4MOYA

Structure of a second nuclear pp1 holoenzyme, crystal form 1
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
294
structure length
294
Chain Sequence
LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase PP1-alpha catalytic sub
publication title Understanding the antagonism of retinoblastoma protein dephosphorylation by PNUTS provides insights into the PP1 regulatory code.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/nuclear protein
total genus 112
structure length 294
sequence length 294
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2013-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00149 Metallophos Calcineurin-like phosphoesterase
A PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.21.10 Alpha Beta 4-Layer Sandwich Purple Acid Phosphatase; chain A, domain 2 Purple Acid Phosphatase; chain A, domain 2 4moyA00
3PSOA 1M63A 2AHDA 2WDEA 3IVEA 4G9JA 2DFJA 5B8IA 1MF8A 4FBKA 2IE3C 3RL5A 3RQZA 2Q8UA 4IYPC 5C1VA 1V73A 2QJCA 4H2FA 1JK7A 3DSCA 3T1IA 4UT2A 2ZBMA 3IB7A 2P6BA 3DW8C 1S3LA 3ICFA 4DSYA 1UF3A 1QFCA 3QFKA 4JA7A 2WDCA 2A22A 2IE4C 1Z2WA 4HD0A 2O8GA 3IVDA 3H68A 4ZVZA 3EGGA 2KKNA 2HYPA 4NZVA 2BQ8X 4OR9A 2O8AA 4ORAA 3QFNA 3H62B 3E7BA 4Q7FA 3EGHA 4F0ZA 4JA9A 4ZX2A 3QG5C 3TGHA 3THNA 4O43A 3H60A 3K7VC 3H66A 2HY1A 1OIEA 1XM7A 3GVEA 1U32A 3JYFA 1IT6A 1USHA 2Z72A 3K7WC 4WWLA 1HPUA 2CV9A 2GJUA 3QFMA 5JPEA 4UWQA 2WDDA 2R17A 3C5WC 2QFRA 3C9FA 3E7AA 4M0VA 3P71C 1HO5A 2XMOA 1WARA 1Z2XA 4DHLA 1XZWA 3DSDA 3ZTVA 1FJMA 4XPNA 4B2OA 2YVTA 4LTYA 3QFOA 3ZU0A 2WDFA 4H2IA 2IAEC 1W24A 4I5NC 4O24A 4TUIA 4IL1A 4H1YP 2NPPC 4KBPA 4ORBA 2NYMC 3H67A 4H2BA 2BCDA 1T70A 4V0WA 1S70A 1T71A 3RL4A 2Z1AA 4UT3B 1HP1A 3H69A 4LACC 3KBPA 1UTEA 4FBWA 4YKEA 3THOB 2USHA 5GTUA 1OI8A 5EQVA 4ORCA 1KBPA 3HVQA 4MP0A 4O4KA 3N5UA 3IB8A 4KKZA 5IOHA 4UT3A 4H1SA 5JPFA 3AUZA 1II7A 2JOGA 5F3WA 4FBQA 4H2GA 4TUGA 4J6OA 5J28A 2NYLC 3H61A 2NXFA 1WAO1 1AUIA 3V4YA 3FGAC 4LU9A 3AV0A 4O5GA 3RL3A 2QFPA 3H63A 1SU1A 1S8EA 4I5LC 1S95A 3LL8A 2HYOA 1S3NA 5JJTA 4DT2A 2BDXA 4MOVA 3PSNA 1NNWA 2Z06A 4FCXA 1TCOA 4V0VA 1G5BA 4V0XA 1OIDA 3CK2A 1QHWA 5DNYA 5HPEA 3H64A 1S3MA 4MOYA 5INBA
chains in the Genus database with same CATH superfamily
3PSOA 1M63A 2AHDA 2WDEA 3IVEA 4G9JA 2DFJA 5B8IA 1MF8A 4FBKA 2IE3C 3RL5A 3RQZA 2Q8UA 4IYPC 5C1VA 1V73A 2QJCA 4H2FA 1JK7A 3DSCA 3T1IA 4UT2A 2ZBMA 3IB7A 2P6BA 3DW8C 1S3LA 3ICFA 4DSYA 1UF3A 1QFCA 3QFKA 4JA7A 2WDCA 2A22A 2IE4C 1Z2WA 4HD0A 2O8GA 3IVDA 3H68A 4ZVZA 2ZOAA 2KKNA 3EGGA 2HYPA 4NZVA 2BQ8X 4OR9A 2O8AA 4ORAA 3QFNA 3H62B 3E7BA 4Q7FA 3EGHA 4F0ZA 4JA9A 4ZX2A 3QG5C 3TGHA 3THNA 4O43A 3H60A 3K7VC 3H66A 2HY1A 1OIEA 1XM7A 3GVEA 1U32A 3D03A 3JYFA 1IT6A 1USHA 2Z72A 3K7WC 4WWLA 1HPUA 2CV9A 2GJUA 3QFMA 5JPEA 2DXLA 4UWQA 2WDDA 2R17A 3C5WC 2QFRA 3C9FA 3E7AA 4M0VA 3P71C 1HO5A 2XMOA 1WARA 1Z2XA 4DHLA 1XZWA 3DSDA 3ZTVA 1FJMA 4XPNA 4B2OA 2YVTA 4LTYA 3QFOA 3ZU0A 2WDFA 4H2IA 2IAEC 1W24A 4I5NC 4O24A 4TUIA 4IL1A 4H1YP 2NPPC 4KBPA 4ORBA 2NYMC 2ZO9B 3H67A 2BCDA 1T70A 4H2BA 4V0WA 1S70A 1T71A 3RL4A 2Z1AA 4UT3B 1HP1A 3H69A 4LACC 3KBPA 1UTEA 4FBWA 4YKEA 3THOB 2USHA 5GTUA 1OI8A 5EQVA 4ORCA 1KBPA 2DXNA 3HVQA 4MP0A 3N5UA 4O4KA 3IB8A 4KKZA 5IOHA 4UT3A 4H1SA 5JPFA 2YEQA 3AUZA 1II7A 2JOGA 5F3WA 3E0JA 4FBQA 4H2GA 4TUGA 4J6OA 5J28A 2NYLC 3H61A 2NXFA 1WAO1 1AUIA 3V4YA 3FGAC 3FLOA 4LU9A 3AV0A 4O5GA 3RL3A 2QFPA 3H63A 1SU1A 1S8EA 4I5LC 1S95A 3LL8A 2HYOA 1S3NA 5JJTA 4DT2A 2BDXA 4MOVA 3PSNA 1NNWA 2Z06A 4FCXA 1TCOA 4V0VA 1G5BA 4V0XA 1OIDA 3CK2A 1QHWA 5DNYA 5HPEA 3H64A 1S3MA 4MOYA 5INBA
chains in the Genus database with same CATH topology
3PSOA 1M63A 2AHDA 2WDEA 3IVEA 4G9JA 2DFJA 5B8IA 1MF8A 4FBKA 2IE3C 3RL5A 3RQZA 2Q8UA 4IYPC 5C1VA 1V73A 2QJCA 4H2FA 1JK7A 3DSCA 3T1IA 4UT2A 2ZBMA 3IB7A 2P6BA 3DW8C 1S3LA 3ICFA 4DSYA 1UF3A 1QFCA 3QFKA 4JA7A 2WDCA 2A22A 2IE4C 1Z2WA 4HD0A 2O8GA 3IVDA 3H68A 4ZVZA 2ZOAA 2KKNA 3EGGA 2HYPA 4NZVA 2BQ8X 4OR9A 2O8AA 4ORAA 3QFNA 3H62B 3E7BA 4Q7FA 3EGHA 4F0ZA 4JA9A 4ZX2A 3QG5C 3TGHA 3THNA 4O43A 3H60A 3K7VC 3H66A 2HY1A 1OIEA 1XM7A 3GVEA 1U32A 3D03A 3JYFA 1IT6A 1USHA 2Z72A 3K7WC 4WWLA 1HPUA 2CV9A 2GJUA 3QFMA 5JPEA 2DXLA 4UWQA 2WDDA 2R17A 3C5WC 2QFRA 3C9FA 3E7AA 4M0VA 3P71C 1HO5A 2XMOA 1WARA 1Z2XA 4DHLA 1XZWA 3DSDA 3ZTVA 1FJMA 4XPNA 4B2OA 2YVTA 4LTYA 3QFOA 3ZU0A 2WDFA 4H2IA 2IAEC 1W24A 4I5NC 4O24A 4TUIA 4IL1A 4H1YP 2NPPC 4KBPA 4ORBA 2NYMC 2ZO9B 3H67A 2BCDA 1T70A 4H2BA 4V0WA 1S70A 1T71A 3RL4A 2Z1AA 4UT3B 1HP1A 3H69A 4LACC 3KBPA 1UTEA 4FBWA 4YKEA 3THOB 2USHA 5GTUA 1OI8A 5EQVA 4ORCA 1KBPA 2DXNA 3HVQA 4MP0A 3N5UA 4O4KA 3IB8A 4KKZA 5IOHA 4UT3A 4H1SA 5JPFA 2YEQA 3AUZA 1II7A 2JOGA 5F3WA 3E0JA 4FBQA 4H2GA 4TUGA 4J6OA 5J28A 2NYLC 3H61A 2NXFA 1WAO1 1AUIA 3V4YA 3FGAC 3FLOA 4LU9A 3AV0A 4O5GA 3RL3A 2QFPA 3H63A 1SU1A 1S8EA 4I5LC 1S95A 3LL8A 2HYOA 1S3NA 5JJTA 4DT2A 2BDXA 4MOVA 3PSNA 1NNWA 2Z06A 4FCXA 1TCOA 4V0VA 1G5BA 4V0XA 1OIDA 3CK2A 1QHWA 5DNYA 5HPEA 3H64A 1S3MA 4MOYA 5INBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PSO A;  1M63 A;  2AHD A;  2WDE A;  3IVE A;  4G9J A;  2DFJ A;  5B8I A;  1MF8 A;  4FBK A;  2IE3 C;  3RL5 A;  3RQZ A;  2Q8U A;  4IYP C;  5C1V A;  1V73 A;  2QJC A;  4H2F A;  1JK7 A;  3DSC A;  3T1I A;  4UT2 A;  2ZBM A;  3IB7 A;  2P6B A;  3DW8 C;  1S3L A;  3ICF A;  4DSY A;  1UF3 A;  1QFC A;  3QFK A;  4JA7 A;  2WDC A;  2A22 A;  2IE4 C;  1Z2W A;  4HD0 A;  2O8G A;  3IVD A;  3H68 A;  4ZVZ A;  3EGG A;  2KKN A;  2HYP A;  4NZV A;  2BQ8 X;  4OR9 A;  2O8A A;  4ORA A;  3QFN A;  3H62 B;  3E7B A;  4Q7F A;  3EGH A;  4F0Z A;  4JA9 A;  4ZX2 A;  3QG5 C;  3TGH A;  3THN A;  4O43 A;  3H60 A;  3K7V C;  3H66 A;  2HY1 A;  1OIE A;  1XM7 A;  3GVE A;  1U32 A;  3JYF A;  1IT6 A;  1USH A;  2Z72 A;  3K7W C;  4WWL A;  1HPU A;  2CV9 A;  2GJU A;  3QFM A;  5JPE A;  4UWQ A;  2WDD A;  2R17 A;  3C5W C;  2QFR A;  3C9F A;  3E7A A;  4M0V A;  3P71 C;  1HO5 A;  2XMO A;  1WAR A;  1Z2X A;  4DHL A;  1XZW A;  3DSD A;  3ZTV A;  1FJM A;  4XPN A;  4B2O A;  2YVT A;  4LTY A;  3QFO A;  3ZU0 A;  2WDF A;  4H2I A;  2IAE C;  1W24 A;  4I5N C;  4O24 A;  4TUI A;  4IL1 A;  4H1Y P;  2NPP C;  4KBP A;  4ORB A;  2NYM C;  3H67 A;  4H2B A;  2BCD A;  1T70 A;  4V0W A;  1S70 A;  1T71 A;  3RL4 A;  2Z1A A;  4UT3 B;  1HP1 A;  3H69 A;  4LAC C;  3KBP A;  1UTE A;  4FBW A;  4YKE A;  3THO B;  2USH A;  5GTU A;  1OI8 A;  5EQV A;  4ORC A;  1KBP A;  3HVQ A;  4MP0 A;  4O4K A;  3N5U A;  3IB8 A;  4KKZ A;  5IOH A;  4UT3 A;  4H1S A;  5JPF A;  3AUZ A;  1II7 A;  2JOG A;  5F3W A;  4FBQ A;  4H2G A;  4TUG A;  4J6O A;  5J28 A;  2NYL C;  3H61 A;  2NXF A;  1WAO 1;  1AUI A;  3V4Y A;  3FGA C;  4LU9 A;  3AV0 A;  4O5G A;  3RL3 A;  2QFP A;  3H63 A;  1SU1 A;  1S8E A;  4I5L C;  1S95 A;  3LL8 A;  2HYO A;  1S3N A;  5JJT A;  4DT2 A;  2BDX A;  4MOV A;  3PSN A;  1NNW A;  2Z06 A;  4FCX A;  1TCO A;  4V0V A;  1G5B A;  4V0X A;  1OID A;  3CK2 A;  1QHW A;  5DNY A;  5HPE A;  3H64 A;  1S3M A;  4MOY A;  5INB A; 
#chains in the Genus database with same CATH topology
 3PSO A;  1M63 A;  2AHD A;  2WDE A;  3IVE A;  4G9J A;  2DFJ A;  5B8I A;  1MF8 A;  4FBK A;  2IE3 C;  3RL5 A;  3RQZ A;  2Q8U A;  4IYP C;  5C1V A;  1V73 A;  2QJC A;  4H2F A;  1JK7 A;  3DSC A;  3T1I A;  4UT2 A;  2ZBM A;  3IB7 A;  2P6B A;  3DW8 C;  1S3L A;  3ICF A;  4DSY A;  1UF3 A;  1QFC A;  3QFK A;  4JA7 A;  2WDC A;  2A22 A;  2IE4 C;  1Z2W A;  4HD0 A;  2O8G A;  3IVD A;  3H68 A;  4ZVZ A;  2ZOA A;  2KKN A;  3EGG A;  2HYP A;  4NZV A;  2BQ8 X;  4OR9 A;  2O8A A;  4ORA A;  3QFN A;  3H62 B;  3E7B A;  4Q7F A;  3EGH A;  4F0Z A;  4JA9 A;  4ZX2 A;  3QG5 C;  3TGH A;  3THN A;  4O43 A;  3H60 A;  3K7V C;  3H66 A;  2HY1 A;  1OIE A;  1XM7 A;  3GVE A;  1U32 A;  3D03 A;  3JYF A;  1IT6 A;  1USH A;  2Z72 A;  3K7W C;  4WWL A;  1HPU A;  2CV9 A;  2GJU A;  3QFM A;  5JPE A;  2DXL A;  4UWQ A;  2WDD A;  2R17 A;  3C5W C;  2QFR A;  3C9F A;  3E7A A;  4M0V A;  3P71 C;  1HO5 A;  2XMO A;  1WAR A;  1Z2X A;  4DHL A;  1XZW A;  3DSD A;  3ZTV A;  1FJM A;  4XPN A;  4B2O A;  2YVT A;  4LTY A;  3QFO A;  3ZU0 A;  2WDF A;  4H2I A;  2IAE C;  1W24 A;  4I5N C;  4O24 A;  4TUI A;  4IL1 A;  4H1Y P;  2NPP C;  4KBP A;  4ORB A;  2NYM C;  2ZO9 B;  3H67 A;  2BCD A;  1T70 A;  4H2B A;  4V0W A;  1S70 A;  1T71 A;  3RL4 A;  2Z1A A;  4UT3 B;  1HP1 A;  3H69 A;  4LAC C;  3KBP A;  1UTE A;  4FBW A;  4YKE A;  3THO B;  2USH A;  5GTU A;  1OI8 A;  5EQV A;  4ORC A;  1KBP A;  2DXN A;  3HVQ A;  4MP0 A;  3N5U A;  4O4K A;  3IB8 A;  4KKZ A;  5IOH A;  4UT3 A;  4H1S A;  5JPF A;  2YEQ A;  3AUZ A;  1II7 A;  2JOG A;  5F3W A;  3E0J A;  4FBQ A;  4H2G A;  4TUG A;  4J6O A;  5J28 A;  2NYL C;  3H61 A;  2NXF A;  1WAO 1;  1AUI A;  3V4Y A;  3FGA C;  3FLO A;  4LU9 A;  3AV0 A;  4O5G A;  3RL3 A;  2QFP A;  3H63 A;  1SU1 A;  1S8E A;  4I5L C;  1S95 A;  3LL8 A;  2HYO A;  1S3N A;  5JJT A;  4DT2 A;  2BDX A;  4MOV A;  3PSN A;  1NNW A;  2Z06 A;  4FCX A;  1TCO A;  4V0V A;  1G5B A;  4V0X A;  1OID A;  3CK2 A;  1QHW A;  5DNY A;  5HPE A;  3H64 A;  1S3M A;  4MOY A;  5INB A; 
#chains in the Genus database with same CATH homology
 3PSO A;  1M63 A;  2AHD A;  2WDE A;  3IVE A;  4G9J A;  2DFJ A;  5B8I A;  1MF8 A;  4FBK A;  2IE3 C;  3RL5 A;  3RQZ A;  2Q8U A;  4IYP C;  5C1V A;  1V73 A;  2QJC A;  4H2F A;  1JK7 A;  3DSC A;  3T1I A;  4UT2 A;  2ZBM A;  3IB7 A;  2P6B A;  3DW8 C;  1S3L A;  3ICF A;  4DSY A;  1UF3 A;  1QFC A;  3QFK A;  4JA7 A;  2WDC A;  2A22 A;  2IE4 C;  1Z2W A;  4HD0 A;  2O8G A;  3IVD A;  3H68 A;  4ZVZ A;  2ZOA A;  2KKN A;  3EGG A;  2HYP A;  4NZV A;  2BQ8 X;  4OR9 A;  2O8A A;  4ORA A;  3QFN A;  3H62 B;  3E7B A;  4Q7F A;  3EGH A;  4F0Z A;  4JA9 A;  4ZX2 A;  3QG5 C;  3TGH A;  3THN A;  4O43 A;  3H60 A;  3K7V C;  3H66 A;  2HY1 A;  1OIE A;  1XM7 A;  3GVE A;  1U32 A;  3D03 A;  3JYF A;  1IT6 A;  1USH A;  2Z72 A;  3K7W C;  4WWL A;  1HPU A;  2CV9 A;  2GJU A;  3QFM A;  5JPE A;  2DXL A;  4UWQ A;  2WDD A;  2R17 A;  3C5W C;  2QFR A;  3C9F A;  3E7A A;  4M0V A;  3P71 C;  1HO5 A;  2XMO A;  1WAR A;  1Z2X A;  4DHL A;  1XZW A;  3DSD A;  3ZTV A;  1FJM A;  4XPN A;  4B2O A;  2YVT A;  4LTY A;  3QFO A;  3ZU0 A;  2WDF A;  4H2I A;  2IAE C;  1W24 A;  4I5N C;  4O24 A;  4TUI A;  4IL1 A;  4H1Y P;  2NPP C;  4KBP A;  4ORB A;  2NYM C;  2ZO9 B;  3H67 A;  2BCD A;  1T70 A;  4H2B A;  4V0W A;  1S70 A;  1T71 A;  3RL4 A;  2Z1A A;  4UT3 B;  1HP1 A;  3H69 A;  4LAC C;  3KBP A;  1UTE A;  4FBW A;  4YKE A;  3THO B;  2USH A;  5GTU A;  1OI8 A;  5EQV A;  4ORC A;  1KBP A;  2DXN A;  3HVQ A;  4MP0 A;  3N5U A;  4O4K A;  3IB8 A;  4KKZ A;  5IOH A;  4UT3 A;  4H1S A;  5JPF A;  2YEQ A;  3AUZ A;  1II7 A;  2JOG A;  5F3W A;  3E0J A;  4FBQ A;  4H2G A;  4TUG A;  4J6O A;  5J28 A;  2NYL C;  3H61 A;  2NXF A;  1WAO 1;  1AUI A;  3V4Y A;  3FGA C;  3FLO A;  4LU9 A;  3AV0 A;  4O5G A;  3RL3 A;  2QFP A;  3H63 A;  1SU1 A;  1S8E A;  4I5L C;  1S95 A;  3LL8 A;  2HYO A;  1S3N A;  5JJT A;  4DT2 A;  2BDX A;  4MOV A;  3PSN A;  1NNW A;  2Z06 A;  4FCX A;  1TCO A;  4V0V A;  1G5B A;  4V0X A;  1OID A;  3CK2 A;  1QHW A;  5DNY A;  5HPE A;  3H64 A;  1S3M A;  4MOY A;  5INB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...