4MPUA

Human beta-tryptase co-crystal structure with (6s,8r)-n,n'-bis[3-({4-[3-(aminomethyl)phenyl]piperidin-1-yl}carbonyl)phenyl]-8-hydroxy-6-(1-hydroxycyclobutyl)-5,7-dioxaspiro[3.4]octane-6,8-dicarboxamide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Target-directed self-assembly of homodimeric drugs
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Tryptase alpha/beta-1
total genus 53
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mpuA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mpuA01
1QJ6B 1P10A 1FAXA 4AFZA 1QL7A 3MMGA 3QTVH 1GDQA 1YPHE 5DP9A 4X1QU 3QGNB 2VH6A 2VU8E 3A81A 2BOHB 7GCHG 2QAAA 2AIPA 3K6YA 3SU6A 1SHYA 1TIOA 2D2DA 3EQ0H 1W14U 1K1PA 3C1KA 3CS0A 1ZTLA 2J38A 1TBRH 2OUAA 2CF9H 1O3JA 2R3UA 1KLTA 1ANEA 2HNTF 1MTWA 4X2WA 1GVLA 3TJVA 1AFEH 2BVRH 1CT2E 3A8DA 2VB0A 5F8XA 1P2JA 1UTOA 1PPBH 1HUTH 5EXLA 1SGNE 1MTVA 2J4IA 2BDGA 5LH8A 1FPCH 5AVDA 4CBNA 2OINA 3L33A 3Q76A 4WVPE 3T25A 3U9AH 2ZPRA 1BMNH 2SGFE 5EQSA 1KLJH 5BRRE 5EXNA 1W0ZU 2ZFRH 2ALPA 1GI1A 1AN1E 1GGDB 1JXPA 1GHAF 2F9NA 5CHAC 1N6YA 4E06H 5LGOA 1SGTA 1GI7B 1C2MA 3JZ1B 4GCHF 4M7GA 2TIOA 3AVZA 3E0NB 1TRNA 1B7XB 1Y3YA 2OCVB 3DHKH 1TOMH 1C2FA 1J14A 1EB1H 2XW9A 1P06A 4GSOA 3TJUA 1DX5M 2AYWA 2BQWB 1YCPH 1UTJA 2PTCE 9LPRA 2BVSH 4WMDA 4CRCA 1AI8H 4AGJA 4INLA 5EGMA 1H8DH 2C3SA 3T29A 5DP5A 3SO3A 3R0FA 4AG2A 1QY6A 2J92A 1GCTB 2FOMB 1PQAA 2P8OC 1W3CA 1TBQH 4F49A 4Q7XA 1EXFA 2PUXB 3GY7A 1LQDB 2F3CE 1SMFE 1AFQB 5DG6A 3S9AA 1L4ZA 3BTFE 3T2NA 5J4QA 3NKKA 3A86A 1SSXA 4Y7BA 1BUIA 1NZQH 4Y10E 7GCHF 1BTYA 1AB9B 4YLUA 1O2VA 1SGRE 5JBCS 2ZCKP 5C5OA 1CGIE 1GI8B 5AHGH 1BTUA 3UIRA 5K0HA 1AMHA 3HKIB 1O36A 3DA9B 4YLQH 2VIVA 3I78A 1PQ7A 1GMCF 3UUZA 1Q31A 2V35A 1ETSH 1QRZA 3ZZ8A 1U6QA 2YNBA 2Z9LA 4B76A 3UWJH 1WSSH 3RMLH 1AVWA 1DXPA 1GBKA 1NC6A 4MPWA 1KY9A 1HIAA 1K1NA 4ZH8A 2R2MB 3D62A 4FUFA 3GCNA 4NA8A 1DWCH 3A83A 3BN9A 1EZQA 1Z71A 1O2MA 1C1TA 1UCYH 1T7CA 3IITA 1NTPA 2SGPE 1AB9C 2ILNA 1T8MA 1S0QA 1GJ9B 2BD9A 1HBTH 1K28D 2NU0E 1DWBH 1V2PT 1YKTA 1WQVH 2D26C 1NU7B 1ZHRA 2FEQH 2FZZA 2WUCA 3AAVA 1BMLA 1WU1A 1JRSA 5HYOA 5HXFA 4KTSA 2BLVA 3GY8A 3OY6U 2FLBH 3MU8A 2FI5E 1BCUH 2QIQA 6GCHF 1EZXC 1SL3A 1HJAC 1TWXB 3LGYA 1YP9A 2BXUH 1HB0B 3H7OA 4Y0YE 3TIUA 5B6OA 1O3EA 1C4V2 2ANWA 1P57B 2QXHA 1SQOA 1UMAH 2PSYA 2VVVA 1E37B 1W10U 4GVUA 3RMOH 2EEKA 3SBKA 3OYPA 1S5SA 1FPHH 3RXVA 1FNIA 3RC6A 2LPRA 4DJZB 1GI6A 4Y79A 1GL0E 2NU4E 3FP7E 2A5IA 3ZV8A 3K65B 1OXGA 1T31A 3BTGE 4H6TA 3TU7H 3VGCC 3RMMH 3VFEA 2FTMA 1BT7A 2FXRA 5E0HA 2HLCA 2FX4A 1RIWB 4ZAEA 4WY3A 1A5HA 1NRNH 3LGUA 5TJXA 4K69A 2GZ8A 1FONA 1Z8IB 5GWZA 1DLKB 1S83A 3SU2A 1AVGH 3V3MA 1P9UA 1IQIA 1QL9A 3TVJB 3F6UH 1O35A 3W94A 1ELBA 2IPHA 3U1IB 1G3CA 2QF0A 1ID5H 2H9TH 2QYIA 2XCNA 1TPAE 4X6OA 2JKHA 1P2NA 4CRBA 2BY7X 4FUIA 1QTFA 1SLUB 1LMWB 2ZWLH 4ABEA 4UEHH 3ZZBA 1FIZA 1THSH 2J34A 2CF8H 3E6PH 4BAOB 1F5LA 1C5NH 3RXSA 3UWIA 1C2DA 4XFQA 1DDJA 1TNGA 1F0SA 1HNEE 1ZGIA 2WV4A 1JIMA 3F68H 3U69H 2C8XB 1PPCE 3KQEA 4TY7A 2ZGHA 3VB6A 1GL1A 2G51A 1ZRKA 1GVKB 1V2LT 1IQMA 5SGAE 1SG8B 3SW2B 2PGBB 3PO1C 1TE0A 4X6PA 1FY4A 1TAWA 4Y8ZA 3T28A 3SNEA 3TK6A 1EZSC 2AH4X 4WH6A 2BDBA 3ZZ6A 2JH0D 2SNVA 4ABFA 5C1XA 2FO9A 2QA9E 1C4Y2 1O3CA 4KTCA 4AOQA 1JWTA 1C5UA 5E2OA 2BHGA 4X2VA 3SV2H 2OC0A 3E91A 3TNTA 1NRRH 2H2ZA 2TBSA 2UUJB 1UTQA 1YLDA 4R0IA 5FPSA 1CHOG 2ZTZA 4CHAC 2BMGB 1OYQA 4GPGA 3EA9A 1CA8B 1QBVH 2A0QB 4D76A 1V2RT 2FOCA 1D6RA 1P09A 1TRYA 2ZDMA 3DD2H 1O2IA 1K1IA 1VCWA 1GCDA 2ZFFH 2ZFSA 4MNVA 3P8OA 3MU1A 1TPPA 1YPGH 2Z3CA 1DSUA 2J9NA 4UFEH 4YZUA 1BB0B 3ZVGA 4CRGA 1TMTH 3R3GB 4BTTB 4CHAB 3ZZ3A 5H4IB 1D6WA 2EC9H 1A0HB 1A1RA 1Z8JB 3UFAA 3LGWA 1O2RA 4INKA 1FI8A 1L4DA 2F83A 2GZ7A 1K1OA 2ZGJA 3MH4A 1MZDA 2B9LA 1CSOE 1HAZB 1MKXH 1QRXA 3W95A 1P2MA 4X0WU 2J95A 4X8TH 7LPRA 1KXDA 1ZSKA 5T6DA 1ELVA 4K1SA 1A0JA 1O5CB 4DY7B 2WYGA 4HTCH 2EI8A 3NCLA 2A7CA 1O5AB 1OWJA 3A8BA 1PYTD 2VWNA 3P6ZB 4ABIA 4LK4A 2VIPA 6CHAB 3NUMA 2HGTH 4JYUH 2O9QA 5C20A 3SHAH 1A46H 2XNIA 1C1WH 2B5TB 1C5VA 1BTHH 4DVAU 3A85A 3BTDE 1SPJA 1D9IA 1WYKA 2FOAA 5F8ZA 3VB5A 4K8YA 3T62A 1O2KA 1BRCE 4FU7A 3ZZ7A 1DXWA 2FX6A 3PMBB 1O2QA 4RKOB 2ZHEH 3SN8A 2Q6GA 3A8AA 1LKAA 1SGYE 4KP0A 3FP8E 2FTLE 1QIXB 1O38A 2HWLB 2BB4A 1T4UH 3TNSA 1IHTH 2XC4A 4ZKRU 2G5VA 4TWYA 3SU1A 1SGDE 1YLCA 3LH1A 1AIXH 4K1TA 2ZZUH 1UVUH 1O3IA 3BTQE 3RXQA 1NFUA 5LPEA 5AF9H 1BTPA 2GD4B 1HRTH 1O3DA 1Z6EA 4BNRA 1O5BB 1QGFA 3AASA 3QZRA 4JZDH 1C2LA 3QZQA 2ZHQH 4JK5A 2G81E 1ZR0A 1SHHB 3ZVDA 2PKSC 1AWHB 2ZI2H 1SGIB 1CU1A 1LVMA 3BG4C 2C8ZB 2BLQA 1MD7A 1HXEH 1Y59T 1CE5A 1ZOMA 1BHXB 1O3OA 2V0BA 3SNAA 1E0FD 3HK3B 1YCPM 3SU4A 5A09A 2A4OA 3RU4D 1IQJA 1THPB 2VIOA 2H5CA 1GI9B 2BDIA 3GOVB 2IN2A 2GCHG 4Y8XA 1HJ9A 4MNYA 2XBYA 4XSKU 1TALA 2ODYB 5PTPA 1E38B 3PLBA 4I8HA 1G30B 2BLWA 3ZVBA 3OSYA 4O3TA 3SNBA 1TGBA 3RLWH 3ATIA 4DG4A 3QUMP 2WPMS 2ZHFH 2W3IA 3FZZA 1GJBB 2ZU1A 1RXPA 1FMGA 1O30A 2I6SA 2ZF0H 1J9CH 2WINI 4JZIA 1G32B 1ZPCA 1BJUA 2GCHF 4YO9A 1Q2WA 2ZFPH 1G3DA 1Y3UA 1TQ7B 2Q6DA 2Y5HA 5EW2H 3ZVAA 2PLXA 5DP4A 5T3HA 2RA3A 1GBDA 4NZQA 1MH0A 4JCNA 3TJOA 1OWHA 1V2QT 5A0BA 1ELDE 2FPZA 4X6MA 3BG4B 1KXBA 2SGEE 2STAE 1ELGA 6ESTA 4B75A 3K2UA 1VZQH 1O2GH 1UCYE 3UY9A 3E3TA 5GCHF 1P01A 1A2CH 3BSQA 3KQDA 4FUHA 2QXGA 3A7WA 1P8VC 1UTMA 1QA7A 1QJ1B 5EG4A 1RFNA 2FS8A 3MH5A 2QXJA 2G4UA 2F91A 2HOBA 1D3PB 8KME2 2BDAA 1AZZA 1GBBA 1BBRK 1C2KA 4BANB 1BRUP 2ZQ2A 4HZHA 1LPZB 3UPEA 1DICA 1GMCG 3KGPA 1K22H 1BRAA 5FBIA 5C2ZA 1HAVA 4FUEA 1C5QA 4I31A 4CRFA 3Q3KA 3LPRA 2EI7A 1J16A 5DP3A 1QJ7B 4I7YH 1KIGH 4YOGA 2ANMH 1INCA 2DE9A 3VGCB 4AGKA 4MNXA 4K3JA 3HPTB 4TY6A 1SVPA 1SGPE 4DW2U 2ULLA 1EJAA 4XDEA 2A2XH 1C9TA 2VVCA 1YGCH 3Q00A 1UJ1A 4H4FA 2GMTC 5DJ7A 1BTZA 4AB8A 1GI4A 2ZQ1A 1O0DH 1QFKH 1UCYK 3G01A 1P9SA 1Y5AT 1C5SA 1O2TA 1K2I1 2PSXA 2VWMA 1SB1H 3RXJA 1IQFA 4MG3A 1VITG 1PQ5A 4CRAA 1YPLH 1KYNA 1OOKB 3FZDA 3LH3A 4YOIA 1HJAB 5TCCA 1RIWC 3ZZ5A 2IOTA 2GP9B 1WCZA 1F7ZA 9ESTA 4YESB 1DSTA 3LU9B 1MTNB 3ENSB 3RXEA 2ZDAH 1RD3B 1B0FA 1X7AC 3EE0B 4MPUA 2FYQA 2C8YB 3STIA 4WMEA 2GKVE 3BTME 3KEEA 5AFYH 1PQ8A 3RXKA 1F2SE 2ODPA 4O97A 1E34B 3NXPA 1ETTH 3DUXH 4AX9H 1VGCC 1FAKH 2GCTB 4FXGH 1Z8GA 3KL6A 4YM9A 3A8CA 2KAIB 1KXFA 5GIBA 4OS4A 5HM2A 1JMOH 1UTLM 5JB9S 4XBDA 1EAIA 1RTKA 1GBAA 2P8OB 4XBCA 3ZV9A 4B73A 4MQAA 2GX4A 1ELFA 1MCVA 1O31A 3TGIE 1V2TT 1GG6B 3P8FA 1YYY1 1BQYA 2VGCB 2GZ9A 1TA2A 5EODA 4Q2KA 3A80A 1FN6A 4ABGA 2C90B 3FP6E 4K8BA 3RC4A 3HATH 1IQKA 3SQEE 5T6FA 1A0LA 1F92A 1ACBE 1LPKB 4Q80A 1E35B 1V2ST 2A7HA 3SV6A 5I46H 4UFGH 3QGJA 4ZHMU 3SUDA 3V0XA 4BXWA 4UFDH 1RRKA 1VITH 2OXSA 4DURA 1P2KA 1P04A 3P8NA 1EOJA 5HM9A 1GCTC 2A5KA 1TMBH 2A4GA 1G9IE 2RCEA 3RMNH 3A88A 3M5OA 4GAWA 1ZMNA 1ZPBA 1O37A 1GHYH 1GBEA 1ESTA 1GHWH 1KDQB 5ESBA 2AGEX 2ZECA 2ZGXH 2OC7A 1HGTH 1CGHA 4VGCC 1Z6JH 1WBGB 1GHAG 1BTWA 2BQ7B 2GDEH 2ZP0H 1WTHD 4FUBA 4BXSA 1TX6A 2FODA 2JETB 1NT1A 3DT0H 4YT7H 3FVFB 2ZHWH 1F0TA 1S81A 2W3KA 3TPIZ 1O2JA 4ABBA 1UO6A 1AQ7A 1YCPK 4BTUB 1O2UA 3BG8A 2O8UA 3UOPA 3GDUA 1YPMH 3U8RH 3RU4T 2ZFQH 3RXGA 3SGQE 1FUJA 4CRDA 2A31A 1MQ5A 5L30H 1FY8E 4VGCB 1JBUH 4X8VH 3PLKA 3GDVA 4MDSA 1LTOA 4K1EA 4OS2A 1TOCB 1TGSZ 2ZCLP 1MBMA 3ZYDA 2ZFTA 1N8OC 1GMDF 1NM6A 3A87A 5ESTE 8GCHF 2UUYA 2VINA 4DIIH 4Y6DA 1OSSA 2P3TB 1P05A 1TQ0B 2W26A 4CR9A 2C8WB 2ASUB 1YPKH 3M36A 3QLPH 1O2LA 4I32A 3N7OA 1O3BA 1C5PA 1N8OB 2J2UA 4UFFH 4IW4E 4FVDA 3S69A 1CBWC 1O33A 1AZ8A 2SGQE 1W13U 3RXCA 3O8BA 2FWWA 1GHVH 1P2QA 1DOJA 5FHTA 1S6FA 2W5EA 3MO9A 5FX6A 3ZYEA 4DIHH 4MTBA 2VIDA 1VCQA 1OWIA 2VVUA 2A1DB 2AERH 3LC3A 3RXIA 6LPRA 4QT8C 1H8IH 3GYMA 2QV1A 1O5DH 1O39A 2GTBA 2PKAB 1FN8A 3K6ZA 3P95A 3HGNA 1EX3A 1BHXF 2G5NA 2Z7FE 3BV9B 4LZ1H 4ESTE 1TGCA 2OBQA 1T32A 1TGTA 4FU8A 3HK6B 2A4RA 2BM2A 3PMAB 4GHTA 5L2YH 1QB9A 4Y11E 1GDUA 4D9RA 4NIVA 1A5IA 1S6HA 3H7TA 1Z8RA 2WPJS 3PWCA 2XBVA 4I8GA 2P95A 4YT6H 4RKJB 1UVOA 4OS5A 4TWWA 3MH6A 5FCRA 1RTLA 2GVFA 1SFIA 4A92A 5E2PA 1XUIA 5HMAA 3BIUH 5HGGA 1TBZH 2ANYA 3RXTA 1QL8A 5DP6A 3PV4A 1O2WA 3MYWA 1DPOA 5IDKA 1SLXB 3KQCA 1MZAA 3UQVA 1DFPA 1A3BH 3SV9A 2VH0A 1N6XA 2QY0B 3GISB 1FQ3A 2ODQA 2P3FH 1W12U 4UE7H 4HI3A 5C1UA 2PTNA 2CMYA 2Y5GA 3D23A 1AY6H 3BEUA 1JRTA 4JK6A 3DFJA 3RXAA 3I77A 2FI3E 3AW0A 1C5YB 4CH8B 1LHCH 3QO6A 3QTOH 1UHBA 3P17H 3TGJE 1K21H 1EAWA 3GY4A 1MCTA 1FV9A 3OY5U 3Q3YA 1YBWA 2SGAA 1PPZA 4X8UH 3GDSA 5EOKA 2XWAA 2FOGA 5EQQA 4A5TS 3STJA 1C5TA 4JZ1A 4GHQA 1KXCA 3E16B 2ZDLA 1C1UH 2PKSB 3RM0H 2BX3A 2AMPA 5G4BA 3RU4E 2ZCHP 3I29A 2A45B 1C1QA 3LC5A 3O8RA 3A82A 1LQEA 2EA3A 1XKBC 1TPSA 1P12E 1MU6B 4IS5A 8LPRA 3V13A 2WV5A 1FJSA 2QGRA 5JBBS 2JETC 3SOSA 5JBAS 3GCHC 1KSNA 3EYDA 4DT7B 1A5GH 2C93B 2QN5T 1XUHA 3LGVA 3PTBA 3OU0A 2XWBI 4JZFH 1ANBA 2IJOB 3VB7A 2THFB 2ZU5A 2OBOA 3SGBE 1KXAA 4YOJA 1XXFA 3OX7U 3F9EA 3MWIU 1QHRB 3SUFA 4Y0ZE 3F9FA 1ZMJA 3M61U 1PPFE 1OP2A 3PMHB 1J8AA 1P2IA 4NA9H 1V2NT 1WQSA 1MU8B 3HKJB 5GXPA 1Z1JA 4AYYB 4J1YA 2BLOA 3OTJE 3SI3H 1CQQA 1AKSA 4ZMAH 3E90B 1O3KA 1L0ZA 4X1SU 3T27A 3EAJA 1RS0A 2ZGCA 4OS6A 3RC5A 1SI5H 3RLYH 1MTSA 1G37A 3D49H 5A2MH 1BBRH 1DT2A 3FAOA 3MU0A 4NG9H 1AKSB 3CS7A 4WXIA 2CJIA 2ZIQH 3JZ2B 1NESE 3L6PA 4K60A 1AFQC 2PGQB 5JPMH 3NK8A 1ZJDA 2BZAA 2VGCC 1MD8A 1TX7A 2UWPA 4AFSA 1ORFA 3RM2H 1MKWK 1UVTH 3DFLA 4IGDA 3VXFH 1C5XB 1TYNA 3B8JA 3RXLA 8GCHG 1C5LH 1OP8A 1G3BA 1P3EA 2WPHS 5EPNA 3SV8A 3A89A 2SFAA 4MLFB 3BTWE 1P3CA 1OWEA 2TGPZ 1BJVA 4TYDA 3ZZCA 3LDXH 4ZXXH 1N1LA 2FI4E 3SNCA 2YNAA 1EPTC 1TABE 1L1NA 2P16A 5JBTA 3ZZDA 1GMDG 3UNQA 3PMJA 1H1BA 1ETRH 1Y3XA 4FVBA 2XC5A 2B8OH 2YOLA 1DITH 3KQBA 1NFWA 3SZNA 1NY22 2CHAB 2RA0A 2JH5D 1MTNC 3BTEE 1TRMA 2FM2A 2TGDA 1QB6A 1DY8A 2PW8H 2BD7A 5DP8A 1TNLA 3A7XA 2ZA5A 1UHBB 3ATWA 2V6NA 3IWMA 2CGAA 3SJ8A 1T4VH 1TONA 1ABJH 1XVMA 4HGCA 2XRCA 5GPIB 5J4SA 1EASA 4NIYA 1SOTA 5JYIA 1LPGB 1V2MT 3TLOA 4BAKB 3TJNA 5K7RA 1BMAA 2A7JA 3ITIA 3TK5A 3MOCA 4ZUHA 1F5RA 1F5KU 1H9HE 4OGYA 3A7ZA 3A84A 5F8TA 3S9BA 1QBNA 2FESH 1GBHA 2QF3A 3GY3A 4IMZA 1GI5A 1CT0E 1MTUA 3M3TA 3M5LA 1AUJA 1HAGE 5EXMA 1O2XA 1IQGA 1HDTH 1EKBB 1Y3VA 4RN6A 5FPYA 2Z9GA 1CVWH 5FX5A 1G2LA 4O9VA 5IYTA 1AU8A 2SNWA 1P03A 4ABAA 1ZYOA 1D3QB 1C1OA 3NPSA 2FMJA 3SU0A 4B2AA 1EP6A 1C1MA 2BY9X 4FUCA 1S0RA 1QR3E 2PV9B 1IQEA 1CHGA 3A7TA 3SV7A 1DANH 1HAHH 4D7FA 3PB1E 2GV6A 1ABIH 1D4PB 1GHZA 1LHDH 1NROH 1SOZA 4NSVA 5E8EH 2AGIX 1Z7KA 3BTKE 4E7RG 3SNDA 1C2EA 3PM3A 1O2OA 1ZMLA 4UD9H 1D3DB 1O2HA 2B7DH 4YTAA 3M35A 3M5MA 1DE7H 2P59A 3VB4A 1KTTB 3LIWA 2ZHDA 3SJOA 3MNCA 2AIQA 1LCYA 2Y80A 2BDYA 4U2WA 1CA0B 3WY8A 1DUAA 1O32A 2HRVA 1IHSH 1MAXA 2FS9A 2UUKB 4ISHH 4X8SH 1YF4A 1EJNA 4AZ2B 2F9BH 1GDNA 1ZGVA 4ABHA 4B1TA 2UWOA 1O5EH 2A5AA 1ZTJA 4IN2A 1YPHC 3FANA 4IC6A 3QDZB 1H9LB 5T6GA 2Y6TA 5CE1A 2ANKH 5TCAA 1A4WH 4BOHA 4NWKA 3AW1A 2FOEA 4XE4A 3S7HB 1CO7E 2O8WA 1VITF 1AE5A 2XC0A 2Z3EA 3ATMA 2W7SA 4CBOA 4ZHLU 1EZUC 3D65E 4LXBH 3UR6A 1XKAC 4XOJA 2Q6FA 3MI4A 1E36B 2DUCA 1HAXB 1UTPA 4THNH 2I6QA 1TGNA 1ARCA 3BTTE 1GJ8B 4ISLA 1OWDA 2GT7A 7ESTE 4KKDA 1C1VH 3LOXA 1C2HA 1PYTC 4A1VA 3T5FH 3KF2A 3UNRA 1M9UA 2HNTE 1ZRBA 2ZDKA 4Z6AH 2ALVA 4K5ZA 3ELAH 4FUJA 5EPYA 3PTNA 3TITA 1XX9A 4E7NA 4MVNA 1HYLA 3GCOA 2VWOA 4INHA 1GBMA 3GY6A 5C3NA 1F0UA 2Z6BD 4O03A 2KAIA 1NPMA 3MNSA 1JIRA 2WYJA 4PROA 1TX8A 4DOQA 1QCPA 2BVXH 1EPTA 3GCHB 1NFXA 5DP7A 4AN7A 1KDQA 2AS9A 4OGXA 1GBJA 1HJ8A 1SBWA 3E1XB 3RUOA 2HVXA 2A32A 4A1XA 2WPLS 4A6LA 2BY6X 1CGJE 1FXYA 3QX5H 1O3FA 4JMYA 1G2MA 1GBIA 4X2XA 2G4TA 2OP9A 1SQAA 4UONA 1SGEE 4LZ4B 2TGTA 1BRBE 2BD3A 1HAOH 1YC0A 3A7YA 5GJ4B 5LPRA 3VB3A 1O2NA 1T8OA 4SGAE 4Q7ZA 1V3XA 3NZIA 2NWNA 1O5FH 1BTXA 1WUNH 2Z9KA 1EP5A 1ESBA 2D8WA 3ZVEA 2GMTB 4B74A 4X1RU 1HXFH 1F0RA 3EDXB 1WOFA 4IMQA 1PPEE 1BBRE 1XUJA 1V2OT 1ZPZA 2QXIA 3UTUH 5JDUB 3AAUA 1C4U2 5DGJA 1O3LA 3LKWA 3TH3H 1GHXH 1UK3A 4WF8A 2H6MA 4FU9A 1L2EA 2Q1JA 3MTYA 4WXVA 3U8OH 2R0LA 4WMFA 3RXOA 1MUEB 4BAHB 3NWUA 4NSYA 2CN0H 3U1JB 2OC8A 1QBOA 4X1NU 5CMXH 4CREA 6CHAC 1SC8U 5EW1H 3LONA 1V2KT 1QRWA 4FUGA 3SQHE 1EQ9A 1AD8H 2Z3DA 2ZEBA 3ZZ4A 5EQRA 1O3AA 2FDAA 4Y8YA 2FOBA 2FP7B 3UREA 2B0FA 1XUFA 1PPGE 3SJIA 2OQUA 1GJAB 2ZU2A 1FLEE 3EA7A 1GI2A 2AMQA 1EB2A 4KTUA 1UVSH 4CH2B 2BD4A 4JYTA 1GMHF 2BX4A 3O8CA 4D8NA 2RDLA 1C5OH 3TH4H 3LJJA 1DVAH 1GHBG 4NGAH 4ZKOU 2VNTA 3SHCH 2Y81A 1A61H 1DUEA 3KCGH 4AFQA 4WJG2 2OC1A 1TLDA 2Z94A 3V7TA 4BTIB 1C5WB 1MKXK 5E0GA 2V3HH 2G52A 3ODFA 1W2KH 1EAXA 3KN2A 4NFFA 1ZSLA 5L6NH 1A3EH 4U01A 4Y76A 1Y5BT 5AFZH 1DLEA 1C5RA 3ZZAA 2J94A 1CBWB 1GBTA 2ZPQA 1UK4A 2V3OH 8ESTE 2FIRH 3MHWU 2FYRA 3RXUA 1C5ZB 1ESAA 4D9QA 4I8LA 2Y7ZA 1IQHA 1C1PA 1C1NA 1GJDB 2W7UA 1SLWB 3T26A 1MQ6A 2H9EH 1GBCA 1SGCA 1ZHMA 1XXDA 4ISIH 1GVZA 3LGTA 1TFXA 3L3TA 1C9PA 1GWAA 2UUFB 4NIWA 3H5CB 2ZU3A 1WV7H 3Q3XA 3GCTF 5L2ZH 3RXPA 1AVXA 1BIOA 3KNXA 3MO3A 2BZ6H 1GG6C 4MNWA 5GCHG 1LHFH 1V6DA 2PR3A 4GCHG 1GI3A 2PHBA 3LGIA 2NU2E 2HALA 1KXEA 4X2YA 1O5GH 4BAMB 2F9OA 1EATA 1ZZZA 4B2BA 2PKAA 1O3HA 3ZZ9A 1XVOA 4MPXA 3RXBA 2C4FH 1QB1A 2Z9JA 3ATKA 2XBWA 5DPAA 1GBLA 2BDCA 3URCA 1TNHA 1O2ZA 1OX1A 1BMMH 4NIXA 2F9PA 5BPEA 3RXDA 2F9UA 2OD3B 4BAQB 1T8NA 1LVOA 1HAYB 1P0SH 2OQ5A 2WPKS 2O8TA 4AG1A 2Y82A 3M3VA 3LJOA 5FXLA 2K1QA 4I8JA 4IBLH 2NU3E 3M37A 1GBFA 1P02A 2XTTB 4X1PU 2XXLA 1C5MD 1NS3A 2HPQH 2AFQB 1K1MA 1EAUA 4GLYA 4DCDA 3EA8A 1CHOF 1O2PA 3MU5A 4H6SB 2CV3A 1P11E 4FUDA 1XM1A 5ABWA 3SI4H 1JOUB 1MKWH 1NO9H 3ATLA 2H1UA 3BIVH 1H4WA 2D1JA 3PLPA 3CP7A 1OS8A 1Y8TA 4RSPA 1FY3A 1IOEA 2ZDVH 3F1SB 1C2GA 1VCPA 3B9FH 3SGAE 1HV7A 1O2SA 2BTCE 2BD2A 4CR5A 2STBE 2FOFA 5A8ZA 1ELCA 1GJ6A 2ZTXA 3TH2H 1Z1IA 2HPPH 1GJ5H 2Z9IA 2H9HA 1TPOA 4I33A 1GI0A 2H5DA 1BITA 3GCTG 2G8TA 2FOHA 1QURH 1HPGA 3PO1B 1L1GA 1UTNA 1GJ7B 2BDHA 1OKXA 1QQ4A 3EGKH 5JB8S 4Z0KA 1DWEH 3ZVCA 4ABDA 1ZLRA 3B23B 3KIDU 1AHTH 1THRH 4F4OC 1XUGA 5DKMA 1ZTKA 1K1LA 3RXRA 2TRMA 3P70B 2WUBA 1S85A 3P92A 2AEIH 4Y71A 1QA0A 1AUTC 3VEQB 2DE8A 3SUGA 5FCKA 1CA0C 1HIAB 3GY2A 1H9IE 1K9OE 3M7TA 4JYVH 1AO5A 1BOQA 2O8LA 5A8YA 1GJCB 1RGQA 2FLRH 3SU3A 3QK1A 4IC5A 2BY8X 3U8TH 4ASHA 1V2JT 3FFGA 1BZXE 3QN7A 1KTSB 2HNTC 4KGAA 5DK1A 1VR1H 3SUEA 2BYAX 3ODDA 1S82A 3PWBA 1GPZA 1W7XH 2CHAC 1G3EA 2PWXA 1BDAA 3SORA 1VJAU 1YPJH 3M7UA 4U32A 1SQTA 3Q77A 2OLGA 3ESTA 5F03A 4I8KA 1PJPA 1PPHE 4ISNA 1Y3WA 2GV7A 5DO4H 4UDWH 1NRQH 2Y5FA 4GUXA 4IN1A 4NCYA 5C5NA 1XMNB 2RG3A 2ZGBH 4AORA 3TGKE 2AGGX 2QCYA 1UTKA 1GHBF 1NN6A 1Q3XA 2VWLA 3BEIB 2XYAA 5A8XA 3S9CA 3RXHA 2UWLA 1FY1A 2VIQA 4D7GA 1XUKA 1C1SA 4Y7AA 1BA8B 6GCHG 2NU1E 3LT3A 5FPTA 1S84A 1TNIA 1ELAA 1C2JA 1RJXB 1B0EA 2GT8A 4AB9A 1Y5UT 3MFJA 3P8GA 2CXVA 1ELEE 4Q7YA 1O34A 3KHVA 1ANCA 3C27B 1TA6A 4A1TA 3RXFA 1IAUA 1IQLA 3MO6A 1DY9A 2TGAA 4OS1A 4J2YB 4DGJA 4ZXYH 2ZNKH 1NFYA 4NFEA 1FIWA 4LOYH 1B5GH 3UOUA 1C1RA 1HLTH 1VJ9U 1DWDH 4U30A 2BD5A 3E8LA 3SJ9A 1T8LA 1OWKA 3GICB 1LKBA 2GDDA 1FY5A 1FDPA 1LHEH 4B2CA 3VPKA 2EI6A 2ZO3H 4SGBE 3RP2A 2M5TA 4ZKSU 2Y7XA 1SGFA 2LNCA 5C67A 1OYTH 1A7SA 2A2QH 3PYHA 1EJMA 4X6NA 1MBQA 3MU4A 2R9PA 1WAYB 3S0NA 2QC2A 3K9XB 4K2YA 1DS2E 2GCTC 1TNJA 1EPTB 3F9GA 3BEFB 1W11U 2ZTYA 1EUFA 1V2WT 1C2IA 1ELTA 5I25A 1LO6A 4NZLA 1HAVB 1OP0A 1SGFG 1UVPA 5FBEA 4ABJA 2VIWA 4WWYA 1QNJA 3U98H 1AE8H 2G55A 2BQ6B 2GGVB 1D3TB 1LHGH 3RDZA 3VXEH 4E05H 5A0CA 2TPIZ 2VJ1A 1IQNA 3SJKA 4ZKNU 3M3SA 4AFUA 1V2VT 1MMJN 3HGPA 2AMDA 2G00A 3BF6H 4AYVB 7KMEH 2P3UB 2ZDNA 4WH8A 1K1JA 1EOLA 2PUQH 3MNBA 1O3GA 2F9VA 4HFPB 1TNKA 5EU8A 3V12A 2A4QA 4JZEH 3GYLB 2PFEA 4H42U 1O3MA 3ZVFA 2O8MA 3RXMA 3MNXA 3MH7A 3A7VA 2BY5X 2BXTH 1W7GH 2OTVA 2ZU4A 1J15A 1NRPH 2ZKSA 4ZHAA 2ZG0H 1VGCB 2R0KA 1OPHB 1O3NA 1PFXC 3SU5A 1YM0A 3S7KB 1HCGA 2WPIS 5C1YA 1LDTT 3PROA 3M7QA 3QWCH 3M5NA 1L1JA 1NU9A 1ARBA 4MPVA 4A7IB 2SGDE 5A0AE 1J17T 1AGJA 1SLVB 1HFDA 1ANDA 1TB6H 3F9HA 1O2YA 2BOKA 1O3PB 3E0PB 5GDSH 3URDA 4OS7A 2ESTE 1ZHPA 5E0JA 1NRSH 1ZSJA 4NA7A 4TPYA 1AWFH 5FAHA 2R3YA 4KELA 1FZZA 1RTFB 1V2UT 1GJ4H 2BD8A 1LVBA 2XCFA 1YPEH 1W8BH 4R8TB 1SFQB 1SR5C 3CENA 3UQOA 1CT4E 3UR9A 4ISOA 1P2OA 1HAPH 2JH6D 2XBXA 2ZPSA 3GY5A 5F6MA 1HAIH 3TK9A 3UNSA 5LPFA 1UK2A 3O8DA 5CHAB 1GGDC 4XBBA 1SGQE 1WTGH 1G36A 1LVYA 4TPIZ 1GMHG 2R2WU 1DM4B 4O3UA 1TMUH 1KLIH 1QQUA 2P93A 2P94A 4ZROA 3BTHE 4NWLA 5ETXA 2ZC9H 3IG6B 1MAYA 4B71A 1W0YH 1ZJKA
chains in the Genus database with same CATH superfamily
1QJ6B 3ZIAD 1P10A 1FAXA 4XRNA 4AFZA 1QL7A 3MMGA 3QTVH 1GDQA 1YPHE 5DP9A 4X1QU 3QGNB 2VH6A 2VU8E 3A81A 2BOHB 7GCHG 2QAAA 2AIPA 3K6YA 3SU6A 1SHYA 1TIOA 2D2DA 3EQ0H 1W14U 1K1PA 3C1KA 3CS0A 1ZTLA 2J38A 1TBRH 2OUAA 2CF9H 1O3JA 1FX0B 2R3UA 1KLTA 1ANEA 2HNTF 1MTWA 4X2WA 1GVLA 3TJVA 1AFEH 2BVRH 1CT2E 3A8DA 2VB0A 5F8XA 3UB0A 1P2JA 1UTOA 1PPBH 1HUTH 5EXLA 1SGNE 1MTVA 2J4IA 2YMSC 2BDGA 5LH8A 1FPCH 2KR7A 5AVDA 4CBNA 2OINA 3L33A 3Q76A 4WVPE 3T25A 3U9AH 2ZPRA 1BMNH 2SGFE 5EQSA 1KLJH 5BRRE 5EXNA 1W0ZU 2ZFRH 2ALPA 1GI1A 1AN1E 1GGDB 1JXPA 1GHAF 2F9NA 5CHAC 1N6YA 4E06H 5LGOA 1SGTA 1GI7B 1C2MA 3JZ1B 4GCHF 4M7GA 2TIOA 3AVZA 3E0NB 1TRNA 1B7XB 1Y3YA 2OCVB 2V3MA 3DHKH 1TOMH 1C2FA 1J14A 1EB1H 2XW9A 1P06A 4GSOA 3TJUA 1WDIA 1DX5M 2AYWA 2BQWB 1YCPH 1UTJA 2PTCE 9LPRA 2BVSH 4WMDA 4CRCA 1AI8H 4AGJA 4INLA 5EGMA 1H8DH 2C3SA 3T29A 5DP5A 3SO3A 3R0FA 4AG2A 1QY6A 2J92A 1GCTB 2FOMB 1PQAA 2P8OC 1W3CA 1TBQH 4F49A 4Q7XA 1EXFA 2PUXB 3GY7A 1LQDB 2F3CE 1SMFE 1AFQB 5DG6A 3S9AA 1L4ZA 3BTFE 3T2NA 5J4QA 3NKKA 3A86A 1SSXA 4Y7BA 1BUIA 1NZQH 4Y10E 7GCHF 1BTYA 1AB9B 4YLUA 1O2VA 1SGRE 5JBCS 2ZCKP 5DSFA 1CGIE 1GI8B 5AHGH 1BTUA 5C5OA 3UIRA 5K0HA 1AMHA 3HKIB 1O36A 3DA9B 4YLQH 2VIVA 3I78A 1PQ7A 1GMCF 3UUZA 1Q31A 2V35A 1ETSH 1QRZA 3ZZ8A 1U6QA 2YNBA 2Z9LA 4B76A 3UWJH 1WSSH 3RMLH 1AVWA 1DXPA 1GBKA 1NC6A 4MPWA 1KY9A 1HIAA 1K1NA 4ZH8A 2R2MB 3D62A 4FUFA 3GCNA 4NA8A 1DWCH 3A83A 3BN9A 1EZQA 1Z71A 1O2MA 1C1TA 1UCYH 1T7CA 5T1VA 3IITA 1NTPA 2SGPE 1AB9C 2ILNA 1T8MA 1S0QA 1GJ9B 2BD9A 1HBTH 1K28D 2NU0E 1DWBH 1V2PT 1YKTA 2L74A 1WQVH 2D26C 1NU7B 1ZHRA 2FEQH 2FZZA 2WUCA 3AAVA 1BMLA 1WU1A 1JRSA 5HYOA 1VKYA 5HXFA 2W6ID 4KTSA 2BLVA 3GY8A 3OY6U 2FLBH 3MU8A 2FI5E 1BCUH 2QIQA 6GCHF 1EZXC 1SL3A 1HJAC 1TWXB 3LGYA 1YP9A 2BXUH 1HB0B 3H7OA 4Y0YE 3TIUA 5B6OA 1O3EA 1C4V2 2ANWA 1P57B 2QXHA 1SQOA 1UMAH 2PSYA 2VVVA 1E37B 1W10U 4GVUA 3RMOH 2EEKA 3SBKA 3OYPA 1S5SA 1FPHH 3RXVA 1FNIA 3RC6A 2LPRA 5C0TA 4DJZB 1GI6A 4Y79A 1GL0E 2NU4E 3FP7E 2A5IA 3ZV8A 3K65B 1OXGA 1T31A 3BTGE 4H6TA 3TU7H 3VGCC 3RMMH 3VFEA 2FTMA 1BT7A 2FXRA 5E0HA 2HLCA 2FX4A 1RIWB 4Q4LA 4ZAEA 4WY3A 1A5HA 4F55A 1NRNH 3LGUA 5TJXA 4K69A 2GZ8A 1FONA 1Z8IB 5GWZA 1DLKB 1S83A 3SU2A 1AVGH 3V3MA 1P9UA 2IJD1 1IQIA 1QL9A 3TVJB 3F6UH 1O35A 3W94A 1ELBA 2IPHA 3U1IB 1G3CA 2QF0A 1ID5H 2H9TH 2QYIA 2XCNA 1TPAE 4X6OA 2JKHA 1P2NA 4CRBA 2BY7X 4FUIA 1QTFA 1SLUB 1LMWB 2ZWLH 4ABEA 4UEHH 3ZZBA 1FIZA 1THSH 2J34A 2CF8H 3E6PH 4BAOB 1F5LA 1C5NH 3RXSA 3UWIA 1C2DA 4XFQA 1DDJA 1TNGA 3WWFA 1F0SA 1HNEE 1ZGIA 2WV4A 1JIMA 3F68H 3U69H 2C8XB 1PPCE 3KQEA 4TY7A 2ZGHA 5IK2D 3VB6A 1GL1A 2G51A 1ZRKA 1GVKB 5GNDA 1V2LT 2KCYA 1IQMA 3F2GA 5SGAE 1SG8B 3SW2B 2PGBB 3PO1C 1TE0A 4X6PA 1FY4A 1TAWA 4Y8ZA 3T28A 3SNEA 4YXWD 3TK6A 1EZSC 2AH4X 4WH6A 2BDBA 3ZZ6A 2JH0D 2SNVA 4ABFA 5C1XA 2FO9A 2QA9E 1C4Y2 1O3CA 4KTCA 3WWBA 1JWTA 1C5UA 5E2OA 2BHGA 4AOQA 4X2VA 3SV2H 2OC0A 3E91A 3TNTA 1NRRH 2H2ZA 2TBSA 2UUJB 1UTQA 1K0HA 1YLDA 2RDEA 4RT1A 4R0IA 5FPSA 1CHOG 1COWD 2ZTZA 4CHAC 2BMGB 1OYQA 4GPGA 3EA9A 1CA8B 1OHHD 1QBVH 2A0QB 1EFRD 4D76A 1V2RT 2FOCA 1D6RA 1P09A 1TRYA 2ZDMA 3DD2H 1O2IA 1K1IA 1VCWA 1GCDA 2ZFFH 2ZFSA 4MNVA 3P8OA 3MU1A 1TPPA 1YPGH 2Z3CA 1DSUA 2J9NA 4UFEH 4YZUA 1BB0B 3ZVGA 4CRGA 1TMTH 3R3GB 4BTTB 4CHAB 3ZZ3A 5H4IB 1D6WA 2EC9H 1A0HB 1A1RA 1Z8JB 3UFAA 3LGWA 1O2RA 4INKA 1FI8A 1L4DA 2F83A 2GZ7A 1K1OA 2ZGJA 3MH4A 4DT4A 1MZDA 2B9LA 1CSOE 1HAZB 1MKXH 1QRXA 3W95A 1P2MA 4X0WU 2J95A 4X8TH 7LPRA 1KXDA 1ZSKA 5T6DA 1ELVA 4K1SA 1A0JA 1O5CB 4DY7B 2WYGA 4HTCH 2EI8A 3NCLA 2A7CA 1O5AB 1OWJA 5HIZA 3A8BA 1PYTD 2VWNA 3P6ZB 4ABIA 4LK4A 2VIPA 6CHAB 3NUMA 2HGTH 4JYUH 2O9QA 5C20A 3SHAH 1A46H 2XNIA 1C1WH 2B5TB 1C5VA 1W0JD 1BTHH 1MABB 4DVAU 3A85A 3BTDE 1SPJA 1D9IA 1WYKA 2FOAA 5F8ZA 3VB5A 4K8YA 3T62A 1O2KA 1QZ8A 1BRCE 4FU7A 3DSOA 3ZZ7A 1DXWA 2FX6A 3PMBB 1O2QA 4RKOB 2ZHEH 3SN8A 2Q6GA 3A8AA 1LKAA 1SGYE 4KP0A 3FP8E 2FTLE 1QIXB 1O38A 2HWLB 2BB4A 1T4UH 3TNSA 1IHTH 2XC4A 4ZKRU 2G5VA 4TWYA 3SU1A 1SGDE 1YLCA 3LH1A 3SYJA 1AIXH 4K1TA 2ZZUH 1UVUH 1O3IA 3BTQE 3RXQA 1NFUA 5LPEA 5AF9H 1BTPA 2GD4B 1HRTH 1O3DA 1Z6EA 4BNRA 1O5BB 1QGFA 3AASA 3QZRA 4JZDH 1C2LA 3QZQA 2ZHQH 4JK5A 2G81E 1ZR0A 1SHHB 3ZVDA 2PKSC 1AWHB 2ZI2H 1SGIB 1CU1A 1LVMA 3BG4C 2C8ZB 2BLQA 1MD7A 1HXEH 1Y59T 1CE5A 1ZOMA 2EQNA 1BHXB 1O3OA 2V0BA 3SNAA 1E0FD 3HK3B 2OK5A 1YCPM 3SU4A 5A09A 2A4OA 1YLNA 3RU4D 1IQJA 1THPB 2VIOA 2H5CA 1GI9B 2BDIA 3GOVB 2IN2A 2GCHG 4Y8XA 1HJ9A 4MNYA 2XBYA 4XSKU 1TALA 2ODYB 5PTPA 1E38B 3PLBA 4I8HA 1G30B 2BLWA 3ZVBA 3OSYA 4O3TA 3SNBA 1TGBA 3RLWH 3ATIA 1E1RD 4DG4A 3QUMP 2WPMS 2ZHFH 2W3IA 3FZZA 1GJBB 5C94A 2ZU1A 3OEED 1RXPA 1FMGA 1O30A 2I6SA 2ZF0H 1J9CH 2WINI 4JZIA 1G32B 1ZPCA 1BJUA 2LELA 2GCHF 4YO9A 1Q2WA 2ZFPH 1G3DA 1Y3UA 1TQ7B 2Q6DA 2Y5HA 2KX4A 5EW2H 3ZVAA 2PLXA 2M2AA 5DP4A 5T3HA 2RA3A 1GBDA 4NZQA 1MH0A 4JCNA 3TJOA 1OWHA 1V2QT 5A0BA 1ELDE 2FPZA 4X6MA 3BG4B 1KXBA 2SGEE 2STAE 1ELGA 6ESTA 4B75A 4I86A 1YY3A 3K2UA 1VZQH 1O2GH 1UCYE 2PP6A 3UY9A 3E3TA 5GCHF 1P01A 1A2CH 3BSQA 3KQDA 4FUHA 2QXGA 3A7WA 1P8VC 1UTMA 2KZ4A 1QA7A 1QJ1B 5EG4A 1RFNA 2FS8A 3MH5A 2QXJA 2G4UA 2F91A 2HOBA 1D3PB 8KME2 2BDAA 1AZZA 1GBBA 1BBRK 1C2KA 4BANB 1BRUP 2ZQ2A 4HZHA 1LPZB 3UPEA 1DICA 1GMCG 3KGPA 1K22H 1BRAA 3PRBA 5FBIA 5C2ZA 1HAVA 4FUEA 1C5QA 4I31A 4CRFA 3Q3KA 3LPRA 2EI7A 1J16A 5DP3A 1QJ7B 4I7YH 1KIGH 4YOGA 2ANMH 1INCA 2DE9A 3VGCB 4AGKA 4MNXA 4K3JA 3HPTB 4TY6A 1SVPA 1SGPE 4DW2U 2ULLA 1EJAA 4XDEA 2A2XH 1C9TA 1YGCH 2VVCA 3Q00A 1UJ1A 4H4FA 2GMTC 5DJ7A 1BTZA 4AB8A 1GI4A 2ZQ1A 1O0DH 1QFKH 1UCYK 3G01A 1P9SA 1Y5AT 1C5SA 1O2TA 1K2I1 2PSXA 3F2FA 2VWMA 1SB1H 3RXJA 1IQFA 4MG3A 1VITG 1PQ5A 4CRAA 1E1QD 1YPLH 1KYNA 1OOKB 3FZDA 2WZQA 3LH3A 4YOIA 3KYGA 1HJAB 5TCCA 1RIWC 3ZZ5A 2IOTA 2GP9B 2XNDD 1WCZA 1F7ZA 9ESTA 4YESB 1DSTA 3LU9B 1MTNB 3ENSB 3RXEA 2ZDAH 1RD3B 1B0FA 1X7AC 3EE0B 4MPUA 2FYQA 2C8YB 3STIA 4WMEA 2GKVE 3BTME 3KEEA 5AFYH 1PQ8A 3RXKA 1F2SE 2ODPA 4O97A 1E34B 3NXPA 1ETTH 3DUXH 4AX9H 1VGCC 1FAKH 2GCTB 4FXGH 1Z8GA 3KL6A 4YM9A 3A8CA 2KAIB 1KXFA 5GIBA 4OS4A 5HM2A 1JMOH 1UTLM 5JB9S 4XBDA 1EAIA 1RTKA 1GBAA 2P8OB 4XBCA 3ZV9A 4B73A 4MQAA 2GX4A 1ELFA 1MCVA 1O31A 3TGIE 1V2TT 1GG6B 2AHME 3P8FA 1YYY1 3WW7A 1BQYA 2VGCB 2GZ9A 1TA2A 5EODA 4Q2KA 3A80A 1FN6A 4ABGA 2C90B 3FP6E 4K8BA 3RC4A 3HATH 1IQKA 3SQEE 5T6FA 1A0LA 1F92A 1ACBE 1LPKB 4Q80A 1E35B 1V2ST 2A7HA 3SV6A 5I46H 4UFGH 3QGJA 4ZHMU 3SUDA 3V0XA 4BXWA 4UFDH 1RRKA 1VITH 2OXSA 4DURA 1P2KA 1P04A 2YMSD 3P8NA 1EOJA 5HM9A 1GCTC 2A5KA 1TMBH 2A4GA 1G9IE 1YWUA 2RCEA 3RMNH 3A88A 3M5OA 2KCPA 4GAWA 1ZMNA 1ZPBA 1O37A 1GHYH 1GBEA 1ESTA 1GHWH 1KDQB 5ESBA 2AGEX 2J98A 2ZECA 2ZGXH 2OC7A 1HGTH 1CGHA 4VGCC 1Z6JH 1WBGB 1GHAG 1BTWA 2BQ7B 2GDEH 2ZP0H 1WTHD 4FUBA 4BXSA 4XD7D 1TX6A 2FODA 2JETB 1NT1A 3DT0H 4YT7H 3FVFB 2ZHWH 1F0TA 1S81A 2W3KA 3TPIZ 1O2JA 4ABBA 1UO6A 1AQ7A 1YCPK 4BTUB 1O2UA 3BG8A 2O8UA 3UOPA 3GDUA 1YPMH 1NBME 3U8RH 3RU4T 2ZFQH 3RXGA 3SGQE 1FUJA 4CRDA 2A31A 1MQ5A 5L30H 1FY8E 4VGCB 1JBUH 4X8VH 3PLKA 3GDVA 4MDSA 1LTOA 4K1EA 4OS2A 1TOCB 1TGSZ 2ZCLP 1MBMA 3ZYDA 2ZFTA 1N8OC 1GMDF 1NM6A 3A87A 5ESTE 8GCHF 2UUYA 2VINA 4DIIH 4Y6DA 1OSSA 2P3TB 1P05A 1TQ0B 2W26A 4CR9A 2C8WB 2ASUB 1YPKH 3M36A 3QLPH 1O2LA 4I32A 3N7OA 1O3BA 1C5PA 1N8OB 2J2UA 4UFFH 4IW4E 4FVDA 3S69A 1KMHB 1CBWC 1O33A 1AZ8A 2SGQE 1W13U 3RXCA 3O8BA 2FWWA 1GHVH 1P2QA 2VBCA 1DOJA 5FHTA 1S6FA 2W5EA 3MO9A 5FX6A 3ZYEA 4DIHH 4MTBA 2VIDA 1VCQA 1OWIA 2VVUA 2A1DB 2AERH 3LC3A 3RXIA 6LPRA 4QT8C 1H8IH 3GYMA 3PV5A 2QV1A 1O5DH 1O39A 2GTBA 2PKAB 1FN8A 3K6ZA 3P95A 3HGNA 1EX3A 1BHXF 2G5NA 2Z7FE 3BV9B 4LZ1H 4ESTE 5KECA 1TGCA 2OBQA 1T32A 2RFKC 1TGTA 4FU8A 3HK6B 2A4RA 2BM2A 3F3BA 2KCOA 3PMAB 4GHTA 5L2YH 1QB9A 4F48B 2J97A 4Y11E 1GDUA 4D9RA 4NIVA 1A5IA 1S6HA 3H7TA 1Z8RA 2WPJS 3PWCA 2XBVA 4I8GA 2P95A 4YT6H 2HLDD 4RKJB 1UVOA 4OS5A 4TWWA 3MH6A 1H8HD 5FCRA 1RTLA 2GVFA 2WV9A 1SFIA 4A92A 2HVYB 5E2PA 5EJ1A 4Z1MD 1XUIA 5HMAA 3BIUH 5HGGA 1TBZH 2ANYA 3RXTA 1QL8A 5DP6A 3PV4A 1O2WA 3MYWA 1DPOA 5IDKA 1SLXB 3KQCA 1MZAA 3UQVA 1DFPA 4TT3D 1A3BH 3SV9A 2VH0A 1N6XA 2QY0B 3GISB 1FQ3A 2ODQA 2P3FH 1W12U 4UE7H 4HI3A 5C1UA 2KM0A 2PTNA 2CMYA 2Y5GA 3D23A 1AY6H 3BEUA 1JRTA 4JK6A 3DFJA 3RXAA 3I77A 2FI3E 3AW0A 1C5YB 3PRDA 4CH8B 1LHCH 3QO6A 3QTOH 1UHBA 3OEHD 3P17H 3TGJE 2F43B 1K21H 1EAWA 3GY4A 1MCTA 1FV9A 3OY5U 3Q3YA 1YBWA 2SGAA 1PPZA 4X8UH 3GDSA 5EOKA 4ACAA 2XWAA 2FOGA 5EQQA 4A5TS 3STJA 1C5TA 4JZ1A 4GHQA 1KXCA 3E16B 2ZDLA 1C1UH 2PKSB 3RM0H 2BX3A 2AMPA 5G4BA 3RU4E 2ZCHP 3I29A 2A45B 1C1QA 3LC5A 3O8RA 3A82A 1LQEA 2EA3A 1XKBC 1TPSA 1P12E 1MU6B 4IS5A 8LPRA 3V13A 2WV5A 1FJSA 2QGRA 5JBBS 2JETC 3GS9A 3SOSA 5JBAS 3F2HA 1KSNA 3EYDA 3GCHC 4DT7B 5B6LA 1A5GH 2C93B 2QN5T 1XUHA 3CNRA 3LGVA 3PTBA 3OU0A 2XWBI 4JZFH 1ANBA 2IJOB 3VB7A 2THFB 2ZU5A 2OBOA 3SGBE 1KXAA 4YOJA 1XXFA 3OX7U 3F9EA 3MWIU 1QHRB 4HG6A 3SUFA 4Y0ZE 3F9FA 1ZMJA 3M61U 1PPFE 1OP2A 3PMHB 1J8AA 1P2IA 4NA9H 1V2NT 1WQSA 1MU8B 3HKJB 5GXPA 1Z1JA 4AYYB 4J1YA 2BLOA 3OTJE 3U28C 3SI3H 1CQQA 1AKSA 4ZMAH 3E90B 1O3KA 1L0ZA 4X1SU 3T27A 3EAJA 1RS0A 1SQRA 2J5UA 2ZGCA 4OS6A 3RC5A 1SI5H 3RLYH 1MTSA 1G37A 3D49H 5A2MH 1BBRH 1DT2A 3FAOA 3MU0A 4NG9H 1AKSB 3CS7A 4WXIA 2CJIA 2ZIQH 3JZ2B 1NESE 3L6PA 4K60A 1AFQC 2PGQB 5JPMH 3NK8A 1ZJDA 2BZAA 2VGCC 1MD8A 1TX7A 2UWPA 4AFSA 1ORFA 3RM2H 1MKWK 1UVTH 3DFLA 4IGDA 3DSPA 3VXFH 1C5XB 1TYNA 3B8JA 3RXLA 8GCHG 1C5LH 1OP8A 1G3BA 1P3EA 2WPHS 5EPNA 3SV8A 3A89A 2SFAA 4MLFB 3BTWE 1P3CA 1OWEA 2TGPZ 1BJVA 4TYDA 3ZZCA 3LDXH 4ZXXH 1N1LA 2FI4E 3SNCA 2YNAA 1EPTC 1TABE 1L1NA 2P16A 3OFND 5JBTA 3ZZDA 1GMDG 3UNQA 3PMJA 1H1BA 1ETRH 1Y3XA 4FVBA 2XC5A 1BMFD 2B8OH 2YOLA 1DITH 3KQBA 1NFWA 3SZNA 1NY22 2CHAB 3OTPA 2RA0A 2JH5D 1MTNC 3BTEE 1TRMA 2FM2A 2TGDA 1QB6A 1DY8A 2PW8H 5FL7D 2BD7A 5DP8A 1TNLA 3A7XA 2ZA5A 2J98B 1UHBB 3ATWA 2K8IA 2V6NA 4B6EA 3IWMA 2CGAA 3SJ8A 1T4VH 1TONA 1ABJH 1XVMA 5KEDA 4HGCA 2XRCA 5GPIB 5J4SA 4P02A 1EASA 4NIYA 1SOTA 5JYIA 1LPGB 1V2MT 3TLOA 4BAKB 3TJNA 5K7RA 1BMAA 2A7JA 3ITIA 3TK5A 3MOCA 4ZUHA 1F5RA 1F5KU 1H9HE 4OGYA 3A7ZA 3A84A 5F8TA 3S9BA 1QBNA 2FESH 1GBHA 2QF3A 3GY3A 4IMZA 1GI5A 1CT0E 4FOUC 1MTUA 3M3TA 3M5LA 1AUJA 1HAGE 5EXMA 1O2XA 1IQGA 1HDTH 1EKBB 1Y3VA 4RN6A 5FPYA 2Z9GA 1CVWH 5FX5A 1G2LA 4O9VA 5IYTA 1AU8A 2SNWA 1P03A 4ABAA 1ZYOA 4OM9A 1D3QB 5DN6D 1C1OA 3NPSA 2FMJA 3SU0A 4B2AA 1EP6A 1C1MA 2BY9X 4FUCA 1S0RA 1QR3E 2PV9B 1W0KD 4ASUD 1IQEA 1CHGA 3A7TA 3SV7A 1DANH 1HAHH 2EY4C 3NRLA 4D7FA 3PB1E 2GV6A 1ABIH 1D4PB 1GHZA 1LHDH 1NROH 3KYFA 1SOZA 4NSVA 5E8EH 2AGIX 1Z7KA 3BTKE 4E7RG 3SNDA 1C2EA 3PM3A 1O2OA 1ZMLA 4UD9H 1D3DB 1O2HA 2B7DH 4YTAA 3M35A 3M5MA 1DE7H 2P59A 3VB4A 1KTTB 3LIWA 2ZHDA 3SJOA 3MNCA 2AIQA 1LCYA 2Y80A 2BDYA 4U2WA 1CA0B 3WY8A 1DUAA 1O32A 2HRVA 1IHSH 1MAXA 2LP6A 2FS9A 2UUKB 4ISHH 4X8SH 1YF4A 1EJNA 4AZ2B 2F9BH 1GDNA 1ZGVA 4ABHA 4B1TA 2UWOA 1O5EH 2A5AA 1ZTJA 4IN2A 1YPHC 3FANA 4IC6A 3QDZB 3N7EA 1H9LB 5T6GA 2Y6TA 5CE1A 2ANKH 5TCAA 1A4WH 4RI0A 4BOHA 3DSGA 4NWKA 3AW1A 2FOEA 4XE4A 3S7HB 1CO7E 2WHXA 2O8WA 1VITF 1AE5A 2XC0A 2Z3EA 3ATMA 2W7SA 4CBOA 4ZHLU 1EZUC 3D65E 4LXBH 3UR6A 1XKAC 4XOJA 2Q6FA 3MI4A 4FETA 1E36B 2DUCA 1HAXB 1UTPA 4THNH 2I6QA 1TGNA 1ARCA 3BTTE 1GJ8B 4ISLA 1OWDA 2GT7A 7ESTE 4KKDA 1C1VH 3LOXA 1C2HA 3EE7A 1PYTC 4A1VA 3T5FH 3KF2A 3UNRA 1M9UA 2HNTE 1ZRBA 2ZDKA 4Z6AH 2ALVA 4K5ZA 3ELAH 4FUJA 5EPYA 3PTNA 3TITA 1XX9A 4E7NA 4MVNA 1HYLA 3GCOA 2VWOA 4INHA 1GBMA 3GY6A 5C3NA 1F0UA 2IPQX 2Z6BD 4O03A 2KAIA 1NPMA 3MNSA 1JIRA 2WYJA 4PROA 1TX8A 4DOQA 1QCPA 2BVXH 1EPTA 3GCHB 1NFXA 5DP7A 4AN7A 1KDQA 2AS9A 5F53A 3DCLA 4OGXA 1GBJA 1HJ8A 1SBWA 3E1XB 3RUOA 2HVXA 2A32A 4A1XA 2WPLS 4A6LA 2BY6X 1CGJE 1FXYA 3QX5H 1O3FA 4JMYA 1G2MA 1GBIA 4X2XA 2G4TA 2OP9A 1SQAA 4UONA 1SGEE 4LZ4B 2TGTA 1BRBE 2BD3A 1HAOH 1YC0A 3A7YA 5GJ4B 5LPRA 2CK3D 3VB3A 1O2NA 1T8OA 4SGAE 4Q7ZA 1V3XA 3NZIA 2NWNA 1O5FH 1BTXA 1WUNH 2Z9KA 1EP5A 1ESBA 2D8WA 3ZVEA 2GMTB 4B74A 4X1RU 1HXFH 1F0RA 3EDXB 1WOFA 4IMQA 1H8ED 1PPEE 1BBRE 1XUJA 1V2OT 1ZPZA 2QXIA 3UTUH 5JDUB 5C0UA 3AAUA 1C4U2 5DGJA 1O3LA 3LKWA 3TH3H 1GHXH 1UK3A 4WF8A 2H6MA 4FU9A 1L2EA 2Q1JA 3MTYA 3OAAD 4Q63A 4WXVA 3U8OH 2R0LA 4WMFA 3RXOA 1MUEB 4BAHB 3NWUA 4NSYA 2CN0H 3U1JB 2OC8A 1QBOA 4X1NU 5CMXH 4CREA 6CHAC 2W6JD 1SC8U 5EW1H 3LONA 1V2KT 1QRWA 4FUGA 3SQHE 1EQ9A 1AD8H 2Z3DA 2ZEBA 3ZZ4A 5EQRA 1O3AA 2FDAA 4Y8YA 2FOBA 2FP7B 3UREA 2B0FA 1XUFA 1PPGE 3SJIA 5HIYA 2OQUA 1GJAB 2ZU2A 1FLEE 3EA7A 1GI2A 2AMQA 2WPDD 1EB2A 4KTUA 1UVSH 4CH2B 2BD4A 4JYTA 1GMHF 2BX4A 3O8CA 4D8NA 2RDLA 1C5OH 3TH4H 3LJJA 1DVAH 1GHBG 4NGAH 4ZKOU 2VNTA 3SHCH 2Y81A 1A61H 1DUEA 3KCGH 4AFQA 4WJG2 2OC1A 1TLDA 2Z94A 3V7TA 4BTIB 1C5WB 1MKXK 5E0GA 2V3HH 2G52A 3ODFA 4B6FA 1W2KH 1EAXA 3KN2A 4NFFA 1ZSLA 5L6NH 1A3EH 4U01A 4Y76A 1Y5BT 5AFZH 1DLEA 1C5RA 3ZZAA 2J94A 1CBWB 1GBTA 2JJ2D 2ZPQA 5HKKD 1UK4A 2V3OH 8ESTE 2XOKD 3OE7D 2FIRH 3MHWU 2FYRA 3RXUA 1C5ZB 1ESAA 4D9QA 4I8LA 2Y7ZA 1IQHA 1C1PA 1C1NA 1GJDB 2W7UA 1SLWB 3FOAA 1MQ6A 3T26A 2H9EH 1GBCA 1SGCA 1ZHMA 1XXDA 4ISIH 1GVZA 3LGTA 1TFXA 3L3TA 1C9PA 1GWAA 2UUFB 4NIWA 3H5CB 2ZU3A 1WV7H 3Q3XA 2F4LA 3GCTF 5L2ZH 3RXPA 1AVXA 1BIOA 3KNXA 3MO3A 4ZCNA 2BZ6H 1GG6C 4MNWA 5GCHG 1LHFH 1V6DA 2PR3A 4GCHG 1GI3A 2PHBA 3LGIA 2NU2E 3F0PA 2HALA 1KXEA 4X2YA 4TSFD 1O5GH 3FO8D 4BAMB 2F9OA 1EATA 1ZZZA 4B2BA 2PKAA 1O3HA 3ZZ9A 1XVOA 4MPXA 3RXBA 2C4FH 1QB1A 2Z9JA 3ATKA 2XBWA 5DPAA 1GBLA 2BDCA 3URCA 1TNHA 1O2ZA 1OX1A 1BMMH 4NIXA 2F9PA 2QE7D 5BPEA 3RXDA 2F9UA 2OD3B 4BAQB 1T8NA 1LVOA 1HAYB 1P0SH 2OQ5A 2WPKS 2O8TA 4AG1A 2Y82A 3M3VA 3LJOA 5FXLA 2K1QA 4I8JA 4IBLH 2NU3E 3M37A 1GBFA 1P02A 2XTTB 4X1PU 2XXLA 1C5MD 1NS3A 2HPQH 2AFQB 1K1MA 1EAUA 4GLYA 4AC9A 4DCDA 3EA8A 1CHOF 1SKYE 1O2PA 3MU5A 4H6SB 2CV3A 1P11E 4FUDA 1XM1A 3N7DA 5ABWA 3H09A 3SI4H 2L6OA 1JOUB 1MKWH 1NO9H 3ATLA 2H1UA 3BIVH 1H4WA 2D1JA 3PLPA 3CP7A 1OS8A 1Y8TA 4RSPA 2JIZD 1FY3A 1IOEA 2ZDVH 3F1SB 1C2GA 1VCPA 3B9FH 3SGAE 1HV7A 1O2SA 2BTCE 2BD2A 4CR5A 2STBE 2FOFA 5A8ZA 1ELCA 1GJ6A 2ZTXA 3TH2H 1Z1IA 2HPPH 1GJ5H 2Z9IA 2H9HA 1TPOA 4I33A 2QF4A 1GI0A 2H5DA 1BITA 3GCTG 2G8TA 2FOHA 1QURH 1HPGA 3PO1B 1L1GA 1UTNA 1GJ7B 2BDHA 1OKXA 5CDFE 1QQ4A 3EGKH 5JB8S 4Z0KA 1DWEH 3ZVCA 4ABDA 1ZLRA 3B23B 3KIDU 1AHTH 1THRH 5EIYA 4F4OC 1XUGA 5DKMA 2V7QD 1ZTKA 1K1LA 3RXRA 2TRMA 3FN8A 3P70B 2WUBA 1S85A 3P92A 2AEIH 4Y71A 1QA0A 1AUTC 3VEQB 2DE8A 3SUGA 5FCKA 1CA0C 1HIAB 3GY2A 1H9IE 1K9OE 3M7TA 4JYVH 1AO5A 1BOQA 2O8LA 5A8YA 1GJCB 1RGQA 2FLRH 3SU3A 3QK1A 5KGOA 4IC5A 2BY8X 3U8TH 3N99A 4ASHA 1V2JT 3FFGA 1BZXE 3QN7A 1KTSB 2HNTC 4KGAA 5DK1A 1VR1H 3SUEA 2BYAX 3ODDA 1S82A 3PWBA 1GPZA 1W7XH 2CHAC 1G3EA 2PWXA 1S6LA 1BDAA 3SORA 1VJAU 1YPJH 3M7UA 4U32A 1SQTA 3Q77A 2OLGA 3ESTA 5F03A 4I8KA 1PJPA 1PPHE 4ISNA 1Y3WA 2GV7A 5DO4H 4UDWH 1NRQH 3F0OA 2Y5FA 4GUXA 4IN1A 4NCYA 5C5NA 1XMNB 2RG3A 2ZGBH 4AORA 3TGKE 2AGGX 2QCYA 1UTKA 1GHBF 1NN6A 1Q3XA 2VWLA 3BEIB 2XYAA 5A8XA 3S9CA 3RXHA 2UWLA 1FY1A 2VIQA 4D7GA 1XUKA 1C1SA 4Y7AA 1BA8B 2YMSB 6GCHG 2NU1E 3LT3A 5FPTA 1S84A 2KFWA 1TNIA 2WSSD 1ELAA 4ACBA 1C2JA 1RJXB 1B0EA 2GT8A 4AB9A 1Y5UT 3MFJA 1E79D 3P8GA 3VG8A 2CXVA 1ELEE 4Q7YA 1O34A 3KHVA 1ANCA 3C27B 5EJLA 1TA6A 4A1TA 3RXFA 1UW7A 1IAUA 1IQLA 2JDID 1DY9A 2TGAA 3MO6A 4J2YB 4OS1A 4DGJA 4ZXYH 2ZNKH 1NFYA 4NFEA 1FIWA 4LOYH 1B5GH 3UOUA 1C1RA 1HLTH 1VJ9U 1DWDH 4U30A 2BD5A 3E8LA 3SJ9A 1T8LA 2GJGA 2QF5A 1OWKA 3GICB 3W1EA 1LKBA 2GDDA 1NBMD 1FY5A 1FDPA 1LHEH 4B2CA 3VPKA 2EI6A 2ZO3H 4SGBE 3RP2A 2M5TA 4ZKSU 2Y7XA 1SGFA 2LNCA 5C67A 1OYTH 4M9FA 1A7SA 2A2QH 3PYHA 1EJMA 4X6NA 1MBQA 3MU4A 2R9PA 1WAYB 3FKSD 3S0NA 2QC2A 3K9XB 4K2YA 1DS2E 3UAIC 2GCTC 1TNJA 1EPTB 3F9GA 3BEFB 1W11U 2ZTYA 1EUFA 1V2WT 1C2IA 1ELTA 5I25A 1LO6A 4NZLA 1HAVB 1OP0A 1SGFG 1UVPA 5FBEA 4ABJA 2VIWA 2K0QA 4WWYA 1QNJA 3U98H 1AE8H 1WXRA 2G55A 2BQ6B 2GGVB 1D3TB 1LHGH 3RDZA 3VXEH 4E05H 5A0CA 2TPIZ 2VJ1A 1IQNA 4RT0A 4ZKNU 3M3SA 3SJKA 4AFUA 1V2VT 1MMJN 3HGPA 2AMDA 2G00A 3BF6H 4AYVB 7KMEH 2P3UB 2ZDNA 4WH8A 1K1JA 1EOLA 2PUQH 3MNBA 1O3GA 4P00A 2F9VA 4HFPB 1TNKA 5EU8A 3V12A 2A4QA 4JZEH 3GYLB 2PFEA 4H42U 5CHBA 1O3MA 3ZVFA 2O8MA 3RXMA 3MNXA 3MH7A 3A7VA 2BY5X 2BXTH 1W7GH 2OTVA 2ZU4A 1J15A 3KQ5A 1NRPH 2ZKSA 4ZHAA 2ZG0H 3SZEA 1VGCB 2R0KA 1OPHB 1O3NA 1PFXC 3SU5A 1YM0A 3S7KB 3MQKC 1HCGA 3AK5A 2WPIS 5C1YA 1LDTT 3PROA 3M7QA 3QWCH 5C17A 3M5NA 1L1JA 1NU9A 1ARBA 2JJ1D 4MPVA 4A7IB 2SGDE 5A0AE 1J17T 1AGJA 1SLVB 1HFDA 1ANDA 1TB6H 3F9HA 1O2YA 2BOKA 1O3PB 3E0PB 5GDSH 3URDA 4OS7A 2ESTE 1ZHPA 5E0JA 1NRSH 1ZSJA 4NA7A 4TPYA 1AWFH 5FAHA 2R3YA 4KELA 1FZZA 1RTFB 1V2UT 1GJ4H 2BD8A 1LVBA 1YPEH 2XCFA 1W8BH 4R8TB 1SFQB 1SR5C 3CENA 3UQOA 1CT4E 3UR9A 4ISOA 1P2OA 1HAPH 2JH6D 2XBXA 2ZPSA 3GY5A 5F6MA 1HAIH 3TK9A 3UNSA 5EJZA 5LPFA 1UK2A 3O8DA 5CHAB 1GGDC 4XBBA 1SGQE 1WTGH 1G36A 1LVYA 4TPIZ 1GMHG 2R2WU 1DM4B 4O3UA 1TMUH 1KLIH 1QQUA 2P93A 2P94A 3PV2A 4ZROA 3BTHE 4NWLA 2KCAA 5ETXA 2ZC9H 3IG6B 1MAYA 4B71A 1W0YH 1ZJKA
chains in the Genus database with same CATH topology
1QJ6B 1P10A 1FAXA 4AFZA 1QL7A 3MMGA 3QTVH 1GDQA 1YPHE 5DP9A 4X1QU 3QGNB 2VH6A 2VU8E 3A81A 2BOHB 7GCHG 2QAAA 2AIPA 3K6YA 3SU6A 1SHYA 1TIOA 2D2DA 3EQ0H 1W14U 1K1PA 3C1KA 3CS0A 1ZTLA 2J38A 1TBRH 2OUAA 2CF9H 1O3JA 2R3UA 1KLTA 1ANEA 2HNTF 1MTWA 4X2WA 1GVLA 3TJVA 1AFEH 2BVRH 1CT2E 3A8DA 2VB0A 5F8XA 1P2JA 1UTOA 1PPBH 1HUTH 5EXLA 1SGNE 1MTVA 2J4IA 2BDGA 5LH8A 1FPCH 5AVDA 4CBNA 2OINA 3L33A 3Q76A 4WVPE 3T25A 3U9AH 2ZPRA 1BMNH 2SGFE 5EQSA 1KLJH 5BRRE 5EXNA 1W0ZU 2ZFRH 2ALPA 1GI1A 1AN1E 1GGDB 1JXPA 1GHAF 2F9NA 5CHAC 1N6YA 4E06H 5LGOA 1SGTA 1GI7B 1C2MA 3JZ1B 4GCHF 4M7GA 2TIOA 3AVZA 3E0NB 1TRNA 1B7XB 1Y3YA 2OCVB 3DHKH 1TOMH 1C2FA 1J14A 1EB1H 2XW9A 1P06A 4GSOA 3TJUA 1DX5M 2AYWA 2BQWB 1YCPH 1UTJA 2PTCE 9LPRA 2BVSH 4WMDA 4CRCA 1AI8H 4AGJA 4INLA 5EGMA 1H8DH 2C3SA 3T29A 5DP5A 3SO3A 3R0FA 4AG2A 1QY6A 2J92A 1GCTB 2FOMB 1PQAA 2P8OC 1W3CA 1TBQH 4F49A 4Q7XA 1EXFA 2PUXB 3GY7A 1LQDB 2F3CE 1SMFE 1AFQB 5DG6A 3S9AA 1L4ZA 3BTFE 3T2NA 5J4QA 3NKKA 3A86A 1SSXA 4Y7BA 1BUIA 1NZQH 4Y10E 7GCHF 1BTYA 1AB9B 4YLUA 1O2VA 1SGRE 5JBCS 2ZCKP 5C5OA 1CGIE 1GI8B 5AHGH 1BTUA 3UIRA 5K0HA 1AMHA 3HKIB 1O36A 3DA9B 4YLQH 2VIVA 3I78A 1PQ7A 1GMCF 3UUZA 1Q31A 2V35A 1ETSH 1QRZA 3ZZ8A 1U6QA 2YNBA 2Z9LA 4B76A 3UWJH 1WSSH 3RMLH 1AVWA 1DXPA 1GBKA 1NC6A 4MPWA 1KY9A 1HIAA 1K1NA 4ZH8A 2R2MB 3D62A 4FUFA 3GCNA 4NA8A 1DWCH 3A83A 3BN9A 1EZQA 1Z71A 1O2MA 1C1TA 1UCYH 1T7CA 3IITA 1NTPA 2SGPE 1AB9C 2ILNA 1T8MA 1S0QA 1GJ9B 2BD9A 1HBTH 1K28D 2NU0E 1DWBH 1V2PT 1YKTA 1WQVH 2D26C 1NU7B 1ZHRA 2FEQH 2FZZA 2WUCA 3AAVA 1BMLA 1WU1A 1JRSA 5HYOA 5HXFA 4KTSA 2BLVA 3GY8A 3OY6U 2FLBH 3MU8A 2FI5E 1BCUH 2QIQA 6GCHF 1EZXC 1SL3A 1HJAC 1TWXB 3LGYA 1YP9A 2BXUH 1HB0B 3H7OA 4Y0YE 3TIUA 5B6OA 1O3EA 1C4V2 2ANWA 1P57B 2QXHA 1SQOA 1UMAH 2PSYA 2VVVA 1E37B 1W10U 4GVUA 3RMOH 2EEKA 3SBKA 3OYPA 1S5SA 1FPHH 3RXVA 1FNIA 3RC6A 2LPRA 4DJZB 1GI6A 4Y79A 1GL0E 2NU4E 3FP7E 2A5IA 3ZV8A 3K65B 1OXGA 1T31A 3BTGE 4H6TA 3TU7H 3VGCC 3RMMH 3VFEA 2FTMA 1BT7A 2FXRA 5E0HA 2HLCA 2FX4A 1RIWB 4ZAEA 4WY3A 1A5HA 1NRNH 3LGUA 5TJXA 4K69A 2GZ8A 1FONA 1Z8IB 5GWZA 1DLKB 1S83A 3SU2A 1AVGH 3V3MA 1P9UA 1IQIA 1QL9A 3TVJB 3F6UH 1O35A 3W94A 1ELBA 2IPHA 3U1IB 1G3CA 2QF0A 1ID5H 2H9TH 2QYIA 2XCNA 1TPAE 4X6OA 2JKHA 1P2NA 4CRBA 2BY7X 4FUIA 1QTFA 1SLUB 1LMWB 2ZWLH 4ABEA 4UEHH 3ZZBA 1FIZA 1THSH 2J34A 2CF8H 3E6PH 4BAOB 1F5LA 1C5NH 3RXSA 3UWIA 1C2DA 4XFQA 1DDJA 1TNGA 1F0SA 1HNEE 1ZGIA 2WV4A 1JIMA 3F68H 3U69H 2C8XB 1PPCE 3KQEA 4TY7A 2ZGHA 3VB6A 1GL1A 2G51A 1ZRKA 1GVKB 1V2LT 1IQMA 5SGAE 1SG8B 3SW2B 2PGBB 3PO1C 1TE0A 4X6PA 1FY4A 1TAWA 4Y8ZA 3T28A 3SNEA 3TK6A 1EZSC 2AH4X 4WH6A 2BDBA 3ZZ6A 2JH0D 2SNVA 4ABFA 5C1XA 2FO9A 2QA9E 1C4Y2 1O3CA 4KTCA 4AOQA 1JWTA 1C5UA 5E2OA 2BHGA 4X2VA 3SV2H 2OC0A 3E91A 3TNTA 1NRRH 2H2ZA 2TBSA 2UUJB 1UTQA 1YLDA 4R0IA 5FPSA 1CHOG 2ZTZA 4CHAC 2BMGB 1OYQA 4GPGA 3EA9A 1CA8B 1QBVH 2A0QB 4D76A 1V2RT 2FOCA 1D6RA 1P09A 1TRYA 2ZDMA 3DD2H 1O2IA 1K1IA 1VCWA 1GCDA 2ZFFH 2ZFSA 4MNVA 3P8OA 3MU1A 1TPPA 1YPGH 2Z3CA 1DSUA 2J9NA 4UFEH 4YZUA 1BB0B 3ZVGA 4CRGA 1TMTH 3R3GB 4BTTB 4CHAB 3ZZ3A 5H4IB 1D6WA 2EC9H 1A0HB 1A1RA 1Z8JB 3UFAA 3LGWA 1O2RA 4INKA 1FI8A 1L4DA 2F83A 2GZ7A 1K1OA 2ZGJA 3MH4A 1MZDA 2B9LA 1CSOE 1HAZB 1MKXH 1QRXA 3W95A 1P2MA 4X0WU 2J95A 4X8TH 7LPRA 1KXDA 1ZSKA 5T6DA 1ELVA 4K1SA 1A0JA 1O5CB 4DY7B 2WYGA 4HTCH 2EI8A 3NCLA 2A7CA 1O5AB 1OWJA 3A8BA 1PYTD 2VWNA 3P6ZB 4ABIA 4LK4A 2VIPA 6CHAB 3NUMA 2HGTH 4JYUH 2O9QA 5C20A 3SHAH 1A46H 2XNIA 1C1WH 2B5TB 1C5VA 1BTHH 4DVAU 3A85A 3BTDE 1SPJA 1D9IA 1WYKA 2FOAA 5F8ZA 3VB5A 4K8YA 3T62A 1O2KA 1BRCE 4FU7A 3ZZ7A 1DXWA 2FX6A 3PMBB 1O2QA 4RKOB 2ZHEH 3SN8A 2Q6GA 3A8AA 1LKAA 1SGYE 4KP0A 3FP8E 2FTLE 1QIXB 1O38A 2HWLB 2BB4A 1T4UH 3TNSA 1IHTH 2XC4A 4ZKRU 2G5VA 4TWYA 3SU1A 1SGDE 1YLCA 3LH1A 1AIXH 4K1TA 2ZZUH 1UVUH 1O3IA 3BTQE 3RXQA 1NFUA 5LPEA 5AF9H 1BTPA 2GD4B 1HRTH 1O3DA 1Z6EA 4BNRA 1O5BB 1QGFA 3AASA 3QZRA 4JZDH 1C2LA 3QZQA 2ZHQH 4JK5A 2G81E 1ZR0A 1SHHB 3ZVDA 2PKSC 1AWHB 2ZI2H 1SGIB 1CU1A 1LVMA 3BG4C 2C8ZB 2BLQA 1MD7A 1HXEH 1Y59T 1CE5A 1ZOMA 1BHXB 1O3OA 2V0BA 3SNAA 1E0FD 3HK3B 1YCPM 3SU4A 5A09A 2A4OA 3RU4D 1IQJA 1THPB 2VIOA 2H5CA 1GI9B 2BDIA 3GOVB 2IN2A 2GCHG 4Y8XA 1HJ9A 4MNYA 2XBYA 4XSKU 1TALA 2ODYB 5PTPA 1E38B 3PLBA 4I8HA 1G30B 2BLWA 3ZVBA 3OSYA 4O3TA 3SNBA 1TGBA 3RLWH 3ATIA 4DG4A 3QUMP 2WPMS 2ZHFH 2W3IA 3FZZA 1GJBB 2ZU1A 1RXPA 1FMGA 1O30A 2I6SA 2ZF0H 1J9CH 2WINI 4JZIA 1G32B 1ZPCA 1BJUA 2GCHF 4YO9A 1Q2WA 2ZFPH 1G3DA 1Y3UA 1TQ7B 2Q6DA 2Y5HA 5EW2H 3ZVAA 2PLXA 5DP4A 5T3HA 2RA3A 1GBDA 4NZQA 1MH0A 4JCNA 3TJOA 1OWHA 1V2QT 5A0BA 1ELDE 2FPZA 4X6MA 3BG4B 1KXBA 2SGEE 2STAE 1ELGA 6ESTA 4B75A 3K2UA 1VZQH 1O2GH 1UCYE 3UY9A 3E3TA 5GCHF 1P01A 1A2CH 3BSQA 3KQDA 4FUHA 2QXGA 3A7WA 1P8VC 1UTMA 1QA7A 1QJ1B 5EG4A 1RFNA 2FS8A 3MH5A 2QXJA 2G4UA 2F91A 2HOBA 1D3PB 8KME2 2BDAA 1AZZA 1GBBA 1BBRK 1C2KA 4BANB 1BRUP 2ZQ2A 4HZHA 1LPZB 3UPEA 1DICA 1GMCG 3KGPA 1K22H 1BRAA 5FBIA 5C2ZA 1HAVA 4FUEA 1C5QA 4I31A 4CRFA 3Q3KA 3LPRA 2EI7A 1J16A 5DP3A 1QJ7B 4I7YH 1KIGH 4YOGA 2ANMH 1INCA 2DE9A 3VGCB 4AGKA 4MNXA 4K3JA 3HPTB 4TY6A 1SVPA 1SGPE 4DW2U 2ULLA 1EJAA 4XDEA 2A2XH 1C9TA 2VVCA 1YGCH 3Q00A 1UJ1A 4H4FA 2GMTC 5DJ7A 1BTZA 4AB8A 1GI4A 2ZQ1A 1O0DH 1QFKH 1UCYK 3G01A 1P9SA 1Y5AT 1C5SA 1O2TA 1K2I1 2PSXA 2VWMA 1SB1H 3RXJA 1IQFA 4MG3A 1VITG 1PQ5A 4CRAA 1YPLH 1KYNA 1OOKB 3FZDA 3LH3A 4YOIA 1HJAB 5TCCA 1RIWC 3ZZ5A 2IOTA 2GP9B 1WCZA 1F7ZA 9ESTA 4YESB 1DSTA 3LU9B 1MTNB 3ENSB 3RXEA 2ZDAH 1RD3B 1B0FA 1X7AC 3EE0B 4MPUA 2FYQA 2C8YB 3STIA 4WMEA 2GKVE 3BTME 3KEEA 5AFYH 1PQ8A 3RXKA 1F2SE 2ODPA 4O97A 1E34B 3NXPA 1ETTH 3DUXH 4AX9H 1VGCC 1FAKH 2GCTB 4FXGH 1Z8GA 3KL6A 4YM9A 3A8CA 2KAIB 1KXFA 5GIBA 4OS4A 5HM2A 1JMOH 1UTLM 5JB9S 4XBDA 1EAIA 1RTKA 1GBAA 2P8OB 4XBCA 3ZV9A 4B73A 4MQAA 2GX4A 1ELFA 1MCVA 1O31A 3TGIE 1V2TT 1GG6B 3P8FA 1YYY1 1BQYA 2VGCB 2GZ9A 1TA2A 5EODA 4Q2KA 3A80A 1FN6A 4ABGA 2C90B 3FP6E 4K8BA 3RC4A 3HATH 1IQKA 3SQEE 5T6FA 1A0LA 1F92A 1ACBE 1LPKB 4Q80A 1E35B 1V2ST 2A7HA 3SV6A 5I46H 4UFGH 3QGJA 4ZHMU 3SUDA 3V0XA 4BXWA 4UFDH 1RRKA 1VITH 2OXSA 4DURA 1P2KA 1P04A 3P8NA 1EOJA 5HM9A 1GCTC 2A5KA 1TMBH 2A4GA 1G9IE 2RCEA 3RMNH 3A88A 3M5OA 4GAWA 1ZMNA 1ZPBA 1O37A 1GHYH 1GBEA 1ESTA 1GHWH 1KDQB 5ESBA 2AGEX 2ZECA 2ZGXH 2OC7A 1HGTH 1CGHA 4VGCC 1Z6JH 1WBGB 1GHAG 1BTWA 2BQ7B 2GDEH 2ZP0H 1WTHD 4FUBA 4BXSA 1TX6A 2FODA 2JETB 1NT1A 3DT0H 4YT7H 3FVFB 2ZHWH 1F0TA 1S81A 2W3KA 3TPIZ 1O2JA 4ABBA 1UO6A 1AQ7A 1YCPK 4BTUB 1O2UA 3BG8A 2O8UA 3UOPA 3GDUA 1YPMH 3U8RH 3RU4T 2ZFQH 3RXGA 3SGQE 1FUJA 4CRDA 2A31A 1MQ5A 5L30H 1FY8E 4VGCB 1JBUH 4X8VH 3PLKA 3GDVA 4MDSA 1LTOA 4K1EA 4OS2A 1TOCB 1TGSZ 2ZCLP 1MBMA 3ZYDA 2ZFTA 1N8OC 1GMDF 1NM6A 3A87A 5ESTE 8GCHF 2UUYA 2VINA 4DIIH 4Y6DA 1OSSA 2P3TB 1P05A 1TQ0B 2W26A 4CR9A 2C8WB 2ASUB 1YPKH 3M36A 3QLPH 1O2LA 4I32A 3N7OA 1O3BA 1C5PA 1N8OB 2J2UA 4UFFH 4IW4E 4FVDA 3S69A 1CBWC 1O33A 1AZ8A 2SGQE 1W13U 3RXCA 3O8BA 2FWWA 1GHVH 1P2QA 1DOJA 5FHTA 1S6FA 2W5EA 3MO9A 5FX6A 3ZYEA 4DIHH 4MTBA 2VIDA 1VCQA 1OWIA 2VVUA 2A1DB 2AERH 3LC3A 3RXIA 6LPRA 4QT8C 1H8IH 3GYMA 2QV1A 1O5DH 1O39A 2GTBA 2PKAB 1FN8A 3K6ZA 3P95A 3HGNA 1EX3A 1BHXF 2G5NA 2Z7FE 3BV9B 4LZ1H 4ESTE 1TGCA 2OBQA 1T32A 1TGTA 4FU8A 3HK6B 2A4RA 2BM2A 3PMAB 4GHTA 5L2YH 1QB9A 4Y11E 1GDUA 4D9RA 4NIVA 1A5IA 1S6HA 3H7TA 1Z8RA 2WPJS 3PWCA 2XBVA 4I8GA 2P95A 4YT6H 4RKJB 1UVOA 4OS5A 4TWWA 3MH6A 5FCRA 1RTLA 2GVFA 1SFIA 4A92A 5E2PA 1XUIA 5HMAA 3BIUH 5HGGA 1TBZH 2ANYA 3RXTA 1QL8A 5DP6A 3PV4A 1O2WA 3MYWA 1DPOA 5IDKA 1SLXB 3KQCA 1MZAA 3UQVA 1DFPA 1A3BH 3SV9A 2VH0A 1N6XA 2QY0B 3GISB 1FQ3A 2ODQA 2P3FH 1W12U 4UE7H 4HI3A 5C1UA 2PTNA 2CMYA 2Y5GA 3D23A 1AY6H 3BEUA 1JRTA 4JK6A 3DFJA 3RXAA 3I77A 2FI3E 3AW0A 1C5YB 4CH8B 1LHCH 3QO6A 3QTOH 1UHBA 3P17H 3TGJE 1K21H 1EAWA 3GY4A 1MCTA 1FV9A 3OY5U 3Q3YA 1YBWA 2SGAA 1PPZA 4X8UH 3GDSA 5EOKA 2XWAA 2FOGA 5EQQA 4A5TS 3STJA 1C5TA 4JZ1A 4GHQA 1KXCA 3E16B 2ZDLA 1C1UH 2PKSB 3RM0H 2BX3A 2AMPA 5G4BA 3RU4E 2ZCHP 3I29A 2A45B 1C1QA 3LC5A 3O8RA 3A82A 1LQEA