4MPPA

Crystal structure of benzoylformate decarboxylase mutant h281y/t377p/f397t/a460i
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
525
structure length
525
Chain Sequence
ASVHGTTYELLRRQGIDTVFGNPGSNELPFLKDFPEDFRYILALQEACVVGIADGYAQASRKPAFINLHSAAGTGNAMGALSNAWNSHSPLIVTAGQQTRAMIGVEALLTNVDAANLPRPLVKWSYEPASAAEVPHAMSRAIHMASMAPQGPVYLSVPYDDWDKDADPQSHHLFDRHVSSSVRLNDQDLDILVKALNSASNPAIVLGPDVDAANANADCVMLAERLKAPVWVAPSAPRCPFPTRHPCFRGLMPAGIAAISQLLEGHDVVLVIGAPVFRYYQYDPGQYLKPGTRLISVTCDPLEAARAPMGDAIVADIGAMASALANLVEESSRQLPTAAPEPAKVDQDAGRLHPETVFDTLNDMAPENAIYLNESPSTTAQMWQRLNMRNPGSYYTCAAGGLGFALPAAIGVQLAEPERQVIAVIGDGSANYSISALWTAAQYNIPTIFVIMNNGTYGILRWFAGVLEAENVPGLDVPGIDFRALAKGYGVQALKADNLEQLKGSLQEALSAKGPVLIEVSTVSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Benzoylformate decarboxylase
publication title A pseudo study of thiamin diphosphate-dependent decarboxylases
rcsb
source organism Pseudomonas putida
molecule tags Lyase
total genus 196
structure length 525
sequence length 525
ec nomenclature ec 4.1.1.7: Benzoylformate decarboxylase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mppA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mppA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4mppA02
2WVAA 1PNOA 5K3SA 1MA3A 1PI3A 1YBHA 2YICA 2C3YA 2G28A 2OZLA 4C78A 3ZG6A 4I5IA 1D4OA 3F6BX 1YTLA 2VK8A 2OORC 1EFVA 3D4BA 3HWWA 2PANA 1M2KA 3DVAA 3LQ1A 3PKIA 3D81A 5EJ7A 2H2GA 1U5BA 1WCIB 1NM5C 3AHGA 4GPEA 1X7XA 2EZ9A 1X7XB 3GLSA 4JUFA 4K9NA 1OLXA 2OD9A 1YI1A 2Q29A 5MGNA 3CF4G 2BFEB 5FYQA 2C3OA 1V1MA 2BFDA 3DV0A 4UTVA 4KXQA 3DV0B 4K9OA 4BV3A 3DUFB 2BEUA 5EJ6A 3EXHC 1S5PA 5AHKA 1PVDA 3GLUA 4BUZA 5I51A 2G25A 4UU7A 3L84A 1U2DC 4UU8A 5EJ8A 2VK4A 4BVBA 2Q28A 3IAEA 1V16A 3OE1A 4J16C 3ZGVA 2R5NA 3M49A 3EXEB 5BWOA 4RJKA 2A1TR 5MF6A 2VJYA 2QQGA 2JI6A 4BN4A 2Q5OA 4BVEA 3FZNA 1TKCA 2OO5C 4KXWA 4RJIA 4GM0A 2FSVC 4C7VA 1UM9A 3GLTA 4GG1A 2X7JA 2YIDA 1OLUA 2H4JA 1W85A 3AHDA 4ZP1A 2NYRA 1M2JA 5EJMA 3EYAA 5K6TA 1U31A 1S7GA 4C7BA 5ERYA 5D7NA 1PTJC 2G67A 4X3PA 3LPLA 4G1CA 2BFFB 4Y6LA 1QS0A 4BVHA 1W88A 3EXIB 1QS0B 3AHFA 2BEWB 5DEIA 3F6EX 2BEVA 2AG1A 3D7KA 4HDAA 4GM4A 4KXXA 2IHTA 2WVGA 4COKA 3UK1A 3E9YA 1T9CA 4MPJA 3KOMA 1QPBA 1UMCA 4BVGA 5K6RA 5DGTA 1N0HA 5FEMA 1Q17A 4F56A 1B0PA 1UMDB 2C3PA 4RMHA 4FVTA 1ITZA 1TRKA 1V5FA 2BFCB 2H59A 1X7YA 5HYVA 1X7YB 1DTWA 1Z8NA 3ZHUA 3M7IA 1SZCA 1DTWB 4F4UA 1T9AA 2VBIA 1YC5A 4MZXA 1M2GA 1OZFA 4GM1A 4O8ZA 2Y0PA 4BV2A 4JU8A 1L8AA 3RIMA 1V11B 2IEAA 5EJ4A 1WCIA 3PKJA 2JGDB 5HGXA 2FRDC 1POXA 2Q5JA 2PGNA 2O1SA 2AG0A 1UPAA 1T9DA 2J9FB 3RIYA 1V5GA 2H4HA 2QTAA 2BFEA 2EZTA 1OLSB 2H4FA 1AY0A 1V5EA 3ZHRA 3JWPA 3DUFA 4QELA 2H2HA 5I5EA 5I5GA 1R9JA 4X3OA 5DGDA 1BFDA 3U31A 4XEUA 4C7XA 2JLCA 2VBGA 1SZDA 4V1CI 3PDHA 1M2HA 2R8PA 2EZUA 3RIGA 1J8FA 1NI4B 4KPUA 3EXEA 2VK1A 1UPCA 2FR8C 2EZ8A 4FEGA 5ESDA 1HZZC 2B4YA 4K9KA 1YNOA 4JD5A 5I4IA 3FLMA 2WVHA 2HJHA 1YHZA 4GP9A 3M6LA 4RMIA 4UTXA 1QGDA 3HYLA 3EXG2 4FZ3A 4RMGA 3EY9A 1Y9DA 1U2GC 4D5EA 1V1RB 1OZGA 3GLRA 4R8MA 5EXDA 4Y6QA 5EJAA 2BFFA 3CLUD 3LQ4A 3EXIA 3JR3A 4KXUA 2BEWA 2FN3A 3ZHSA 2JIBA 2O1XA 3CLTD 2C31A 4Y6OA 3EXHB 1XLTC 4TWJA 3EXG1 3M34A 3MOSA 2NXWA 1TKBA 5EJ9A 4ZZIA 1UMBB 1UMDA 5ERXA 3U3DA 4MPPA 2BFCA 4V1CB 2JLAA 4JUAA 5EJ5A 4JT9A 5HHTA 4KXVA 1EFPA 5MFPA 5BWLA 2H2DA 3ZHVA 2IHVA 3CLRD 1PYDA 3EXFB 3ZHTA 2BRUC 3IAFA 1GPUA 4K9MA 1V11A 4IG9A 2Q27A 2JGDA 4L3OA 1M2NA 1IK6A 2H2IA 4K9PA 4JUDX 3OOYA 3EA4A 2JI7A 5EXEA 2JI9A 3LQ2A 2OZLB 2J9FA 2Q5QA 1OVMA 2EZ4A 1MCZA 4JUBA 4TWIA 5K2OA 1OLSA 1POWA 1DJLA 1RP7A 1X7WA 2Q5LA 4IF6A 4QPZA 4FEEA 1X7WB 2W93A 3DVAB 4JUCA 2XTAA 4UUBA 2QTCA 4L2IA 2FWNA 1U5BB 2XT9A 2BP7A 3AHJA 2BP7B 3CLSD 3AHCA 1PO7A 5IMSA 4HD8A 1OLXB 2OD2A 3FSJX 1U28C 5HJEA 1NI4A 1V1MB 2UZAA 4RMJA 2BFDB 1KEKA 1T9BA 1NGSA 4IAOA 2A1UA 4J1TC 2H2FA 2BEUB 4MQ5A 5MFZA 1PNQA 4KGDA 4JT8A 1Q6ZA 2V3WA 4D5GA 2DJIA 4UTNA 5C4IA 2E6KA 1YI0A 5BWNA 1YC2A 1V16B 4WBXC 1V1RA 1X80A 3AHIA 1X80B 4QQ8A 3AHEA 2R8OA 2XT6A 2IHUA 2UZ1A 3ZHQA 4Q9DA 4JSRA 2UZ1B 4K9LA 1OZHA 1UM9B 1O97D 4BVFA 2JI8A 1Q14A 1OLUB 1O96B 3EXHA 3ZGOA 1W85B 1YD7A 2PGOA 3UPTA 3AI7A 3HWX1 1TKAA 1ICIA 3K35A 2PDAA 4KXYA 1UMBA 1ZPDA 3AHHA 1W88B 1JSCA 1YHYA 4JU9A 4UUAA 2BFBA 4V1CA 2BFBB 2C42A 2BEVB 4MPRA 4BN5A 2VBFA 1UPBA 2C3UA 2QQFA 4K9QA 1E3TA 4RJJA 1X7ZA 2OD7A 2C3MA 3EXFA 1X7ZB 4UTZA 1PT9A 1UMCB 1Q1AA 4UTRA
chains in the Genus database with same CATH superfamily
3IVRA 4N65A 1Z08A 3SDBA 1R5NA 3HY3A 1TM7E 2GEBA 2W2LD 4QHTA 5LP6A 1M75A 1J2UA 2QTMA 4JJZA 3FOZA 2IUSA 3EDYA 4HWRA 1WF6A 2EATA 5CH5A 1EDBA 4DLRA 4QYTA 2P35A 1PSWA 2V5VA 4C78A 4MR9B 1K1EA 4M6WB 1URPA 1B1AA 4JMLA 2JZNA 5CIQA 3OQBA 3PSHA 4B40A 1DJPA 5HMLA 3O8RA 3DVAA 4XRGA 1QP0A 4YASA 1UJ6A 5C3MA 2BKUA 2IU6A 5JW6A 5LDHA 2WU0A 1DCKA 1DKOA 3N6XA 2MJLA 3LRXA 1XROA 4TTJA 1B6TA 5CXUA 2JAPA 1HH4A 1MX1A 2R7AA 4BLQA 4V39A 4Y98A 3L1HA 3VV3A 4C07A 5K0EA 1DMSA 1VKZA 4HEHA 1DQPA 1O6CA 3K9FC 3ANTA 3I09A 4M88A 1ZKMA 2NZUG 5IFKA 2JGAA 4OMUA 5FA6A 3UJ9A 2C97A 1Z73A 2W90A 3OH8A 2H8KA 3S1AA 3G0GA 2E37A 3ZWWA 1LW6E 5IC4A 1BMDA 1UOEA 2B6HA 2ZB3A 3ZIDA 4ZC8A 5HQTA 4CIAA 3U7IA 1IQ0A 1O87A 4A8PA 3NPMA 4IGKA 4QGFA 3IS3A 4K9OA 1Z6GA 1FU4A 2ON6A 3Q7SA 5JFOA 1HR0B 4OXIA 1R8SA 4L4RA 1IRIA 1EHIA 3MZ0A 1I2MA 1AS2A 2CVOA 4RHTA 4V0ME 3UCEA 4ME6A 1F60A 2I0FA 3L4BA 4IIJA 1UFRA 1P1JA 3LDAA 3C3DA 2WZQA 3FCEA 4KE7A 4ZFNA 1ZINA 1OXBB 4MARA 5ALXA 4AX4A 3UWKA 3BDVA 1UZUA 1PVDA 2QG4A 3HSKA 1Y7PA 3WDMA 4PZUA 1DIAA 5JADA 4YJ3F 3TJMA 5CA1A 4EQ6B 1LPPA 1NHGA 1BQ4A 2WJHA 2R1VB 1HKHA 5EJGA 2W2KB 2OE2A 4MGKR 3ROPA 4PXAA 3HYCA 1Y4DE 2XUFA 5HNKA 3N0TA 1SG6A 2RE8A 2FP4A 4J3FA 4KOEC 3CLKA 3PVCA 1LCIA 4ZU3A 4LISA 1OH6A 1F12A 4EVQA 1AHNA 1XZEA 1ZA2A 2WTXA 5BWOA 1Q0LA 4D4HA 2X4DA 4EO4A 3OFNA 4JA0A 1T26A 1P33A 3E61A 3I8OA 2XNSA 3N0RA 3NHJA 4MNTA 4WRRA 4MHOA 3DFZA 3CUTA 2B7LA 3H84A 4IXDA 1P1BA 4QXPA 1OWNA 1QO9A 1TKCA 2J3IA 4ZWNA 1C7JA 5AQEA 1RYDA 4OO3A 4XIGS 5DGHA 1BVYF 2ZPUA 1QYRA 4KYVA 2X2EA 2ZS8A 3ILXA 2X7JA 4A1FA 3NTRA 1CIPA 2P0YA 3D8HA 2HQBA 1OLUA 2J07A 3DCIA 3KSMA 1FQWA 1B2RA 2XVZA 4NHOA 4CU5A 3HFRA 4TTVA 2R5WA 2AXQA 1O03A 3K7EA 4M7PA 4YAKA 4B73A 1EUDA 4LK2A 4UZFA 3MMPA 4AP9A 2A0UA 1Y8QA 3VV2A 5KTKA 1U7TA 5GQSA 2W43A 4JI3B 3NH9A 4DC9A 2ZIEA 2AI2A 3RK4A 1S7GA 1VPEA 3I04M 5KSWB 5L6MB 3DDCA 1JYFA 1PTJC 1QAMA 4PRYA 1AKQA 4CM8A 4E5YA 3OJFA 4YWJA 3PJFA 3ZDXB 2ZJ6A 5A5GA 4ZALA 3TR0A 2W2TA 4G81A 3WMGA 2EKZA 4E21A 2AJ8A 2GOYA 3I0MA 3K1AB 4QJ4A 1CEYA 1XVAA 2AG1A 2PX6A 3NHWA 3MOGA 1VIMA 4BX0A 3A6KA 1XDSA 3LYLA 4QRDA 2I2AA 3ZHYA 5K03A 1MO4A 1Q1QA 4J4TA 3LQQA 3RS9A 1RJ9A 3IIJA 1FPMA 1Z4LA 1WM1A 3PC8A 4QXAA 3B6JA 1B8NA 1NFQA 1UMCA 2Z0MA 4RXTA 4CM7A 3A4VA 1N77A 4U7PB 3COVA 5JYEA 1QG4A 3A6EA 5F3RA 2J5XA 3RSGA 4JYBA 3IMFA 3IP6A 4MGEA 1Q17A 1YRBA 4LTNA 1EM8A 5KMGA 1QRAA 3M1IA 4ZGBA 3I5XA 3VPXA 3HUUA 1D1TA 2ZYUX 1EPUA 3GT4A 1YDEA 1VJ0A 2PD6A 2H59A 4WVFA 1OI4A 5DTJA 1KWKA 2O3UA 1BJTA 5C8DA 1T8YA 2GN1A 2CNDA 3QEMA 1W2HA 5BNIA 3WKCA 1MC8A 3R0ZA 5KAPA 4MUXA 2PLFA 2W8BB 5FAKA 4PXYA 2CXQA 3M6FA 4FYXA 1E0DA 4LY9A 3TW0A 5IT5A 3HV2A 4XPZA 1VIDA 4JYCA 3EDOA 3L93A 1QK3A 3LCJA 5D6NA 4H35A 4WACA 2FX3A 4C21A 1ND6A 3IPCA 3FUTA 4MUFA 4NYJQ 2IEAA 1DEXA 3IKLA 5G1OA 3ASUA 5CX1A 3NOVA 5CA0A 1M2VA 2WAOA 1RRMA 5HGXA 3WIBA 1H42A 4BIIA 1N6OA 2YH2A 1GCOA 4Z3DA 1CR4A 3C6ZA 1HOXA 3JZMA 3MYYA 1P91A 3VH2A 3EH2A 4ZCLA 1KOGA 1K5PA 3AI3A 3QW4B 1PR2A 1LVUA 2QMYA 2GEJA 4L7VA 4BMVA 3AY3A 4P54A 1VBNA 4DV6B 2B20A 2HRZA 5E2AA 1SUPA 2FZ5A 4EYKA 1K4KA 1NU6A 4BQNA 3HVUA 1Z6AA 2WQ7A 2ZRDA 5DXFA 1KS9A 3R3ZA 4OU4A 3GA5A 2WTAA 4RWEA 2DHDA 2AFHA 4Y1RB 1Z45A 2GN0A 2OLKA 2V6FA 1YOVA 2VYQA 3C5WP 3I9KA 4I19A 4HN4B 4R1UA 2COEA 3BIFA 1H3NA 2LTAA 2XB2A 2D1SA 4UREA 3NKFA 5I5GA 1DRJA 3G0CA 1NPYA 3P0HA 4QFBA 3I01M 4JLMA 3P0RA 2WW8A 3L0IB 4XFJA 2OUKA 1TQ2A 3SX2A 2GBIA 1K6IA 1NBMA 1NMQA 4DIUA 2X76A 4QFMA 3TFOA 2GN9A 2BRUA 4PYIA 4F97A 4Q9HA 1CJMA 2PGDA 2FZVA 1V7ZA 3LV8A 4YRZA 1YSCA 1DKLA 1NJ6A 2JH9A 1RC0A 2PLAA 5GMOA 1NBEA 4EELA 5BN4A 2IUYA 1QZUA 1JFSA 4DE5A 1A04A 1N2JA 1R6VA 3CJTA 3HFGA 2GWHA 1YS2X 2B4TO 3K15A 1RMTA 4NHEA 5JS8A 1ZNWA 4TQGA 1GTRA 1DO2A 3KE9A 2PH3A 3BMQB 3WA6A 4WLEA 5LC1A 4R9VA 3UKJA 2QTTA 1RYZA 3C24A 5AKKA 4B8ZA 2XNKA 4NYJR 5C53B 1US8B 2ZBGA 3IV7A 1GPKA 1M83A 4QYIA 4RH0A 2QSUA 2B5WA 3SN6A 2R6DA 4BX3A 3RSLA 3KQOA 3BRWD 1Q5PA 4HTAA 1EUCB 2IX9A 2QY6A 3KDPA 4NWIA 4PR0A 3ZWXA 4DYVA 3T3MB 2NZXA 2XNDA 3QKRB 5EN4A 1AJEA 4E3WA 2YMPA 3WGUA 1ZRSA 1JU9A 1XDDA 3JZDA 1ZONA 4FYYA 1HLPA 4XI9A 4DIBA 2LRHA 3B2EA 1HYBA 1Y9DA 5KTRA 1N5KA 3S2ZA 4TYNA 1J2JA 3BGVA 5CAEA 3EIQA 4F12A 5BT8A 3SYRA 2J0EA 2I55A 2RKOA 2K7ZA 5F23A 1R9NA 1N4DA 4Q1FA 2H6EA 2VNJA 1IPHA 4PTYA 1JDPA 4G23A 3ILVA 3MFQA 4QDTA 3AKEA 4S2EA 3T5BA 1MC1A 2IPNA 1X1TA 3EXIA 4IRUB 2DR0A 4MUMA 1DBSA 3QKSB 4R0NA 1V2GA 5FUVA 3T9FA 2QUJA 2EARA 3LK7A 1A1SA 2O1XA 3DKKA 5HBGA 4EA8A 1PVVA 3M6UA 4MVJE 1NLYA 2YCLA 4TSFD 1HXHA 4V0QA 2JCSA 1JEQB 3OZVA 4TV9F 1R37A 1DRVA 2HAEA 1IATA 4GZ3A 2JJ8A 4RJ2A 1DV2A 4L6CA 5K0CA 4H6VA 3M34A 1FYEA 1EXVA 1A27A 3OEHA 3L8DA 1UAGA 1JB9A 1OJLA 4EECA 5FBKA 1GZHB 1NBME 3ASZA 1KRXA 4DN6A 4I66A 3QVJA 4LYFA 3PHJA 4X8OA 2ZT7A 4G5OA 2JJQA 4ZQHA 4HDSB 4TQUS 2E4ZA 3GI1A 5T4EA 3DEYX 1EFTA 1K6XA 4JUAA 1XQ9A 3FXAA 5TVKA 1FVXA 2OCDA 3D6HA 2CZQA 4A9AA 1RZUA 3STTA 2W71A 4LYAA 3SZRA 4FE3A 4R98A 3VKWA 3BPSA 4E13A 2C5HA 5CBPB 1JA0A 3TF5A 4C2UA 1WW8A 1MRSA 4GT1A 4HWOA 2FW7A 2V4MA 3LXUX 5JECA 3QYFA 1VL0A 5IXYA 1REQB 1T2NA 1ZI8A 3BSSA 3R1IA 2QY9A 1Z5GA 4I0WB 4XLZA 5FOTA 4MV6A 4NDAA 5TQ0B 1N6LA 3C7DB 3W8FA 3KQSA 4UDXX 3LFTA 3EWNA 2Z2KA 4LDQA 3TOXA 4ZZ3A 2P1DA 1ZM3A 4ZO4A 4UQOA 3K1ZA 2EFEB 4NEQA 5EIXA 1NNI1 1MX5A 1ESNA 2H1WA 3CUYA 2XVYA 4FUQA 4QXMA 5EIEA 4CEJB 2ZIZA 4HPWA 4RPCA 5B4VA 4XJXA 1DUVG 3OOYA 2CYAA 3MN1A 1AGNA 3PC4A 2DWOA 3JSXA 3LLCA 2J9FA 3A6GA 3EZNA 4NBNA 4RMNA 1UJ4A 3SZLA 4EGSA 4GLJA 4DV3B 2C1XA 2QGFA 1N5IA 1ZC3A 5DMHA 3D3QA 3AZPA 2MDTA 3GNTA 5SY6A 4G24A 4XFKA 3SGLA 4YP7A 3P26A 4GMHA 1GTG1 4U7GA 2LXNA 5KWIA 3M70A 3ADDA 1YHNA 1NWCA 1YFJA 4R9UC 4KU4A 2Y3IA 4W5HA 4DUGD 3R9XA 5TQVA 2Q4DA 2YN4A 3DE1X 3T3EA 2OOSA 5D3MA 2NO4A 1G2OA 3OX1A 1II9A 4O5OA 3VPHA 3FR7A 3NTQA 4NJMB 3VNBA 1CDOA 3WJ2A 3PNQA 3Q5GA 2GASA 4M9XA 1S3FA 3GGJA 4ND3A 1KMMA 3T4UA 4MH0R 1KDYA 1JUDA 5C51B 1KOFA 5GVRA 2XTJA 2M1ZA 5BPHA 1LDNA 3QE4A 4IMJB 1GGNA 1NJ8A 3EODA 4PVDA 4EL0A 5A62A 4HVTA 1EHYA 2DPLA 1E69A 4WQMA 1G5RA 4A6XA 1SD5A 5T3YA 5TXGA 3E2MA 4OJQA 2CB9A 4V0KA 1Z37A 4CMGA 3DS8A 1MORA 2BHLA 2Q1XA 1XF9A 3AF0A 2Z56A 2Y2UA 2Z58A 3GROA 5EMJA 1KR5A 3RR2A 3W9SA 2A0FA 4PO3X 2VHEA 5K2MA 4CG1A 3X0DA 1QWOA 5FB3A 4RDHA 2DJIA 3CLSC 4LE0A 5ITZA 1QH1A 3HEAA 4TPKA 1BH2A 3Q41A 1K7XB 2G83A 3EEIA 3OHPA 5FA8A 3LUCA 2XQFA 2FEXA 2R6FA 2W98A 4JI6B 4J94A 3KJEA 1WZUA 3A26A 1JFTA 4FT2A 4RPKA 4PG5A 4E12A 1RQ2A 1U8CB 3TBFA 3SICE 3GGOA 3ZCQA 2ACVA 2FPIB 3OIGA 1X80B 8LDHA 5A5DA 1ZIXA 1Z6XA 4D43A 3SQWA 3HO1A 1GD1O 1JQEA 3TI7A 1G20A 3P9IA 2YFQA 4FW8A 4MYSA 1FMTA 3K3PA 3B6IA 1O0CA 4NOJA 5E6UB 1B23P 3CW8X 3ZHQA 1N0VC 3GMDA 5BYJA 1I0IA 4QSMA 1XKLA 1KY2A 3NATA 2C9CA 3JVEA 3FBGA 2IHBA 4JFRA 2PJDA 4MP8A 1SQ6A 4X84A 3THRA 4C89A 4W5TA 4NCAA 5F12A 4OD0A 1T25A 2YVUA 2AQKA 4M55A 4CM5A 1O96B 1T5LA 1EVKA 2ZTHA 3B48A 3SJAA 4YMHA 2BFWA 3HJGA 4M22A 5IHPA 1SBNE 3OZBA 4QAQA 4UDOA 4B35A 5EINA 2P91A 1W0KA 2R0QC 1FPQA 1K9VF 4RHYA 1EGMB 3ZNPA 1GPYA 3TM4A 2VZ9A 1G41A 3H4TA 4WOKA 4P5EA 3EVAA 5HJ7A 4XLLA 5IYZA 2VPXA 3CEPB 1N9KA 4QD3A 4UVGA 1YQUA 5CT5A 5EPEA 5C8ZA 4DLKA 1RHUA 3OZ7A 1NASA 3TXAA 2CLEB 1DU4A 5BRAA 1HYHA 1QFYA 3TO5A 5JY1A 3U4GA 4B74A 3SC4A 2RGRA 4HGQA 4MWTA 1JDBC 4FYVA 3LWNA 2REXB 4UFPA 3DR3A 5CCEA 1GNTA 2P79A 5CW2A 2FN4A 4ARSA 4M9ZA 4D92A 2D7CA 4KIGA 2PH1A 4Z99A 1SUCA 3DB2A 2X86A 3PUHA 4DILA 2DQZA 1EFLA 1ZOLA 4JT2A 1V37A 3NDIA 4BNWA 4YMSA 4ZRDA 5F3DA 4HTFB 3MT0A 1YBHA 2EDCA 4PYQA 3QFSA 5EGNA 2ZWOA 5KSOA 1B15A 1LV8A 2P67A 4FR5A 2JFBA 4AJ1A 5AK6A 4KR7A 3ZG6A 2H1FA 1KKLA 2EL9A 5JANA 2EC5A 4HDMB 1TEXA 2JEYA 2QUHA 3SIPA 5CDGA 4POAA 3D8BA 1Y6FA 4NCBA 5IBRA 2I4IA 1EVYA 3KBBA 1OASA 4IX9A 2ODWA 4Y3UA 2ZRQA 4H7DA 5A5EA 3CVUA 4HNRA 1O6BA 5KEIA 2D2EA 3SX4A 3Q3VA 1G2IA 3L4SO 1Z0DA 1W8IA 3NT4A 2NYAA 3S68A 1EJ0A 3O4HA 3DTVD 2WRZA 4NOKA 3D9QX 4RZSA 5K7SA 2P30A 4FHCA 4CIYA 1R8YA 3IJPA 4Z9YA 1PQ4A 5FQNA 4GZLA 4P3PA 1P45A 1RBZA 2XGGA 2XB6A 3N2KA 2C88A 3NDJA 3S3TA 3UG6A 1JS1X 3CF4G 4M0MA 3ORQA 5DNEA 5BN5A 4P0PB 1VMIA 4OYRA 1KP2A 2W6ZA 1TU4A 1UBGA 4YMTA 3EHEA 4N8SA 4IH4A 4JYPA 5AHRA 3D1VA 3D5QA 4RX1A 1SU8A 4J75A 4DLPA 1W581 2IEYA 3DUFB 4X41A 4ND1A 3GFPA 4KKVA 3VHXA 1XHLA 1B8OA 4HH3C 5CCDA 5IZCC 3WLEA 3JVVA 3V4FA 4ALNA 1SVUA 2O2YA 3IP5A 3U7JA 4GUDA 5ICMA 5I51A 4X1KB 4AICA 2LIPA 1RP1A 1F0KA 2R00C 4NDZA 5T6MA 3DZKA 3HR4A 3N2YA 4UU8A 3OCZA 2R1ZA 4RTRA 5E9QA 3F5FA 3DBRA 2O0JA 3U7QA 3AP2A 5KHLB 3JAMA 2Q28A 3FETA 3OE5A 3P27A 5DNAA 5IJ9B 3T5TA 4R1QA 2FMXA 3KQWA 4KHZA 4MPTA 2RHOA 1RRFA 4URVR 3I58A 1DLJA 3UAGA 1WL8A 3IMGA 4HAYA 3V4LA 3WK5A 2ALJA 2F48A 5KINB 2E0IA 1O89A 2VDLB 3RTGA 1KL7A 3DDWA 3GLHE 2X5KO 5P8WA 4ZODA 3P19A 2WWWA 2YVKA 1GA6A 3SF8A 3MWDA 4OQEA 1A9XB 1HURA 1W1UA 3BE8A 3G7SA 2IBSA 1D9ZA 1ZVMA 5B3AA 1F06A 2CWDA 2X14A 2NADA 1CQPA 3QRWA 2XWQA 4ZZ1A 4BATA 4X66B 3GJSA 4CKEA 1SXGA 3AM1A 2E4AA 3LM8A 2ZXEA 1Q7EA 3UW3A 5DM0A 1T3GA 1YDMA 1D4AA 3PC3A 1HDIA 4MQEA 3P32A 3NHRA 4YHBA 2XZDA 5CITA 2G07A 5CFQA 4Q16A 2Z8YA 2AK3A 3ABQB 3ZY2A 3PFHA 1PLKA 2JLYA 1QQBA 1M6YA 1XDUA 2NPIA 3U80A 1T4GA 3RLFA 4BB5A 3LPLA 1JDTA 2AXNA 2RGUA 3UXYA 2X7HA 4M1SA 3HKBA 4INAA 3DWEX 2CXPA 3ANLA 3HTXA 4LX8A 5BW5A 3U44B 1CR6A 1RXIA 3SYLA 3QNMA 1O8BA 1UEIA 2C5SA 3DOCA 3C3AA 3FGNA 5DT9A 5T3UA 2DUMA 1R6DA 3H4IA 3IQHX 1BKYA 3FUVA 4I6EA 4CLRB 2QRHA 4O2AA 1PG0A 1ZVQA 3GPCA 1Y4ZA 3C8MA 2VWGA 3ZE6A 3EGDB 3WGQA 4JJ8A 4G85A 4L51A 3U7EB 1XMIA 1RHKA 5E95A 3RRFA 2GM4A 1UC8A 1XTVA 3VJRA 1YQTA 2CWWA 3N05A 3NNNA 5F78A 1R9MA 4RLHA 5AW9A 2AOTA 5K8TA 4NONA 2EGHA 1FRQA 4QJBA 4XEHA 4A2CA 4F56A 5HMMA 5AYVA 1UMDB 1W30A 3UJNA 5CHYA 2C3PA 2YNMA 2VDMB 2X23A 3WTCA 5KVCA 1DARA 3PQFA 4NCHA 4EHFA 3I3OA 2E6UX 1XP8A 4FDMA 4DJDC 4MI3A 2BM1A 4F1JA 5DASA 1CRWG 5IP5A 3ZQUA 5HYVA 1A9OA 5CLGA 5KYNA 4B8YA 1QGED 1K68A 1XVTA 3DE2X 4ETWA 1EVQA 4YYEA 2A86A 5J5VA 4AO7A 3CE9A 4P82A 3RTEA 1HZJA 1L1RA 1ZQ1A 2JBAB 4FILA 1FFYA 4IYRA 2ST1A 4MW1A 3K53A 1L5HA 3OFJA 3WV5A 1I1OA 2FGJA 4CL0A 1E2HA 4R54A 1LRLA 3FZYA 4ZC1A 1GL3A 2IU3A 2OECA 2RHHA 3FH0A 3K16A 1R4AA 7ADHA 2FW1A 1R64A 4K1LA 3LQKA 3Q88A 2HZBA 1ZK3A 4AB1A 4GOMD 1ZN8A 1EIWA 2QEQA 5DLQC 3S7ZA 2X4IA 3ZDDA 1PG5A 5KSPA 3BXHA 3C6MA 3OE7A 2WYOA 5DN9A 4Q93A 3UW1A 1YVRA 4MROA 1KI9A 2F67A 1XMPA 2A1TS 4FK8A 2VT7A 5I4CA 3VGJA 3FCOA 1O94D 2OYSA 4FOPA 4B3HA 3QTLA 4RELA 1UBUS 2IXEA 3VC2A 4PN3A 1EWTA 4OP3A 4QHYA 5DI3B 2CUKA 4C5AA 5A4MS 1A95A 2JHPA 2R7NA 2J0UB 4FX2A 4EJMA 1RS0A 3SD7A 2PGJA 1JSRA 4TN5A 1ZUWA 4RESA 1ESEA 2NO5A 5E0KB 4RTSA 2EKQA 4KMMA 1OOEA 1JXQA 1P8JA 3T5GA 1P8AA 2ZJZA 4DQXA 2FPPB 3VKFA 3H17A 5EIBC 3JARB 4RFSB 1L7QA 5LYJF 3DZDA 1Z63A 1FNSA 1IPEA 3C5EA 1Z2DA 2H0AA 2FWAA 4YT8A 3SKYA 2C2OA 5DCLA 1RYFA 4G56A 3GK3A 4U5QA 1P5ZB 4AJKA 4EP1A 4F9EA 1P77A 1G1AA 2W2PA 2JJ2D 5ALYA 2PKCA 3AKZA 3CVXA 4QUGA 3E15A 4RV9A 3CX6A 4IWXA 3KEGA 1VFNA 3QNWA 3GLIA 1CF9A 1ZOPA 5K0SA 1QIJA 3H97A 3Q11A 4AYXA 4MA4A 1CUWA 2PUVA 2EGGA 3KQKA 1DIBA 4LZZA 4Q1DA 2YHUA 3GP3A 1OHHD 2VK1A 1UPCA 5EPUA 3GMIA 2C9BA 4R5HA 3MUNA 1IOVA 2EYQA 1TCCA 3A14A 4JZKA 4CT4B 2NP6A 1TC2A 3G2LA 3JQFC 4BZXA 3B2NA 2QMHA 1JIXA 3F78A 4UUPA 4PYKA 5H83A 2NWQA 2OCGA 2QE6A 1BS1A 4Z4HA 1OI3A 4O4JB 2AH5A 1V3TA 3NUZA 5JH7B 2NQTA 3AVXA 3MHTA 1E6KA 2C20A 4E07A 1Z17A 1CPYA 4G41A 4B33A 4RVSA 4ZYVA 1U2EA 5HA5A 3CR3C 1JFVA 1HORA 2GCIA 1A2QA 3HUDA 1N36B 3VPSA 1L7XA 1U7UA 2JBWA 2D5CA 5I9TA 2YQ4A 1H9AA 3DOEA 3JVUA 4PAQA 4NAVA 3VR3D 2ZE5A 4CMIB 1N25A 4AK9A 4P36A 2ZB8A 2MTBA 2YWGA 4JLWA 3BH0A 2FZLA 4PLTA 5EFOA 4JS0A 1XRPA 4IY1A 2FN3A 4FKBA 6AT1A 1RCUA 2ERXA 3HACA 1G3QA 5EKSA 4CETA 2HI0A 4CNBA 4HEJA 2XZTA 4PINA 3T7IA 4AT1A 2B9VA 2UAGA 4FC7A 4XX1A 3W8DA 4WOBA 4PQRA 2QBYA 2Q3BA 4YVFA 4C0XA 1XZNA 2G63A 2VH5R 4DUGA 3ZNQA 2BIFA 3HP7A 4MTCA 3GFFA 1R15A 4GVLA 4QJIA 1QAOA 1PJCA 1IUNA 1IEQA 3IDFA 4XUGB 3PQEA 3TVTA 4IDHA 2J3KA 2PZJA 3AO0B 3SBEA 4KG7A 4KAJA 1O9GA 4FI3C 1O3YA 2OBMA 3E03A 4KN8A 5EVJA 4RVNA 1J23A 1ZM9A 2ZTMA 1NBOA 1O7JA 4J4HA 1QHSA 4AY2A 2XH8A 4OA5A 3KUKA 2WKRA 1GG8A 2JASA 5AI0A 2YV1A 3TQOA 4E2ZA 3CS3A 1DB3A 1GUDA 3W6NA 4OMDA 3A32A 2WMYA 3S29A 2GK4A 1QJCA 5D2CA 3UJ8A 2Y9PB 3ZBPA 1EXMA 3RBVA 4DCSA 5IF3A 1A77A 3GLIE 4IOLA 4EB6A 4JXZA 4IQ4A 2ZAGA 4BMYA 2G1KA 1U8FO 4UCXA 1IN5A 5BWLA 3GRVA 4KCGA 4N18A 4QC2A 4UTVA 2JK0A 1U0TA 3MS7A 5CRIA 1ZNQO 1ZWKA 5DIFA 2FEOA 4NZPA 4PFKA 2R6GA 3TPCA 4DDWA 2PQ6A 5KQMA 4AMBA 3FLBA 1O77A 2WF6A 1I51A 4JUIA 4U6QA 5C8YA 3USZA 2JGDA 2FFRA 4N8EA 2HU8A 3MNFA 2RD2A 4HNTA 2CE7A 5EWJA 3THYB 3NWEA 4P4UA 1L4MA 2XMQA 4OB8A 2G1PA 1XTQA 5KHAA 5T4HA 4W7HA 4OXQA 2DSTA 2NO6A 4TKVB 5SV2A 3KR1A 2GLTA 3VO2A 4CGZA 5AW0A 2R97A 3EEQA 2YWDA 3A28A 1V25A 4MWGA 1VYUA 3RFVA 3CZRA 4W8HA 1WA5A 1GQOA 2JIRA 5K0FA 3CPEA 3I8SA 4YP6A 2VJAA 4RWZA 4PY2A 4N0MA 3SBDA 2VAMA 4CV0A 5CFRA 1T8TA 5BVHB 3V8PA 1RJFA 3D4IA 4IIVA 5TF4A 3AR9A 4QASA 2VHXA 4AMZA 1HFWA 2JLQA 2V96A 2VZ8A 3M83A 4EA6A 5FI3A 1XZIA 2PXAA 3PXEA 4MA5A 3H6HA 2R48A 2WIJA 3STVA 3SVZA 3AEUB 1MZVA 3VO9A 2QRVB 3I5UA 5FO0A 4KR6A 1VLVA 2BMFA 3PNMA 1FDUA 3LUGA 1QQ7A 1RZRD 1Q0TA 3U60B 2YW9A 2V8BA 3AXSA 3PA8A 5DNVA 3MRTA 1M76A 2V7PA 4LTMA 1NDUA 4RMJA 1M8FA 2R8RA 1FFDA 4HNSA 3OICA 1AM4D 1ORIA 4BVLA 1IC6A 4D9KA 1M5RA 1T6ZA 3D6AA 1YRWA 3D1LA 4D7AA 1F51E 1WU7A 5MFZA 4H7PA 3PE4A 2GAAA 2JEOA 2BF4A 2GVNA 2VAXA 2QDXA 3FKQA 1GGHA 4DMRA 5I7VA 3PRHA 3SBXA 5GM1A 1TA9A 2XT0A 5IAKA 3N0WA 4HWTA 1WDKA 2P41A 2I2FA 2Y1LA 5HF5A 5KS2A 5HCIA 4F96A 2X9GA 5FOXA 5G3YA 1MQSA 4HL6A 4NENA 4OHKA 4GI2A 4Z49A 2M6KA 3VZPA 5BWNA 1BQEA 1ZUHA 3VUEA 1V16B 4US2R 4JCOA 2GZAA 2IZ1A 1KO1A 1TK2A 3CV3A 1PR0A 1V1RA 2DUJA 3LXXA 3PG5A 4X63A 1YUBA 4JJKA 1WMEA 3VHRA 4E5UA 4ES6A 2GPYA 2ZRAA 3T5CA 2CNWA 5CEEA 1QBKC 4D6YA 5AOAA 1E7RA 1YBMA 1QTRA 3SP1A 3UPDA 4QBGB 1OBVA 3VDNB 1AGPA 2V4UA 2YV4A 3FD8A 3Q8WA 4PV7A 1Y48E 4CYMA 1KSJA 4O1MA 4B3FX 5KYKA 1EDEA 2WUEA 3BIJA 2UUAB 4KFSA 2ZYWX 1FFXB 4RVCA 4BE9A 1KY5A 3NBFA 4N0PA 4I3HA 3AUFA 3KYJB 2W9XA 3O4IA 5B3JC 1GXSB 3BMCB 2DGDA 4ESHA 3TVDA 4C6TA 1NXSA 1QUFA 4RXMA 3HN7A 5EMKA 5B4TA 1EQAA 2NU6B 3I6ZA 3DTVA 3SXUA 3DHWC 3WIDA 5EQJB 3WGIA 4O4IF 5CDSA 5KTMA 1J70A 2QN2A 3L8MA 4AP6A 1L9KA 2QJTA 5ICEA 2O5VA 2WUWE 2R8YA 5AJYA 3RAEC 3HO6A 4JP1A 4UUAA 2UDPA 2VRCD 3QUAA 2RGDA 3U9LA 5KTSA 1V5WA 4ONEA 3NMUF 3V7WA 3Q7IA 1NSFA 2PUAA 1ZK4A 2C42A 3AFIA 3A31A 3PV0A 4R5MA 5TJHA 4P7FA 3CPJB 3IBTA 3TR5A 1KO4A 4QQFA 3UAOA 3RAGA 4OFXA 4XWKA 2GCPA 2ZRLA 3PUZA 1Q0SA 2JIOA 4J90A 4O4LB 3DGEC 1JIQA 5HBRA 1C1DA 2VP2A 2VHQA 1NQAO 2Q45A 1OY1A 2ZJ8A 3EXFA 5A1JA 1LRJA 2FQ1A 1PT9A 1UQRA 2EFGA 2GJ9A 3FPGA 4MS4B 1XE3A 2ETVA 5JBIA 3RRMA 1ELOA 2QWXA 3H5IA 3TB6A 4BKQA 2H16A 4ZEXA 1SCQA 3BB3A 3MGBA 3GA7A 1HTWA 2XGSA 2D1RA 3JQAA 4AF7A 2P40A 3QW2A 4JA2A 3UA4A 1J00A 1GZ4A 1BW9B 1N2OA 1XMJA 3V80A 3GJYA 2I9KA 3PF8A 1FMFA 2OBBA 1MG5A 1SCIA 2PMEA 3UK0A 4EEZA 3R7SA 2ZS7A 3REGA 3PVSA 3KKEA 3PGVA 1LDYA 1A2KC 4KIUA 3MTDA 4BLVA 4MMZB 4U3JA 3V8VA 1EFVA 3BXFA 4Y2YA 3RYIA 2E1PA 2Q9AA 1I6KA 4I4LA 3PS9A 2PN1A 2XQVA 4OLFA 1IM5A 1UIMA 2B0JA 4UHFA 4LZAA 2QIOA 2HSEA 3WZLA 5EIBD 2XJ9A 4GE0A 3ZTWA 4QTUB 5AICA 1U5BA 1U3UA 2FFQA 3DVRX 5T41A 1L3CA 2A9FA 3FLEA 2NXNA 3LP6A 3CH5A 2PZGA 3LX4A 1ZITA 3A1WA 2FV8A 3MJHA 1NUTA 4F6CA 1Y33E 1RAFA 4PGAA 3HEBA 1DOZA 1WCWA 3GLSA 4OKSA 3RYCB 2YBEA 3WAGA 1ST2A 1U0BB 4C4RA 1KR2A 4PX9A 4EY3A 1JJIA 5TV2A 2Q29A 3ITKA 4FN4A 1B14A 4M87A 5IVHA 4MUEA 1VTKA 1SZJG 2G70A 5DBHX 3PYMA 3PEYA 5EGSA 1LPOA 4FR0A 3A6HA 3H6GA 1PJ3A 2GBLA 3ASVA 3JZAA 1QTQA 2SBTA 1CT9A 4N82A 4U63A 3ZWCA 1S02A 2IUFA 3QV1A 1G7RA 2O6HA 4IEEA 3DHNA 4N0DA 4RL4A 2N3ZA 4E4TA 3F2IA 1XK6A 4Q6BA 2DHRA 2QXYA 3ED1A 3FNEA 3ICOA 2WM9B 4LPKA 4DLTA 1F6BA 3HDYA 1TEZA 1FA9A 5KC9A 3IR5A 4BLSA 1TX4B 1YDWA 4UHKA 2NUAB 5FWAA 3C6QA 4MRMB 3MJRA 3PNPA 3KR9A 4Q9JA 3DBOB 4ZI7B 3MJCA 5FD8A 3GJ0A 4JJ7A 4U9IS 3KD3A 4LV5B 5KOHB 4MQLA 1VLHA 3KKQA 3DDHA 3EA5A 4I1PA 1GDTA 3B3QA 4WKCA 2O2GA 3JQCA 3UTCA 1SK9A 2P75A 2QRNA 4J1NA 3JYOA 4XIYA 1KYQA 4ZA2A 3EX7C 4Q1EA 2HMAA 1NW5A 1A4XA 2FHSA 2IPXA 2R5NA 3KR0A 4R40A 5LMNB 1PGJA 1U9JA 2VL7A 1I0LA 1SC6A 2DWCA 4UZSA 3IIMA 4GL4A 4AJOA 3BJIC 1XNHA 2AFVA 2N0SA 5HFAA 2BTEA 1E6UA 2BMDA 4K03A 4BTVA 1DWOA 1CUXA 3DZ8A 4QTTB 3VR6D 1R18A 1TF5A 2JFPA 1P73A 3O8OB 1JH9A 1K97A 2GJ8A 4YCDA 2JAXA 1Q92A 5HIIA 4BVEA 3I2KA 5BWCA 2WB2A 1VRWA 3CIOA 3SHVA 4WESA 4M0PA 1TLTA 1DKNA 1UM9A 2MINA 2PV0A 3FF4A 2GD6A 1A8QA 1JZTA 1QJ4A 3E1GA 5IULC 1Q7GA 3TQRA 1W85A 2QROA 2F1OA 8GPBA 4H3HB 5K4GA 2GI4A 4JEMA 4GBGA 4GBMA 1XDGA 2HCJB 4EB8A 4WEOA 3BA1A 3IOCA 3P2OA 5H3CA 4UXIA 2OM6A 3O2SB 5K3FB 3WG9A 3OX2A 2OWDA 3B5IA 3L6DA 3F3SA 1M8PA 1QP8A 4KZKA 2J1LA 2P69A 2ODEA 4N6NA 4UBLA 5KQRA 2UXDB 4CR6A 1WS6A 2Q6IA 4BVHA 1KK3A 1O94A 3RQIA 3RYFB 5BOSB 1MJNA 1P1KA 3AHFA 2AFIB 1PUIA 4MR7B 3F6EX 3LNTA 2CFCA 3I28A 1R0RE 3QTBA 4MHTA 5I6DA 3LVRE 5HEKA 2F62A 2HPHA 1SOVA 2VPWA 3JYLA 1W9MA 3OCCA 3SBOA 4AUNA 5DTMA 5JXIA 4GI5A 5FPPA 4ZVVA 3E3LA 4ALKA 4MYRA 4NTZA 2G0TA 4BBAA 4F86A 2WHXA 4HLCA 4G8DA 4FHGA 3RVOA 4C04A 4J0EA 1NBWB 4MLPA 4BVGA 3WNCA 3D8SA 3IQGX 5JI3E 2JJ2A 1IBSA 3NRCA 4MIEA 1NAIA 1ZISA 3X1MA 3GPIA 3RV4A 1Y5LA 2P62A 2RB4A 3GJ6A 1T1GA 4N5IX 4TQAA 2JAWA 3A27A 1U2GA 3FNQA 3LOQA 4RE6A 3B9RA 3V2IA 2IVZA 4PNPA 1TUIA 1VJCA 2JATA 1OHHA 5E7QA 3TL2A 4J4BA 4ZO8A 4BKUA 1Q11A 6ADHA 1HF3A 5BSKA 1ZGJA 2ZJOA 4JP5A 2CLHB 2IXDA 3D2BA 3KHKA 4WI1A 4XCVA 1E59A 3NTUA 1C7IA 1E5LA 3AXTA 3KVNA 2IDZA 1MTOA 1A69A 3JCZA 2PSSA 5DIZA 4AAYA 2BSAA 4XM2A 3U9TA 2QM8A 2B21A 3OD5A 3RIMA 3WHKA 1Q7RA 4RXUA 4K9SA 5EZQA 3SLKA 1JR2A 3GXOA 3WSVA 1XLTA 4GDFA 2VQSA 5K8IA 3HCNA 2ID8A 3I1FA 2FWPA 3AFNA 3LS2A 3M6WA 4KC0A 5JZVA 4NFLA 3CT6A 3HYNA 4PLCA 4XSGA 3EASA 5G2OA 2C9MA 3U4CA 1C81A 2WABA 2YJGA 3NAQA 4Q7JB 1Q0ZA 3C8DA 3S27A 3VR3A 1GTJ1 4FN5A 5G41A 2ZWVA 2OFOA 4R8LA 3JAWB 1O6GA 3KQNA 1DLIA 1OWLA 4PSAA 5JR3A 4M1YA 2OAP1 2EIXA 3AR6A 2XY4A 1XBTA 4UCQA 5CVEA 5JWHA 1PDWA 3HBJA 1JQ5A 3ZWAA 1E4EA 2WIDA 3FDZA 4QARA 1ZAKA 3KU1A 1UBRS 6YASA 1Z82A 3RVJA 5C5CA 1WNFA 4OJMX 5FLKA 1QF7A 3BHIA 2QTRA 1JI3A 1G9SA 2WQ6A 4YK7A 5AESA 3NM6B 1Q15A 3I5MA 2PX0A 5LP1A 4D81A 3MLEA 1W59A 3UAWA 4OGLA 5BSVA 1Y3BE 721PA 2BJVA 1D6MA 1VHLA 2YN2A 5AKYA 4R01A 2ZUWA 1MO2A 3FZGA 1EG7A 3SR3A 1K8ZB 3DF9A 4YAEA 1U6JA 3RSSA 1P72A 1FFAA 1NI4B 5DCWA 3R9WA 5A9SB 3AVQA 2GEDA 2Z09A 3IJRA 4L07A 5DKFA 1VI6A 2P6NA 3CYFA 4O0MA 3WC4A 4PEVA 3W2EA 2PMWB 4QYWA 3C3MA 4EA9A 4KO2S 3F6RA 1VL8A 3UHPA 2PG3A 1OGYA 4YR7A 1DELA 4AJPA 2PPVA 1A7AA 4GE3A 4GC5A 2WU1A 2QPTA 3K0KA 1U11A 3QYPA 2XWSA 4QBIA 3QXXA 3WLKX 3C74A 3U7GA 1SKMA 3NVDA 4KSYA 4J49A 4J07A 3TGWA 2I66A 4RLQA 3B36A 1T9KA 2H5IA 2WHQA 4W8OA 1TYCA 3NFYA 4I9HA 5IDYA 4Z7QB 2I2DA 3UGJA 2ZYAA 3NOOA 1G5TA 3B12A 1ZI6A 4RMGA 3TKLA 1GAJA 4UNPA 4Z4GA 5J2TB 2W6MA 2WHYA 1TVMA 5EY5B 2QP9X 4EVSA 2DERA 2AKYA 4RK1A 1YFKA 2ZVDA 4R8MA 4HEQA 3R7DA 1OX4A 4IWNA 1NE7A 4WUVA 3GAZA 5EJAA 3EDRA 3JQ8A 3P0IA 1WRBA 4HDRB 3TOVA 1GY8A 1AKYA 1T6BY 2PS3A 3A4TA 4R1SA 5DDIP 3TLKA 4HAWA 1FU8A 3VYWA 3H9EO 1XC7A 2PNJA 1PJRA 1W4RA 5B2EA 3ZJ4A 3FVTA 2CDRA 2VUIB 3PC7A 1YB7A 1YJQA 4P86A 4A6DA 4LZPA 2C31A 3RRBA 2PCJA 2HL6A 2E2WA 3C85A 2YJ5A 2VJCA 3SYMA 2CXHA 1NC3A 1MW9X 4C2TA 5LWHA 4Z5XA 1YL6A 5J58A 1XJWA 4IRMA 3VXKA 2HT6A 3JASA 4NPAA 1QOZA 3N75A 2R6HA 1LTHR 2VXOA 1XNRB 1BVRA 3EPHA 5CK5A 4PFQA 4RVDA 1P1RA 2I7CA 4AMVA 1IXKA 2ZR9A 4YB8A 4LC0A 2V7WA 1FJXA 1RZRA 4IJUA 3DMDA 5ERXA 3BBPA 3KQVA 1E9VA 4H7EA 1N8KA 4BO7A 3AL0C 4NV3A 1E3EA 4R16A 4C1NA 3UATA 1QO0D 4V1CB 1WZEA 3KV1A 2G80A 4IZHA 3M9XA 5A6SA 3GY0A 1J8DA 1EFPA 3FHLA 3Q3JB 5TT0A 4CFYA 1MR3F 5FWYA 2BFNA 1OZAA 1YK0A 5B7PA 2YN0A 3GOQA 1F6DA 3JRWA 2BCJQ 3MTEA 1NUAA 1GQRA 4X91A 4YJDA 5B6JA 4GKAA 1OYVA 5ALKA 3Q7RA 3KAKA 1DOHA 3N7AA 1Q1GA 5FQOA 2R8XA 5IUJC 4IS3A 5H59A 2XGOA 1G18A 4LRQA 3ZE8A 1DBQA 2JFZA 3ZV3A 4RTPA 1CVLA 1SO8A 5JVDF 2BGJA 4R83A 4ZGWA 1DQSA 1M1YE 1WABA 5CXXA 1G66A 1OTYA 3WKDA 4ZT2A 2HJ9A 2G4VA 3B89A 3NNSA 3PXXA 1E18A 3ELDA 2RBGA 4F46A 4BTLA 2Q5QA 4BUJA 2GB4A 1AN9A 2DKNA 1Z25A 4KV9A 2PO5A 2VT3A 1J2YA 3F74A 3ML1A 3ROMA 1XA3A 4YIHA 1LSOA 1Y89A 1X7WA 2CLKB 3LUKA 2HO5A 4IF6A 2NOAA 4RH3A 2XTNA 3D8UA 3N6VA 1F7UA 3ORSA 3GDWA 4YPFA 2BV3A 3LT4A 4URUR 2YXDA 4I50F 2AF4C 4O5AA 3PA6A 1SN7A 5A2QA 1R10A 1GPBA 4EG1A 1SC1A 2QTCA 4IIEA 3OD1A 4DRZA 4YJ2A 3OPYA 4IXMA 1OFVA 3DMYA 4QICA 1G3UA 1W5TA 3KE8A 3B78A 4P32A 4PGHA 2XT9A 4ZI2A 3QE3A 1WVIA 3KL2A 2D2IA 5KSYA 4PC6A 4Q5IA 1GG5A 5D5QA 1N2IA 4DM7A 5IMSA 2L82A 4OY3A 5KIAA 2OGUA 4BL5A 1R5OA 2QM3A 3DBIA 3DPIA 4IF4A 1VXRA 1R0WA 2R47A 4YN3A 3H0EA 5KKAA 1R8XA 5H4HA 2VDRB 3Q85A 3IPYA 3HXTA 3UENA 4B45A 4TL8A 1X8KA 1GKIA 2ZFUA 3C5HA 5JS7A 4F71A 2I3GA 1SCDA 1LZLA 2VRNA 3ER6A 3C98A 4FNOA 2BEUB 5C4GB 3AP3A 5J4HA 1L5KA 5IXJA 4M8SA 3LYAA 1QVVA 3ETLA 1X9IA 1E79D 2OAQ1 1DJMA 4X1IA 5DBFA 4G1EB 1QRRA 1GNRA 1NTRA 3CH4B 4JJ6A 4UM7A 2DETA 2OC4A 2R5FA 4D5GA 4QLBA 4HAXA 2XVMA 4RYLA 5BN3A 2I1LA 5JJCA 3WSWA 1VJ1A 2G0AA 3HB7A 3M1AA 1SVIA 2MOKA 1RLUA 1YC2A 1KKUA 2IIBA 3PB3A 4ZOLB 4L8WB 2DU8A 3ZYZA 3H5TA 1YOBA 5I7EA 3ZDRA 4DGQA 5FF9A 5DF1A 4MWBA 4TS9A 3ZY6A 3CWZA 3E0QA 2ID4A 3KZOA 5FNZA 4AJ2A 2AXPA 4JC8A 3V4PB 3AHIA 5IT9A 1R9GA 1YZTA 1IN6A 5HDBB 2IHUA 1MU0A 1S6YA 3BXXA 5H9WA 1NNEA 3TYXA 3C7KA 5I7FA 1DQZA 2ZBPA 4Q9DA 3KL4A 4ZQGA 1EFDN 1FW8A 1U80A 2W4IA 3AGQA 5A7GA 1SCKA 3QLUA 5TVGA 4UM8B 4WDRA 3UUGA 3TW6A 1P7YA 4BFSA 3H1FA 5E3HA 1RT9A 1JJAA 3D3WA 3LVBA 1IN7A 1PWHA 2JPDA 3MIIA 4KQKA 1FDSA 3NH6A 4MEJA 4WW0A 5F7JA 3TTXA 5HF9A 4A7PA 4YCSA 2C59A 1Z8HA 1W25A 4XGKA 2ONYA 1C30A 4E6PA 3KB8A 3RB8A 3OLYA 2Z8YM 5LD2B 3VJMA 1NP7A 4EYGA 1HI9A 3HWX1 3WSTA 4YUZA 2LDXA 3E3OA 4FSDA 4AMYA 3USCS 5K0NA 5G40A 4EG7A 2D5IA 3UHAA 4D9CA 5HQ3B 1NN1A 4YJ3A 3WE7A 5M29A 3I5YA 1ONOA 2GK7A 2H8GA 3OF2A 1GZ3A 4L5YA 4RA6A 4YH1A 4J16A 5DHUA 5IAGA 3VC7A 5J23A 2XGJA 9ABPA 4MLCA 1W88B 3BBLA 3HG7A 1Z62A 4NYMQ 3B1JA 4MUAA 3I9NA 3IE1A 3LKBA 4JBXA 1UXIA 4MKZA 2J0SA 3OF3A 2AJLI 1ACJA 3I39X 4Z4QA 2QPLA 1COWA 1RKXA 4Z9XA 3LZ6A 4TL7A 4HH4A 1FSPA 3G8AA 4YV0A 4G2TA 3DR5A 3HE3A 3MAJA 2O2DA 1LK7A 3OWOA 2E9SA 2FSVA 1KI2A 1U5CA 2QLNA 2C3MA 2VHUA 3R9KA 4BQFA 4LY6A 2IYNA 2F59A 4HJRA 4Y1EA 1JTFA 5DYYA 3ITEA 4ED9A 5CDUA 3D4LA 1T1RA 1QFZA 2PFGA 2Z9BA 4LOHA 1N2CB 1J7JA 1QIFA 4DDUA 3ZS9A 1TQ4A 1UR5A 1HFJA 1MA3A 1NRIA 1HDGO 3IBGA 4QU9A 3RVSA 1UKZA 3R44A 3ME5A 3TE7A 3RAFC 1JFLA 3EFOB 3I61A 1IZ8A 3P1JA 4DV1B 2WKPA 1CQJB 3DZBA 4M6WA 1IIRA 1V3VA 1BWQA 3DA8A 3IUJA 4PS0A 4A2QA 5F33A 3SXPA 1K6MA 4H1UA 1L4FA 5IN5A 2QLLA 1ZN9A 2J30A 2XMPA 4LE2A 3M1YA 1JQJC 3DYVA 2OORC 2I5PO 1VL5A 4F7DA 4ZMSA 3WTBA 1YA6A 3AK4A 3TQFA 3PKZA 4MGHA 4PAWA 1ESZA 2QSZA 5BSMA 1T13A 2ZWPA 2Q8PA 1W36B 4HWGA 2C0CA 3S40A 1FXUA 3FI0A 2EEZA 2FMKA 3GLKA 3IQDB 3PCRB 5DTQA 5KKNB 3GH3A 3AQIA 3BFKA 2WWHA 1E1QD 1TO2E 2HKIA 4NYMR 1TM3E 3HH8A 4G1FA 5M3BA 5LIRA 1DP4A 1JRLA 4UVHA 1KAHA 4H7IA 4MPDA 4CQMB 4KHPB 3HDGA 4PSKA 1NI3A 1I5EA 2I7DA 3EB9A 4MKXA 4ROTA 2CLSA 3CSUA 4JMPA 4D9NA 3CRZA 1I0ZA 2EJCA 1RRVA 4N41A 2XITA 3H1BA 2P3QA 5KQSA 1WMSA 5CVCA 1RVV1 5KQPA 1RM5A 5AJZA 3SLRA 3Q8XB 2A92A 2BKXA 2RBKA 3I30X 4KN9S 4MKRA 2D74A 5D87A 4DJ5X 5JMWA 3GLGA 3AVTA 3PXAA 2IPAB 4G8BA 1IU9A 4V24A 3W0LB 2P9QA 3LP8A 4G8JA 4CMKA 3RSFA 3E05A 2AG6A 5DJ5A 3P4UA 1G9XA 1IHOA 2D5BA 5CIWA 2WWIA 2Z5VA 3G2NA 3WRYA 5E4FA 1KH1A 4CN9A 1WUJS 2QP4A 2BGNA 4YALA 3EZLA 4YP1A 2D0IA 1QHHA 3R5XA 3VO1A 5A2GA 5AXBA 3WHIA 2YOHA 2NMVA 3O6VA 4EF6A 2V7QD 3L7IA 5HKKA 4IQFA 3KLPX 1CUUA 1SPBS 1PFGA 4JXXA 3K2BA 4M1KA 3FB1A 4DZTA 2ODPA 2QRZA 4KDCA 4L8VA 4MVJH 1W4BA 3BMOA 3NIFB 5B57C 1XPJA 2B1JA 7MDHA 2EJTA 5EZYF 4JCCA 3WK6A 3WRWA 3ZGVA 2JFQA 2OZPA 4CPDA 3TOSA 2G9UA 1AUVA 1N1MA 5CEFA 4GZ5A 5LQNA 2GKSA 4Q7EA 1L4HA 3ENNA 3C48A 4ZANA 3NZEA 4OBXA 2L18A 1J25A 3ETCA 2FY8A 3ECAA 5CP8A 3OUTA 5CFLA 4BRSA 3OZTA 2VTBB 3IA7A 4ESEA 4AJLA 3R5HA 1A5BB 4JX8A 2G9VA 5FH9A 2EQ5A 4L4SA 5EZSA 2HYIC 1R3UA 2A58A 1BEZA 1O9BA 1IYZA 3GRRA 3NWOA 1VKJA 4WY8A 1EMDA 2MR6A 4F93B 3AFMA 4ZP1A 4TZKA 2PX3A 2VPYA 4MS3B 5ALTA 3IO5A 4PW0A 1KEUA 4UJ3A 4ACBA 4CEHA 1M67A 2F2TA 4CM1A 2X6TA 4RADA 4HY3A 1RCTE 4ND8B 4EI8A 1UCFA 1AS3A 2VJLA 4JP3A 4OOEA 2AW3A 4ZAXA 1KSGA 3V55A 4C7BA 6REQB 4XB6B 5ERYA 1X9HA 2ZBEA 1FS5A 1F2TA 3GMSA 3SM3A 1L4YA 1KIAA 4UVEA 3H75A 1YQ9A 5JCPA 5BNTA 2D4AA 4PC7A 3RF6A 1ZL0A 1JW9B 5AK4A 3T6KA 4HRAA 1E32A 3PR3A 3H2SA 5EWLA 4X00A 3MW8A 4FCCA 3PTAA 2BEWB 5DCUA 5DEIA 3WGMA 1V7CA 4QM6A 1DCFA 4PU0A 3ENWA 3VYUB 1EU1A 1YJ8A 2FR8A 1GM5A 1LLQA 4KRGA 4D96A 2P9JA 1H4SA 4MUJA 1N5RA 3ZXXA 2P6UA 2XDAA 1GARA 2VP3A 1MT0A 2FMUA 4C2AA 3TSOA 1XL1A 3FMIA 4GBED 1Z8DA 4NQRA 1F4LA 4B71A 1TM5E 3RVQA 5CPFA 1XALA 4BHTA 2ENWA 1UP6A 3NJ4A 3L0CA 5ADHA 4JYZA 4UM9B 4QPCA 1N0HA 1QCDA 3GUVA 2FOXA 5H16A 3BD6A 5FOWA 1EXNA 4WT7A 5ALWA 5HE8A 5LA6B 4OGFA 2FF7A 2PUHA 4HGOA 4ZJUA 5HPYB 2VXBA 1B42A 1SVSA 4RK4A 5F2EA 4EHNA 1BXRB 2AN5A 4LBVA 1CNMA 4TMWA 1KP9A 5BNWA 4W5NA 4MVJP 1ZNXA 2OV1A 2P6OA 5E6RA 2HZ7A 2WTEA 1SZCA 4HUJA 4XRRA 1JG4A 3I62A 4D8TA 2FZCA 3W1VA 3AEQB 3KG2A 1Z06A 5IS2A 1M2GA 3V1LA 2H1OA 1Y6GA 4Q7LA 1E5DA 3DLCA 5GADl 4CKYA 4S35A 5FDFA 3KVOA 1PL7A 2O54A 1LXCA 1SEPA 4JU8A 4BV2A 4BKPA 2C84A 1JDZA 4KITB 3WLAA 1W44A 2Q99A 4WKNA 2YQ5A 2JLXA 4R69A 1RHMA 2CLLB 2ZCUA 4RQBA 1TW3A 2ZI9A 1W87A 4Q47A 2XKAA 4U2FA 3UJCA 4DW8A 1DBWA 3EBLA 4PNEA 5LNK6 4MW5A 2QGNA 1S2DA 4DDKA 2PGNA 2R8BA 4TV9A 3MGGA 2XCIA 4EMSA 3K8ZA 2ATEA 1EXDA 3EUFA 2BMVA 2IOYA 3GVPA 5DULA 2HTFA 3HKDB 3CX8A 3KSRA 2IQIA 3UUEA 2V0CA 5AM0A 2DTEA 4WZ6A 4DR6B 3W5VA 1OAOC 1Z5OA 2O8DA 3HDVA 1WULS 4Y1RA 5JSZB 1T3ZA 4F84A 1KMCA 2O06A 3Q3GE 1KU0A 2A4KA 3G6KA 3CX3A 4RZIA 5AVYA 1NVGA 2G1UA 3I73A 5CM9C 2OV6A 1AQUA 2D1FA 5JALA 1ZW1A 3DE6X 1MIOA 2I1VB 3HJTA 1J20A 1N4AA 3QIVA 3JAKA 1JFFB 5EVCA 4MWCA 4P3KA 1WDWB 2I4LA 3CN7A 1GSAA 4AIIA 3Q98A 1ISJA 2C4HA 2DC1A 2NSLA 3FX2A 3HJUA 4PBTA 2JCGA 1B74A 1PK7A 2VDPB 3KD2A 4IKPA 4PLHA 5LKRA 3DBHB 5LXTB 1H0HA 1R50A 1XXLA 2PO7A 3NGXA 2EP7A 3QNUA 4HXEB 3F6YA 2JJYA 4N0QA 4RJLA 3GIWA 5L53A 4CLOB 4U7DA 2UZ4A 1QVWA 1GNLA 2YHSA 1FRNA 2Z2JA 3PDIA 4NMXB 2P5TB 5F51A 4YFVA 4D4KA 1SHTX 5FV7A 2JHGA 3TLGB 3BVPA 2EBWA 2W8ZA 4X1YA 3TOZA 5C2JB 3IKVA 1ZUD1 1UC4B 2HWXA 2P2SA 2XXBA 4GPBA 1AUPA 1GNQA 1MFZA 2A1UB 2MSNA 1A3CA 2H1SA 4OLHA 1KJJA 1XFAA 1ZCJA 4FEGA 2PXHA 1PBTA 4H6WA 1I6WA 1Z0ZA 1TNDA 2GERA 4C06A 3HA3A 2Y1CA 1JDVA 1PW5A 3WFIA 3JQRA 2FMHA 2ZYTX 3O03A 4F7WA 1UJCA 2HIGA 3FNBA 4C0AC 3F5DA 2EX0A 1DG1G 3H2JA 4RMIA 2IFTA 2GZDA 3O83A 4MKGA 1QGYA 1HE1C 5L7YA 1LPSA 1JIKA 2WMNB 3QU9A 3OCVA 4BQSA 5TIIA 1R0CA 3QE2A 4AY6A 3G23A 4FFDA 2WY2D 2QQ5A 2O19A 1QKJA 2WSIA 4FBGA 1OZGA 1RXVA 1DI0A 2NU8B 3NAGA 4OG2A 1W75A 5JHHB 4NU0A 4H17A 4DCNA 4YTEA 2IV3A 1RPNA 3H5NA 3UT0A 2GRAA 3QKSA 3COYA 3RC9A 2LGJA 1NVEA 1CHNA 1C3VA 1E66A 2FPUA 3PFKA 1Y3HA 4LJ7A 4RVFA 3D2CA 3QFTA 1GDDA 4ARAA 2H0RA 1PL6A 1QM5A 2CD7A 1NVKA 1AXRA 2XE4A 4R05A 4Y9DA 3HSSA 2RH8A 2XOKA 4XWAA 1W34A 4TZTA 3GT0A 4FGKA 3L1JA 4UE2A 2EJVA 4JENA 2H18A 1KO5A 4W99A 4JEIA 4YJGB 4D57A 2AUTA 1M2WA 3EQ9A 1CJBA 3GHHA 4EHKA 2OKCA 3V2GA 5J2UF 3L8HA 3MBOA 1X77A 3OLQA 1T8PA 4GBJA 1E0JA 3DMNA 1QFXA 3RLIA 3VI3B 1E2EA 4N3NA 3DTTA 4JB3A 2V58A 4XWYA 4WLOA 4XDZA 5JLAA 4OHZA 3U09A 2GXUA 3FPJA 1E9SA 2EX4A 3CM0A 4K9DA 3RK1A 3SEFA 3ZGYA 4A16A 4C4OA 4DEVA 4EA7A 4IJVA 5JO0A 1SBYA 3QE0A 2X0JA 4OFZA 1ICEA 1JB1A 1YVUA 2PMFA 4W1QA 4G3XA 2LBPA 3IQIX 5FADA 2PUGA 4YAJA 1UODA 1Y6RA 1BX0A 2RHJA 2FFJA 1WP9A 1ODTC 4I9GA 5CVJA 1LLFA 2DXIA 4YGXB 2QB5A 5LXTF 1NKSA 3DMFA 3RI3A 4EK9A 4KWEA 5CBPA 1E79A 3BYZA 4X8HA 1LK5A 1F6WA 1RRPA 4DCCA 3UM9A 1LV7A 4DYHA 4ZK2A 2CDNA 3LGSA 3ZVNA 1IFXA 1REQA 4UBKA 2P2YA 3E9MA 3H9QA 4LEIA 2BH9A 2E5FA 2QYOA 3LC2O 5BN1A 3CNEA 1WPXA 3UOGA 2Y71A 2QAGB 2VTVA 1Z26A 4LV8B 5LP6B 1ZIYA 2GEKA 2IYPA 2PT6A 1RI3A 1VDMA 1OJ7A 2QTNA 4FZRA 5J4LA 2JI7A 1UDBA 3D6NB 2FUCA 4XGNA 4TWRA 2YUIA 3K0CA 3SVLA 3M33A 3ES9A 4GYJA 1RNLA 3R3VA 1X8JA 4OYYA 5SYAA 3ZE2B 1WBBA 1UBHS 1OLSA 3C8ZA 3TMKA 3FA2A 3PPWA 2L0XA 1MEJA 4JP2A 2Q5LA 1BMTA 4TYQA 3SYKA 5REQB 2ZBDA 4MYHA 4D4IA 1CULC 3DVAB 3IEPA 2BCEA 4BB9A 4UHDA 3OQ6A 3C97A 4RS3A 5KU1A 3ICQB 1X7HA 3PFIA 2ID9A 3PTLA 3OOHA 2DFDA 2ETXA 1H2HA 4YDRA 1Q1BA 3MLBA 3BHJA 1Z9BA 4AZ3A 5JSFA 4JDPA 2OBNA 2XCUA 2UYYA 4I4NA 3T9AA 5FNVF 3ZE9A 1ABBA 2OG1A 3I2HA 4HRYA 5HIKA 2XHEA 4I1IA 1APBA 1A2OA 5CT8A 4BNXA 4Z7OB 2ZUEA 3AL3A 4GMKA 4JEUA 4E88A 3WWEA 3HKEB 4F6RB 4IZIA 4BBJA 3EQ7A 4PHHA 5B12A 1H6BA 1MNAA 4XUCA 1CNEA 2Y1DA 4MCAA 2GDZA 1OA0A 2YWJA 3QELB 1UBNA 3RU9A 2B30A 2KW5A 3SM9A 3TUIC 1IQPA 3RFTA 3WGKA 2XRZA 1V96A 2IDJA 2LP4Y 1AN0A 1CIVA 5CT6A 5HS6A 1DRKA 2AOWA 1TQHA 3OTGA 4FC6A 4M9UA 5ULLA 2G5GX 2ESRA 4C6SA 1C3OA 4C7MA 3TNYA 1BKSB 1S3SA 2R66A 1V9LA 3GEEA 4RH1A 4JT8A 3OP1A 2Q0HA 4FLFA 4COOA 1AQLA 4L57A 4CMAA 2NX2A 4KVGA 4NU8X 2IHJA 1M1XB 1E62A 1PQUA 1Y8CA 5CA1B 4S04A 4WD3A 2DTDA 3TUJC 3ORRA 2Z9DA 4UTNA 3MTGA 1XSEA 1E9DA 4N5NA 1XCMA 4NK4A 3O1IC 3AX6A 1NQOA 5EPOA 5DNYB 2Y1KA 2FP4B 2Q5EA 4B6GA 5FFMA 4GRDA 2GNPA 2QF7A 1NM5A 3FNHA 4N3BA 3RUDA 2R86A 1E94E 3L7DA 5UKDA 3WHPA 3O2QB 1NUQA 2NYUA 2YBDA 1AUOA 4JJEA 4DANA 1ZD4A 1T0PA 1X80A 1UZMA 4PIVA 3U39A 2HXSA 3OURA 2IP2A 3NW9A 3QXJA 2WWFA 1F8UA 4REQA 5CVUA 5EESA 2F9MA 3W34A 4UUNA 5FLYA 3ZI0A 4QUJA 2IP4A 4B7XA 2IRWA 1UBLS 3MTAA 3PSAA 4GVPA 4LXXA 3OOEA 3I23A 3BQNB 1OLUB 1HT1E 3BKWA 1OZ0A 1G55A 2JCYA 2PKEA 2Q3FA 1IONA 3UB4A 4CLEA 5LL6P 1GUFA 1EUDB 1SKYB 4AL4A 3EVDA 1VG1A 4ALIA 2TMGA 1QIDA 4G9GA 2LCQA 3V8EA 1TC1A 4TUYB 2Q5CA 1C9JA 4C5BA 2FUEA 3DCJA 3IKTA 2ES4A 1N3IA 3IQFA 4ESOA 3C16C 3Q7QA 3LGAA 1JXMA 1WV1A 2AB0A 4KXYA 1NXTA 5H5JA 5SZHB 3I6IA 4LJYA 3RYHA 5FUYA 5AVRA 4RKFA 3KLOA 1E2BA 2NZYA 3D6VA 3CGWA 3I6YA 1IY9A 3LOPA 4JU9A 4QDUA 1NG9A 2CL7X 5KOIA 3WRXA 5TR9A 2YXNA 3K92A 4S1WA 3P2IA 1QG0A 3LVFO 1FYFA 4KE9A 3UC9A 4ZZ2A 1PS9A 3OLWA 1WQ3A 5AKIA 2VDQB 2GPWA 3WV4A 3WLTA 4BN5A 1RFLA 4ZGGA 2C29D 4L9RA 1JKFA 3BK1A 1U7HA 4FOSA 1R2QA 1S1MA 2W2QA 1X7DA 3RC1A 1H4VB 2OO5A 3CX4A 4RJJA 2R1TA 4P4GA 1RJ9B 1EE9A 3FCCA 4DEXA 2P2CA 4F2PA 3IP3A 1XI2A 1X7ZB 2G6TA 1UMCB 2C7VA 5G1PA 3PJEA 1EX9A 3HZRA 3TCNA 5JROA 5BR8B 3FYTA 2WDZA 1G7SA 4QX6A 4D3XA 2V7QA 4TRMA 4UTRA 4MLZA 2WSMA 1YS1X 1EM8B 2BISA 1V26A 3GB9A 4M46A 1JMKC 1UPTA 2YV5A 3WLRA 3L6BA 4Q3BA 3IMKA 1KC3A 2NSYA 3F9IA 1N5MA 3B8EA 4HK4A 1RU3A 2PRZA 4HTFA 4Q4JB 4WCFC 3V1KA 4LF5B 3EIUA 3TAUA 3MJDA 4OI4A 5K1ZA 1DDIA 1VIAA 3V1YA 2MSEB 3GNLA 1YB1A 4KL8S 4LXQA 1JG6A 5FFFA 2NP7A 1USIA 4C14A 4ZO6A 1N6NA 3ONWA 3OETA 4J6FA 4BNTA 5F2NA 4LF4B 4QVGA 2J9YB 1XCPA 4KWCA 4OLBA 2C5AA 3FMFA 3OIFA 1V8OA 2OQ2A 2X1HA 2ZTSA 4C76A 2O20A 4KTVE 3LQ1A 5BRJA 2WD7A 3RJMA 1IJBA 2P5UA 1ZVVA 2DSNA 2RJ3A 1PT8A 1OAAA 2ORED 4BO5A 3PEVA 3H3XA 5CA0B 1E7MA 1M2VB 2DPHA 2HA7A 1T91A 2CBZA 3Q6MA 4Z86A 4N5DA 3RJ5A 5K6AC 4GPEA 1FMJA 1EKXA 5KX5B 1JNYA 5EXXA 1X7XB 121PA 4I1OA 2DKOA 3G8BA 1Z4PX 2Q1TA 4IR7A 3RC7A 3USES 4WA8A 1VLJA 4MAAA 3AEYA 5EQFA 5AXDA 1QK5A 1BHJA 3R0VA 4X3CA 2VNIA 5IDVA 1A9TA 4GLLA 1SHJA 1TU3A 5HCUA 3W5IA 5THQA 1IEXA 2G71A 3O3CA 1RLIA 2R25B 4H27A 1PWYE 3D54D 2AFHB 2FSUA 3GDHA 3VZCA 1IQUA 2MMGA 1YOVB 4J03A 2PH5A 1HV8A 5T6BA 1MO6A 4Z4FA 2BDEA 4DNPA 4YT2A 1JHVA 2FMIA 3HJFA 2XB8A 5JJBA 1DX6A 1JE0A 3MJTA 2ZUUA 4UUOA 2VHWA 4QRIA 1EJ6A 5K0LA 1GDHA 1NF2A 3ZIAA 2PY6A 3OQNA 2Q2WA 1C41A 1GTL1 4BUZA 3OHMA 1EWRA 4K05A 4R41A 1BE1A 2HUPA 4JGGA 4IRXA 5ALFA 3RU2A 1II8B 2BGUA 2V7BA 1UXJA 5C1DA 2G17A 5K0GA 1FUKA 1OXVA 3K30A 1VL1A 2P2GA 2XF2A 4ZVUA 3WJ1A 3AUAA 1EDZA 5IJ9A 2XYRA 3EVFA 4E4YA 1N5OX 2BFAA 3KT0A 3M5WA 1FJGB 3CG0A 4OBEA 2YJ4A 4F0JA 4BMPB 4ZI5A 2E4WA 3NBKA 5IVPA 3PYXA 3E82A 3DWFA 3T8YA 2IBMA 4QU8A 3UMYA 3R6DA 4Y0VA 1WUYA 2RCYA 5EE0A 3WICA 1T2VA 2Q5OA 4M1ZA 4QYIB 1P81A 2CYCA 4M7OA 1EFUA 3V7UA 4FINA 3B1FA 1IWPB 2E4YA 2OPBA 3EVNA 4IUYA 5JMOA 2AYYA 1O95C 3CO0S 3DONA 2Y93A 3T15A 4C05A 1GUYA 3ACDA 1KVUA 3DLAA 2A5GA 3B6EA 3N3BC 2GD2A 4YRMA 2RONA 1N34B 3CR7A 2NYRA 3WKEA 1L5FA 2W11A 2ZJ0A 1M2JA 2PXXA 5ESWA 1FBTA 2GF9A 3RFUA 2HBZA 4YCNA 4MVJI 1UF9A 1W46A 3R77A 4IWYA 2MYUA 2B4QA 3IBFA 2ZI6A 4EW6A 4F85A 3L0ZA 5K6TA 1SQ0A 1JJ7A 5LYJA 1FUEA 4NXMB 3FPLA 3L1UA 4B2LA 5ALPA 5K0ZA 4B6PA 2O4UX 3P97A 3VTAA 3X1YA 3VTFA 2WJPA 2F1RA 2HLHA 2P4HX 3KR2A 3GFVA 1N32B 2NSHA 1H66A 4MW0A 1PZNA 3RC3A 3EXIB 4NEGA 1T1SA 2EERA 1KZ6A 5AI8A 1VC2A 2DM6A 4CG0A 2BSXA 4JLVA 2WBLC 2A5LA 2EHJA 4MS1A 4J1QA 2G76A 2QD1A 2V03A 2Y0EA 1XLVA 3FSGD 1MH1A 1THMA 4L0MA 5TB5A 4B34A 4CLRA 2A14A 3FZEA 2J87A 2YHIB 2DUUA 4KKXB 1PN3A 4BMZA 1GN9A 4KQ1A 3N28A 5KREA 2WC1A 1G7TA 1KK0A 4ROSA 2LD4A 3G17A 1U9ZA 4RE5A 4DMHA 5DP1A 3AR3A 1F8YA 3RODA 2XB9A 4II2A 4CR7A 1K7CA 5AKHA 5EMMA 4N40A 1KGSA 4TMXA 4UAUA 4HO1X 2JLBA 1U3FA 2Q07A 4XSHA 1Q0QA 2C8LA 1QE5A 1P0QA 2PL1A 4FVTA 4Q15A 1TRKA 2FW6A 2JD0A 4DM3A 4ZDJA 4BRWA 3GAAA 2QL5A 3MIZA 3AQ4A 4MV3A 1MV8A 2OCAA 1PW7A 2RDMA 5IKMA 2VBCA 4ZRNA 1Z7WA 5CFNA 5JAUA 2IZOA 4RABA 4JGIA 3HL4A 3OX4A 4N7MA 2QGZA 2IEDA 4X7RA 1GRQA 2BI4A 4RFLA 3DLHA 2ZLBA 3MWKA 3HCRA 3KQLA 1BRMA 2TSYB 2W0MA 1XR3A 1KBQA 1CUAA 4JYMA 2G4LA 2IP1A 1JZSA 1BD4A 3V7YA 9LDTA 3ZHSA 3M3PA 1QOQB 4XPIB 3U48A 1N2GA 1R66A 1UBFA 4AG5A 4MO2A 3EMKA 1DEKA 2H5LA 4MULA 2DR2A 3OBIA 3A1DA 2IS6A 1JILA 4FFNA 5DGIA 1CE8A 1X15A 3Q7PA 1RIIA 2JH3A 5KJ6A 3U19A 1L5NA 4AI6A 1N8TA 2J9FB 3QXSA 1NG1A 4DUPA 2W6ID 2HH9A 1Z8FA 5JG7A 5DI3A 1MJ5A 1OFUA 2PUEA 5E8JA 3PC2A 3ISVA 2OXFA 3A25A 2GLXA 3VBEA 13PKA 1RLOA 2J3JA 3OLVA 4IDNA 4QELA 5BUZA 3HZHA 1BDIA 3W5SA 2NZ2A 1SHZA 3GDFA 3KXLA 3TH5A 4X3OA 4ERNA 1WLYA 2C58A 3JARA 5E9JA 1QU2A 4YIKA 2F3TA 2GJ4A 4YUWA 4NL4H 5LD2C 3NIBA 4GX1A 3GUUA 1CCWA 2WI8A 3A0RB 5IABA 2CC2A 2ZTVA 3RC2A 4JBHA 1I3OA 1Q12A 3RYTC 1GEGA 5ES3A 1BOOA 1Y82A 3KQYA 1NKTA 4IIXA 3I8XA 2MYTA 4CDNA 2IXGA 4EH1A 2RC6A 4OXYA 2FOIA 4HBGA 2B37A 1DTSA 1J8FA 2YJ3A 2GD0A 2JGFA 4N8DA 1OFHA 4NC9A 4XVHA 1R6UA 1E99A 3LD9A 4NATA 2OQVA 4ND7A 4ZD6A 1XYVA 2EZ8A 4XYLA 1NHWA 2QZJA 4HKTA 4ETMA 4ZHQF 3DFKA 4E0BA 4WXHA 1T10A 4KWIA 1ILWA 2XTZA 2PBLA 1YNOA 4DOMA 2VTDA 1QFSA 4OHPA 4BNFA 4H1HA 1K0FA 3VQTA 1KYVA 3QEBZ 2WZDA 1IB0A 2PWAA 3K4PA 4TLDA 2QLBA 4UXJA 5IC5A 3VAYA 3VZSA 4DMGA 2R60A 1OE0A 4GP9A 2AN9A 1JHQA 1QH1B 2EHDA 5AW3A 4G0PA 5ITZB 1YDHA 2W7TA 2D5LA 3DXZA 4G09A 4I4CA 3K9WA 1V43A 4RYDA 1ODLA 1VYTA 4L4XA 4DRYA 2PRIA 2ZP1A 2HYDA 3EHDA 2Y4OA 1Z2AA 4G0OA 2HM7A 2GESA 5WRFA 2WU3A 1TJ3A 3L05A 1A7JA 1XRRA 4DTIA 4P6VF 4H0NA 3EZ7A 1C7RA 1O9HA 1G16A 5H1YA 1G20B 1MIHA 4XKJA 3ID6C 4TL9A 3VOBA 7ABPA 4M9RA 5BV8A 4OHOA 4KXUA 1V8PA 2F3UA 2H31A 4GR4A 4U7TB 4C7OA 4JSTA 1F14A 3IP9A 1LPNA 4TKZA 4J1TA 4BGUA 1BJRE 3T7AA 1ESCA 2YDXA 3BG5A 2X9LA 3PD7A 4X44A 3CMMA 621PA 1IEVA 3FHOA 1I3MA 3GFBA 2AKAB 1X1RA 1XTTA 3LO5A 1FB5A 4H4EA 4GYWA 4OYLA 5CT4A 1PFWA 3VOSA 3BF8A 2CXOA 4HJXA 1YZGA 1TZJA 1AVTA 4TXNA 1Y37A 2GSWA 3N86A 4M60A 2VI5A 5T8KA 1OIWA 2A94A 3G0IA 3T1OA 3ZV4A 3DEFA 4IJ5A 2PZLA 3GEBA 1A9RA 1MF7A 3OMLA 3PDCA 3MSCA 2PL9A 5IYZB 2Z1NA 2HLDA 2TYSB 2HMYB 2ADMA 3RPEA 4DNQA 1F3OA 3Q8MA 4LFCB 4IHQA 5KOJA 3K72B 3VR2D 1TXGA 2IC5A 1XTJA 2OESA 4WLFA 2BC9A 1MOSA 2QTHA 2PA3A 2IHZA 4Y2SA 5AW1A 2RHLA 4KPEC 3DLBA 3QTTA 2H2DA 1T6XA 3CA8A 3ZWNA 5HP4A 1GL6A 4IV8A 4MUNA 4B4OA 4UOEA 5KPDA 1CUEA 4NYIQ 2W2OA 4DMCA 3G88A 2CFTA 1RAHA 1JG7A 3LBYA 2G5CA 1B8UA 3HUTA 4I14A 5EQDA 1FSGA 2IOQA 3F4KA 5A7HA 3I5AA 4WN9B 3JD0A 3EG9B 1HT2E 3AGPA 1SOUA 4R1NA 3AOEC 4KBYA 3IUPA 3SMVA 3UXMA 4TYYA 5TMPA 1NFFA 2WEKA 4H1VA 4UBNA 5TX7A 2IXTA 3FYUA 4PHFA 2EU8A 5LBIA 3WIOA 1LDGA 1GCUA 1MJGM 1TUEA 1NY5A 2JJ1D 2IXAA 5TQ2B 2NVUB 4TKVA 1XQXA 3ZK7A 4HGPA 3WDKA 4FUTA 4O4IA 1E8MA 2C2GA 4KMSA 4QPZA 3X1WA 3BA6A 2W93A 3PE6A 4FTWA 4KK3A 5HG0A 3R4CA 4HFMA 4LZNA 4ZARA 5LU9A 4XOIA 4ZT7A 2HU7A 2ZRJA 1RRKA 1JAHA 1EINA 2CXNA 3B6KA 2JFWA 3E6AA 4KIFA 3QEJA 2QN6A 5C32A 3PBKA 1C0LA 3CNQS 4BCDA 3AUJB 3NC4A 1VHTA 3HDTA 4B6JA 4HNHA 1LSSA 2X9NA 2XUHA 1LFDB 1K88A 1KH2A 1ZM7A 2Y8EA 1PO7A 2VWPA 3AEUA 2ZB7A 4TS4A 4EGAA 5I7AA 3SHFA 5L95A 1SKAA 3DAFA 4HD8A 2OD2A 5FTJA 4WFKA 2I8LA 1ZFNA 1R6AA 2HRCA 2RAUA 1RZ3A 2YFKA 3EE6A 3N2KB 3WMXA 3ZIUA 1U1CA 4DIFA 3DH0A 2C7PA 3CZCA 4F3CA 2A33A 5T4BA 2JGKA 3LT2A 4NYIR 5DSZA 1KJZA 3GPDG 3V32A 1XAHA 1CUZA 1UWLA 2WINI 3CHYA 4GICA 4G0NA 1BH6A 3T52A 2HT1A 4Z2AA 2QRJA 4U7WA 2DY1A 2GF0A 4M8KA 5T67A 5C81A 4MGZR 3VHXB 2BGLA 2AUNA 4ESVA 1II0A 1QTNA 2WP0A 3IAUA 3LL7A 1U3CA 1TVKB 2X22A 3OESA 3QPWA 4U39A 5FL7D 3ZLJA 4UMVA 5JBQA 2V7GA 1RI2A 3AC0A 4OHUA 1MLDA 4FDAA 4G9BA 1KRWA 2BHRA 4FD3A 1DJNA 3X44A 3TZBA 1V45E 3LTEA 4FXPA 3BWCA 1FMLA 2MSDB 5E2BA 3C39A 2WWVD 4CLHA 3DBRB 4O6VA 3U7QB 2J59A 3KS9A 3E3NA 2X40A 2DYKA 2P5YA 4BFWA 4GOLD 2X4GA 4X0EA 3TNDA 2WMOB 1IQRA 1C1HA 1PEAA 3DTYA 3E22A 4OUDA 3V2UA 1SEVA 1D2MA 2ZT5A 4QDZA 3WDSA 5LOVF 2CT8A 1E6WA 4GECA 1ULHA 2EJBA 2PA0A 1FTYA 3AY7A 2EIHA 3BK2A 1SIUA 4D74A 1ZGAA 3E8XA 3ANNA 3MWDB 1ZH4A 4LI3X 2QG6A 5EKXA 1IZYA 3G0OA 4YMIA 4CKXA 5L7TA 2CY0A 3LBIA 3F6PA 3NHZA 3SDSA 1J09A 2HDNB 3A9TA 1GXSA 1OZHA 2IYFA 3EYWA 4MV7A 5FBZA 4C4SA 1RE1A 2L19A 2ZEJA 3RUHA 4CKEB 2JIDA 1FZQA 3IDSA 3OJEA 3QH4A 4DJTA 2DQKA 1B6SA 5KB3A 1IY0A 5DBEX 4LXTA 2FR1A 4IW3B 4UNSA 4L5CA 3QVWA 1TVCA 3EY4A 4MQEB 1KQFA 3LH5A 3GFQA 3EZ6A 3LBFA 3G9TA 1TAUA 4JVMA 3EIXA 1TKAA 4G5FA 4LWOA 1U2DA 4QOGA 2FFBA 3ZDZB 5BWMA 1TGVA 1Q7TA 3JQ9C 4HR7A 4GI3A 4CCYA 1NT2A 2FSIA 3ZX5A 4HXYA 1ABEA 2R2AA 2PDAA 1UMBA 4EPWA 5BSEA 3EZ9A 4JBIA 1E1RA 4Q05A 1MB3A 4DLUA 1QLWA 2CKMA 5A71A 2VAPA 1W47A 2QTZA 1B76A 3BZUA 3O26A 1YHYA 3K0SA 1TUGA 3OT1A 4MVXA 5KHOC 3HKBB 4NF2A 1Z35A 4BNJA 3QBDA 1RSZA 2PU5A 3CLUC 4KBFA 4W4TA 3TSZA 4EFMA 2VEOA 5