X A;  3T2O A;  5IJR A;  3K4A A;  5HXM A;  3HEI A;  1W0N A;  2ORX A;  3C7O A;  1JYW A;  5DPN A;  3LEG A;  3A22 A;  4UI9 L;  4QDS A;  4ARY A;  1OD3 A;  2ZEY A;  4GWI A;  2Y6G A;  2RV9 A;  3VDC A;  3K4Z A;  3E1F 1;  3AC0 A;  3LPF A;  5DQ0 A;  1UY3 A;  3I2J A;  3WSO A;  2B4K A;  2LS6 A;  3IAP A;  1WCQ A;  3T09 A;  4ARX A;  2W87 A;  5LA1 A;  2J1S A;  3NJX A;  2QQN A;  3SEP A;  2VCA A;  5IYY A;  4LQR A;  3ACF A;  4OYU A;  2QQO A;  1F4H A;  1UYZ A;  2V72 A;  4HG6 B;  3I2H A;  4A3Z A;  1HN1 A;  1P8J A;  1SHW B;  3NQH A;  3SEE A;  3HNM A;  3OEA A;  3C7E A;  3EB7 A;  4LKS A;  5CYY A;  2YC4 A;  3HN3 A;  4BJ0 A;  3HNB M;  3FHQ A;  3T0D A;  1JZ4 A;  1W99 A;  2J1R A;  2DCJ A;  2W3J A;  2EIB A;  2J1T A;  2R7E B;  3BGA A;  4QX1 A;  1JU3 A;  4RYD A;  1DLC A;  3DYM A;  2E32 A;  4E8C A;  5LA0 A;  1XNA A;  1ULP A;  3ACI A;  1GUI A;  1PMH X;  3IB3 A;  2VOT A;  4QB6 A;  1W8O A;  2EIE A;  1TVG A;  2VZT A;  2C26 A;  4XUN A;  3WNN A;  4RN5 A;  5IFP A;  2C4X A;  2W9X A;  2VQU A;  1JZ3 A;  3P6B A;  3VDB A;  2VCB A;  3WF4 A;  1J84 A;  2YFZ A;  4OZO A;  4XUP A;  2W1W A;  3WF0 A;  2VJX A;  4KI5 M;  5DMY A;  2RVA A;  1JZ7 A;  4PQQ A;  2JD9 A;  2XHN A;  4DUX A;  2EID A;  2Z4F A;  3MUY 1;  4ZZ8 A;  1PX3 A;  1J83 A;  1UMI A;  2W46 A;  4ZY9 A;  4L0P A;  4QDQ A;  4D8M A;  5LCW L;  1EUU A;  2Y6J A;  4OMD A;  4CUC A;  4P02 B;  3NJV A;  1L7R A;  3T0B A;  3IAQ A;  3PUH A;  5JMO A;  1UX7 A;  1I5P A;  1CIY A;  2V4V A;  3THC A;  1W9S A;  2HYX A;  2VMD A;  3ACH A;  5EJ1 B;  1K42 A;  3GM8 A;  4XVH A;  5B4X A;  2J1V A;  3EYP A;  3OG2 A;  2J1A A;  2J22 A;  3ZM8 A;  2ZEX A;  3WQB A;  3WNO A;  1XC6 A;  2BZD A;  4KWU A;  2WN2 A;  4DXT A;  3I2F A;  3CDZ B;  3VD5 A;  2WYS A;  2QQJ A;  2WZE A;  2C9K A;  4M4P A;  3T2Q A;  2WUH A;  1UY2 A;  4MGQ A;  1US2 A;  2W1S A;  2VC9 A;  2W1U A;  2VZQ A;  2VR4 A;  3C7G A;  4QX2 A;  3WF3 A;  5JUV A;  5I0D A;  2VO5 A;  5B4N A;  1IQD C;  4QDR A;  1CX1 A;  4TXW A;  2J1E A;  1JYX A;  4JKM A;  2VMC A;  2WBK A;  1NKG A;  2VME A;  4UAP A;  4QX3 A;  3K4D A;  3W5M A;  4KMQ A;  3CKH A;  4OUE A;  3LE0 A;  2RJ2 A;  4DUW A;  4Z2A A;  2EIC A;  1LNS A;  1KEX A;  2QQL A;  5C71 A;  3I3D A;  1DYO A;  3C7H A;  4UOJ A;  5HPO A;  2DDU A;  2Y8K A;  4FI9 A;  3J7H A;  1PX4 A;  3OEB A;  5EJZ B;  2W91 A;  4W50 A;  1UY0 A;  2YFU A;  4QPW A;  2XOM A;  4A6O A;  2QQM A;  3DYO A;  4CU9 A;  1UMH A;  4AAX A;  3FHA A;  2WAA A;  5G04 L;  3CZJ A;  4M4R A;  1WKY A;  1TG7 A;  1K3I A;  2Y6L A;  2VCC A;  3CZU A;  4MAD A;  2JE8 A;  1O8P A;  1D7P M;  3I2G A;  2W1Q A;  2E31 A;  2V5D A;  1NUK A;  5IHR A;  1CZV A;  3A7Q A;  1YQ2 A;  3I3E A;  3WNL A;  4JKK A;  4PF1 A;  3NNG A;  2VZU A;  3CMG A;  4DXS A;  1DP0 A;  1O8S A;  1GU3 A;  4CU8 A;  1OT5 A;  3T08 A;  2ID4 A;  2VZO A;  2ORZ A;  2WAO A;  3MUZ 1;  1OF3 A;  3LEK A;  2PQS A;  1H6Y A;  3CQO A;  3C7F A;  5C70 A;  2WAB A;  3SKV A;  1K45 A;  4XUT A;  5EIY B;  3OBA A;  5FUI A;  2ZXQ A;  4LPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...