4MPPA

Crystal structure of benzoylformate decarboxylase mutant h281y/t377p/f397t/a460i
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
525
structure length
525
Chain Sequence
b'ASVHGTTYELLRRQGIDTVFGNPGSNELPFLKDFPEDFRYILALQEACVVGIADGYAQASRKPAFINLHSAAGTGNAMGALSNAWNSHSPLIVTAGQQTRAMIGVEALLTNVDAANLPRPLVKWSYEPASAAEVPHAMSRAIHMASMAPQGPVYLSVPYDDWDKDADPQSHHLFDRHVSSSVRLNDQDLDILVKALNSASNPAIVLGPDVDAANANADCVMLAERLKAPVWVAPSAPRCPFPTRHPCFRGLMPAGIAAISQLLEGHDVVLVIGAPVFRYYQYDPGQYLKPGTRLISVTCDPLEAARAPMGDAIVADIGAMASALANLVEESSRQLPTAAPEPAKVDQDAGRLHPETVFDTLNDMAPENAIYLNESPSTTAQMWQRLNMRNPGSYYTCAAGGLGFALPAAIGVQLAEPERQVIAVIGDGSANYSISALWTAAQYNIPTIFVIMNNGTYGILRWFAGVLEAENVPGLDVPGIDFRALAKGYGVQALKADNLEQLKGSLQEALSAKGPVLIEVSTVSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Benzoylformate decarboxylase
publication title A pseudo study of thiamin diphosphate-dependent decarboxylases
rcsb
source organism Pseudomonas putida
molecule tags Lyase
total genus 196
structure length 525
sequence length 525
ec nomenclature ec 4.1.1.7: Benzoylformate decarboxylase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00205 TPP_enzyme_M Thiamine pyrophosphate enzyme, central domain
A PF02775 TPP_enzyme_C Thiamine pyrophosphate enzyme, C-terminal TPP binding domain
A PF02776 TPP_enzyme_N Thiamine pyrophosphate enzyme, N-terminal TPP binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mppA03
3.40.50.970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4mppA01
3.40.50.1220 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold TPP-binding domain 4mppA02
4BN4A 1YHZA 2JGDB 1W85A 5FYQA 4KXVA 2W93A 4ZZIA 4UUBA 2VK4A 2XTAA 3RIMA 2PDAA 4KXQA 3CLSD 1U5BB 1UPBA 3L84A 4K9OA 5MGNA 1AY0A 2A1UA 4UTXA 1UMBB 2PGOA 1YI1A 1T9DA 4L2IA 4GM4A 1QS0B 2R8OA 1OVMA 3LQ4A 3ZHTA 3RIYA 1S5PA 2AG1A 1V16A 2EZ8A 3GLRA 1UMBA 2PGNA 4JD5A 2OORC 2Q5LA 5C4IA 2FSVC 3CLUD 1QS0A 3AHCA 4C7VA 5MF6A 4UTNA 1BFDA 2VBFA 4UTZA 3EXFA 2H4FA 3IAFA 1S7GA 2YICA 4BVFA 1V11B 4JU9A 4C7BA 5BWNA 2JI6A 5EJMA 5IMSA 1V11A 4KGDA 5MFPA 3EXIB 2BRUC 1JSCA 1X80B 1WCIB 4Y6QA 4F4UA 4K9NA 4F56A 3ZHVA 2C42A 5K6RA 2BFDB 4IG9A 2JI9A 2V3WA 2FRDC 5DGDA 3EXIA 3F6BX 5EJ4A 1X80A 3IAEA 1WCIA 4COKA 4MZXA 3ZG6A 1YC5A 4X3OA 2BFDA 2BFFB 2BEVB 4BN5A 3D81A 2A1TR 2IHUA 1TKCA 1M2KA 3DV0B 1X7WA 4O8ZA 1MA3A 5BWOA 1YHYA 2BFFA 5HYVA 4JUDX 2BEVA 1V5GA 4GG1A 4FVTA 3U3DA 2OD9A 3LQ1A 3DV0A 2QQGA 3MOSA 1PI3A 2JI8A 3CF4G 1PNQA 4Y6LA 2VK8A 3OE1A 3ZHQA 3M6LA 1EFVA 5EJAA 1DTWB 1YI0A 4XEUA 2PANA 3ZHSA 1V5EA 3FLMA 4K9PA 2C3UA 5ERYA 1V1MB 4FEGA 2C3YA 2WVGA 1DTWA 2G28A 1PVDA 1OZFA 1PTJC 3GLSA 1OLXB 1D4OA 2O1XA 1V1MA 3FZNA 1J8FA 2E6KA 4C7XA 5HJEA 1MCZA 4JUAA 1RP7A 2EZTA 2H59A 3HWWA 1KEKA 1OLXA 1V16B 3AHEA 2XT9A 4K9LA 3EXEB 2FN3A 4UU7A 4GM0A 3KOMA 4KXWA 5K3SA 1O97D 2HJHA 1YD7A 1YBHA 4GM1A 1M2JA 2C3MA 3GLUA 4QQ8A 4K9MA 2QTCA 5ESDA 4JT9A 3EXEA 3EXFB 2OZLB 1NI4B 4D5EA 5EJ7A 4JUBA 5FEMA 1OLSB 5EJ9A 5DEIA 1V5FA 1L8AA 1Z8NA 3UPTA 4QELA 2OZLA 2UZ1B 1NI4A 1UMDB 2Y0PA 1OLSA 1Q17A 1OLUB 3PDHA 4JSRA 1DJLA 3AI7A 4Y6OA 4R8MA 3ZGOA 4MPRA 3GLTA 2IHVA 1SZDA 2H2DA 4RJKA 2UZ1A 2C3OA 1UMDA 1OLUA 3EYAA 2JLCA 1T9CA 1Q14A 3EA4A 3HWX1 1T9AA 1SZCA 4X3PA 2FR8C 3AHJA 3AHIA 1X7WB 2H4JA 1X7YB 1R9JA 4ZP1A 4FZ3A 1HZZC 2BFCB 1QPBA 4K9QA 3EXG2 1QGDA 3LQ2A 1W88B 2FWNA 1PNOA 4JUFA 4IAOA 1T9BA 1X7YA 1NGSA 4L3OA 1IK6A 2JLAA 3DUFB 2BFCA 4BVGA 4HD8A 1M2HA 1W88A 3RIGA 4KXYA 4RJJA 2JIBA 4K9KA 5K6TA 1E3TA 2IHTA 1GPUA 3DUFA 3U31A 1TRKA 1UMCB 4JU8A 4V1CI 1X7ZA 3CLTD 2Q5JA 1O96B 1TKAA 1OZGA 5I5GA 1ICIA 3M7IA 1UMCA 2EZ9A 5EXDA 5K2OA 4QPZA 5EJ6A 1U2GC 1PO7A 5EXEA 4I5IA 3OOYA 3K35A 5I51A 2BFEA 3M34A 4UUAA 4BV2A 2H2HA 1TKBA 5D7NA 3PKJA 4J1TC 4KPUA 3EXHC 3ZHUA 2OO5C 2G67A 2C31A 1M2NA 2J9FB 4UU8A 2YIDA 3AHGA 1U31A 4JUCA 2Q28A 2BFBB 2B4YA 4G1CA 1YNOA 2JGDA 2VBGA 2J9FA 1YC2A 2VK1A 3D7KA 1U28C 1POXA 2Q29A 2BFBA 5I4IA 3E9YA 1POWA 3EXG1 1U5BA 4IF6A 3FSJX 2NXWA 1NM5C 2Q5OA 2WVHA 3EXHB 3AHDA 4BVBA 4UTRA 2H2GA 2IEAA 4J16C 2QQFA 2R8PA 1YTLA 3EXHA 3DVAB 4UTVA 5HHTA 2Q27A 4MQ5A 3LPLA 2WVAA 4KXUA 2C3PA 4FEEA 2X7JA 1ZPDA 1X7XB 2BP7B 2XT6A 5MFZA 4MPPA 3ZGVA 4V1CB 5EJ8A 3DVAA 4Q9DA 1UPAA 4RMHA 3AHHA 1PYDA 1Y9DA 1M2GA 4D5GA 4C78A 2QTAA 2BP7A 1X7XA 3EY9A 4GPEA 4RJIA 2NYRA 5DGTA 4KXXA 4V1CA 2AG0A 1Q6ZA 3D4BA 4RMGA 5HGXA 2H4HA 2UZAA 2H2IA 1UM9B 4WBXC 2R5NA 2OD7A 2BEWB 4RMIA 3JR3A 2EZUA 5ERXA 4MPJA 1X7ZB 1UM9A 1UPCA 1XLTC 1B0PA 2O1SA 4BVEA 2JI7A 3AHFA 2BEWA 5I5EA 4RMJA 4TWJA 1Q1AA 1OZHA 2G25A 3F6EX 1EFPA 5AHKA 4BVHA 3PKIA 1V1RB 2BEUB 2BFEB 3UK1A 2EZ4A 2VJYA 1PT9A 4TWIA 3HYLA 2VBIA 2OD2A 2H2FA 3ZHRA 1V1RA 1N0HA 2BEUA 2Q5QA 3M49A 1ITZA 5EJ5A 5BWLA 3JWPA 1W85B 2DJIA 4GP9A 4HDAA 4BUZA 4JT8A 4BV3A 1U2DC 3CLRD
chains in the Genus database with same CATH superfamily
3PJEA 2J4DA 3A1CA 3GMDA 3N8KA 5HZGA 1VGVA 2HTFA 2LP4Y 3O8OB 4Q1EA 4QAQA 5FYQA 4GX1A 2I7DA 5IBCA 1CIPA 1NVGA 1KJNA 4QRHA 1WW3A 5DMHA 3WRYA 1S2LA 1VPWA 1GL6A 3OWHA 1JI0A 4AU1A 2R8EA 4LX8A 1ECBA 1A2QA 4M4SA 4BNKA 3H16A 1BVRA 1T3LA 4EA6A 1IZ0A 2N47A 1H8HA 4KR6A 4V0KA 4XYLA 1BN7A 4ICIA 1QFYA 1ZKDA 1PJ8A 2WHPB 2AN4A 3ICCA 4ZJPA 1DPGA 1FW6A 4L3WA 4L2IA 3KPYA 4LQCA 2V9ZA 2CWWA 3GVHA 1SB9A 3LFTA 1QS0B 2FW9A 5EMKA 3RS4A 1CB7A 4EMTA 2D2EA 4M1SA 1TRHA 6LDHA 1QE5A 4L7QA 2I7CA 1FDRA 4KIFA 4I1SA 3TF5A 1ND5A 2OORC 4AF6A 1E9RA 1TF7A 2QLTA 3EMKA 4HH3C 4J9VA 3ZY4A 1YQUA 1DFIA 1FNSA 2RDMA 2B61A 1FTGA 2PLFA 3CLUD 1TTTA 2BGRA 4G09A 3I92A 3I28A 4RXUA 1RYHA 3GLGB 2CZQA 1SRRA 3N53A 1YE8A 1XZNA 4OHMA 2IH4A 1U0RA 4IJKA 1REQA 2P2LA 4FMPA 2YINC 1IDN1 1CQJB 1YBFA 3MTBA 5FTNA 5DNEA 3AEXA 3E22B 4BKUA 3MC1A 2IEGA 3COSA 5CT5A 5IW8A 1YQEA 3TQTA 3ROFA 1VJTA 3WK4A 4OLAA 1AKYA 1QXSA 1O6CA 2JLUA 2FDRA 1I24A 4NCAA 1JDBC 2CK3D 4DEXA 1XEWY 4ZCLA 4XWAA 2YV5A 4L9WA 5JTTA 4EYGA 1WA5A 1F2TB 1JG1A 1HKUA 1UWCA 1J06A 1NJSA 2QW8A 4NIMA 2EOAA 4F0JA 4Q66C 1XJ0A 3DL7A 4IJWA 1ZGCA 1I10A 4FDAA 5L3SB 3VZRA 3U16A 4QM6A 4NWIA 2JJ8A 2G1AA 3OSZA 4Q4HB 1AQUA 2XKKA 3GVPA 5JVDA 1FFDA 1JSCA 3TL6A 1TM7E 3LTNC 4IIYA 2OA0A 4OQMA 4PQEA 4K9NA 4EY8A 2P2ZA 4URYR 1XDSA 3L04A 2C42A 3MIIA 3QF4A 1YONA 4P4UA 2GPWA 1K3UB 5JYDA 4PPFA 1B15A 2C03A 1I3KA 3HM9A 4F1KA 3F6BX 3CINA 4XJSA 3T5BA 1A71A 2FSVA 1T8TA 1BO6A 3KJIA 1TFRA 3WLLA 3R24A 4LAFA 4O2AF 1NQTA 5MGBA 1EWVA 4ID3A 1DO2A 1FLVA 2BFFB 1ZINA 2X5XA 2YXBA 3VU9A 3D81A 3DXXA 3EGEA 5DP2A 5A6SB 3NWOA 3CNHA 3O93A 3HCOA 1XMJA 2H07A 1ZW1A 3WI7A 2Z8ZA 2AW5A 2DFPA 2YW9A 3A6DA 5KYTA 4C7OB 2WJZB 4I14A 3MMXA 4C4TA 4EW2A 4FPXA 4PONA 5FKJA 2WWWA 1O8BA 2NO9A 2WIBA 4HGQA 5K4AA 3SSMA 4C7MA 5A06A 5KYYB 3RC1A 1Z6AA 4HF7A 3ZVRA 1KZGB 3VU3A 4F38A 5BVHA 1ZK1A 1JWBB 3U3DA 3C6QA 3KHSA 3WYFA 4J91A 2NVOA 4XSHA 3QE3A 4NG4A 2OV4A 4OGKA 4WT7A 3UBTA 4TZ6A 3WZLA 1DOZA 1JR3D 2QPTA 4PFSA 2EHDA 5FCDA 2X1HA 5FF9A 3JQ9C 5H16A 4KR2A 1ZMOA 4XZ3A 1SIUA 3LVBA 1NBHA 2GLUA 2WSSA 4GE3A 1SKAA 1I4LD 2X22A 3WLSA 3WWYA 4WCDA 4BV3A 4HQLA 1I6MA 3H2HA 3GLIB 4R0VA 1WB4A 2Z5GA 3ORSA 1H6BA 3DWIA 3S6JA 1BVYF 1KNXA 1G8MA 1RXSA 3AUKA 5IPFA 3Q5DA 1IOWA 1GA6A 1KAQA 2D5AA 2HUPA 3BWMA 4MI9A 2UUPA 4OKSA 4TV9F 2OPHA 1MVOA 1PP4A 3PFFA 4JFAA 3K9WA 3NYRA 1PWZA 3QKRA 1NT2A 5FO1A 1MF7A 1KR2A 4WZBB 3QMPA 1P0IA 2PT6A 3FZNA 3E58A 2ZLBA 1Y63A 4LRWA 2BEKA 4IQ8A 5HKLA 3I9NA 5LU8A 4YJ3F 3RJZA 121PA 4PX3A 2PLRA 1P60A 3OJ0A 1NU8A 3BS4A 2W6JA 4C7JA 4EKNB 1TUIA 5K9ZA 1ZHOA 3QU5A 2PZLA 1WZNA 4I9FA 4Z4GA 1KIMA 2AQKA 3EXEB 4EL0A 1XVTA 4I1PA 2UU9B 5A4AA 1GZ4A 2XUQA 3K31A 2I2FA 1QANA 3CF0A 3QJ5A 5K3SA 3AKZA 4HAUA 3SYLA 1RC1A 3PFBA 3MB8A 1PZFA 3L8EA 2CLHB 3KXLA 4FGJA 5G0TA 3OLWA 1CUGA 1MLDA 4QNRA 4K9MA 3U37A 2G07A 3WWEA 3IODA 2UZIR 4V0LA 3D6FA 1BDIA 4JJFA 2OZLB 3GPCA 4RVSA 3EUEA 4OQFA 4BRSA 5DEIA 3H04A 1XA3A 4MYUA 2QM8A 1KFJB 4N54A 1RIFA 1QVRA 4K3VA 4N4AA 4F06A 1Z39A 1B42A 1NQUA 1W9MA 2YZ2A 5LLSA 4BO2A 2A92A 1TCUA 3H5TA 4OBXA 1BRMA 3EVDA 3L0OA 1FZQA 5C7YA 3K9LA 4HGPA 1LSOA 3DTNA 3K20A 4TSFA 3U7FB 3QMVA 2E21A 1DHTA 3LA6A 4CV1A 4MPRA 3UYLA 1PV1A 1HDEA 1V95A 5LBIA 5KTNA 1FYDA 3M3HA 1FFGA 5ESRA 1CX9B 3FXAA 2H11A 1OVGA 1N2IA 2VS1A 5DXAA 1XCOA 1AGPA 4R4JA 2QUJA 1SZJG 2ZROA 1SU8A 2ZRLA 2CJWA 10MHA 4LWOA 3D0OA 4OQPA 4YECA 2BWJA 2RI1A 4XX0A 2FUG6 3VYTB 4W82A 4BBPA 3QKTA 5AK3A 3RYIB 3LCRA 3WBBA 3LZDA 3MJEA 1WU7A 4OYYA 1XRPA 3BYZA 5HIMA 3FPSA 3NBMA 2ZUTA 1CJUC 1OBCA 4P38A 4WJZA 4EHKA 2R1VB 4Z6KA 1IEXA 4F1JA 1M72A 2Q7XA 2IODA 5CDYA 3C3WA 1N5JA 1T2AA 1G6OA 3C8HA 4DCOA 3NT2A 3T3HA 4C6TA 2GBPA 2NPOA 2W2XA 3O8BA 1L7RA 2WU0A 2EKZA 2O8NA 3E9MA 4XOIA 5AKGA 5JC8A 5KX5A 2DBZA 5CH3A 4A82A 1G5TA 1PJLA 3HB7A 2OEPA 4ON9A 4BO8A 1W88B 3UOAB 5EUQB 3TI9A 2QVXX 2YYAA 2NUAA 1RWKA 3ZZUA 2YWXA 3I6ZA 1Z4NA 2IEIA 2GEBA 3RYFA 5KUTA 1L0BA 2VR1A 3R0ZA 3HM2A 4D42A 5K6AA 1I2DA 4K7JA 3OFSA 3INGA 3OQPA 3RSHA 2Z43A 4HD8A 4YPFA 4I1VA 2HD4A 2QX6A 1T43A 1FFBA 3LUAA 3MLAA 4PTZA 1DTSA 2CXXA 3PYXA 1AN0A 1OWLA 4LGCA 4DLXA 2H5LA 4NYIQ 4E14A 2HU5A 4Y6PA 3MT0A 3R7BA 3GA0A 2PXHA 5LP6F 5AWFC 3OHPA 1OUMA 2H54A 5HSGA 5FDFA 2FQXA 1SOUA 3D4IA 1EJ2A 4Y0VA 2VAVA 4EI9A 5I6DA 3UQZA 4Y9RA 2OGSA 2CNBA 4JYAB 4V3CA 1TJYA 1SM4A 1KTVA 3PJRA 3A4YA 2J67A 4OOEA 4Q82A 1P1FA 5A3JA 5D5HA 5F7XA 4BHTA 1MORA 4RTSA 1P4RA 3KWJA 4TL9A 3BGIA 3V48A 3WLFA 2I6UA 3IAXA 5BSGA 3EFOA 1EKXA 5HF9A 1W4RA 1U7HA 1FXWA 2ZI6A 1C8LA 4NMXB 1K8YB 4RGQA 3AJ8A 2ZBQA 4KH1A 3S3TA 3HVHA 2H0QA 2DPLA 1GNLA 1OBHA 2JAWA 3V7UA 4RK7A 2ZUEA 1SCJA 3JRWA 1DAIA 1ENOA 2D4HA 3CB4A 4NTZA 1KMQA 5FLKA 3RSFA 1UDRA 4D81A 1BCSB 4GXNA 4F85A 2E1PA 1OFIA 1TZ2A 2PH7A 3ETCA 3OY2A 3ETJA 4OMFG 5JCJA 2YZNA 1H94A 1OI3A 1T9GS 2C2KA 2WWHA 5I7SA 4KAAA 4I9HA 3E7XA 1TZMA 1M66A 3AKCA 3RT7A 1J0CA 4C6RA 1L1FA 5LPNA 3K16A 1W0JA 4QGGA 1UFQA 2RAFA 4M0PA 4OF4A 4QJ5A 5T4FA 1R0SA 3EUAA 3EZ6A 4HNSA 4HWKA 5KWSA 2NZUG 1QHHB 2VDLB 1DZ3A 2AC2A 2QM0A 3KZMA 4Q9NA 2P4SA 3DTYA 2QD1A 3U7RA 3OQNA 4OQNA 2JGFA 3AI2A 2WD7B 2YIDA 1CYDA 1QRDA 3QY0A 3MYYA 4U39A 3LUJA 2G71A 1K0UA 3RHSA 2PUBA 5GOTA 2GTIA 3KLNA 3BULA 1T2EA 1XG5A 3NHJA 2A30A 4JNKA 4OU4A 1YNOA 3T3NA 3GZNB 1KH1A 3M8KA 3UMFA 2GZAA 4RY8A 1U9IC 2Y99A 3I1IA 3SPXA 4RYDA 2B21A 1JE1A 3TD2A 2GEUA 4W5HA 2Z57A 5BRAA 2C2HA 3HEMA 1POXA 3HU2A 1O2DA 3TAUA 5CPBA 2H6EA 3ET5A 5E7IA 2QMQA 3BHIA 3GGJA 1XZPA 3HDQA 4FHFA 4Z3KA 2BMAA 3B5JA 2PH1A 5FWXB 3WWZA 1F4LA 2W6CX 3CUTA 3KAKA 3KAJA 3NNNA 2QRJA 3GV0A 1N32B 4JK3A 4HZUB 2EQAA 3BXFA 2AOWA 4HDNA 4CKBB 3RAFC 4JX9A 4YUWA 2J0SA 1N2CA 2IY7A 3DZFA 2PKRA 4ETNA 5L40A 4HYEA 3AR3A 3MQFA 1UAGA 1PJTA 2F9FA 1B0ZA 4UTRA 4MGKR 3G7SA 2LV8A 4JLVA 1HC7A 4RTPA 2QQFA 1ZD5A 4JVSB 3W3AH 1PBTA 4KMSA 3WMEA 4DG8A 4ZZ1A 4E94A 3R3WA 1RI4A 3HN2A 4I1OA 5C8VA 3B9RA 2BGIA 5GY7A 5FO0A 2VF8A 2CXUA 3LPLA 1D2EA 5HMLA 2XQJA 1HDOA 3SX4A 4J94A 3RIEA 1V4VA 3G1TA 3I9MA 4DSNA 4S24A 2XTMA 5EKSA 3SP1A 4V1CB 1CULC 1Z12A 3B2EA 3SR3A 3GH1A 3JASA 2V7BA 1UPAA 2RONA 3LCJA 3JQAA 3OZDA 5B1HA 2W98A 1GUFA 2WQ7A 1JSXA 5GJCA 3RWOA 2Q49A 5J59A 2VWPA 1USUA 3F74A 3O8QB 3T4EA 4NS4A 1SA0B 2XD9A 1GLVA 3INRA 8ABPA 1GEGA 3S8EA 3PHJA 1R16A 3JPWA 1O9GA 4J3NA 1HDGO 2R5NA 3E8MA 5TDHA 3RARA 4DMMA 1P9NA 1YXMA 4HC4A 4Q4JA 1TCCA 5ALSA 3OTOB 4A6EA 3FGNA 4ODIA 4R5MA 5AVSA 1XALA 2OORA 2BDEA 1PJ3A 1XTPA 4UEKA 2ODEA 3IUEA 1YU9A 3TRKA 4WUVA 2AN5A 3HCCA 3WDLA 3NYIA 1L7MA 1WTAA 4PC6A 2ZYUX 4ZVOA 2Q9BA 4BVEA 2NZJA 1E3DA 2C8JA 2Z83A 2MSEB 1NWCA 3DOIA 3Q5GA 1JU4A 2DYKA 4XD2A 1KDVA 4AUMA 4EHBA 4Q7QA 5EZ5A 1YQTA 4MQEA 4OFXA 3IL2A 3Q12A 2C5FA 3ZZNA 4DR1B 2OCPA 4MQ4A 4OATA 3GJYA 4NAUA 2CFTA 2EBUA 3HNPA 1IOVA 1NBMD 2DHDA 2I4IA 1N1DA 1L8OA 4MO2A 4PC1A 2WP8J 1EWYA 1WF6A 1XTZA 1F2VA 5FBHA 1CJSA 2O2EA 3UWKA 1U3VA 3TW8B 2JJQA 2QG9A 2GUWA 1LCIA 2NADA 3F5MA 4J0FA 5TS3A 1YF3A 5GONA 1RC8A 2JARA 4WN9A 5D8DA 1MQAA 4DLLA 1ZI8A 4J3JA 1B73A 1ZU4A 2G4LA 2HRRA 3CX3A 3IAM1 3Q1LA 4G1UC 5H9VA 1KDYA 4FKMA 4WTOA 2PTGA 3VDMA 3PGXA 3UK6A 3HP7A 4CLRB 4JVNA 3BBLA 4UAJA 2ZIXB 3FCYA 2IQIA 3SIXA 5KQSA 1QQ5A 2IYVA 4GH5A 1SBIA 5G0WA 2H5EA 4RLQA 1NL3A 1WCXA 3PHBE 3KU4A 1NC3A 4PICA 5FI5A 2FLWA 2B5VA 1LPNA 2KS6A 3FFWA 2JK0A 2PU5A 1WDKA 2HH9A 3JALA 4NNOA 2JFGA 4HDAA 4NH4A 5G1PA 1D6NA 2ALJA 2W8BB 1WXWA 2MYTA 1P2UA 4DPLA 1BS2A 1KOLA 5AVKA 2JHAA 4GWKA 4EZIA 2ZRQA 4OUDB 3W3AD 2WB4A 4DT1A 3DHVA 1C9YA 2RCYA 5E4YA 3VUEA 1T6ZA 3P9SA 3QVLA 1KS9A 1NP7A 4ZCPA 3SE7A 4ZMSA 1W85A 3ILYA 4OQLA 4QYIA 3GDGA 4RVNA 4JXZA 1YQDA 6GPBA 3EZXA 1KSHA 3O1LA 4FFWA 3NVDA 4L5CA 3SBXA 3UOGA 3ND5A 4BV9A 1AXGA 1C0LA 2B2CA 4KXNA 1WXDA 3UOWA 4WAUA 4HSGA 3WIVA 1G8SA 2MYUA 2P6OA 4BMYA 1DOHA 4KV9A 5CYOA 1RJ9B 2FWPA 3WGUA 4BLVA 1N5KA 1M1YE 5KDDA 4OBEA 2GEKA 1UADA 2PIAA 2NVWA 3HJTA 3UVEA 3WZ2A 3U7GA 4I4CA 1K5HA 3PLAE 1WAMA 4RVGA 4UUPA 2FV8A 3SC6A 1OHHD 4FWBA 3O92A 1X2BA 3M6FA 3R44A 2VRBA 4H7HA 3D7MA 1LLCA 3HFJA 2IU3A 3D3EA 4GZ6A 1Q3HA 4M2LA 4GKJB 1P61B 1KFKB 1U90A 3H9BA 2WIAA 3I04M 4KZKA 5HS4A 1A82A 1E3LA 2R8OA 3EFBA 3LQ4A 3NZEA 4REQA 1T2FA 3MJVA 4EELA 2PKYX 3TNFA 3JD0A 3N0RA 3O8CA 4D3YA 3GT4A 3KLOA 1UMBA 2CXHA 3L40A 4G5HA 3V2UA 5AVRA 2FEOA 2Y1DA 4G5FA 1R27A 4OH1A 4YAIA 1LSUA 5C4IA 1S02A 4ZREA 1P0CA 1OGYA 1SCAA 2NGRA 2H17A 1HFEL 4KODA 4URFA 3EG9A 2IGTA 3F5DA 4YC7A 4GKKB 5KAMA 1R4NB 3EQZA 2AEMA 4CCYB 2D1FA 5J40A 3NHBA 1W2HA 1ZL0A 2CHGA 4EPXA 2PSDA 2PEZA 2DVMA 1DBSA 5AW2A 3X0DA 5J23A 4TMWA 5D1HA 5MN5A 4N7RA 1KH2A 3PHLA 1P1CA 4HEHA 4FFMA 2I1QA 3HGQA 4PAWA 5GQSA 1K7YA 4WZ6A 3ZNNA 4AMVA 4BKRA 4TSRA 2A1IA 2P35A 3HY4A 3MGCA 1E1QD 3O75A 4KMOA 5BNTA 2X8WA 4K6OA 1WUHS 2Y2UA 4HVLA 4CXMA 1HGXA 1DCMA 1V11B 5K0BA 5KZMB 4OY3A 4WZAB 2BZ1A 2WYUA 3CBQA 2ECQA 2X77A 4RD6A 2IEBA 3R76A 4MGHA 3I52A 4U7WA 4XXHA 2VT2A 1O95C 1NI3A 3UFXB 1CY0A 2EATA 5K0TA 5AM0A 1GTZA 1NBWB 5IMSA 3G88A 3QVVA 2WWTA 4U9HS 1HOXA 3J80A 1DKUA 3EXIB 1J23A 3DZCA 2FPIB 4E21A 3ZDFA 1RQGA 3PGLA 1BVHA 2PD6A 3TAXA 2F7SA 3X2EA 3HC7A 2BGWA 2R6AA 4BMDA 3EVBA 1VMKA 4YT5A 3QENA 2A88A 2QK4A 3TLBA 3L7DA 4H7DA 1QLHA 4AZSA 2A9FA 2VT3A 2ZCJA 1N0VC 1YMVA 2QF7A 4QRIA 5DGDA 3N7UA 2HF2A 2E82A 1GFWA 4WW0A 3DLCA 1G64A 5DNWA 4JC8A 1YVUA 1P7YA 4FFOA 4K03A 2FZEA 3WK8A 5CEJA 2Q46A 2R00A 2VPQA 3VOBA 5JQGB 3NDPA 5DBFA 3DCJA 4A5OA 3MCUA 3G9ZA 3OX4A 3V32A 1E98A 1RTKA 3IVRA 2A1TR 3NHKA 1UM8A 4E1VA 4PG4A 2IHUA 2NO7A 2ACVA 1TO6A 1QGYA 1MVLA 2EBFX 4UMDA 2EJCA 3FETA 3U4DA 3TUZC 1SCIA 2F1KA 1ZD1A 4QT0A 4QUGA 5EERA 5CLQA 1I32A 3AVYA 4YV2A 1DHRA 1XYYA 1Z7WA 3PEEA 1BGWA 4RFLA 4JI8B 1AKNA 3ORQA 1YHYA 3TLXA 5FLEX 4HZIA 1PQWA 1EFVB 4PG7A 4BJ6A 2DETA 1RKVA 3DE1X 3I04A 1J9GA 3PQFA 2QQGA 3OPYA 4XIJA 2JI8A 1DCTA 4Y9SA 2XA2A 4G5XA 5ICMA 3OOEA 3O4VA 3IHTA 2C7PA 3TLZA 1K4MA 4XR9A 2JBAB 4IH1A 3C8ZA 5KVQA 4U7GA 3VC1A 1N2XA 2QBYA 3M6LA 4R2JA 3LHFA 3W5SA 1UEIA 3ICEA 3D0QA 1I7SB 2W6ZA 5TR9A 1NY5A 3SDBA 3VKGA 2FOLA 3MEQA 4IJ6A 4CKCA 1OH8A 4EG7A 3SM3A 1GCAA 1GGMA 1A7JA 4XOUA 3SF8A 1HEIA 1ZQ1A 2BFWA 3FFAA 3ZDDA 1KO4A 3SBDA 1E18A 4EF4A 4ZI7B 3JQCA 2OR3A 2PZKA 1ZH4A 5A71A 3WDSA 3N2KA 1B3RA 1FQKA 2IUFA 2JGEA 2P1ZA 3BL5A 1VL1A 1MXFA 1ZEJA 3QUAA 1WBDA 3BICA 3GLSA 4M0CA 3GVIA 4G65A 2ENUA 1K68A 2ODWA 2BJWA 4UFNA 5ICFA 3X1DA 2VP5A 1KQFA 3DPIA 4F4DA 1QJ4A 1THGA 1G4HA 4OHCA 4D0NA 3HMKA 3L05A 3CLRC 3OZRA 3STWA 3TIXB 3TLKA 3FCSB 1L4HA 3C6BA 1UZAA 2R97A 4O4IF 1O77A 4ENTA 5CDUA 5AVQA 1XPOA 4RETA 1GZVA 1NX6A 1MJGM 1Y3DE 1VMAA 1ZICA 1E8DA 3KJFA 4BZZA 4NY1A 4BFZA 3OX3A 2DPYA 4QICA 3LCVB 3UMYA 2XZPA 2ZK7A 3K1JA 3PA8A 4DOMA 1E2FA 1Z82A 3VSAA 2IL1A 4UU7A 2HSEA 4TMVA 2JIRA 4IXDA 2DQYA 4KXWA 2H51A 3JY6A 3NWBA 1ZRSA 1PX0A 5J5AA 4OXXA 5KB3A 4HOYA 5CB4B 3U1TA 2D0DA 4GBGA 3IP6A 3PSAA 4TRNA 1O6FA 4RCVA 5M5BA 1XLWA 1EQAA 2HREA 1UDWA 3HXTA 1E63A 5GJVC 3VR4D 3VMFA 4EG1A 3TGPA 5C51B 1XU7A 4JUBA 2QN2A 5T64A 2BFOA 4BNMA 1VL6A 2W9XA 4GPD1 2B25A 2GFQA 1JS1X 3PG5A 5ECDA 3PGJA 4OI4A 2NSYA 4R0NA 3FDZB 3KB8A 2JLZA 4RX1A 1FNBA 2DFKB 3VPSA 4XTCS 1V6AA 2QY6A 3Q98A 5ALXA 3WK5A 4BDSA 4JZKA 5LD2B 2G88A 3CUWA 4O4JA 4YCNA 2C2ZA 4U7FA 2PXCA 2WF6A 2C1ZA 2X14A 1XIVA 2X8JB 3C4QA 2ZYAA 4FOPA 4UDYX 1EIZA 4YRSA 3UA3A 3TOZA 1DJLA 1PT8A 1ZA1A 2X13A 1Y1PA 4RLFA 3ZK8A 4EHJA 1E8MA 2GCEA 4BE4A 1TF2A 1WZ2A 3A2KA 5CB6A 2LIVA 2PSHA 4XLLA 2CKDA 2FPGB 5CXXA 2VTBB 5T41A 4LC1A 1QHYA 4IX1A 1ZNXA 2ZIVB 2ZE8A 3SZ3A 1A8UA 1EDBA 4P82A 2ZUBA 1BIFA 4TT8A 1BHO1 3WNQA 4YRMA 1T26A 1WD5A 1QGUB 1A9TA 1TUBA 2J9ZB 3H5AA 1DJMA 4GLFA 4D96A 4OP3A 3WNDA 4CL3A 4D56A 2J0VA 1T9CA 1ZNQO 3SLGA 1JEAA 1ML4A 1YOVA 3EZFA 3JWHA 1ADYA 4XVRA 1P1BA 1C3XA 2OY0A 4NPCA 1SXJA 5F5XA 3GLFB 2R0QC 1UZNA 2JF0A 3ZBTA 4RF2A 2FF7A 3C4VA 3DBIA 4MYHA 3F4KA 2PWPA 1P7PA 1SR8A 3B89A 1OC4A 1JQ5A 1L7BA 2OHOA 2X9GA 4FHCA 4HUQB 4RO0A 3KJXA 1G63A 2MINB 2GZMA 3JWJA 2XKBA 4ZYZA 3J81k 3WMRA 1FU4A 4DVJA 3KPJA 4RA6A 1GN9A 1LDNA 4RH3A 5FBVB 4MAAA 2CXNA 4CV3A 3IVXA 3BXXA 4DE5A 4BNNA 1EESA 1NPTO 2Z0MA 1WSBA 5HTOA 1MJGA 4ZI5A 2REBA 4JOQA 2QJRA 1CQIA 3H17A 4L3OA 4KR7A 3ELUA 2XOKA 3ECCA 1WHSA 4G0UA 4CEIA 2NU8B 4DMGA 1P0QA 2PIDA 3OA0A 4JP2A 4BVGA 3UFBA 2CLMB 4MLZA 4HJXA 1PJCA 4KXYA 4ZI2A 4ENVA 2JIBA 1N6PA 4K9KA 2YWCA 5IS2A 4KQEA 4GSYA 2FF5A 2AI3A 5IG2A 4CMBA 5C5IA 2CT8A 3H1BA 3IHKA 2V8BA 1IATA 1IYZA 2H2WA 4RVDA 4QFDA 1CS0A 2DHEA 1SIBE 3BE5A 3E5RA 1I2BA 1XU9A 3ZI0A 2AX3A 3S2SA 1OZGA 3E2MA 2WYIA 3HCFA 1DAKA 1G7RA 1YKSA 3L2OB 2I78A 1P5FA 1AH2A 1VG8A 2OCIA 1JALA 4CIDA 2JAOA 1ICIA 1YL6A 2JAPA 3H0KA 3TQOA 3WXMA 4EVSA 1DAFA 3U1VA 4HP8A 3RVRA 5IMBA 2FFAA 3E5MA 5J9FA 5CDFA 4EJ0A 4JS0A 3I6YA 3WP1B 1CRLA 2GM5A 3WQBA 3IX7A 2GRUA 1UBFA 3U4QB 4RM3A 4HDRB 1ECJA 1HRKA 3MJFA 4WLUA 3TLYA 5KWIA 2YMQA 1GZSA 1WD7A 3DLIA 2WIDA 4KVAA 2P77A 3WBKA 4ZHQB 2UYHA 4BB9A 2QRGA 4J43A 1R9GA 3T0FA 4B5KA 4DIKA 2UYYA 3CNBA 3W05A 5AOAA 4EITA 3ONNA 1ORWA 3OJXA 1ZSYA 4RQUA 5HIKA 1P9WA 3DAFA 5DISB 3UJCA 3NHLA 3PR1A 2DBRA 4CZ2A 2AA3A 2B1IA 3EXHC 1GTMA 3SC2B 1YMQA 2XOXA 4FQ7A 3D7LA 4KIJA 3UN1A 3HACA 1VI6A 4M1QA 4M49A 4OHWA 1KYZA 2Y0EA 5F9HA 4ZOBA 4CQMB 1MO4A 3BE6A 3MIZA 3G2IA 4HVTA 3MM4A 3OHSX 1U31A 1BEEA 3FMGA 4FC6A 3LSYA 1DAEA 1NASA 4PPNA 5CLFA 3KQPA 2OILA 1N2GA 2XDWA 3P8ZA 2I33A 1DQNA 1QG2A 1PR9A 4XJXA 4YUXA 4ZVVA 1Q57A 3RC9A 3Q87B 2HSGA 1IIBA 1O6GA 3W0LB 1YC2A 3G89A 1T0UA 1TYEB 4CLOB 4DCGA 1T29A 2VPZA 3GGSA 4PZUA 2H1VA 1Z18A 2VHUA 3A3KA 3UMGA 1DX9A 1H5QA 3H1PA 1QBKC 1R8SA 3PUVA 3BOSA 4Q24A 1KE2A 3ZBPA 3PDUA 4AG5A 4GXTA 4KDEA 3M4JA 3ZLVA 1X74A 1I5RA 1B93A 1E3WA 3JU3A 4TT3D 1VPDA 4DYHA 4J1QA 2ZBEA 1UAYA 4K26A 4TMZA 3G8CA 4LV5B 5AJYA 5EVCA 1YQWA 4DTIA 1KF0A 3GK3A 5TJ9A 1F8UA 4YMGA 4GIBA 1SUCA 5AW9A 4P4TA 1O5OA 4I50F 4BVBA 3QMWA 3QMMA 1TO1E 2JJ1D 1ZR2A 1XK7A 2NTNA 1Q0SA 2QI9C 2SCUA 3HDTA 3LL7A 3QXXA 4RQAA 1M73E 1V6SA 4NPHA 4XGRA 3IPCA 1OOEA 2DF8A 3H8JA 4TXLA 3UTDA 2VXCA 1S3GA 4CTJA 2IDZA 1D1QA 4M9QA 4RZXA 2BGTA 2CLIB 3E1KA 5CNJA 1N7GA 3T1VA 4E30A 5A4KA 3MB5A 1IVYA 2EJWA 1BGXT 1H0HA 2P91A 3EQ9A 1TCAA 4JJ4A 3E81A 4LIPD 4PNZA 5DHFA 3SKVA 3T7IA 1GTG1 1SBHA 4IR7A 3TCKA 2H63A 2H06A 1AKQA 2VDKB 1T1RA 1UP4A 5AYVA 1ZIXA 1RWMA 1XD2A 3OPQA 4UNSA 3DOUA 1TYCA 1H66A 5AKZA 4MR9B 1B2LA 2EL9A 3AR8A 1L5GB 3ZX4A 2IE0A 1H2AS 1PYDA 2J46A 2R68A 3FPGA 3IO5A 4MRSA 1YFZA 1UK9A 2D5CA 1NMXA 1TM5E 3H86A 4GPEA 2NYRA 2CNWD 2HWXA 2RHOA 5FNVF 1DXQA 1GGKA 3JARB 3DKPA 2V4ZA 4F04A 3L1HA 5KCZA 1SVOA 2YWDA 3MELA 4LGMA 2R8XA 2YUIA 4IZHA 2FFBA 1AQ6A 1RLMA 4JI3B 4WCFC 1DQRA 4GMHA 1P4AA 3KUXA 2IX3A 2MOKA 2OQ2A 4BNXA 4G23A 2PPVA 5CVJA 1B00A 3UJBA 3HE3A 4FXPA 1CY2A 4EH1A 1YVPA 4WLNA 1CS4C 5JXIA 1KJ9A 2GH1A 1UM9A 4R6WA 3PLNA 2EERA 3RPEA 1V47A 2XGMA 3MF4A 2PVSA 2VSQA 2BEWA 3FYUA 4GC9A 2QRZA 4AQDA 4BWVA 2XXBA 3D7NA 5AKKA 3RUHA 4DC0A 5EESA 4AW9A 2EP7A 1IJFA 4LHWA 4ZO4A 3WLJA 1C0PA 2AKEA 1UEXC 3L92A 2H18A 4L5JA 3O4IA 5DJ5A 5AHKA 3F4LA 4EMBA 4ESOA 2A2ZA 3EVZA 5DKFA 2G82A 3STUA 4QHYA 4AURA 1BROA 4DWWA 2D06A 5C5EA 2O8EB 2JFYA 4QPJC 3PFNA 3NVAA 4LI3X 2ZJ7A 2ORED 3HYSA 3BF8A 4YK7A 1AA9A 3PF8A 1RCUA 3PHGA 1UT8A 1PG5A 4AP5A 3ILXA 4G0MA 4LRSB 5D3MA 4A3SA 1O95A 3BAFA 3CG4A 5FT9A 4BKOA 3B1WA 4QJIA 4BZXA 1S9DA 2C95A 4ZAXA 2WFMA 2FE4A 1G21E 3ETDA 4FQ5A 4LKRA 4F92B 2XTZA 1AN9A 1O9HA 2HXGA 3U40A 3KTFA 5LNK1 1ZBDA 3R5TA 4R81A 1ITZA 2XLBA 2YDXA 2IBSA 4X6UA 1E7RA 1KEPA 1XTQA 4JA0A 1JECA 2RC5A 2C5EA 1KERA 2AEEA 2ZRMA 3VPGA 1XEWX 3MAAC 5JWRA 1IUOA 3OA2A 1ABFA 2ZIEA 1DQSA 3WADA 3KEOA 1KZ4A 3I64A 1SBZA 3JZMA 2VRNA 3H11B 5FWYB 2NV6A 5AKLA 5E9WA 3E48A 1PS8A 2HI0A 2OBXA 3G8DA 3G2LA 3NB0A 3KYIB 3O3MB 4IL5A 4YI5A 1GV1A 3V1LA 4JY7A 1X38A 3QI2A 4ZEOA 4A8JA 1YE5A 3AUTA 2BUBA 1UWKA 4IHJA 2X1VA 1W5FA 3QE0A 5AXCA 3D6HA 2G6BA 2MHCA 1FS5A 4R05A 1Z4LA 4XIGS 3WV4A 4D4LA 4F6RA 2IBMA 3HXLA 2C88A 3MGAA 3VBCA 5BV8A 1FFXB 5CTAA 4I3FA 2AJBA 3FCCA 3IUPA 1ZWLA 4G26A 4BUCA 3K2QA 3LVRE 4KVGA 4CGYA 2ATIA 3IPXA 1BJRE 4IUCS 1E9BA 4ZYUA 2R62A 3CO0S 1RLIA 1DZIA 4F46A 3EPPA 3KAPA 3DOFA 2P6RA 5F1YA 3RHTA 4DSOA 3QKUA 4P2GA 4WNAB 5IHPA 3F6SA 4LBWA 4IVPA 4DB4A 3TW4A 2AG1A 3CZAA 4HR7A 3ZV5A 3IE1A 3QOFA 5JHHB 4Z9YA 1U7ZA 2A14A 4ENPA 3WHPA 4ITVA 5JDIA 1JFFB 1V71A 4BNDA 1T2DA 5LB4A 4YAFA 3ZGYA 2BONA 5FOVA 1B7GO 2I1LA 3IPYA 1NAIA 2G0AA 4V2IA 4ZRNA 4YACA 1X13A 1I6WA 4IDHA 3VOTA 3W6PA 4UPEA 1SC1A 2DFDA 3BN3A 5AM5A 4UCXA 1GNTA 2YS6A 3P0JA 3S5JA 1M76A 4MB6A 5KTPA 1E0JA 2GYVA 1F0KA 2PX0A 1C4OA 2IX9A 1BDMA 4MJXA 4L8WB 1DRVA 4LK3A 4P83A 5GJWC 5JOQA 3QLVC 5IKXA 2YYZA 4NR0A 5L3RA 3BREA 3NYWA 3F2IA 2J6HA 3HVRA 2GEVA 2H4FA 3TGLA 1GDTA 2AVDA 3PNYA 3HADA 4JQOA 4EKDA 2JLSA 1Z5ZA 5AKIA 1QRSA 3I3OA 4F9TA 4GYJA 1O6ZA 2G9ZA 3RB8A 4D43A 2EFHB 2CYAA 3NV9A 1X6VA 1AKWA 2LE0A 3GOQA 4GL2A 4EZEA 1TVCA 2QMEA 2WF5A 2G3YA 2GJAA 3URKA 2D1YA 2HV9A 3GIDA 3K6SA 3U7EB 1JAZA 1WOMA 4Q7LA 1ZITA 1H8EA 3T5GA 5LOVB 1K9SA 1MVNA 5IWCA 4GL4A 4KGDA 3WGHA 1MB2A 1W47A 4ZPJA 3SXUB 5KJ6A 1ZSVA 1PWYE 1VSBA 1WDMA 1Z2OX 5KNBA 4PGHA 1JIXA 3BMXA 1A72A 3AFGA 3ZWKA 2ZXFA 2BFDB 2VLBA 2C2YA 4M7OA 4ITRC 4WNYA 4BQQA 2R751 4Z7OB 1I3CA 3B38A 4FLEA 5C3UA 1ACJA 2H48A 3ZI7A 5KNCA 4PC7A 3AJ9A 3WLMA 2XQVA 3CH5A 4N49A 1ZOPA 1Q1GA 4HFRA 3COWA 5B58T 5I7EA 1P33A 1MIOA 4M99A 1FQWA 3R74A 4E7OA 2ZUVA 4EB6A 4OIMA 2WWYA 4DV3B 2B5OA 3FSGD 1EG7A 2WU3A 4CTKA 3KS9A 1FTQA 3MWLA 1TXGA 1MEOA 5EWLB 1QRUA 4HS4A 4I36A 4PQFA 3W5CA 3ACBA 3T3IA 1ZSNA 1AF4A 1GRCA 1RJFA 4RDCA 4X6YA 2WA1A 3WLKX 1G7TA 2E4UA 3GA5A 3W1WA 1H2WA 2I5PO 4R01A 4PXSA 1ODFA 3PQ8A 3EOAI 3RDPA 4AMYA 3L3BA 2OD9A 3LX4A 3QYJA 5EL0A 1N8KA 5GWXA 2BBSA 3H2KA 4YRRA 5IBRA 3ROGA 5BORA 2C7OA 4YO7A 1ZJWA 4Y6LA 1KDTA 2QTBA 1LC0A 2LCQA 3NHFA 2ORYA 4WY8A 4TN5A 4MWEA 2FN8A 4MICA 2NVBA 5DBIA 2OB2A 3RYHA 4BAGA 4KRFA 5IJAA 1VL5A 2Y4OA 3BH6A 2GYUA 4PG6A 3ZHSA 3K70C 2C5SA 3DEZA 2HMTA 2RGDA 4WBNB 3PUWA 3Q72A 5IWAB 4DA6A 2H65A 4B3GA 2O0MA 2VTEA 2QPOA 4EM6A 3BRWD 3SY8A 4PLGA 1LK0A 2AOVA 5CBPB 1Q74A 1ETHA 2Y1OA 3P2MA 2WKSA 2YHIA 2GARA 4LMBA 4PYRA 3AXTA 1OQAA 1PTJC 3DH0A 4TKUA 5U4XA 4DILA 2OHXA 2B4KA 3DFUA 4FOOA 3RG8A 1EGMB 2VCYA 1YUBA 1HOTA 7MDHA 3U9TA 3U4MA 3GBSA 3IP8A 1QIDA 1Z68A 4GX2A 5ALOA 1N5OX 3P4YA 4C7XA 5JCPA 1U0SY 1JB1A 3ERCA 4U7JA 4JEUA 1E1YA 1R88A 5GIPE 1KY4A 3HWWA 1XT6A 3V1TC 1DFHA 1ML3A 4B6OA 2H8KA 1QPGA 5J2TF 4W5NA 2EP5A 1KYTA 3SDZA 5JJIA 1FRZA 4ITUA 4DA7A 3A9TA 1S2GA 4Z9BA 1W19A 3VJMA 1RKXA 1E0DA 2F4VB 1Y5RA 2GBCA 2WFZA 3O1IC 2DSNA 1M7GA 1ECCA 1DARA 2E3JA 3EMVA 1K89A 2JFZA 1QH8B 1SHZA 3MSXA 2IH2A 1W48A 2C3MA 4YMUA 4M37A 3VNQA 4BYMA 2IYEA 3DAPA 2KW5A 1YS7A 2HBQA 1ZHHA 2P5TB 2O7QA 3L7MA 5IT9A 2GPTA 1EG2A 5LZ9A 4D5EA 2V65A 2A7XA 3C3PA 3OZ7A 3HR7A 3QVTA 4HFNA 4Q7KA 5EE0A 4ZIRB 1DLJA 3N58A 3TUJC 4BLWA 1GCIA 3VR2D 2FJUA 3LA8A 4TWZA 4R2HA 4AO8A 5COBA 1WW2A 1BJKA 1FMJA 2FDCA 2C7GA 4HDSA 3PZBA 1UMDB 3PC4A 1OLUB 1Z4IA 4X20A 4AMZA 1JNXX 3TSCA 4BNUA 2UVPA 2VH2A 4JBNA 1ZM7A 4U3JA 4AZTA 2B9VA 4YDQA 4TRJA 1SZDA 2HLDD 3DWFA 1R10A 5HOEA 3WKBA 1WXFA 3STTA 1DAHA 2ZGVA 1QYDA 2OUIA 3BZBA 1JEYB 1X77A 4EI8A 1RKUA 3EYAA 4Y2PA 1M34A 2JLCA 4O5AA 4PGFA 2FG6C 4LECA 4YCJA 2P7HA 4U5QA 4QYSA 2X2EA 4LZJA 3BMNA 1TF5A 3RVOA 1Z06A 3LY5A 1MMFB 1KVRA 3NAMA 2AMVA 1VLVA 2FWJA 2C4HA 2Q3BA 4X1YA 5ADHA 2RHWA 3VH1A 3A2MA 1YRHA 4ZTUB 2L69A 3D2LA 4BQIA 2A4KA 4R2WA 4BBAA 3DGFC 4BKQA 3AY7A 3BB3A 2IF0A 1VXRA 5HRUA 1UK6A 1SVNA 4C2AA 5BR8B 2FN7A 3ZTTA 1PR4A 1AT1A 1C3JA 1E1NA 2O3SA 4RVHA 4E31A 3H5WA 4B4VA 1LF0A 4Q12A 5JXGA 1JR2A 3CZPA 2ILTA 3BWCA 3U7QB 3B3JA 3WGGA 1JN0A 1Q7GA 1CP3A 2TSYB 4RD3A 4IGFA 3CNEA 2Q2OA 4E6PA 1A8IA 3U26A 1OKKA 3BRCA 5JJCA 5D87A 1V35A 1AKEA 2PQ6A 1N25A 1U0EA 2HBZA 3NBYC 4A23A 2XE6A 3DNPA 1EQ2A 3AKEA 5H9WA 2GD2A 1J8QA 3MN1A 4LZAA 1XVLA 5CR9A 5KSYA 2GHTA 2GMWA 1M2HA 2I6FA 3Q6MA 1ZH8A 3OEHD 3N74A 1A7UA 1NONA 3ISVA 3DT6A 2GJ8A 3M1LA 1ORIA 3O2QB 4TMXA 5AP9A 1AGRA 1BMFD 1HFKA 1UBRS 2I87A 4XRRA 1BE8A 2HL6A 2CVQA 2NT4A 3UMVA 5DV9A 2G9NA 3I6IA 3PENA 5AVTA 2O23A 5HDQA 1SEVA 4F12A 3THXA 3ZKWB 2WD8A 1UMCB 3IT1A 2GQ0A 2DTDA 4L15A 2EIHA 2Y2VA 4W9RA 1CY8A 5FLXA 4UBJA 2QU8A 2XB8A 3E5HA 3IOMA 1F9AA 2QP3A 3BCRA 2GPYA 1NW6A 5ECWA 3U7HB 1LPMA 4D4JA 4EAAA 3PRHA 4Q9HA 5FUWA 4W9NC 2P4UA 1QDUA 5D85A 2FR8A 2X0RA 3CYFA 3DL0A 4RA9A 5B6IA 1MT0A 3M7IA 1ZN7A 4A0HA 2HJ9A 2AK3A 1YJCA 5JSZA 2V7XA 2EZ9A 3PJGA 5C4GB 4CCWA 1L5QA 4TTRA 1NVXQ 1SHUX 1Z3IX 2IZZA 3ESAA 2P9BA 1HL7A 3MWKA 4CUKA 4F1WA 1M83A 2P3OA 4LZOA 4OUKX 4CM9A 1EBUA 1CUZA 2FHPA 3IUJA 2F17A 2XGSA 3DFZA 1LBEA 3HCRA 3FTEA 1J6UA 3IR6A 5I51A 3N07A 1NF3A 5DDIP 4EMUA 2QXYA 4IOJA 1YR7A 1KEWA 3WP0A 3TTXA 2H2HA 4J0JA 3RFXA 1JFRA 3NHZA 1JDPA 3FSRA 5AOCA 1HNWB 3F3YA 5KJ1A 4BWGA 3IE2A 4IDEA 3NEJA 1I13A 3RRJA 2WU8A 3NQ41 1P9LA 4HAZA 2Q0XA 3WOHA 1NI5A 1D4ZA 1HLPA 4ZK2A 1TI7A 5GJBA 3M83A 5D84A 1P3Y1 4N3BA 4N82A 1KOGA 3RCBA 3SEFA 1I5OA 1R66A 4BIIA 4NULA 4WACA 3NVKI 4FLMA 4A03A 2TECE 4M7RA 1NE2A 1KEEA 1C3EA 1ICEA 2IYQA 1BN6A 5LA6B 2WG2A 4C5BA 2BFBB 2FN4A 4IIJB 5KTSA 2DT5A 1E59A 3WLPA 3DOOA 1P2FA 1Y8QB 2JH3A 3H3JA 3QWIA 3R6LA 4DC9A 1W25A 3A1UA 2WAOA 2QL6A 4W99A 4EI2A 3AIOA 4RELA 5KYXA 4YPOA 4XYBA 1Z56C 2PUDA 1BDBA 3GUVA 1NTOA 1U28C 4EVQA 3ICPA 4EKEA 5I48A 2Z2YA 4OJYA 3S27A 4DDMA 3D02A 4IIHA 5HUJA 5I4IA 1GFSA 4Z54A 1TJ5A 1T91A 2PRYA 3DP7A 5A2GA 3RT1A 2BUAA 3STVA 4L28A 1O1YA 5EJ2A 5EE3A 2CVPA 5DW0A 4P86A 5KYUB 2NYAA 3SN6A 1IBCA 1P5ZB 1MC5A 4JCCA 4QVKA 3JZAA 3PCXA 1OR8A 4FHZA 2QWXA 3AJEA 1S8FA 3AHDA 1Z6ZA 3GLVA 2WUEA 3HKDB 3I09A 3DWGA 3Q8MA 2GPAA 4J16C 5DSXA 4UKDA 3BT7A 1NYQA 3QPCA 4WY5A 3W04A 4BO4A 1BS9A 3TIIA 3AEUA 4DWOA 1OIXA 3QUQA 3CUKA 3L8CA 4UTVA 4BEVA 1XHEA 4AWXA 4OK5A 3DGEC 1IVNA 3VH3A 1XJ5A 2C3PA 1GD1O 2ATXA 2OSBA 4JYBA 4KPFC 3BMCB 3EC2A 1R5OA 2ZSAA 3A1DA 2QTRA 3S8MA 1JZQA 1LZLA 4XFJA 4ZDIA 5LQRA 3WA6A 3ZDZB 3N2NA 5EXTA 3FYTA 3ZYCA 4YMVA 4E2WA 4A0FA 3NUQA 3GRZA 5DGIA 5BR1A 1Z2EA 3W2IA 2VYND 1IBRA 2WE8A 4HN2A 3Q3HA 3ABSB 1G8KA 1ZC3A 1PR2A 3NP7A 1ULBA 2GSDA 1SVKA 3K0FA 1A5AB 4CR7A 2YWRA 1QYCA 1NE7A 4RSMA 1AZWA 3G0CA 1MO2A 5A9TA 5G02A 1URPA 4QUJA 3K1TA 5IVIA 2O8CA 1FMLA 2ADMA 2XY4A 1GAQA 3EZYA 4EENA 4QUBA 1DAPA 3L8GA 3EUWA 1FQOA 2NZXA 4OXRA 4N76A 3VR5H 2VYCA 2PYIA 1K5DA 3A4VA 4LE0A 4UBOA 1EGQA 4E1BA 3DFMA 3V8PA 1WG8A 2NM0A 3MERA 4R7TA 1XD8A 3PFHA 5IH7A 4LOJA 3I76A 1RHUA 3T3MB 1LV7A 1TZJA 4RKYA 3C3CA 4TWBA 4L4ZA 3TDMA 3F3MA 3HU5A 3LC7O 4G0WA 3LQQA 4Y6SA 2Z3VA 3N3AC 2V7EA 5DTEA 3PPYA 3WGKA 4YR7A 5B30A 5C7IO 3QLVA 3EDCA 4OBWA 2DLNA 3SHVA 3IEVA 4D6PA 1EZ4A 1CVLA 4B47A 1W73A 4AX4A 3EVTA 5MN6A 3IUBA 4MCIA 4UM5A 1JDVA 2ZPAA 5UKDA 2PNJA 1Y6ZA 2GXUA 4D41A 1AB6A 3I8OA 2FEMA 4FBGA 1J8DA 4PANA 1PQYA 4XFKA 1GA4A 3K9HA 2D2XA 3LWBA 1EGAA 3R3VA 4TWIA 1Y6FA 1JFVA 1WUJS 4EG5A 1MC4A 1OB2A 3HN6A 1ENPA 4G56A 5HKKD 3A6LA 1VKZA 1ZCZA 3HLKA 4ATNA 1C3LA 1FL9A 1U0LA 1W1WA 2Q5QA 1SXHA 1ZZGA 2PD4A 5H68A 2JD1A 3UATA 4ALLA 5ITZB 1EA5A 4YBZA 4D4GA 1HTBA 1JLKA 4EMSA 2EX4A 4GOXA 2A3NA 2DTEA 2WMOB 4WECA 5DW3A 4QGBA 5EPOA 5FB3A 2BTOA 3A2NA 4HDQB 2X0EA 2XB6A 3T06B 4DHEA 3PNKA 1KSGA 1SVSA 3IVCA 5C8YA 2WKWA 4U2EA 1I4WA 3E53A 4LWPA 2GS9A 2H1LA 2QUIA 4A7PA 4MVJH 3ZNQA 2W0SA 2LWIA 2H0AA 2V74B 3UK0A 2R6DA 3MMPA 2F90A 2FEXA 5CT4A 4W9MC 3WYEA 1HA3A 3H9JA 3UAWA 1SEPA 3QH4A 4JI6B 1RBYA 3GLKA 2NXEA 1UWLA 3CVWA 3RKSA 4KXVA 2W00A 1DQYA 4RL6A 2H1OA 4RENA 2NU9B 3TGWA 3RIMA 3NKFA 5I01A 4I2VA 4PNEA 1TL7C 2PMBA 2QVZX 2RC6A 2Z4SA 4AROA 5EINA 5CNMA 4O8CA 2WJIA 5MGNA 4J49A 4GMFA 5H3HA 2FW1A 5C8ZA 5B4UA 1WBJB 3K8ZA 1NXVA 5HKBA 3RD5A 2PFSA 4ZYYA 4DG5A 1JQKA 1T9DA 1WB6A 4LY0A 1GZHB 2VTDA 5CW2A 3VO2A 2Q1YA 3D3KA 4RZIA 4MUYA 2CLKB 4MUMA 4P84A 4OOFA 4XGKA 5KTKA 4MUAA 3V6MA 2BZSA 2CSUA 2X0DA 3VR5D 3H6KA 1ODIA 1DDOA 2AXPA 1Z37A 3S4YA 4C0QC 1DIGA 1TMOA 4MV7A 3UK2A 2PX8A 1ZD2P 2QZ9A 1UKAA 3F67A 1KBQA 4QYMA 3ANSA 1L7PA 4EQ6B 1GAJA 5FPHA 1KBZA 1ZS9A 2E4AA 3RTBA 1CD5A 2Y77A 4MA5A 2Z6UA 3DDSA 5FWDA 2VXYA 3WWPA 3Q9UA 1W96A 4WGFA 2VOJA 3OECA 4NHEA 2VBFA 4RKEA 3IDSA 2M6SA 3OJFA 1SOAA 3M9WA 2PUFA 3K4PA 3NBAA 1PTJA 4Y1GA 3GD5A 3AUFA 2JLRA 4XR4A 4OVKA 2GESA 1SGWA 4MQBA 3MRVA 3NC1C 3KOOA 1TIKA 3C3JA 3IKLA 3MTJA 3IELA 4GEGA 1ORRA 5AIAA 4ROSA 4M0FA 2WZDA 5ESWA 1XOIA 1XMQB 1U2TA 4YRQA 4TGLA 2PCJA 4RIFA 4O2AB 1QFMA 3U17A 3BCSA 2W2LD 1BGVA 1E99A 3RO7A 3G5AA 1SRQA 1J0DA 4UHCA 4ZN6A 1LZKA 2AJ8A 2XADA 4ZQCB 4K2AA 1F0YA 4YCBA 3R9WA 4G1EB 1X1DA 4P31A 4PX9A 3RS3A 3KZNA 4D79A 5AI9A 1SBYA 3CVUA 1QCCA 5JYBA 1B6RA 3OIVA 3PXGA 2HA3A 3EWNA 4YY3B 4INZA 1ZIPA 2XB2A 1X80A 4YP0A 3ZVMA 4MVJD 4JENA 3THWB 2XMQA 1YI8A 1NXTA 2JS7A 4P8RA 4EIWA 1N6IA 2C59A 3FNIA 1ZN9A 2CJXA 5JHGB 3HRKA 5FTMA 1QLJA 3PRJA 4M9ZA 3DV0B 2W43A 1LI7A 3H4IA 4BXOB 3KKNA 4A8TA 3ESDA 1F0PA 4X94A 1U2QA 5DWVA 4Q4CA 3QNWA 1HE3A 4QOEA 4B4KA 1K8ZB 4WRRA 5K09A 2R6R1 4AWAA 5BOSA 1ZC4A 1NVDA 1YRBA 5DP1A 5FTWA 1JH8A 5T3YA 3ZQ6A 4C01A 5CK4A 4GG1A 4NJEB 1VBFA 3LK6A 3DONA 3AFOA 3LQ1A 3MOSA 3QX9A 1JX6A 2ES4A 1ZM9A 3BFXA 1B0AA 1KZ9A 4Y7DA 4CM1A 3DTVD 4CQMD 4XVCA 1RXVA 2NNLD 4TV9B 3FHOA 1JHAA 2VK8A 5HKKA 2ODNA 4IY1A 4LGYA 2BKXA 3OX1A 3ZHQA 3E70C 3ZIUA 4FGSA 2FWMX 2J32A 4L76A 3Q7IA 5TF0A 3EPHA 3DT8A 1YIAA 2J3HA 1ZD3A 4ZOLA 2CFIA 2AKAB 3W2FA 3ZGXA 3VFDA 2AFIA 3IT2A 1R18A 3F5SA 3FR7A 2R6GA 3K2EA 4U0JA 3NAZA 2HCJB 5E6UB 2IV7A 4LS3A 5JJBA 1LBHA 3ILVA 4DLSA 3MTIA 4L4XA 1EP3B 2AZDA 4Q9LA 3IVMA 4KGXA 3FUVA 4YJ3B 3J81A 2AC7A 4BVLA 1G9XA 3EEYA 4FEGA 4ENUA 2OGUA 3OFND 1EAMA 1K92A 2UV8A 1ECGA 1FYVA 4K2HA 4Y2GA 3E2IA 1ADGA 4P0PB 1WDTA 1QUEA 4LFBB 3KCQA 4CQLA 3PSHA 2GN1A 2YCBA 2GD1O 4CEJB 1N2ZA 4NYMQ 2K5UA 3TR6A 2OFXA 3W8FA 1M6HA 5HBGA 3JYNA 4HL6A 3DW3X 5DVZA 3IQZA 3QG1A 4X62B 3SZMA 1CV2A 2G7MC 3CU5A 2B0CA 3FF1A 3IIKA 5DTJA 1QFSA 1A8HA 1MCZA 2PL5A 4YGXB 1Z47A 2Z1NA 1ZD9A 3MINB 3R0XA 4CMIA 4F21A 5CA1F 4PYOA 5J1SB 4MIKA 2UVDA 4TLAA 2PMCA 4YRIA 3L43A 1YZVA 5LB2A 2LVBA 1L7NA 5FULA 5EP2A 1DIRA 1CEQA 2VSYA 1KMMA 3G2NA 2ZWMA 1P4HA 4NZOA 1RJEA 2OV1A 4OXYA 2XX3A 3L93A 3VZBA 5DM1A 3F6RA 4R1UA 2QX9A 1U0JA 2JDID 4R3NA 1GZUA 5ESXA 4N5HX 1JFTA 4NU5A 1N4DA 4B17A 2D7CA 3T15A 2YXNA 2G6TA 4IMPA 1UT6A 2YC4C 3CEMA 1H22A 2Z5FA 1JDJA 2ZT5A 3DPSA 2QT1A 3JQDA 1X7GA 1BW9A 2OP0A 2Q3EA 5TPZA 3LFUA 4W9NA 2UXDB 2PRIA 2XMRA 3EXFB 3TZCA 3A3NA 3TXXA 1TUEA 1W0KA 3H8VA 2R1UA 1WIWA 2AFHA 3LVQE 1IZ8A 1KBOA 2ZEJA 2ZB8A 3ROXA 5DLEA 5GVSA 2BH9A 1M5TA 3QBVA 5B55A 4HQNA 1SC9A 3L7KA 3ZWAA 1OI2A 1U2PA 4MGIR 2WZBA 4G8CA 4X1OA 3WYCA 4CV2A 3MCWA 7YASA 3UPTA 1P2BA 4XVHA 2QRVB 5HZHA 1Y7PA 1SBCA 4P81A 1NI4A 1D2NA 2YH2A 3TAHA 4L51A 3TH5A 2QXTA 4LVCA 2HMAA 2PFGA 3IAM6 3AI7A 2J3EA 2RBKA 1XDWA 5AICA 5DO9A 5MDHA 1D2AA 1R8XA 1YZFA 4X8LA 3RC8A 3CE6A 3DYVA 3ODPA 4RMNA 1Z5GA 2IHVA 1IUNA 2GJ4A 4OL9A 1LW6E 3V7FA 3HU3A 3ZU6A 4O4HA 1XROA 4WXEA 3G1UA 3L4KA 3B9BA 1I9CA 2OCGA 2ZSUA 2I4OA 2ZKIA 3MBOA 2QTHA 4IWXA 4LXIA 3RV4A 1U7TA 2FP4A 3ZV4A 2Z3ZA 4KRXA 3ZK9A 4C76A 1XXHB 3GQBB 4RPKA 4ZVLA 5TJHA 1FUIA 3DOHA 1LPBB 5EHQA 2QV7A 2V7PA 1VECA 2Q07A 5HG0A 3CSSA 1RYYA 1VJ5A 3W5BA 3P2JA 2FEWB 2QN7A 2GILA 5ETJA 5KYGA 1GG8A 3RLIA 2A86A 3ZWPA 5ICCA 2PL9A 1LBTA 2XVXA 3GLHA 5G2OA 1X1EA 1QYRA 2X76A 4EVIA 1QOPB 2F6RA 2GTHA 2W0MA 3KSRA 3R9XB 2ZDQA 3QY9A 4LCBA 4W5OA 5ILGA 1JPNA 4LZLA 4DCCA 3T54A 1A50B 1GQRA 1I7QB 1TU0A 4ZP1A 2Y1LA 1QOQB 1U28A 2J45A 3JV7A 4MVXA 3V8NA 5FQNA 1VC2A 1Q6YA 1N5LA 3GFPA 4RZSA 4Y2UA 2GAFA 1Q44A 5LP6B 1B6SA 3DNMA 1NW9B 1NBIA 5G4KA 3TNYA 1XTVA 3RI3A 1RZVA 3DQQA 2ZJ1A 4I0WB 4JLSA 4U2CA 4F3CA 3U3JA 2HX1A 1UKCA 4M76B 3VPDA 4MP8A 3IIIA 1HBJA 3DUFB 4EKGA 2J0UA 1IOZA 2NG1A 1VGRA 2FR0A 4KXMA 3CRMA 2CUNA 2PQ0A 2Q5CA 2F1IA 3GZTB 2FWBA 4HWTA 3UJ6A 1Q22A 1LLFA 4KREA 1JKJB 3KZ1E 2Z56A 3L1IA 3MVEA 3Q3GE 4J16A 4O4LA 1SY7A 2IHNA 1U4SA 1VE6A 3TRHA 3V1MA 3QVOA 1R0WA 3UHJA 2HK8A 1NSTA 3OIGA 2L2QA 3C3YA 1UKVY 4B73A 3L49A 4C3ZA 1TKAA 5B1IA 2R7MA 3QEMA 2ZIWB 3L6DA 2CK3A 4HKTA 1U9CA 2KQUA 4G5OA 1GTJ1 1V48A 5B7GA 4X90A 1NUQA 2ZI5A 1H9AA 3GXOA 3QP9A 3AQIA 4R9SA 1K6MA 4YRBA 2IYNA 4MUGA 5IBQA 2QTFA 4A27A 5ARBA 1TT7A 3OZAA 1EXVA 2FPMA 3ZU4A 2PHZA 3FHCB 1XVAA 1QZ3A 1L5KA 2D0OB 3QLEA 2F2TA 3R7WA 4JLOA 2DB3A 1DMRA 4H08A 4U63A 3RADC 3K32A 2Q62A 3N6XA 1RZUA 5EXEA 1MXHA 1IZZA 4DY4A 3U7IA 1Z5NA 3K35A 2OCLA 2MIIA 2V7VA 5JFOA 3SVLA 1CUDA 3CRNA 2HLPA 3DZIA 4QD3A 4H18A 5HA5A 1VCNA 5HILA 1KY2A 1L9KA 2XEDA 2F64A 3MRXA 4ZDWA 2VT6A 4ETMA 4QHSA 4R2IA 3SICE 5FUQA 1U0OC 1II8A 2B0JA 3U56A 4GECA 4DDUA 4G85A 1HT2E 3H65A 4K0RA 4UTPA 5EIXA 1V3UA 2IZOA 3ZHUA 5EWMB 1L7OA 5IKPA 4U9IS 1ORHA 2MJLA 2J0EA 3VPBA 1MQ8B 3I5AA 4OSPA 2WAYA 5JLJA 5DTMA 5JEEA 2QW1A 3DVLA 4RXTA 3NHWA 4AZ0B 4HRYA 3QEJA 3IHLA 4HQOA 2W42A 3QOYA 1CYEA 3W5DA 3O4JA 4X95A 2Q28A 5JROA 4GP7A 2ARKA 2O3TA 4K86A 1YK0A 3R40A 4I4LA 5C7OO 2WWXA 3RSSA 2AFVA 3N05A 5EWJB 3IP1A 3K53A 1PZHA 3C1TA 3TVYA 4P98A 4P3XA 5EE9A 2FMKA 4J0QA 4XM1A 5B1DA 4EPVA 1I4OA 2YWJA 3AY3A 1JR3A 2G63A 3CLVA 1N6HA 2A9PA 3RKUA 1H42A 1XA4A 3RAPR 3NM6B 4C4ZA 3PQ6A 4LDAA 1IY8A 3UTCA 4EW3A 2B6HA 5IJXA 3ZXYA 2MMCA 1H1DA 3B3AA 5CYGA 2DBQA 2QLMA 4U4AA 3WICA 3DB2A 4AJNA 4EO7A 3OU6A 1KFEB 2BI7A 3RS2A 2VJAA 2QROA 3TTWA 2AOXA 4P34A 4JYPA 2HF7A 5T3UA 3DT9A 2GKOA 1Z0SA 2COUA 1OC2A 5DNVA 3WKDA 1NQAO 1PL8A 2TYSB 2DQZA 2VDQB 2P1RA 4BCDA 1VCIA 3LF1A 3VUFA 3OQOA 4JQZA 1RSZA 5F78A 1T15A 1ZVKA 4IIDA 3Q3EA 3SAJA 3V6LA 1IAQA 2X3FA 1ZRMA 4D3FA 3UT5B 1HT1E 4RHXA 2VJMA 2BM8A 1R0YA 3AXSA 4PLYA 3SQWA 4RF4A 3JZFA 1GGHA 5FBWB 3PNOA 4P4GA 1S3FA 3ZWQA 1KHHA 2ZAIA 4NQRA 4X63A 3UWSA 1XZMA 3V00A 4CQMA 4YQFA 1A76A 1SQ0A 2WJPA 2QA5A 3REGA 4BKPA 4GE0A 4EYSA 2ID7A 2CYBA 2P3SA 2ZBUA 3N2YA 5AHXA 3ZGVA 3S1AA 4DLKA 4ND7A 4JJAA 1W94A 1BU8A 1L4FA 2EYQA 3F5QA 1E9FA 1ZK0A 2AQ8A 2PGDA 1AKRA 1OU4A 4UE3S 4EUNA 3K1AB 4OXIA 2QJFA 1VJ1A 2R1TA 1WEKA 1LSJA 3C74A 2IZ6A 4DQXA 4QBIA 2C20A 5GVRA 5JU6A 1Z8HA 1XZAA 2G4VA 3HKEB 2ID8A 3OLZA 2H08A 2Q3HA 4HAWA 1DKMA 3JVVA 4MGZR 4MEAA 3ZNOA 3OQMA 2IZ7A 3QRWA 5EKDA 1LW7A 1VHWA 3PUHA 4K6KA 3W6OA 1J25A 3N75A 4K1XA 5BURA 1FP7A 4R1PA 4K3UA 2V6MA 3AV0B 1N5IA 3EW7A 4ACBA 2YZKA 3LT5A 4B2PA 3VYSB 2O52A 1EFPB 1X7ZB 3K0CC 3QOWA 1YCDA 2DAPA 4XD7D 5EZYA 2B94A 4CMEC 4RE5A 4RTRA 3JR7A 3FUTA 4ZD6A 3AHFA 4UE6A 5IJZA 4R68A 4DABA 2AXNA 2FEKA 4PSDA 3B52X 3MBKA 1Q1AA 1U94A 3OJCA 3QXJA 1ZGGA 4PFJA 3F8WA 1PW7A 2QI9F 3BKXA 2QW0X 3E05A 1ZXLA 4G89A 5EZSA 2X6TA 2HB6A 1XGKA 1I7PA 3ANMA 2CLDX 4E5NA 4MP3A 3DMHA 2BEUB 4UHHA 2D13A 1H6CA 1RJGA 5LSAA 4F3YA 4NBLA 3W5VA 1N9GB 2IH5A 2WABA 2BTQA 1Z17A 1JT9A 2OGZA 2I9PA 2VFAA 3ODGA 4H0NA 4TMYA 5B3JA 4YXWD 5KTTA 4DIOA 3LPAA 3IEUA 3VH2A 4D3SA 2QVBA 2HF8A 1XZIA 4P3OA 2ISCA 3F49S 3LUCA 2DHRA 3DCYA 5L3VA 4MR7B 3NFRA 2ZTVA 4QM7A 2HBRA 1ADFA 1ND6A 2DJ5A 1X1RA 2PTHA 3K30A 4IXMA 3WLOA 4BQSA 1DRWA 4I6JA 2HSJA 4X41A 1FLAA 1LX7A 4OYLA 3EAFA 3PZRA 1WX1A 3E9RA 2TMGA 2A5DA 2JHCA 3WRVA 3CLKA 4S0XA 1XKXA 3BK7A 3JWPA 4QNMA 3F47A 4RIIA 3BH0A 2F43B 4BUZA 5FQOA 4EYQA 5T67A 1VIVA 4GOND 1CE8A 3EQ7A 1ENZA 4HYTA 4LJ5A 5ICSA 2P2GA 5LMNB 4I4TF 4FD2A 1PFWA 2W6NA 3PB3A 1XEXA 1PGJA 4HN4B 4AWBA 4XQGA 4US0R 3STHA 1Z6YA 2P9EA 3K2IA 4WIAA 2RI0A 1OTYA 4B1FA 1B8UA 1WR8A 3CKKA 1K27A 4O1IA 1J20A 3EE6A 5DYIA 3LH5A 5TXGA 2PM8A 1NLYA 3BDVA 1H1LA 2W93A 3A37A 3DHNA 3L06A 3NGLA 4J1NA 5IT0A 1E1RD 1Z38A 3OG9A 1ZNWA 3EVEA 1ORVA 5A1JA 2D1SA 3H3FA 5KQRA 2B7CA 3T5MA 2Y6VA 3NTQA 5CEFA 3LUKA 5FFNA 1DVRA 2FZCA 3LX5A 3AR7A 1DI0A 4LCEA 1NW8A 4H1VA 1FSFA 5H59A 1GN8A 3D8NA 1VBKA 2GHIA 4ZZ0A 3Q7EA 5HFAA 1MR3F 2Q9AA 1VYVA 3TRFA 2FXIA 5AXDA 2J3JA 2X3YA 1E5LA 3U49A 2P6PA 2QM3A 4GICA 4PWYA 1L5VA 4QQNA 3B1FA 4NKRA 4WWHA 4IDOA 4YJDA 3ORRA 5HEKA 4U6QA 3UCFA 3SS7X 3I39X 5JG7A 1K4YA 3A7EA 2CXTA 1FFCA 1AXRA 3CY6A 3OLCX 7ADHA 4ZGBA 2CXRA 3B6IA 2ZAYA 2NTYC 4KO8A 2IE8A 1GGNA 4LV8B 2Q9CA 5IEBA 1TAUA 1NNUA 4TS3A 1LI4A 4CKEA 1A7KA 3P2EA 4IJMA 1LLUA 3ITKA 5FOQA 2JCYA 5GGXA 2PJRA 2YWHA 3B12A 3TVDA 5JT1A 1NULA 1P31A 3IERA 1A8QA 1BFDA 2E4XA 2GTPA 4UPVA 1IBMB 2IU0A 3KP1A 3VYUB 2OFFA 2AFRA 3DHYA 2HUNA 4IDCA 4DQDA 3TPCA 1E5VA 3M6VA 4N9WA 5DSTA 3EEBA 1WETA 1FMCA 1MAUA 2OVBA 1Q0LA 3EK2A 3FI9A 5H81A 4E2ZA 1M1NA 1PJQA 4XQ9A 3WIOA 2WPDD 3VJRA 5HPYB 2FWIA 3AYZB 1VQ1A 1M10A 2NSLA 5DCLA 3BILA 3V4ZA 4BMOB 3I9OA 1YR9A 1JNYA 1T4CA 4U0KA 3AVPA 1OGJA 4UNNA 1AM4D 4AMUA 5H02A 4CTNA 2C4TA 3G5LA 1AGYA 1EDZA 4PCVA 1JAYA 2C99A 4ASUD 5J2UA 1XP5A 1U8CB 2DUUA 3MMZA 2XGJA 3AEKB 3NXSA 5K0SA 1EHIA 1KYQA 3VHXB 5KVSA 3U19A 4YCCA 2G80A 1NW3A 2X42A 2TS1A 2QGFA 1Y8CA 5M2QA 1H4TA 2ATCA 3EDMA 2ZUFA 4I81A 4OYHA 3HL0A 2V3WA 3C3KA 4BECA 1S9HA 4D9CA 5JNLA 3H8WA 3RRMA 2PX4A 1IMJA 4CQNA 2XMPA 1YACA 3M5CA 1ZLXA 4PNPA 4WI1A 1YZGA 2QVLA 1P2TA 3JZDA 1YFLA 1N7HA 2PX6A 4OHKA 2VZEA 4G8DA 1HR0B 1BQEA 2BEVB 1P18A 4BN5A 4D8TA 2JKVA 1YS2X 3MXOA 1M2KA 1M1ZA 4KLNA 2QZPA 1T25A 3HKCB 3RJ9A 3CZ4A 3GEIA 3K7EA 1DAGA 1K8QA 4TXHA 2OPBA 4HZGA 1UDBA 2V5UA 4D46A 5CK5A 3RU7A 1LNSA 4ZTBA 4BMZA 4B85A 3RVJA 2PRZA 1EHCA 2X7HA 1MG0A 3GBPA 3LQRA 1HLGA 4FVTA 4MW1A 4WKPA 2C9OA 1PDVA 1O03A 1HDCA 3NIDB 1IJKA 2A9VA 1U3TA 3OBIA 1J0XO 3BMOB 5L4SA 3FCOA 3CF4G 4J7CA 3KYBA 1IE3A 1QC5A 5EEHA 2O8BA 4RFVA 1FA9A 2G1KA 3PUKA 1SQ6A 4KO1S 4S2UA 1GUAA 2P4QA 3H2IA 4ZO9A 4FJ1A 5CCBA 1P6XA 4N8DA 1GEEA 3A27A 1CUJA 2ZQ5A 2PGXA 1KJWA 3D0RA 4ME6A 3WZMA 2OE2A 2JVKA 2GVZC 2RBEA 2XMZA 3PCTA 4PAQA 2NW6A 3HMQA 1OV4A 2DFVA 4XEUA 4TV8A 3JAWA 3MTQA 2BHRA 2X6QA 2OV2A 2WJ4A 2FI1A 3G8BA 2PJDA 3CF2A 5I7RA 1CUHA 3D1VA 4M38A 1R12A 4Q02A 1YJQA 2V8OA 3GHHA 1UPFA 2BE7A 1PUIA 2C2OA 2I8LA 1IXRC 3CG0A 1T4MA 4LGVA 4MDHA 4N6GA 4O4IB 4QU0A 1Y3HA 4S1PA 2AD1A 2O1WA 1N4AA 1MHTA 3KYCA 2VDWB 2KX7A 5GV7A 1YB2A 3TD9A 4DB2A 3ZWDA 4EB0A 4DIEA 2W6OA 2MMGA 2ZI3A 1AE1A 2W2OA 3C2QA 3O03A 4YRTA 5C8YF 4GI7A 4ZGWA 5KYWB 5THXA 2FJ0A 3HCBA 3VNBA 1JQ3A 4JLKA 1XZHA 5AUNB 1J8FA 1AO0A 1USVA 2PVPA 4F2GA 1H1TA 2YMLA 2O4CA 1K0FA 1NHWA 3ANLA 4QT4A 2BDUA 3ZVLA 3NOVA 2P9JA 7GPBA 1P3DA 2BI8A 2XCUA 2NU6B 4I19A 4MTCA 3C87A 1CQZA 3M5DA 3OU7A 2PV0A 2GSWA 3CR3C 5TVKA 4F97A 1QB7A 2XT9A 1D07A 3LS2A 1LNZA 3TZLA 2JB9A 3LG2A 5A2QA 1AHNA 4IEFB 3DLHA 1KI1A 2RJ3A 3UB4A 3IEMA 2W6MA 4TVBA 2F62A 2C5LA 1MJNA 1CU1A 1NBMA 1VPVA 1W9HA 2V6JA 3O7WA 3ZS9A 1QGAA 5I4CA 4HT3B 2V6IA 3N6RA 2XMSA 5BNFA 5TQ0A 1FBNA 2ZVPX 4MKIA 4NL4H 2TMDA 4D92A 3R3YA 1C9NA 1XWIA 3PUYA 4ZICA 5L51A 3FNEA 4D9EA 4FGWA 5EHGA 3OM0A 1BVUA 3IMFA 1X7DA 4MJ3A 3CF4A 1NMSA 3WO1A 3B2QA 1BOOA 2RB4A 4ARVA 4MWGA 4B76A 4UQPA 3KJGA 1SK8A 3QVJA 3PDCA 3E27A 3UC9A 3ZLJA 1O6BA 4OHUA 4KPEC 5DTIA 3ILSA 1F6WA 3H05A 2VNHA 3HSSA 4AXXA 1QGOA 1TKRA 4DIBA 4G1MB 1UDCA 4WFIA 5JAZA 1YFJA 1VHQA 2ZJ5A 4O29A 3AY6A 5JAPA 3DEHA 4P80A 3UMCA 1MZVA 2AJTA 1VE9A 4CT4B 3QNMA 3W3AA 5LYJA 1QONA 2PO7A 3GLTA 3RTEA 4CTOA 2GM3A 1JAHA 3M82A 4P9NA 2Q1UA 3KPUA 1J99A 1PGQA 2X1LA 3ORHA 4HRVA 4JMPA 5I9NA 4MKHA 2GHRA 3GZJA 5E6RB 4L0QA 2C3OA 4I3HA 1YZTA 1Y42X 4F3TA 4QGSA 1H2BA 1QIEA 1HNXB 3AESA 1Z28A 2RIPA 2WM8A 2BIFA 4HBZA 1CQXA 1W30A 2MYNA 3CW8X 3D8BA 4RZ3A 4UU1A 5JNVA 3NEPX 5BV2P 1APBA 4II3A 3ANNA 2FNAA 5T8KC 3TZQA 1SZCA 4KFTA 2JASA 2P4EA 4P33A 4FGKA 5JNSA 1UH5A 3ZXSA 3A9UA 2R66A 2HHCA 4JIMA 2V7WA 4RK4A 4BB6A 1SHKA 4WHMA 5EP3A 4MAMA 2CGEA 1OHHA 3WKAA 1EWQA 1RRVA 1WHTA 1X42A 3AF2A 4H60A 2GN2A 5JUWA 3AVVA 3A9RA 1G0NA 3IGFA 3RFTA 2UYOA 5HS6A 4BY9E 3D6NB 1DC8A 2B78A 3HUUA 3LX6A 1EVEA 2VZLA 5CB0A 5IASA 3LT4A 1Y5MA 2VYFA 3O8LA 4QBKA 5E8RA 4UNQA 3N2GB 1EUCA 3AETB 5HFNA 4XWTA 4IAOA 4M8LA 1QBGA 4PHFA 2QX7A 5M29A 1IK6A 2YX1A 4EUFA 3LXXA 2WOOA 4R9NA 5CJJA 4UEQA 2VG8A 3E9DA 1YR8A 4OFWA 3BD8A 1GUDA 1SHLA 3GU3A 4UBNA 1N8SA 1MRNA 1P2GA 4NCXA 3RFUA 3WYNA 5AHOA 4KN5A 3ZXUB 4PS0A 1VMIA 2WU1A 2XUZA 1T1IA 2AIRA 3N2IA 1LDGA 5CM8B 3UO8B 2X1MA 3KZVA 3L18A 5DPMA 3ER9A 1QCZA 1AO3A 3GJRA 3WGOA 1WMFA 3O21A 5L3QA 2KBEA 1E1QA 1Z5PA 2WSMA 4G5RA 2AS0A 4AKGA 4DLPA 5CFLA 2ROQA 5AKYA 4ETIA 5JY6A 2FWRA 2V4MA 2G06A 3ELDA 2FPPA 3RH0A 1YFKA 3U1BA 2W2KA 1YIOA 1ZXBA 3LECA 3LKZA 4MVJE 1RPNA 2ZIAA 4CG3A 4DRXB 4OB6A 4ZOLF 4YAUA 1KMIY 4DUZB 2RAUA 3EZLA 2N0SA 1BFUA 1K2WA 3Q7PA 4Q4LA 2Q4DA 4R2XA 1S8OA 1GPBA 3S7ZA 3UUFA 3LGXA 4EKYA 2Y71A 1XQXA 3KT6A 4F72A 4KFCA 3AVWA 5B36A 2O2GA 3ASZA 4QNNA 3H9GA 3QVGB 3WK9A 1C8BA 4JH0A 4RSHA 8ADHA 4I5IA 2WI8A 4AY4A 2BFEA 1M0TA 3ZVKA 5L95A 4Z4QA 4UUAA 1MX1A 2OM2A 4PVDA 3TNJA 4WOKA 4EGFA 1PL7A 3BWDD 4PYIA 5LZ5A 4BQPA 1VSUA 4CIYA 1PVVA 3W6ZA 2ZSHA 1G5QA 3CRRA 4H4EA 4OA8A 2GCPA 2PWBA 3K0CA 4QHTA 5I9MA 3ROZA 4KQ1A 1TDJA 4UM8B 3ZH9B 1Y48E 3OURA 1GRRA 3FTCA 3N7AA 1XNRB 4ZAVA 4RSGA 2HRQA 5ER6A 2G67A 2P6MA 2PUJA 3FPLA 4Z4HA 1R15A 4AJ2A 4DV4B 2EG5A 2A5GA 1NYTA 3Q88A 3ZY6A 4MEJA 2VJOA 1H5UA 3I2YX 3CEJA 4RH0A 4RV9A 3ZNPA 3RRNA 3AZPA 1UBUS 1XEAA 2UZ0A 2BJVA 2FG5A 1U6IA 3GCGA 4H2DA 5AVOA 1RWWA 5JRZA 2BBOA 4RULA 3UKDA 1B1AA 3H5RA 3L6RA 4CL0A 3D3JA 3H99A 3HY3A 821PA 2XNKA 3FGPA 1C3VA 3IQFA 3RRXA 4I50B 3FWZA 2FQ1A 3DD5A 4U6NA 4AJPA 2AMJA 2ZRBA 4TLEA 2MU1A 5AKXA 3PD1A 4HUTA 1RWPA 3PC2A 3KDSE 2CHFA 5KINB 2IZ1A 4Q7MB 4MLCA 1J1UA 1IB6A 3EXG1 4PQRA 4WKNA 2Y9MB 2Z2KA 3BCUA 5A4DA 5BN4A 2CV1A 2VH5R 5JW6A 3ECSA 4IF6A 4QA9A 1Q7CA 1I7DA 2R60A 1G5IA 5JSHA 2D1RA 2KPOA 3OT5A 4HAIA 4HY3A 4NZNA 4RIHA 3V33A 1EJ0A 1YL5A 4HMPA 3SR0A 3P94A 1VRCA 3HFSA 1FRQA 3LM8A 3N76A 3FPAA 4OQXA 1E2LA 3DF7A 2FSIA 1P7CA 2P11A 1GYRA 4MB2A 2G72A 1XB2A 4NG5A 2WFLA 4QFCA 5DULA 3HDJA 3UAYA 3K0HA 5HJ5A 2L17A 3QTLA 1RMQA 1STOA 3OJWA 4KE7A 4PCLA 4CE6A 4WK6A 4B3MB 2CMDA 2ZIUB 5DFAA 5HHTA 4DXDA 5FNVB 3FOZA 2Q27A 5C81A 3C14C 4MQ5A 4O4HF 3LPNA 2X0NA 2ZKLA 1NZFA 2N9UA 2Y8EA 3DDHA 3AFMA 1F2UA 4PZCA 2XT6A 5TT0A 5FEUA 4C6TB 3ZI4A 1G4AE 5KWJA 4EA9A 4OL0A 2QAJA 5F9MA 2IP4A 4H7FA 4HNTA 2WV7A 2P2NA 2ETXA 2IUSA 3FMPB 3AB3A 2D54A 2SHKA 3AHHA 3CGWA 4KUGA