4MPUA

Human beta-tryptase co-crystal structure with (6s,8r)-n,n'-bis[3-({4-[3-(aminomethyl)phenyl]piperidin-1-yl}carbonyl)phenyl]-8-hydroxy-6-(1-hydroxycyclobutyl)-5,7-dioxaspiro[3.4]octane-6,8-dicarboxamide
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase alpha/beta-1
publication title Target-directed self-assembly of homodimeric drugs
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 53
structure length 243
sequence length 243
chains with identical sequence B
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mpuA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mpuA01
3PM3A 3SO3A 3E90B 3BTKE 1V6DA 1WTHD 2G81E 4DW2U 7KMEH 1HAYB 1FAKH 2RDLA 2EEKA 4K5ZA 2H2ZA 2OC1A 3KF2A 2OC8A 1SGEE 2PKAB 1F5RA 1HJAB 1K1LA 4WMFA 3ZVGA 3GY6A 1GI5A 1WQSA 1HYLA 3ATMA 4A7IB 1E38B 4Q2KA 2Y5FA 4ISIH 1YCPM 3QO6A 1E34B 1EAUA 2ALPA 1TQ7B 5A0BA 4CH8B 1SLUB 3ATWA 2CGAA 1P04A 1ZTJA 4AG2A 5L2ZH 3SI3H 1KLJH 4BAMB 4DJZB 1B0FA 3O8CA 2AS9A 2H6MA 2XW9A 3UOPA 4CH2B 4IMZA 4ZUHA 2Y81A 5FCRA 5GIBA 1O36A 2A0QB 2WPKS 3RC4A 4NA7A 1Y5AT 1GI6A 1SPJA 4E05H 1C2IA 1QBNA 4O03A 2CF9H 2ZO3H 4NA8A 2A31A 1O5BB 1ZHRA 5E0GA 2FTMA 1RTFB 1GL0E 2A2QH 4MNWA 1O34A 1N1LA 2F9OA 2ZGCA 3AASA 1O2SA 1MBQA 3KQCA 1DSTA 1BITA 1UTJA 1BTZA 1ABJH 1TBZH 3SU4A 1ELGA 4WY3A 4AFQA 3LOXA 2FOEA 2QGRA 2AIPA 1FONA 2CV3A 1PPGE 3RLWH 4QT8C 3BV9B 1BRCE 1P3EA 4DT7B 3RXCA 1OSSA 1AE8H 1ELBA 1MH0A 2ZPRA 3U69H 1EJNA 1YPHE 3UNRA 1RIWC 1S84A 1L0ZA 1AHTH 2PTNA 3P8OA 1NM6A 1PYTC 8GCHF 1P3CA 3JZ1B 1O3MA 5I25A 1KDQA 1GCDA 3E16B 1YLCA 3SU2A 4JZ1A 3K65B 2PR3A 1K9OE 2BVRH 3RDZA 2VWOA 4BANB 2QIQA 1E36B 1C5MD 1CBWC 2WUCA 5AFZH 4WH6A 4IN2A 1G3CA 1OWDA 1TAWA 3T27A 1V2UT 1ETRH 2Q6DA 3MO6A 2ZHDA 1JRSA 1F5KU 1CHOF 2BXTH 4MQAA 2F9UA 1TX6A 1EZUC 1HAZB 1QJ7B 1C2DA 1O39A 1XUFA 2FPZA 2F3CE 2OLGA 3GCTG 1K1JA 1QFKH 2PWXA 4GVUA 1A3EH 3FANA 2F91A 3M7QA 3SUEA 1UTPA 1FXYA 1CHGA 1HJAC 2FI5E 3T28A 1HLTH 3QK1A 1DX5M 2GGVB 1C2GA 1ZTKA 3RXIA 1UCYE 2J38A 3ODDA 6LPRA 4BXWA 4B1TA 1O2QA 1IAUA 1OS8A 3D49H 1O2TA 5JB9S 4ZKSU 1YPGH 1FIWA 3KN2A 1QA0A 3HATH 5DG6A 2VNTA 4Y7AA 2RG3A 2AYWA 2ZDNA 1ELCA 1O32A 2G4UA 4KGAA 3ZZ5A 1NTPA 4INHA 2SGEE 3PMJA 4BTIB 3ENSB 1JWTA 1C1PA 4FU9A 4CRCA 1O2JA 1O5AB 1MKWK 1TNJA 2XNIA 1TNKA 4NIVA 3SV8A 3A8CA 5LPFA 2RA3A 5ETXA 2G00A 3ZVFA 1N8OB 1J8AA 1DXWA 4GPGA 4Q80A 2PFEA 4CRFA 1RD3B 2ZFFH 2ZU5A 2FOBA 4IMQA 1O2OA 3SW2B 4HTCH 4BXSA 5C3NA 4I7YH 1UCYH 3AVZA 5E2PA 3PTNA 2FOMB 5TCAA 2OP9A 3PMBB 1W13U 2NWNA 4NIXA 4K1EA 4DIHH 1UK3A 3A88A 3MMGA 1MU8B 4YOGA 1GCTB 2ZIQH 4RSPA 4Q7YA 3ZZBA 2C8YB 1THPB 4X8UH 1XUKA 4JYUH 1TRMA 3RXOA 1TWXB 3T29A 1LHFH 3VPKA 1O3NA 3W94A 2G55A 2PSYA 4TPYA 2H9TH 5L6NH 1QY6A 2P3UB 2H9HA 1EASA 4OS5A 1SGTA 3ZVBA 1D9IA 1QRWA 2G52A 4JZFH 3UQOA 1EPTC 3SJKA 2R0LA 2BLQA 1TGTA 5T6FA 1TNLA 1WV7H 1ZRBA 1FPCH 1IHSH 1MKXH 3RXAA 1QRXA 3FP8E 3I78A 4CHAB 5LGOA 4ABFA 3B8JA 1A61H 1DS2E 3K9XB 4X2YA 3L6PA 1QRZA 3RM0H 2ZKSA 1BTUA 1ZGIA 1GJ8B 1G32B 2G51A 2TRMA 1TPSA 3CP7A 2A4RA 1GHAG 2FX6A 2AEIH 5FXLA 3T62A 1DUEA 1GJ6A 1J14A 1NFUA 3OYPA 3O8BA 3FP6E 5FPTA 2H5DA 3LC5A 4JZEH 4MTBA 4X6MA 3KNXA 1UTMA 1MD8A 1V2JT 4WWYA 2TIOA 1QIXB 3DUXH 2C8XB 2EA3A 2ZA5A 3SJ8A 5DKMA 1O3JA 4LOYH 2ZC9H 3ELAH 3B9FH 1VITH 5EG4A 4A1TA 2QY0B 5GPIB 4YESB 1VCPA 4K8YA 3RXQA 1XUJA 3KQEA 2Z3EA 2FODA 1L2EA 3UNSA 4A1XA 3VB7A 1TGBA 1OWIA 4CRAA 3VB3A 3A85A 3V3MA 2ZQ2A 4MLFB 1P2JA 3VFEA 2ZG0H 2CF8H 2B9LA 1BRUP 2QN5T 1ARCA 5EQSA 3GY8A 3P8NA 1WCZA 4J2YB 2BD2A 1W0YH 2QF3A 2SGPE 8ESTE 1JOUB 1C2JA 1Q2WA 1UTLM 2D26C 2VH6A 1CT0E 1C1WH 4Y0YE 5LPEA 1EJMA 1EXFA 2R2MB 2F9BH 4YLQH 4AB9A 2P8OB 1PQ7A 1CVWH 1A0JA 2XYAA 4OS7A 5IDKA 1F0UA 1FJSA 3Q3KA 1BDAA 3TU7H 1GJDB 1TE0A 4ABAA 1O2IA 3PWCA 4XBBA 4ABIA 1YPJH 4ZKNU 2OCVB 2BDBA 2WPMS 2GT8A 3SBKA 2FS9A 1L1GA 1VCQA 3LJOA 4FXGH 2W26A 1GJ9B 3SNAA 1K1NA 3QX5H 3SV9A 1TNGA 3LH1A 3SQHE 1HAIH 4UDWH 2XBWA 2CJIA 4OS4A 1PJPA 1DDJA 3A86A 4FUHA 2GDEH 1G30B 4X8TH 2J92A 1S6HA 3SGAE 4UFEH 1OWEA 1EZSC 2YOLA 1Z1IA 2AH4X 1Z71A 3TJUA 2BD5A 2P3TB 1VJ9U 2M5TA 1E35B 2J95A 4K60A 4ABBA 3URCA 8KME2 9LPRA 1C1RA 1ELAA 1ZR0A 4FVDA 2Z9JA 2AFQB 2ZQ1A 1PPEE 1LVYA 1VR1H 1QCPA 1LMWB 2H9EH 4JYTA 1C5WB 3N7OA 1BCUH 3SJIA 3ATIA 1BUIA 1J17T 5C2ZA 3T5FH 1BZXE 1FY4A 3UQVA 3A7TA 1QB9A 5AF9H 1YLDA 1LHEH 1TABE 6GCHF 3MWIU 2PSXA 5A2MH 1CU1A 1SB1H 1SOTA 1V2ST 3GCHB 1YPKH 4I33A 4UD9H 1ZPBA 3FP7E 2BM2A 2FOHA 1GBHA 1XVMA 1BIOA 2BDAA 1SGPE 3U8OH 3UY9A 4WJG2 4X6PA 1NRNH 1JIMA 5J4SA 1KIGH 5DK1A 1SGDE 1THSH 3AAVA 4AORA 1ELVA 3LC3A 5F8TA 3ZYDA 1S83A 1P2NA 5GCHF 1XX9A 1DE7H 2PKSC 2R2WU 1AUTC 2ZDMA 4XBCA 3VGCC 1P06A 1B5GH 1P9SA 4X1PU 2A2XH 1CA8B 3VB6A 1C1TA 4UFDH 2XBYA 3WY8A 1F5LA 1YP9A 1DWDH 2BY5X 1V2NT 1IQMA 1W7XH 1WTGH 3A87A 1SMFE 3MTYA 1SHHB 3U8TH 2K1QA 4UFFH 2ZGJA 2O8WA 1HUTH 2ZCKP 3BF6H 3MYWA 1QB6A 3HKIB 1FMGA 4XOJA 1GBIA 3UR6A 2BY7X 4FUIA 1UVSH 1FN8A 3KHVA 4WMDA 1AUJA 4BTTB 3F9FA 3DT0H 4YT7H 2GV6A 1MMJN 1GDUA 2Z9GA 3BTWE 4O3UA 5JBTA 1DFPA 2ZFRH 3SOSA 1OXGA 4ZH8A 1PQAA 1TMBH 1V2OT 2ZP0H 4GUXA 1RFNA 2HWLB 3PTBA 4JK5A 4ASHA 2PV9B 2VWMA 4K1SA 4CREA 1A7SA 4Z0KA 1C5SA 2XXLA 2VWNA 1IQFA 4NFFA 3ZZCA 1YCPH 3M5MA 2O9QA 3HPTB 3GY5A 3MH6A 3RXFA 3KQBA 3UWIA 4ZAEA 1QURH 7GCHG 1LTOA 3LH3A 1DVAH 1P12E 1Y3VA 1KXEA 1Z8JB 2BD3A 1UMAH 2Z6BD 4B2AA 5H4IB 3GCHC 5DP9A 1QA7A 4WF8A 1QJ1B 1BOQA 1SGFA 4FU8A 2RA0A 2FIRH 3BG8A 1D6WA 3BEUA 7ESTE 1GHBF 2BX4A 1G2MA 2HNTF 4F4OC 6ESTA 1SOZA 3QZRA 3M3VA 5GWZA 1HGTH 1AI8H 2ALVA 3LIWA 4RKOB 1GGDB 1GDQA 1A4WH 1H9IE 4U32A 1IOEA 1C5UA 3AAUA 1W3CA 1C1OA 2ZCHP 4X6OA 2OC7A 2ASUB 5K7RA 4AX9H 3LT3A 1XUIA 1RXPA 3TNTA 1WYKA 3RU4E 4DVAU 3BTEE 1BRAA 5C1UA 7LPRA 1O30A 2BY6X 3UFAA 3ODFA 5F8XA 1TLDA 1OOKB 3TPIZ 3E3TA 3PLPA 3QDZB 4X2XA 1HNEE 5AHGH 3BTHE 2Y80A 1GJ5H 1NFXA 1O3GA 2QV1A 5GJ4B 1GVKB 1BTHH 4DGJA 4OS1A 3GCOA 1O2MA 1GWAA 2CN0H 1GI3A 1MAYA 3RXTA 2STAE 5EODA 1B7XB 1J9CH 3TJVA 1AGJA 3A8BA 3UPEA 1PPZA 1T4UH 1TONA 4K8BA 2WINI 3TH2H 2PW8H 2NU3E 2G5NA 5EPNA 1J15A 1VGCC 3HKJB 1F0RA 1KLIH 1O3LA 1EZXC 1O2VA 1GMDG 2CHAB 3HGPA 2A4OA 3M3SA 1IQIA 5GXPA 1MAXA 1ZPCA 2BD9A 5A0AE 2VVVA 1HDTH 1NFWA 5FX5A 5C5NA 1O2UA 1TRNA 2VIQA 1LVMA 1UO6A 3OY6U 2DE8A 1C1VH 1P2MA 5ABWA 1LO6A 1BA8B 4X1RU 1C2MA 2FI4E 5C1YA 3U8RH 3IG6B 4B75A 1LDTT 3EQ0H 1CQQA 1CA0B 3U1JB 1O31A 1O2XA 4BNRA 3D65E 1HXEH 3S9CA 3URDA 2C90B 5DP8A 1C5OH 1GHVH 2BQ7B 2A5KA 3SV7A 1OWKA 4GCHF 2ZECA 2FLBH 3LPRA 1KXBA 1AB9C 3BEIB 1G3DA 4FUCA 3V0XA 4CRBA 4B73A 4XSKU 1OWHA 1O2RA 4XFQA 3BTQE 1EZQA 2P16A 1DXPA 1GGDC 1GI2A 4XBDA 2J34A 1BMMH 3SNCA 2BDCA 4Y76A 3SUDA 1Y8TA 1C1SA 1K21H 4NSVA 3NUMA 1C9TA 4F49A 4TY6A 2BTCE 1LPZB 1THRH 1AZZA 2BDYA 4D7GA 3VEQB 1O5DH 4GHQA 3PWBA 4YZUA 3SNDA 3A82A 5B6OA 1VITG 2VGCB 5AVDA 8LPRA 1BBRK 3GDUA 2TGPZ 3SV2H 4E7NA 1P2OA 2AGGX 3NCLA 3Q76A 2Z94A 2GV7A 2YNBA 3SGQE 1NZQH 2W7SA 1DY9A 1P02A 1RTLA 1ESAA 4X2VA 5K0HA 1SI5H 3BEFB 1O5GH 3TITA 1TNHA 4BAQB 4X1NU 1TA2A 3DHKH 1Y5BT 4Q7ZA 3HK3B 6CHAB 2ANWA 3RXSA 4TWWA 1UVPA 2ZDAH 3E1XB 1XXDA 2KAIA 1C4U2 1EB2A 1HPGA 1SLVB 3F1SB 5J4QA 1D6RA 3RXVA 1C4Y2 1ETSH 1H4WA 1XM1A 2ZGBH 3K2UA 4NIYA 1IQJA 1GMCG 2W3KA 3EE0B 3SV6A 3BTTE 1ANBA 3T26A 4X8VH 1O33A 3M36A 1E0FD 2IPHA 1HJ8A 2ODYB 4X6NA 4CRGA 2EC9H 1DY8A 1ZSJA 4X0WU 1IQLA 4M7GA 1W14U 1VJAU 3NXPA 1FQ3A 1XXFA 1BB0B 1G36A 1RRKA 2BVXH 2P93A 1HAGE 4DY7B 4Y71A 2PTCE 4HGCA 2ZI2H 2BXUH 1JIRA 3SI4H 1L1JA 2P59A 3Q3XA 4AG1A 1TGSZ 4YT6H 1OKXA 2JETB 3RXKA 2AGEX 3OTJE 1T8LA 4D7FA 5L30H 4AYYB 1EAIA 3QWCH 1GMHF 2BQ6B 1JXPA 2GDDA 2XCFA 1QL9A 1GVZA 2ZPQA 1C2KA 2B0FA 1KY9A 2O8LA 1HB0B 2BYAX 2THFB 2Y5HA 1EAXA 1UTOA 3F6UH 4IN1A 2D1JA 2FS8A 3S9BA 1OP2A 4Y8YA 1KYNA 1UK2A 4ZHAA 5EU8A 3SJOA 4K1TA 4BTUB 1MQ6A 3QGNB 3QZQA 3QLPH 1QGFA 1BMNH 4KELA 5EW1H 1RJXB 1TPOA 1DICA 2VGCC 4DOQA 1ORFA 1CSOE 1TX7A 1O3KA 1YPEH 2GCHG 1LPGB 4TWYA 3TNSA 4XDEA 4B2BA 4NFEA 2JH5D 4H6SB 1QJ6B 1PPBH 1BT7A 3PMHB 1C5VA 2VIWA 1G37A 3T25A 3ZZ4A 2UWPA 3SN8A 6CHAC 1S0RA 5FX6A 3KGPA 1O3PB 1LVOA 2VINA 1ZGVA 1ELFA 1NRPH 3A7YA 4HZHA 1K1PA 1T32A 1AKSB 2AMDA 1SFIA 1GI1A 1AZ8A 3FVFB 1NU7B 2QYIA 3NK8A 3MU4A 5A8YA 2OTVA 5GDSH 4X1QU 1Y3XA 1SVPA 4UFGH 3TK6A 3IWMA 1ZMJA 1W8BH 3A80A 3LONA 5L2YH 2A7JA 4ISNA 4I8LA 1FY3A 3ATKA 1NT1A 2JETC 4ZHMU 3DA9B 1SC8U 1TMUH 3BIUH 4GLYA 3SU6A 2GP9B 3DFLA 3M5LA 1GVLA 1HRTH 1XUGA 2SGAA 3BTME 2PHBA 1YYY1 4OS6A 5G4BA 3RXLA 1O37A 4AFZA 2BD4A 1N8OC 5CMXH 4VGCB 1Y3WA 2GT7A 2OQUA 3MI4A 4BAHB 1MTSA 1P09A 3H7OA 3LGWA 4KTSA 4ZMAH 1V2QT 3M35A 4SGBE 3RXHA 2CXVA 2FXRA 5T3HA 1HXFH 4DG4A 1UJ1A 1GG6B 4J1YA 4B74A 2Q6GA 2QAAA 3E8LA 1S5SA 1INCA 1BTPA 2A5IA 1D4PB 4AGJA 3A81A 3RXDA 2QC2A 1IHTH 2VB0A 3LGTA 2QXJA 3SHAH 3P8GA 3P95A 4BOHA 2Z3DA 4ABJA 1D3PB 4Y8XA 1GCTC 2BMGB 3OU0A 3UNQA 2BDIA 1UK4A 1C5RA 1SGRE 1P0SH 2SGQE 1F7ZA 1W10U 3GCTF 5IYTA 1JMOH 1XUHA 1PFXC 1SBWA 1O5CB 3LKWA 3SU5A 5BPEA 2V3HH 1HV7A 1O3OA 1GBTA 4CBNA 2CMYA 2BD7A 1OP8A 3ZV9A 1QHRB 1ETTH 2AMPA 1FAXA 1O3CA 4X1SU 1XMNB 1P05A 4ISHH 1AVGH 2FTLE 3RXGA 4A6LA 3A7XA 1EQ9A 1XKBC 2VIOA 1TRYA 2HLCA 1P11E 3H7TA 5JPMH 4CHAC 2GMTB 3EDXB 3KEEA 1QQUA 2NU2E 3KQDA 1ELTA 2WPIS 3GYLB 1KLTA 4MG3A 2HALA 2D2DA 2FLRH 3M5OA 1CGIE 4YO9A 1QTFA 3E91A 3E0PB 1T8OA 4NZLA 1KDQB 1O3DA 2AERH 1EAWA 3BTGE 2B7DH 1BTWA 1HAVA 5DJ7A 3SZNA 5CE1A 3VXEH 4JZDH 3ZZ6A 2ZU1A 2ANKH 2Z9IA 3MFJA 1MQ5A 1BQYA 1YPLH 2ZPSA 5EXMA 3RXBA 3ZVCA 1G3EA 4IC6A 1P2QA 1DPOA 2Z9KA 2Q6FA 3RUOA 2GVFA 4Y6DA 1A5IA 5LPRA 2KAIB 3TH3H 1YPMH 1VZQH 2GZ7A 1T8MA 3LGYA 3TH4H 2WUBA 1KXAA 2NU0E 2ZNKH 1C5ZB 1WBGB 1EPTA 4AN7A 3TK9A 1WAYB 1GL1A 5F03A 1Q31A 2ULLA 2C3SA 1MTVA 2A7HA 2BDGA 2VVCA 2W7UA 1K28D 4WMEA 1O2KA 1MZAA 2Y6TA 4NG9H 2NU1E 1GG6C 2WPLS 1JBUH 4JZIA 2OQ5A 3VXFH 2FM2A 2P8OC 1A46H 1P8VC 1V2LT 1NRSH 1ZZZA 5FAHA 1SQAA 4Y0ZE 1UCYK 3MOCA 2FI3E 4H6TA 2OXSA 5FPSA 2SNVA 1YKTA 3M7UA 2FOGA 4IS5A 3BG4B 4NGAH 1C5LH 5DP6A 3LU9B 2BOKA 1O3HA 3CS0A 4WXIA 3AW0A 4Y79A 1O3IA 1K2I1 2SFAA 4Z6AH 1FY8E 3A7ZA 3OSYA 4YOJA 1T7CA 4X2WA 1SG8B 2QA9E 5F8ZA 1A5HA 3VB5A 1LHGH 2SNWA 2ZEBA 1GHAF 2HNTE 1FY1A 2ZDLA 2FOAA 3MNBA 8GCHG 2W3IA 1NY22 3A83A 2Z3CA 1MUEB 4RKJB 4A1VA 2G5VA 2GMTC 2B5TB 2FOFA 1CT4E 2ZU3A 3QN7A 1EX3A 3ZZ8A 1IQHA 1MTWA 1D3QB 1MKXK 1TBRH 1SGQE 5C5OA 2FDAA 3SNBA 3STJA 3S0NA 4GHTA 1BMLA 1EOLA 1C5QA 2ESTE 3B23B 2ZGHA 2BLWA 1BHXF 1CHOG 3MNXA 2B8OH 3ZV8A 4NSYA 3NWUA 2BQWB 3MO3A 1C4V2 1O2NA 1LHCH 2ZFSA 2ZWLH 4MPWA 3K6YA 1AFQB 1UTKA 1OYQA 4AFSA 1GDNA 3SORA 3STIA 1MKWH 5E0HA 2A7CA 3OX7U 2VJ1A 1CT2E 2HPQH 4D9RA 4OS2A 4B76A 5TJXA 4FU7A 2ODQA 2NU4E 3EA8A 1ZOMA 5DP4A 1RTKA 3DD2H 1G3BA 4ZROA 1D3DB 5DGJA 1BTYA 1TGNA 1K1OA 1OYTH 2HGTH 3SQEE 3EA7A 3O8RA 1O2HA 2FX4A 3FFGA 2Y82A 2ZHEH 3V12A 1FZZA 4YOIA 4TY7A 4FUGA 3F9HA 3RMOH 2BX3A 1MTUA 4NIWA 2DUCA 2R3UA 3U98H 1A1RA 1GBCA 1RIWB 2JH6D 2XC4A 3PROA 2ZCLP 2QXHA 1G9IE 1LHDH 2ZFQH 3U9AH 4IW4E 3SHCH 1O2YA 2XRCA 2GKVE 2QXIA 3P92A 5ESBA 1WSSH 3ESTA 4JK6A 3KIDU 1GBFA 1LQEA 1FY5A 3TLOA 1BHXB 2A5AA 2BY8X 3FZDA 4I8GA 4DCDA 5JBBS 4H42U 2XBVA 1KSNA 3RU4D 1YGCH 1C9PA 1L4ZA 2V6NA 2UWOA 2BD8A 2OBQA 1GBDA 2R3YA 4MPXA 1X7AC 3P70B 2ZZUH 3GISB 3HK6B 4D9QA 2PGQB 5EXLA 1TFXA 5JBAS 3UR9A 1A3BH 4K69A 2DE9A 1DM4B 1T31A 1ZSKA 1AU8A 4B2CA 1Q3XA 1NESE 3P6ZB 4ABEA 1NU9A 1L1NA 5FBEA 1QR3E 1SL3A 5DP7A 5F6MA 1NN6A 4ISLA 2G4TA 1WU1A 4DIIH 1K1IA 1SGYE 3EYDA 3GDVA 5HYOA 2GCTB 4AZ2B 3Q00A 2C8WB 1W7GH 3TVJB 1NPMA 1HAXB 2J4IA 2Y7ZA 2ZTXA 3NZIA 4U30A 3RU4T 2FESH 4B71A 1O2LA 3G01A 3MH5A 1F2SE 3F9EA 4UEHH 4IBLH 3LGIA 5A8ZA 4ABDA 2LPRA 1AFQC 2ZFPH 2VVUA 1XKAC 2GD4B 1Z7KA 1N6XA 2BLOA 3IITA 4I31A 2VIDA 1H8IH 2VH0A 3UREA 5DP3A 1AN1E 4GAWA 2XCNA 3A8AA 3SUFA 1ELDE 3E6PH 2FP7B 1SQOA 1TYNA 3CENA 3RXUA 1IQEA 1PQ8A 2H1UA 3SJ9A 1BMAA 3ZVDA 3MU1A 2GTBA 5A0CA 4H4FA 1FI8A 9ESTA 1W11U 5HGGA 1ESTA 3MNCA 4BAKB 1ZYOA 2ANMH 1QB1A 4MNVA 1GJ4H 5C20A 1PPHE 4R8TB 1LPKB 4WXVA 1J16A 3MNSA 3SUGA 1C1MA 1AE5A 3M5NA 4ZKOU 2OD3B 1HAVB 2TPIZ 2Z7FE 4FUEA 5EOKA 1FLEE 2XTTB 4I8HA 1Y59T 3QGJA 2BZAA 1ELEE 1F0TA 1U6QA 2R0KA 3EGKH 5DP5A 1E37B 2F83A 2JH0D 3H5CB 1V2MT 5DO4H 1S81A 1IQGA 1O2WA 4O3TA 1HBTH 1HIAA 3TIUA 3SU1A 2AMQA 4NA9H 1DWCH 3A84A 3UOUA 3ZVEA 2F9VA 3TJNA 1HCGA 5T6DA 7GCHF 1ID5H 4U2WA 1EPTB 2FO9A 1MD7A 2HNTC 4PROA 5JBCS 2CHAC 1F0SA 4JCNA 1HFDA 3PLBA 1Y3UA 2P94A 2A4GA 3DFJA 2ZF0H 1OP0A 4I8KA 4ABHA 2J94A 2VIPA 5FCKA 1OWJA 2EI7A 2C8ZB 2ILNA 4MPUA 4NZQA 5PTPA 3GY2A 4FVBA 2G8TA 1FDPA 1TQ0B 5FPYA 4HFPB 4AYVB 1MBMA 1N6YA 1C5NH 3HGNA 1H9HE 1Z6JH 3BIVH 4YLUA 1NO9H 1YCPK 1AMHA 1TALA 1CA0C 2GCTC 1DWBH 3MU5A 2OC0A 3SU0A 3K6ZA 4A5TS 1Z8RA 1KTTB 3BN9A 3A8DA 5JDUB 2PUXB 3RLYH 1DOJA 2LNCA 5A09A 1ARBA 5SGAE 5A8XA 2BVSH 3MHWU 3V7TA 5E0JA 2TGDA 2Y7XA 4MPVA 1AQ7A 1NS3A 2W5EA 1SGNE 3P17H 1QL7A 1QL8A 5FHTA 5HMAA 3LJJA 4ZXYH 3F9GA 6GCHG 3D62A 1GHWH 1AFEH 1LCYA 3TK5A 3L33A 1TOCB 1A2CH 4IC5A 3E0NB 3GDSA 3M61U 5JB8S 2AIQA 1O5EH 2P95A 1DT2A 4WVPE 5DPAA 3R0FA 4NWLA 2Q1JA 1WQVH 3W95A 1GI9B 4AB8A 2WPHS 5EW2H 2WV4A 1TA6A 3EA9A 5GCHG 1GI4A 3MU0A 1C5PA 2WYGA 1UVOA 2Y5GA 3UUZA 1GBLA 5E2OA 1FUJA 5JYIA 1GMDF 2AGIX 4INKA 2O8MA 4Q7XA 3TJOA 1KXFA 1YM0A 2R9PA 1V2RT 1O0DH 1LVBA 4I8JA 3M3TA 1F92A 5HM9A 2VU8E 2BHGA 1UHBA 3QTVH 4ZXXH 1AVXA 3R3GB 1W0ZU 3ZZDA 2ODPA 2WPJS 2ZHFH 1ANEA 2HRVA 4R0IA 3S7HB 2BLVA 2ZTYA 1MU6B 1TPAE 2FOCA 1A5GH 3RM2H 3A7WA 1FV9A 2EI6A 2QF0A 1EKBB 4FUFA 1O3FA 2J9NA 1ZMLA 1QBVH 1P01A 2A1DB 3P8FA 3LDXH 1XVOA 1V2TT 4CBOA 1ZHPA 3GYMA 3GY7A 5FBIA 2TGTA 3RXMA 1P10A 4RN6A 1GBBA 3ZVAA 4DURA 1BRBE 3MH7A 1GBKA 3A89A 4JYVH 2FYRA 1GI8B 1ANDA 3S7KB 4XE4A 3RC6A 1EJAA 1GJBB 3ITIA 3D23A 4FUDA 3PV4A 1L4DA 1GHXH 5CHAB 4OGYA 1DLKB 1QBOA 1Y3YA 1Z8GA 1UTQA 1S85A 1AVWA 1SLWB 2GZ9A 3MO9A 2ZU2A 4UE7H 5LH8A 1VITF 4HI3A 1S6FA 1IQNA 1WUNH 1K22H 5AFYH 1Z6EA 2PUQH 2UUJB 4KTCA 1PPCE 3PLKA 1KTSB 1G2LA 3UTUH 2BOHB 1DWEH 1GBEA 1T4VH 2PKAA 2PKSB 4LZ4B 1O3EA 3OY5U 4O9VA 2ZGXH 4THNH 5C1XA 2FMJA 3VGCB 1GBJA 2IN2A 4WH8A 1NFYA 1GHBG 4JMYA 3NPSA 1GI0A 1SGIB 4Y8ZA 2P3FH 1O2GH 3BTDE 1ZLRA 4AGKA 1Z1JA 1SLXB 1Y5UT 3SGBE 1NRRH 2BZ6H 1SHYA 1ZMNA 1IQKA 1UVTH 3BTFE 1TIOA 1V2WT 3QTOH 4LK4A 1O3BA 1YPHC 4I32A 1GMCF 1SGCA 1SSXA 1CO7E 2D8WA 2QCYA 1HAPH 1TOMH 2I6SA 1DSUA 3GCNA 1S82A 4LZ1H 2TBSA 1AWHB 1HJ9A 2BDHA 3GY3A 4CRDA 1D3TB 1A0LA 3V13A 3I29A 2FEQH 1YBWA 1V2VT 3KCGH 1UVUH 2ZU4A 3RMMH 2V35A 1P03A 1SR5C 4ESTE 4YTAA 2O8UA 2XC0A 4E06H 2BY9X 1P2KA 3AW1A 3EAJA 4FUBA 1K1MA 3PMAB 4CR5A 1ZPZA 1C2HA 5EQRA 1MZDA 5ESTE 3TGJE 2C93B 2HPPH 2YNAA 2TGAA 3FZZA 1LQDB 4A92A 2OUAA 1EP5A 1P9UA 2XC5A 1O35A 1V3XA 1AIXH 2ZHWH 1SFQB 1BBRE 1KXCA 4MDSA 1TNIA 1YC0A 3UWJH 1EP6A 1EUFA 3C27B 4INLA 4FUJA 1ANCA 3ZZ3A 3M37A 2UUYA 3BSQA 2BB4A 1GBAA 1C2LA 2PLXA 1C2FA 3RMNH 3RXRA 1PPFE 3TGIE 3FAOA 1H8DH 1OPHB 1V2PT 4BAOB 4E7RG 1GI7B 1NRQH 2SGDE 1O2PA 3SNEA 3VB4A 4CR9A 5CHAC 4SGAE 1V2KT 2UWLA 3LGUA 1SQTA 2HVXA 1HIAB 3LGVA 4VGCC 3M7TA 2Z9LA 3F68H 3CS7A 5TCCA 1C5TA 4GSOA 2A45B 1GHYH 1ZRKA 1BJVA 2O8TA 1YF4A 1A0HB 1C5YB 1O2ZA 3NKKA 3RXJA 4O97A 4TYDA 3PYHA 2GCHF 2GX4A 1DUAA 3PO1B 4U01A 4D8NA 4D76A 1GJCB 1TGCA 4YM9A 2RCEA 1T8NA 1BBRH 4ISOA 1MCVA 1ZSLA 1EB1H 2V3OH 3RXEA 4GCHG 1MTNB 3PB1E 1DANH 2GZ8A 2OBOA 1KXDA 2A32A 1C1UH 1H1BA 4LXBH 3U1IB 2FWWA 3Q3YA 2STBE 4IGDA 4ZKRU 3MH4A 1CGJE 2SGFE 3JZ2B 1P57B 1LKAA 3S69A 1EOJA 1C2EA 3ZZAA 1RS0A 2A4QA 2EI8A 1AO5A 4KTUA 1B0EA 2J2UA 5EPYA 3KL6A 3RXPA 1LKBA 3T2NA 5I46H 5E8EH 1RGQA 1VCWA 1GHZA 2QXGA 3A7VA 1W2KH 1EATA 1ESBA 2ZDKA 2IOTA 1CE5A 1GJ7B 4MVNA 2XWBI 4TPIZ 1P2IA 5BRRE 2H5CA 1GBMA 1TBQH 4AFUA 2IJOB 1PYTD 3RMLH 1GPZA 3ATLA 1TMTH 1BJUA 1M9UA 1QQ4A 1VGCB 2I6QA 3UIRA 2ANYA 2WV5A 1O3AA 1NROH 1O5FH 1AD8H 1TPPA 1ZJKA 2JKHA 4ABGA 2ZDVH 2FYQA 3GOVB 3GY4A 5HM2A 1C1QA 1HAHH 2ZHQH 1NC6A 2VWLA 4ZHLU 1C5XB 3ZZ7A 2OINA 2XWAA 4K2YA 3I77A 1DITH 4AOQA 5C67A 1C1NA 3ZZ9A 1W12U 2ZFTA 3MU8A 1GJAB 1TX8A 5T6GA 3S9AA 1O38A 1OX1A 2PGBB 5EXNA 4K3JA 1FIZA 1WOFA 3O8DA 1H9LB 1SGFG 4MNYA 1ZTLA 1DLEA 1UHBB 1AB9B 1AY6H 5EGMA 4NCYA 4KKDA 2WYJA 1TB6H 4MNXA 2UUKB 4UONA 3RP2A 1PQ5A 3PO1C 3TGKE 2XBXA 1UTNA 3RC5A 1FN6A 4NWKA 1CGHA 3C1KA 1BTXA 1GMHG 1HAOH 1ACBE 1AKSA 3L3TA 1ABIH 3SU3A 2VIVA 1MTNC 3Q77A 5HXFA 4OGXA 1MCTA 3BG4C 3GICB 2FZZA 3QUMP 2F9PA 4X8SH 2ZTZA 2C4FH 3ZYEA 2F9NA 4Y10E 1AWFH 1QNJA 5EQQA 2V0BA 4Y7BA 1ZJDA 2HOBA 1S0QA 4Y11E 1CBWB 1FNIA 4KP0A 1FPHH 2UUFB 1ZHMA 1JRTA 1Z8IB
chains in the Genus database with same CATH superfamily
3PM3A 3SO3A 3E90B 3BTKE 1V6DA 1WTHD 2G81E 4DW2U 7KMEH 1HAYB 1FAKH 2RDLA 2EEKA 4K5ZA 2H2ZA 2OC1A 3KF2A 4FOUC 2OC8A 5EJ1A 1SGEE 2PKAB 2XOKD 1F5RA 1HJAB 1K1LA 4WMFA 3ZVGA 2RDEA 3GY6A 1GI5A 1WQSA 1HYLA 3ATMA 4A7IB 1E38B 4Q2KA 2L6OA 2Y5FA 4ISIH 1YCPM 3QO6A 1E34B 1EAUA 2ALPA 1TQ7B 5A0BA 4CH8B 3UB0A 1SLUB 3ATWA 2CGAA 1P04A 1ZTJA 4AG2A 5L2ZH 3SI3H 1KLJH 4BAMB 4DJZB 3OE7D 1B0FA 3O8CA 2AS9A 2H6MA 2XW9A 3UOPA 4CH2B 4IMZA 4ZUHA 1E1QD 2Y81A 5FCRA 5GIBA 1O36A 2A0QB 2WPKS 3RC4A 4NA7A 1Y5AT 1GI6A 1SPJA 4E05H 1C2IA 1QBNA 4O03A 2CF9H 2ZO3H 4NA8A 2A31A 1O5BB 1ZHRA 5E0GA 2FTMA 1RTFB 1GL0E 2A2QH 4MNWA 1O34A 1N1LA 2F9OA 2ZGCA 3AASA 1O2SA 1MBQA 3KQCA 5CHBA 1DSTA 1BITA 1UTJA 1BTZA 1ABJH 1TBZH 3SU4A 1ELGA 4WY3A 4AFQA 3LOXA 2FOEA 2QGRA 2AIPA 1FONA 2CV3A 1PPGE 3RLWH 4QT8C 3BV9B 1BRCE 1P3EA 4DT7B 3RXCA 1OSSA 1AE8H 1ELBA 1MH0A 2ZPRA 3U69H 1EJNA 1YPHE 1H8HD 3UNRA 1RIWC 1S84A 1L0ZA 1AHTH 2PTNA 3P8OA 1NM6A 2IPQX 1PYTC 8GCHF 1P3CA 3JZ1B 1O3MA 5I25A 1KDQA 1GCDA 3E16B 1YLCA 3SU2A 4JZ1A 3K65B 2PR3A 1K9OE 2IJD1 2BVRH 3RDZA 2VWOA 4BANB 2QIQA 1E36B 1C5MD 1CBWC 2WUCA 5AFZH 4WH6A 4IN2A 1G3CA 3PV5A 1OWDA 1TAWA 3T27A 1V2UT 1ETRH 2Q6DA 3MO6A 2ZHDA 1JRSA 1F5KU 1CHOF 2BXTH 4MQAA 2F9UA 1TX6A 1EZUC 1HAZB 1QJ7B 1C2DA 1O39A 1XUFA 2FPZA 2F3CE 2OLGA 3GCTG 1K1JA 4Z1MD 1QFKH 2PWXA 4GVUA 4AC9A 1A3EH 3FANA 2F91A 3M7QA 3SUEA 1UTPA 1FXYA 1CHGA 1HJAC 2FI5E 3T28A 1HLTH 3QK1A 1DX5M 2GGVB 1C2GA 1ZTKA 3RXIA 1UCYE 2J38A 3ODDA 6LPRA 4BXWA 4B1TA 1O2QA 1IAUA 1OS8A 3D49H 3WWBA 1O2TA 5JB9S 4ZKSU 1YPGH 1FIWA 2W6ID 3KN2A 1QA0A 3HATH 5DG6A 2VNTA 4Y7AA 2RG3A 2AYWA 2ZDNA 1ELCA 1O32A 2G4UA 4KGAA 3ZZ5A 1NTPA 4INHA 2SGEE 3PMJA 4BTIB 3SZEA 3ENSB 1JWTA 1C1PA 4FU9A 4CRCA 1O2JA 1O5AB 1MKWK 1TNJA 2XNIA 1TNKA 4NIVA 3SV8A 3A8CA 2M2AA 5LPFA 2RA3A 5ETXA 2G00A 3ZVFA 1N8OB 1J8AA 1DXWA 4GPGA 3KYFA 2RFKC 4Q80A 2PFEA 3CNRA 4CRFA 1RD3B 2ZFFH 2ZU5A 2FOBA 4IMQA 1O2OA 3SW2B 4HTCH 4BXSA 5C3NA 4I7YH 1UCYH 3AVZA 5E2PA 3PTNA 2FOMB 5TCAA 2OP9A 3PMBB 1W13U 2NWNA 4NIXA 4K1EA 4DIHH 1UK3A 3A88A 4Q4LA 3MMGA 1MU8B 4YOGA 1GCTB 2ZIQH 4RSPA 1YLNA 4Q7YA 3ZZBA 2C8YB 1THPB 3FOAA 4X8UH 1XUKA 4JYUH 1TRMA 3RXOA 1TWXB 3T29A 2XNDD 1LHFH 3VPKA 1O3NA 3W94A 2G55A 2PSYA 4TPYA 2H9TH 5L6NH 1QY6A 2P3UB 2H9HA 1EASA 4OS5A 1SGTA 3ZVBA 1D9IA 1QRWA 2G52A 4JZFH 3UQOA 1EPTC 3SJKA 2R0LA 2BLQA 1TGTA 5T6FA 1TNLA 1WV7H 1ZRBA 1FPCH 1IHSH 1MKXH 5CDFE 2JDID 3RXAA 1QRXA 3FP8E 3I78A 4CHAB 5LGOA 1QZ8A 4ABFA 3B8JA 1A61H 1DS2E 3K9XB 4X2YA 3L6PA 1QRZA 3RM0H 2ZKSA 1BTUA 1ZGIA 1GJ8B 1G32B 2G51A 2TRMA 1TPSA 3CP7A 2A4RA 1GHAG 2FX6A 1SKYE 2AEIH 5FXLA 3T62A 1DUEA 1GJ6A 1J14A 1NFUA 3OYPA 3O8BA 3FP6E 5FPTA 2H5DA 3LC5A 4JZEH 4MTBA 4X6MA 5EIYA 3KNXA 1UTMA 1MD8A 1V2JT 4WWYA 2TIOA 1QIXB 3DUXH 2C8XB 2EA3A 2ZA5A 3SJ8A 5DKMA 1O3JA 4LOYH 2ZC9H 3ELAH 3B9FH 1VITH 5EG4A 4A1TA 4F55A 2QY0B 5GPIB 4YESB 1VCPA 4K8YA 3RXQA 1XUJA 3KQEA 2Z3EA 2FODA 1L2EA 3UNSA 4A1XA 3N99A 3VB7A 1TGBA 1OWIA 4CRAA 3VB3A 3A85A 3V3MA 2ZQ2A 4MLFB 1P2JA 3VFEA 2ZG0H 2CF8H 2B9LA 1BRUP 2QN5T 1ARCA 5EQSA 3GY8A 3P8NA 1WCZA 4J2YB 2BD2A 1W0YH 2QF3A 2SGPE 8ESTE 1JOUB 1KMHB 1C2JA 1Q2WA 1UTLM 2D26C 2VH6A 1CT0E 1C1WH 4Y0YE 5LPEA 1EJMA 2KM0A 1EXFA 2R2MB 5KECA 2F9BH 4YLQH 4AB9A 1PQ7A 2P8OB 1CVWH 1A0JA 2XYAA 4OS7A 5IDKA 1F0UA 2JJ2D 1FJSA 3Q3KA 1BDAA 3TU7H 1GJDB 1TE0A 4ABAA 1O2IA 3PWCA 4XBBA 4ABIA 1YPJH 4ZKNU 2OCVB 2BDBA 4ACBA 2WPMS 1EFRD 2GT8A 3SBKA 2FS9A 1L1GA 1VCQA 3LJOA 4FXGH 2W26A 1GJ9B 3SNAA 1K1NA 3QX5H 3SV9A 1TNGA 3LH1A 3SQHE 1HAIH 4UDWH 2XBWA 2CJIA 4OS4A 1PJPA 1DDJA 3A86A 4FUHA 2GDEH 1G30B 4X8TH 2J92A 1S6HA 3SGAE 4UFEH 1OWEA 1EZSC 2YOLA 1Z1IA 2AH4X 2VBCA 1Z71A 3TJUA 2BD5A 2P3TB 1VJ9U 2M5TA 1E35B 2J95A 4K60A 4ABBA 2WSSD 3URCA 8KME2 9LPRA 1C1RA 1ELAA 1ZR0A 4FVDA 2Z9JA 2AFQB 1SQRA 2ZQ1A 1PPEE 1LVYA 1VR1H 1QCPA 1LMWB 2H9EH 4JYTA 5C17A 1C5WB 3N7OA 1BCUH 3SJIA 3ATIA 1BUIA 1J17T 5C2ZA 3T5FH 1BZXE 1FY4A 3UQVA 3A7TA 1QB9A 5AF9H 1YLDA 1LHEH 1TABE 6GCHF 3MWIU 2PSXA 5A2MH 1CU1A 1SB1H 1SOTA 1V2ST 3GCHB 1YPKH 4I33A 4UD9H 1ZPBA 3FP7E 2BM2A 2FOHA 1GBHA 1XVMA 1YWUA 1BIOA 2BDAA 1SGPE 3U8OH 3UY9A 4WJG2 4X6PA 1NRNH 1JIMA 3WWFA 5J4SA 1KIGH 5DK1A 1SGDE 1THSH 2J97A 3AAVA 4AORA 1ELVA 3LC3A 5F8TA 3ZYDA 1S83A 1P2NA 2W6JD 5GCHF 1XX9A 1DE7H 2PKSC 2R2WU 1AUTC 2ZDMA 4XBCA 3VGCC 1P06A 1B5GH 1P9SA 4X1PU 2A2XH 1CA8B 3VB6A 1C1TA 4UFDH 2XBYA 3WY8A 1F5LA 1YP9A 1DWDH 2BY5X 3F0PA 1V2NT 1IQMA 1W7XH 1WTGH 3A87A 1SMFE 3MTYA 1SHHB 3U8TH 4RT0A 2K1QA 4UFFH 2ZGJA 2O8WA 1HUTH 2ZCKP 3BF6H 3MYWA 1QB6A 3HKIB 1FMGA 4XOJA 1GBIA 3UR6A 2BY7X 4FUIA 1UVSH 1FN8A 3KHVA 4WMDA 1AUJA 4BTTB 3F9FA 3DT0H 4YT7H 2GV6A 1MMJN 1GDUA 2Z9GA 3BTWE 4O3UA 5JBTA 1DFPA 2ZFRH 3SOSA 1OXGA 4ZH8A 1PQAA 1TMBH 1V2OT 2ZP0H 4GUXA 1RFNA 2HWLB 3PTBA 4JK5A 4ASHA 2PV9B 2VWMA 4K1SA 4CREA 1A7SA 4Z0KA 1C5SA 2XXLA 2VWNA 4XD7D 5C94A 1IQFA 2KCYA 4NFFA 3ZZCA 1YCPH 3M5MA 2O9QA 3HPTB 3GY5A 3MH6A 3RXFA 3KQBA 3UWIA 4ZAEA 1QURH 7GCHG 1LTOA 4M9FA 3LH3A 1DVAH 1P12E 1Y3VA 1KXEA 2WZQA 1Z8JB 2BD3A 1UMAH 2Z6BD 4B2AA 5H4IB 3GCHC 5DP9A 1QA7A 4WF8A 1QJ1B 1BOQA 1SGFA 4FU8A 2RA0A 2FIRH 3BG8A 1D6WA 3BEUA 7ESTE 1GHBF 2BX4A 1G2MA 2HNTF 4F4OC 6ESTA 1SOZA 3QZRA 3M3VA 5GWZA 1HGTH 1AI8H 2ALVA 3LIWA 4RKOB 1GGDB 1GDQA 1A4WH 1H9IE 4U32A 1IOEA 1C5UA 3AAUA 1W3CA 1C1OA 2ZCHP 4X6OA 2OC7A 2ASUB 5K7RA 4AX9H 3LT3A 1XUIA 1RXPA 3TNTA 1WYKA 3RU4E 4DVAU 3BTEE 1BRAA 5C1UA 7LPRA 1O30A 2BY6X 3UFAA 3ODFA 5F8XA 2YMSD 2F43B 1TLDA 1OOKB 3TPIZ 3E3TA 3PLPA 3QDZB 4X2XA 1HNEE 5AHGH 3BTHE 2Y80A 1GJ5H 1NFXA 3U28C 1O3GA 2QV1A 5GJ4B 1GVKB 1BTHH 4DGJA 4OS1A 3GCOA 2AHME 1O2MA 1GWAA 2CN0H 1GI3A 3GS9A 4F48B 1MAYA 3RXTA 2STAE 5EODA 1B7XB 1J9CH 3TJVA 1AGJA 3A8BA 3UPEA 1PPZA 4ASUD 1T4UH 3H09A 1TONA 4K8BA 2WINI 3TH2H 2PW8H 2NU3E 2G5NA 5EPNA 1J15A 1VGCC 3HKJB 1F0RA 1KLIH 1O3LA 1EZXC 1O2VA 1GMDG 2CHAB 3HGPA 2A4OA 3M3SA 1IQIA 5GXPA 1MAXA 1ZPCA 2BD9A 5A0AE 2VVVA 1HDTH 1NFWA 5FX5A 5C5NA 1O2UA 1TRNA 2VIQA 1LVMA 1UO6A 3OY6U 2DE8A 1C1VH 1P2MA 5ABWA 1LO6A 1BA8B 4X1RU 1C2MA 2FI4E 5C1YA 3U8RH 1VKYA 3IG6B 4B75A 1LDTT 3EQ0H 1CQQA 1CA0B 3U1JB 1O31A 1O2XA 4BNRA 3D65E 1HXEH 3S9CA 3URDA 2C90B 5DP8A 1C5OH 1GHVH 2YMSB 2BQ7B 2A5KA 3SV7A 1OWKA 4GCHF 2ZECA 4P00A 2FLBH 3FN8A 3LPRA 1KXBA 1AB9C 3BEIB 1G3DA 4FUCA 3V0XA 2JJ1D 4CRBA 4B73A 4XSKU 1OWHA 1O2RA 4XFQA 2V3MA 3BTQE 1EZQA 2P16A 1DXPA 1GGDC 1GI2A 4XBDA 2J34A 1BMMH 3SNCA 2BDCA 4Y76A 3SUDA 1Y8TA 1C1SA 3F0OA 1K21H 4NSVA 3NUMA 1C9TA 4F49A 4TY6A 2BTCE 1LPZB 1THRH 1AZZA 2BDYA 4D7GA 3VEQB 1O5DH 4GHQA 3PWBA 4YZUA 3DCLA 3SNDA 3A82A 5B6OA 1VITG 2VGCB 5AVDA 8LPRA 3AK5A 1BBRK 3GDUA 2TGPZ 3SV2H 4E7NA 1P2OA 2AGGX 3NCLA 3Q76A 2Z94A 2GV7A 2YNBA 3SGQE 1NZQH 2W7SA 1DY9A 2QF5A 1P02A 1RTLA 1ESAA 3N7DA 4X2VA 5K0HA 1SI5H 3BEFB 1O5GH 3TITA 1TNHA 5EJLA 4BAQB 2JIZD 4X1NU 2KCOA 1TA2A 4ACAA 3DHKH 1Y5BT 4Q7ZA 3HK3B 6CHAB 1E1RD 2ANWA 3RXSA 4TWWA 1UVPA 2ZDAH 3E1XB 1XXDA 2KAIA 4YXWD 1C4U2 1EB2A 1HPGA 1SLVB 3F1SB 5J4QA 1D6RA 3RXVA 1C4Y2 1NBME 1ETSH 1H4WA 1XM1A 2ZGBH 3K2UA 4NIYA 1IQJA 1GMCG 2W3KA 3EE0B 3SV6A 3BTTE 1ANBA 3T26A 4X8VH 1O33A 3M36A 1E0FD 2IPHA 1HJ8A 2ODYB 4X6NA 4CRGA 2EC9H 2EY4C 1DY8A 1ZSJA 4X0WU 1IQLA 4M7GA 1W14U 1VJAU 3NXPA 1FQ3A 1XXFA 1BB0B 1G36A 1RRKA 2BVXH 2P93A 1HAGE 4DY7B 2KX4A 4Y71A 2PTCE 4HGCA 2ZI2H 2BXUH 1JIRA 3SI4H 1L1JA 2P59A 3Q3XA 4AG1A 1TGSZ 4YT6H 1OKXA 2JETB 3RXKA 2AGEX 3OTJE 1T8LA 4D7FA 5L30H 4AYYB 1EAIA 3QWCH 1GMHF 2BQ6B 1JXPA 2GDDA 2XCFA 2WV9A 1QL9A 2YMSC 1GVZA 2ZPQA 1C2KA 2B0FA 1KY9A 2O8LA 1HB0B 2BYAX 2THFB 2Y5HA 1EAXA 1UTOA 3F6UH 4IN1A 2D1JA 2FS8A 3S9BA 1OP2A 4Y8YA 1KYNA 1UK2A 4ZHAA 5EU8A 3SJOA 4K1TA 4BTUB 1MQ6A 3QGNB 3QZQA 3QLPH 1QGFA 1BMNH 4KELA 5EW1H 1RJXB 1TPOA 2CK3D 1DICA 2VGCC 4DOQA 1ORFA 1CSOE 1TX7A 1O3KA 1YPEH 2GCHG 1LPGB 4TWYA 3TNSA 4XDEA 4B2BA 4NFEA 2JH5D 4H6SB 4RT1A 1QJ6B 1PPBH 1BT7A 3PMHB 1C5VA 2VIWA 1G37A 3T25A 3ZZ4A 2UWPA 3SN8A 6CHAC 1S0RA 5FX6A 3KGPA 1O3PB 3OAAD 1LVOA 2VINA 1ZGVA 1ELFA 1NRPH 3A7YA 4HZHA 1K1PA 1T32A 2K8IA 1AKSB 2AMDA 1SFIA 1GI1A 4TSFD 1AZ8A 3FVFB 1NU7B 3UAIC 2QYIA 3NK8A 3MU4A 5A8YA 2OTVA 5GDSH 4X1QU 1Y3XA 1SVPA 4UFGH 3TK6A 3IWMA 5F53A 1ZMJA 1W8BH 3A80A 3LONA 5L2YH 2A7JA 4ISNA 4I8LA 1FY3A 3ATKA 1NT1A 2JETC 4ZHMU 3DA9B 1SC8U 1TMUH 3BIUH 4GLYA 3SU6A 2GP9B 3DFLA 3M5LA 1GVLA 1HRTH 3N7EA 1XUGA 2SGAA 3BTME 2PHBA 1YYY1 4OS6A 5G4BA 3RXLA 1O37A 4AFZA 2BD4A 1N8OC 5CMXH 4VGCB 1Y3WA 2GT7A 2OQUA 3MI4A 4BAHB 1MTSA 1P09A 3H7OA 3LGWA 4KTSA 4ZMAH 1V2QT 3M35A 4SGBE 3RXHA 2CXVA 2FXRA 5T3HA 1HXFH 4DG4A 1UJ1A 1GG6B 3F2GA 4J1YA 4B74A 2Q6GA 2QAAA 3E8LA 1S5SA 1INCA 1BTPA 2A5IA 1D4PB 4AGJA 3A81A 3RXDA 2QC2A 1IHTH 2VB0A 3LGTA 2QXJA 3SHAH 3P8GA 3P95A 4BOHA 2Z3DA 4ABJA 1D3PB 3OEED 1GCTC 4Y8XA 2BMGB 5KEDA 3OU0A 3UNQA 2BDIA 1UK4A 2KFWA 1C5RA 1SGRE 1P0SH 2SGQE 1F7ZA 1W10U 2WHXA 3GCTF 5IYTA 1JMOH 1XUHA 1PFXC 1SBWA 1O5CB 3LKWA 3SU5A 5BPEA 2V3HH 1HV7A 4RI0A 1O3OA 1GBTA 4CBNA 2CMYA 2BD7A 3KQ5A 1OP8A 3ZV9A 1QHRB 1ETTH 2AMPA 1FAXA 1O3CA 4X1SU 1XMNB 1P05A 4ISHH 1AVGH 2FTLE 3RXGA 4A6LA 3A7XA 1EQ9A 1XKBC 2VIOA 1TRYA 2HLCA 1P11E 3H7TA 5JPMH 4CHAC 2GMTB 3EDXB 3KEEA 1QQUA 2NU2E 3KQDA 1ELTA 2WPIS 3GYLB 1KLTA 4MG3A 2HALA 1E79D 2D2DA 2FLRH 3M5OA 2KR7A 1CGIE 4YO9A 1QTFA 3E91A 3E0PB 1T8OA 4NZLA 1KDQB 1O3DA 3F3BA 2AERH 1EAWA 2PP6A 3BTGE 2B7DH 1BTWA 1HAVA 5DJ7A 3SZNA 5CE1A 3FKSD 3VXEH 4JZDH 3ZZ6A 2ZU1A 2ANKH 2Z9IA 3MFJA 1MQ5A 1BQYA 1YPLH 2ZPSA 5EXMA 3RXBA 3ZVCA 1G3EA 4IC6A 1P2QA 1DPOA 2Z9KA 2Q6FA 3RUOA 1WXRA 3DSGA 2GVFA 4Y6DA 1A5IA 5LPRA 2KAIB 3TH3H 1YPMH 1VZQH 2GZ7A 1T8MA 3LGYA 3TH4H 2WUBA 1KXAA 2NU0E 2ZNKH 1C5ZB 1WBGB 1EPTA 5EJZA 4AN7A 3TK9A 1WAYB 1GL1A 5F03A 1Q31A 2ULLA 2C3SA 1MTVA 2A7HA 2BDGA 2VVCA 2W7UA 1WDIA 1K28D 4WMEA 1O2KA 1MZAA 2Y6TA 4NG9H 2NU1E 1GG6C 2WPLS 1JBUH 4JZIA 2OQ5A 2HVYB 2J98A 3VXFH 2FM2A 4B6EA 2P8OC 1A46H 1P8VC 1V2LT 1NRSH 1ZZZA 5FAHA 1SQAA 4Y0ZE 1UCYK 3MOCA 2FI3E 4H6TA 2OXSA 5FPSA 2QF4A 2SNVA 5C0UA 1YKTA 3M7UA 2FOGA 4IS5A 3BG4B 4NGAH 1C5LH 5DP6A 3LU9B 2BOKA 1O3HA 3CS0A 4WXIA 3AW0A 4Y79A 1O3IA 1K2I1 2SFAA 4Z6AH 1FY8E 3A7ZA 3OSYA 4YOJA 1T7CA 4X2WA 1SG8B 2QA9E 5F8ZA 1A5HA 3VB5A 1LHGH 2SNWA 2ZEBA 1GHAF 2HNTE 1FY1A 2ZDLA 2FOAA 3MNBA 3PV2A 8GCHG 2W3IA 1NY22 3A83A 2Z3CA 1MUEB 5C0TA 4RKJB 4A1VA 2G5VA 2GMTC 2B5TB 2FOFA 1CT4E 2ZU3A 3QN7A 1EX3A 3ZZ8A 1IQHA 1MTWA 1D3QB 1MKXK 1TBRH 1SGQE 5C5OA 2FDAA 3SNBA 3STJA 3S0NA 4GHTA 1BMLA 1EOLA 1C5QA 2ESTE 3B23B 2ZGHA 2BLWA 1BHXF 1CHOG 3MNXA 2B8OH 3ZV8A 4NSYA 3NWUA 3F2FA 2BQWB 3MO3A 1C4V2 1O2NA 1LHCH 2ZFSA 2ZWLH 4MPWA 3K6YA 1AFQB 1UTKA 1OYQA 4AFSA 1GDNA 3SORA 3STIA 1MKWH 5E0HA 2A7CA 3OX7U 2VJ1A 1CT2E 2HPQH 5B6LA 4D9RA 4OS2A 4B76A 5TJXA 4FU7A 2ODQA 2NU4E 3EA8A 1ZOMA 5DP4A 1RTKA 3DD2H 1G3BA 4ZROA 1D3DB 5DGJA 1BTYA 1TGNA 1K1OA 1OYTH 2HGTH 3SQEE 3EA7A 3O8RA 1O2HA 2FX4A 3FFGA 2Y82A 2ZHEH 3V12A 1FZZA 4YOIA 4TY7A 4FUGA 3F9HA 4HG6A 3RMOH 2BX3A 1MTUA 4B6FA 4NIWA 2DUCA 2R3UA 3U98H 1A1RA 1GBCA 1RIWB 2JH6D 2XC4A 3PROA 2ZCLP 2QXHA 1G9IE 1LHDH 2ZFQH 3U9AH 4IW4E 3SHCH 2K0QA 1O2YA 2XRCA 2GKVE 2QXIA 3P92A 5ESBA 1WSSH 3ESTA 4JK6A 3KIDU 1GBFA 1LQEA 1FY5A 3TLOA 1BHXB 2A5AA 2BY8X 3FZDA 4I8GA 4DCDA 5JBBS 4H42U 2XBVA 1KSNA 3RU4D 1YGCH 1C9PA 1L4ZA 4Q63A 5KGOA 2V6NA 2UWOA 2BD8A 2OBQA 1GBDA 2R3YA 4MPXA 1X7AC 2KCPA 3P70B 2ZZUH 3GISB 3ZIAD 3HK6B 4D9QA 2PGQB 5EXLA 1TFXA 5JBAS 3UR9A 1A3BH 4K69A 2DE9A 1DM4B 1T31A 1ZSKA 1AU8A 4B2CA 1Q3XA 1NESE 3P6ZB 4ABEA 1NU9A 1L1NA 5FBEA 1QR3E 1SL3A 5DP7A 5F6MA 1NN6A 4ISLA 2G4TA 1WU1A 4DIIH 1K1IA 1SGYE 3EYDA 3GDVA 5HYOA 2GCTB 4AZ2B 3Q00A 2C8WB 1W7GH 3TVJB 1NPMA 1HAXB 2J4IA 2Y7ZA 2ZTXA 3NZIA 4U30A 1W0JD 3RU4T 2FESH 4B71A 1O2LA 3G01A 3MH5A 1F2SE 3F9EA 4UEHH 4IBLH 3LGIA 5A8ZA 4ABDA 2LPRA 1AFQC 2ZFPH 2VVUA 1XKAC 2GD4B 1Z7KA 1N6XA 1W0KD 2BLOA 3IITA 4I31A 2VIDA 1H8IH 2VH0A 3UREA 5DP3A 1AN1E 4GAWA 2XCNA 3A8AA 3SUFA 1ELDE 5GNDA 3E6PH 2FP7B 1SQOA 1TYNA 3CENA 3RXUA 5IK2D 1IQEA 1PQ8A 2H1UA 3SJ9A 1BMAA 3ZVDA 3MU1A 2GTBA 5A0CA 4H4FA 1FI8A 3EE7A 9ESTA 1W11U 5HGGA 1ESTA 3MNCA 4BAKB 1ZYOA 2ANMH 1QB1A 4MNVA 1GJ4H 5C20A 1PPHE 4R8TB 1LPKB 4WXVA 1J16A 2V7QD 3MNSA 1C1MA 1AE5A 3SUGA 3M5NA 4ZKOU 2OD3B 1HAVB 2TPIZ 2Z7FE 4FUEA 5EOKA 1FLEE 5T1VA 2XTTB 4I8HA 1Y59T 3QGJA 2BZAA 1ELEE 1F0TA 1U6QA 2R0KA 3EGKH 5DP5A 1E37B 2F83A 2JH0D 3H5CB 1V2MT 3SYJA 5DO4H 3KYGA 1S81A 1IQGA 1O2WA 4O3TA 1HBTH 1HIAA 3TIUA 3SU1A 2AMQA 4NA9H 1DWCH 3A84A 3UOUA 3ZVEA 2F9VA 2F4LA 3TJNA 1HCGA 5T6DA 7GCHF 1ID5H 4U2WA 1EPTB 2FO9A 1MD7A 2HNTC 4PROA 5JBCS 2CHAC 2HLDD 1F0SA 2KZ4A 1HFDA 3PLBA 4JCNA 1Y3UA 2P94A 2A4GA 3DFJA 2ZF0H 1OP0A 4I8KA 4ABHA 2J94A 2VIPA 5FCKA 1OWJA 2EQNA 2WPDD 2EI7A 2C8ZB 2ILNA 4MPUA 4NZQA 5PTPA 5HKKD 3GY2A 2J98B 4FVBA 2G8TA 2KCAA 1FDPA 1TQ0B 5FPYA 3FO8D 4HFPB 4AYVB 1MBMA 1N6YA 1C5NH 3HGNA 1H9HE 1Z6JH 3BIVH 4YLUA 1NO9H 1YCPK 1AMHA 1TALA 1CA0C 2GCTC 1DWBH 3MU5A 1K0HA 1NBMD 2OC0A 3SU0A 3K6ZA 4A5TS 1Z8RA 1KTTB 3BN9A 3A8DA 5JDUB 2PUXB 3RLYH 1DOJA 2LNCA 5A09A 1ARBA 5SGAE 5A8XA 2BVSH 3MHWU 3V7TA 5E0JA 2TGDA 2Y7XA 4MPVA 1AQ7A 1NS3A 2W5EA 1SGNE 3P17H 3DSOA 1QL7A 1QL8A 5FHTA 5HMAA 3LJJA 4ZXYH 3F9GA 6GCHG 3D62A 1GHWH 1AFEH 1LCYA 3TK5A 3L33A 1TOCB 1A2CH 4IC5A 3E0NB 3GDSA 3M61U 5JB8S 2AIQA 1O5EH 2P95A 3WW7A 1DT2A 4WVPE 5DPAA 3R0FA 4NWLA 2Q1JA 1WQVH 3W95A 1GI9B 4AB8A 2WPHS 5EW2H 2WV4A 1TA6A 3EA9A 5GCHG 1GI4A 4FETA 2GJGA 3MU0A 1C5PA 2WYGA 4XRNA 1UVOA 2Y5GA 3UUZA 1GBLA 5E2OA 1FUJA 5JYIA 1GMDF 2AGIX 4INKA 2O8MA 4Q7XA 3TJOA 1KXFA 1YM0A 2R9PA 1V2RT 1O0DH 1LVBA 4I8JA 3M3TA 1F92A 5HM9A 2VU8E 1S6LA 2BHGA 1UHBA 3QTVH 4ZXXH 1H8ED 1AVXA 3R3GB 1W0ZU 3ZZDA 2ODPA 2WPJS 2ZHFH 1ANEA 2HRVA 4R0IA 3S7HB 2BLVA 2ZTYA 1MU6B 1TPAE 2FOCA 1A5GH 3RM2H 3A7WA 1FV9A 2EI6A 2QF0A 1EKBB 4FUFA 1O3FA 2J9NA 1ZMLA 1QBVH 1P01A 2A1DB 3P8FA 3LDXH 1XVOA 1V2TT 4CBOA 1ZHPA 3GYMA 3GY7A 5FBIA 2TGTA 3RXMA 1P10A 4RN6A 1GBBA 3ZVAA 4DURA 1BRBE 3MH7A 1GBKA 3A89A 4JYVH 2FYRA 1GI8B 1ANDA 3S7KB 4XE4A 3RC6A 1EJAA 1GJBB 3ITIA 3D23A 4FUDA 3PV4A 1L4DA 1GHXH 5CHAB 4OGYA 1DLKB 1QBOA 1Y3YA 1Z8GA 1UTQA 1S85A 1AVWA 1SLWB 2GZ9A 3MO9A 2ZU2A 4UE7H 5LH8A 1VITF 4HI3A 1S6FA 1IQNA 1WUNH 1K22H 5AFYH 1Z6EA 2PUQH 2UUJB 4KTCA 1PPCE 3PLKA 1KTSB 1COWD 1G2LA 3UTUH 2BOHB 1DWEH 1GBEA 1T4VH 2PKAA 2PKSB 4LZ4B 1O3EA 3OY5U 4O9VA 4TT3D 2ZGXH 4THNH 5C1XA 2FMJA 3VGCB 1GBJA 2IN2A 4WH8A 1NFYA 1GHBG 4JMYA 3PRDA 3NPSA 4ZCNA 1GI0A 1SGIB 4Y8ZA 2P3FH 1O2GH 3BTDE 1ZLRA 4AGKA 1Z1JA 1SLXB 1Y5UT 3SGBE 1NRRH 2BZ6H 5FL7D 1SHYA 1ZMNA 1IQKA 1UVTH 3BTFE 1TIOA 1V2WT 3QTOH 4LK4A 1O3BA 1YPHC 4I32A 1GMCF 1SGCA 1SSXA 1CO7E 2D8WA 2QCYA 1HAPH 1TOMH 4I86A 2I6SA 1DSUA 3GCNA 1S82A 4LZ1H 2TBSA 1AWHB 1HJ9A 2BDHA 3GY3A 4CRDA 1FX0B 1D3TB 1A0LA 3V13A 3I29A 2FEQH 1YBWA 1V2VT 3KCGH 1UVUH 2ZU4A 3RMMH 2V35A 1P03A 1SR5C 4ESTE 3OEHD 4YTAA 2O8UA 2XC0A 2J5UA 3OTPA 4E06H 2L74A 2BY9X 1P2KA 3AW1A 3EAJA 4FUBA 1K1MA 1BMFD 3PMAB 3W1EA 4CR5A 1ZPZA 1C2HA 5EQRA 1MZDA 5ESTE 2OK5A 3VG8A 3TGJE 2C93B 2HPPH 2YNAA 2TGAA 3FZZA 1LQDB 4A92A 2OUAA 1EP5A 1P9UA 2XC5A 5DSFA 1O35A 1V3XA 1AIXH 2ZHWH 1SFQB 1BBRE 1KXCA 4MDSA 1TNIA 1YC0A 3UWJH 1EP6A 1EUFA 3C27B 4INLA 4P02A 4FUJA 1ANCA 3ZZ3A 3M37A 2UUYA 3BSQA 2BB4A 1GBAA 1C2LA 2PLXA 1C2FA 3RMNH 3RXRA 1PPFE 3TGIE 3FAOA 1H8DH 1OPHB 1V2PT 4BAOB 4E7RG 1GI7B 1NRQH 2SGDE 1O2PA 3SNEA 3VB4A 4CR9A 5CHAC 4SGAE 1V2KT 2UWLA 3LGUA 1SQTA 2HVXA 3NRLA 1HIAB 3LGVA 4VGCC 3M7TA 2Z9LA 3F68H 3CS7A 5TCCA 1C5TA 4GSOA 2A45B 1GHYH 1ZRKA 1BJVA 2O8TA 1YF4A 1A0HB 1C5YB 1O2ZA 3NKKA 3RXJA 4O97A 4TYDA 3PYHA 2GCHF 2GX4A 1DUAA 3PO1B 4U01A 4D8NA 4D76A 1GJCB 4OM9A 1TGCA 4YM9A 3DSPA 2RCEA 1T8NA 1BBRH 4ISOA 1MCVA 1ZSLA 1EB1H 2V3OH 3RXEA 4GCHG 5DN6D 1MTNB 3PB1E 1DANH 2GZ8A 2OBOA 3F2HA 1KXDA 2QE7D 2A32A 1C1UH 1H1BA 4LXBH 3U1IB 2FWWA 3Q3YA 3PRBA 2STBE 4IGDA 4ZKRU 3MH4A 1CGJE 2SGFE 3JZ2B 1P57B 1LKAA 3S69A 1OHHD 1EOJA 1C2EA 3ZZAA 1RS0A 2A4QA 2EI8A 1AO5A 4KTUA 1B0EA 2J2UA 5EPYA 3KL6A 3RXPA 1LKBA 3T2NA 5I46H 5E8EH 1RGQA 1VCWA 1GHZA 2QXGA 3A7VA 1W2KH 3MQKC 1EATA 1ESBA 2ZDKA 2IOTA 1CE5A 1GJ7B 4MVNA 2XWBI 4TPIZ 1P2IA 3OFND 5BRRE 2H5CA 1GBMA 1TBQH 4AFUA 2IJOB 1PYTD 3RMLH 1GPZA 3ATLA 1TMTH 1BJUA 1M9UA 1QQ4A 1VGCB 2I6QA 3UIRA 2ANYA 2WV5A 1O3AA 1NROH 1O5FH 1AD8H 1TPPA 1ZJKA 2JKHA 4ABGA 2ZDVH 2FYQA 1MABB 3GOVB 3GY4A 5HM2A 1C1QA 1HAHH 2ZHQH 1NC6A 2VWLA 4ZHLU 2LELA 1C5XB 3ZZ7A 2OINA 2XWAA 4K2YA 3I77A 1DITH 4AOQA 5C67A 1C1NA 3ZZ9A 1W12U 2ZFTA 3MU8A 1GJAB 1TX8A 5HIYA 5T6GA 3S9AA 4DT4A 1O38A 1OX1A 2PGBB 5EXNA 4K3JA 1FIZA 1WOFA 3O8DA 1H9LB 1SGFG 4MNYA 1ZTLA 1DLEA 1UHBB 1AB9B 1AY6H 5EGMA 4NCYA 4KKDA 2WYJA 1TB6H 4MNXA 2UUKB 4UONA 3RP2A 1PQ5A 5HIZA 3PO1C 3TGKE 2XBXA 1UTNA 3RC5A 1FN6A 4NWKA 1CGHA 3C1KA 1BTXA 1GMHG 1HAOH 1ACBE 1AKSA 3L3TA 1ABIH 3SU3A 2VIVA 1MTNC 3Q77A 5HXFA 2LP6A 4OGXA 1MCTA 3BG4C 3GICB 2FZZA 3QUMP 2F9PA 1UW7A 4X8SH 2ZTZA 2C4FH 3ZYEA 2F9NA 4Y10E 1AWFH 1QNJA 5EQQA 2V0BA 4Y7BA 1ZJDA 2HOBA 1S0QA 4Y11E 1CBWB 1FNIA 4KP0A 1FPHH 2UUFB 1ZHMA 1JRTA 1Z8IB 1YY3A
chains in the Genus database with same CATH topology
3PM3A 3SO3A 3E90B 3BTKE 1V6DA 1WTHD 2G81E 4DW2U 7KMEH 1HAYB 1FAKH 2RDLA 2EEKA 4K5ZA 2H2ZA 2OC1A 3KF2A 2OC8A 1SGEE 2PKAB 1F5RA 1HJAB 1K1LA 4WMFA 3ZVGA 3GY6A 1GI5A 1WQSA 1HYLA 3ATMA 4A7IB 1E38B 4Q2KA 2Y5FA 4ISIH 1YCPM 3QO6A 1E34B 1EAUA 2ALPA 1TQ7B 5A0BA 4CH8B 1SLUB 3ATWA 2CGAA 1P04A 1ZTJA 4AG2A 5L2ZH 3SI3H 1KLJH 4BAMB 4DJZB 1B0FA 3O8CA 2AS9A 2H6MA 2XW9A 3UOPA 4CH2B 4IMZA 4ZUHA 2Y81A 5FCRA 5GIBA 1O36A 2A0QB 2WPKS 3RC4A 4NA7A 1Y5AT 1GI6A 1SPJA 4E05H 1C2IA 1QBNA 4O03A 2CF9H 2ZO3H 4NA8A 2A31A 1O5BB 1ZHRA 5E0GA 2FTMA 1RTFB 1GL0E 2A2QH 4MNWA 1O34A 1N1LA 2F9OA 2ZGCA 3AASA 1O2SA 1MBQA 3KQCA 1DSTA 1BITA 1UTJA 1BTZA 1ABJH 1TBZH 3SU4A 1ELGA 4WY3A 4AFQA 3LOXA 2FOEA 2QGRA 2AIPA 1FONA 2CV3A 1PPGE 3RLWH 4QT8C 3BV9B 1BRCE 1P3EA 4DT7B 3RXCA 1OSSA 1AE8H 1ELBA 1MH0A 2ZPRA 3U69H 1EJNA 1YPHE 3UNRA 1RIWC 1S84A 1L0ZA 1AHTH 2PTNA 3P8OA 1NM6A 1PYTC 8GCHF 1P3CA 3JZ1B 1O3MA 5I25A 1KDQA 1GCDA 3E16B 1YLCA 3SU2A 4JZ1A 3K65B 2PR3A 1K9OE 2BVRH 3RDZA 2VWOA 4BANB 2QIQA 1E36B 1C5MD 1CBWC 2WUCA 5AFZH 4WH6A 4IN2A 1G3CA 1OWDA 1TAWA 3T27A 1V2UT 1ETRH 2Q6DA 3MO6A 2ZHDA 1JRSA 1F5KU 1CHOF 2BXTH 4MQAA 2F9UA 1TX6A 1EZUC 1HAZB 1QJ7B 1C2DA 1O39A 1XUFA 2FPZA 2F3CE 2OLGA 3GCTG 1K1JA 1QFKH 2PWXA 4GVUA 1A3EH 3FANA 2F91A 3M7QA 3SUEA 1UTPA 1FXYA 1CHGA 1HJAC 2FI5E 3T28A 1HLTH 3QK1A 1DX5M 2GGVB 1C2GA 1ZTKA 3RXIA 1UCYE 2J38A 3ODDA 6LPRA 4BXWA 4B1TA 1O2QA 1IAUA 1OS8A 3D49H 1O2TA 5JB9S 4ZKSU 1YPGH 1FIWA 3KN2A 1QA0A 3HATH 5DG6A 2VNTA 4Y7AA 2RG3A 2AYWA 2ZDNA 1ELCA 1O32A 2G4UA 4KGAA 3ZZ5A 1NTPA 4INHA 2SGEE 3PMJA 4BTIB 3ENSB 1JWTA 1C1PA 4FU9A 4CRCA 1O2JA 1O5AB 1MKWK 1TNJA 2XNIA 1TNKA 4NIVA 3SV8A 3A8CA 5LPFA 2RA3A 5ETXA 2G00A 3ZVFA 1N8OB 1J8AA 1DXWA 4GPGA 4Q80A 2PFEA 4CRFA 1RD3B 2ZFFH 2ZU5A 2FOBA 4IMQA 1O2OA 3SW2B 4HTCH 4BXSA 5C3NA 4I7YH 1UCYH 3AVZA 5E2PA 3PTNA 2FOMB 5TCAA 2OP9A 3PMBB 1W13U 2NWNA 4NIXA 4K1EA 4DIHH 1UK3A 3A88A 3MMGA 1MU8B 4YOGA 1GCTB 2ZIQH 4RSPA 4Q7YA 3ZZBA 2C8YB 1THPB 4X8UH 1XUKA 4JYUH 1TRMA 3RXOA 1TWXB 3T29A 1LHFH 3VPKA 1O3NA 3W94A 2G55A 2PSYA 4TPYA 2H9TH 5L6NH 1QY6A 2P3UB 2H9HA 1EASA 4OS5A 1SGTA 3ZVBA 1D9IA 1QRWA 2G52A 4JZFH 3UQOA 1EPTC 3SJKA 2R0LA 2BLQA 1TGTA 5T6FA 1TNLA 1WV7H 1ZRBA 1FPCH 1IHSH 1MKXH 3RXAA 1QRXA 3FP8E 3I78A 4CHAB 5LGOA 4ABFA 3B8JA 1A61H 1DS2E 3K9XB 4X2YA 3L6PA 1QRZA 3RM0H 2ZKSA 1BTUA 1ZGIA 1GJ8B 1G32B 2G51A 2TRMA 1TPSA 3CP7A 2A4RA 1GHAG 2FX6A 2AEIH 5FXLA 3T62A 1DUEA 1GJ6A 1J14A 1NFUA 3OYPA 3O8BA 3FP6E 5FPTA 2H5DA 3LC5A 4JZEH 4MTBA 4X6MA 3KNXA 1UTMA 1MD8A 1V2JT 4WWYA 2TIOA 1QIXB 3DUXH 2C8XB 2EA3A 2ZA5A 3SJ8A 5DKMA 1O3JA 4LOYH 2ZC9H 3ELAH 3B9FH 1VITH 5EG4A 4A1TA 2QY0B 5GPIB 4YESB 1VCPA 4K8YA 3RXQA 1XUJA 3KQEA 2Z3EA 2FODA 1L2EA 3UNSA 4A1XA 3VB7A 1TGBA 1OWIA 4CRAA 3VB3A 3A85A 3V3MA 2ZQ2A 4MLFB 1P2JA 3VFEA 2ZG0H 2CF8H 2B9LA 1BRUP 2QN5T 1ARCA 5EQSA 3GY8A 3P8NA 1WCZA 4J2YB 2BD2A 1W0YH 2QF3A 2SGPE 8ESTE 1JOUB 1C2JA 1Q2WA 1UTLM 2D26C 2VH6A 1CT0E 1C1WH 4Y0YE 5LPEA 1EJMA 1EXFA 2R2MB 2F9BH 4YLQH 4AB9A 2P8OB 1PQ7A 1CVWH 1A0JA 2XYAA 4OS7A 5IDKA 1F0UA 1FJSA 3Q3KA 1BDAA 3TU7H 1GJDB 1TE0A 4ABAA 1O2IA 3PWCA 4XBBA 4ABIA 1YPJH 4ZKNU 2OCVB 2BDBA 2WPMS 2GT8A 3SBKA 2FS9A 1L1GA 1VCQA 3LJOA 4FXGH 2W26A 1GJ9B 3SNAA 1K1NA 3QX5H 3SV9A 1TNGA 3LH1A 3SQHE 1HAIH 4UDWH 2XBWA 2CJIA 4OS4A 1PJPA 1DDJA 3A86A 4FUHA 2GDEH 1G30B 4X8TH 2J92A 1S6HA 3SGAE 4UFEH 1OWEA 1EZSC 2YOLA 1Z1IA 2AH4X 1Z71A 3TJUA 2BD5A 2P3TB 1VJ9U 2M5TA 1E35B 2J95A 4K60A 4ABBA 3URCA 8KME2 9LPRA 1C1RA 1ELAA 1ZR0A 4FVDA 2Z9JA 2AFQB 2ZQ1A 1PPEE 1LVYA 1VR1H 1QCPA 1LMWB 2H9EH 4JYTA 1C5WB 3N7OA 1BCUH 3SJIA 3ATIA 1BUIA 1J17T 5C2ZA 3T5FH 1BZXE 1FY4A 3UQVA 3A7TA 1QB9A 5AF9H 1YLDA 1LHEH 1TABE 6GCHF 3MWIU 2PSXA 5A2MH 1CU1A 1SB1H 1SOTA 1V2ST 3GCHB 1YPKH 4I33A 4UD9H 1ZPBA 3FP7E 2BM2A 2FOHA 1GBHA 1XVMA 1BIOA 2BDAA 1SGPE 3U8OH 3UY9A 4WJG2 4X6PA 1NRNH 1JIMA 5J4SA 1KIGH 5DK1A 1SGDE 1THSH 3AAVA 4AORA 1ELVA 3LC3A 5F8TA 3ZYDA 1S83A 1P2NA 5GCHF 1XX9A 1DE7H 2PKSC 2R2WU 1AUTC 2ZDMA 4XBCA 3VGCC 1P06A 1B5GH 1P9SA 4X1PU 2A2XH 1CA8B 3VB6A 1C1TA 4UFDH 2XBYA 3WY8A 1F5LA 1YP9A 1DWDH 2BY5X 1V2NT 1IQMA 1W7XH 1WTGH 3A87A 1SMFE 3MTYA 1SHHB 3U8TH 2K1QA 4UFFH 2ZGJA 2O8WA 1HUTH 2ZCKP 3BF6H 3MYWA 1QB6A 3HKIB 1FMGA 4XOJA 1GBIA 3UR6A 2BY7X 4FUIA 1UVSH 1FN8A 3KHVA 4WMDA 1AUJA 4BTTB 3F9FA 3DT0H 4YT7H 2GV6A 1MMJN 1GDUA 2Z9GA 3BTWE 4O3UA 5JBTA 1DFPA 2ZFRH 3SOSA 1OXGA 4ZH8A 1PQAA 1TMBH 1V2OT 2ZP0H 4GUXA 1RFNA 2HWLB 3PTBA 4JK5A 4ASHA 2PV9B 2VWMA 4K1SA 4CREA 1A7SA 4Z0KA 1C5SA 2XXLA 2VWNA 1IQFA 4NFFA 3ZZCA 1YCPH 3M5MA 2O9QA 3HPTB 3GY5A 3MH6A 3RXFA 3KQBA 3UWIA 4ZAEA 1QURH 7GCHG 1LTOA 3LH3A 1DVAH 1P12E 1Y3VA 1KXEA 1Z8JB 2BD3A 1UMAH 2Z6BD 4B2AA 5H4IB 3GCHC 5DP9A 1QA7A 4WF8A 1QJ1B 1BOQA 1SGFA 4FU8A 2RA0A 2FIRH 3BG8A 1D6WA 3BEUA 7ESTE 1GHBF 2BX4A 1G2MA 2HNTF 4F4OC 6ESTA 1SOZA 3QZRA 3M3VA 5GWZA 1HGTH 1AI8H 2ALVA 3LIWA 4RKOB 1GGDB 1GDQA 1A4WH 1H9IE 4U32A 1IOEA 1C5UA 3AAUA 1W3CA 1C1OA 2ZCHP 4X6OA 2OC7A 2ASUB 5K7RA 4AX9H 3LT3A 1XUIA 1RXPA 3TNTA 1WYKA 3RU4E 4DVAU 3BTEE 1BRAA 5C1UA 7LPRA 1O30A 2BY6X 3UFAA 3ODFA 5F8XA 1TLDA 1OOKB 3TPIZ 3E3TA 3PLPA 3QDZB 4X2XA 1HNEE 5AHGH 3BTHE 2Y80A 1GJ5H 1NFXA 1O3GA 2QV1A 5GJ4B 1GVKB 1BTHH 4DGJA 4OS1A 3GCOA 1O2MA 1GWAA 2CN0H 1GI3A 1MAYA 3RXTA 2STAE 5EODA 1B7XB 1J9CH 3TJVA 1AGJA 3A8BA 3UPEA 1PPZA 1T4UH 1TONA 4K8BA 2WINI 3TH2H 2PW8H 2NU3E 2G5NA 5EPNA 1J15A 1VGCC 3HKJB 1F0RA 1KLIH 1O3LA 1EZXC 1O2VA 1GMDG 2CHAB 3HGPA 2A4OA 3M3SA 1IQIA 5GXPA 1MAXA 1ZPCA 2BD9A 5A0AE 2VVVA 1HDTH 1NFWA 5FX5A 5C5NA 1O2UA 1TRNA 2VIQA 1LVMA 1UO6A 3OY6U 2DE8A 1C1VH 1P2MA 5ABWA 1LO6A 1BA8B 4X1RU 1C2MA 2FI4E 5C1YA 3U8RH 3IG6B 4B75A 1LDTT 3EQ0H 1CQQA 1CA0B 3U1JB 1O31A 1O2XA 4BNRA 3D65E 1HXEH 3S9CA 3URDA 2C90B 5DP8A 1C5OH 1GHVH 2BQ7B 2A5KA 3SV7A 1OWKA 4GCHF 2ZECA 2FLBH 3LPRA 1KXBA 1AB9C 3BEIB 1G3DA 4FUCA 3V0XA 4CRBA 4B73A 4XSKU 1OWHA 1O2RA 4XFQA 3BTQE 1EZQA 2P16A 1DXPA 1GGDC 1GI2A 4XBDA 2J34A 1BMMH 3SNCA 2BDCA 4Y76A 3SUDA 1Y8TA 1C1SA 1K21H 4NSVA 3NUMA 1C9TA 4F49A 4TY6A 2BTCE 1LPZB 1THRH 1AZZA 2BDYA 4D7GA 3VEQB 1O5DH 4GHQA 3PWBA 4YZUA 3SNDA 3A82A 5B6OA 1VITG 2VGCB 5AVDA 8LPRA 1BBRK 3GDUA 2TGPZ 3SV2H 4E7NA 1P2OA 2AGGX 3NCLA 3Q76A 2Z94A 2GV7A 2YNBA 3SGQE 1NZQH 2W7SA 1DY9A 1P02A 1RTLA 1ESAA 4X2VA 5K0HA 1SI5H 3BEFB 1O5GH 3TITA 1TNHA 4BAQB 4X1NU 1TA2A 3DHKH 1Y5BT 4Q7ZA 3HK3B 6CHAB 2ANWA 3RXSA 4TWWA 1UVPA 2ZDAH 3E1XB 1XXDA 2KAIA 1C4U2 1EB2A 1HPGA 1SLVB 3F1SB 5J4QA 1D6RA 3RXVA 1C4Y2 1ETSH 1H4WA 1XM1A 2ZGBH 3K2UA 4NIYA 1IQJA 1GMCG 2W3KA 3EE0B 3SV6A 3BTTE 1ANBA 3T26A 4X8VH 1O33A 3M36A 1E0FD 2IPHA 1HJ8A 2ODYB 4X6NA 4CRGA 2EC9H 1DY8A 1ZSJA 4X0WU 1IQLA 4M7GA 1W14U 1VJAU 3NXPA 1FQ3A 1XXFA 1BB0B 1G36A 1RRKA 2BVXH 2P93A 1HAGE 4DY7B 4Y71A 2PTCE 4HGCA 2ZI2H 2BXUH 1JIRA 3SI4H 1L1JA 2P59A 3Q3XA 4AG1A 1TGSZ 4YT6H 1OKXA 2JETB 3RXKA 2AGEX 3OTJE 1T8LA 4D7FA 5L30H 4AYYB 1EAIA 3QWCH 1GMHF 2BQ6B 1JXPA 2GDDA 2XCFA 1QL9A 1GVZA 2ZPQA 1C2KA 2B0FA 1KY9A 2O8LA 1HB0B 2BYAX 2THFB 2Y5HA 1EAXA 1UTOA 3F6UH 4IN1A 2D1JA 2FS8A 3S9BA 1OP2A 4Y8YA 1KYNA 1UK2A 4ZHAA 5EU8A 3SJOA 4K1TA 4BTUB 1MQ6A 3QGNB 3QZQA 3QLPH 1QGFA 1BMNH 4KELA 5EW1H 1RJXB 1TPOA 1DICA 2VGCC 4DOQA 1ORFA 1CSOE 1TX7A 1O3KA 1YPEH 2GCHG 1LPGB 4TWYA 3TNSA 4XDEA 4B2BA 4NFEA 2JH5D 4H6SB 1QJ6B 1PPBH 1BT7A 3PMHB 1C5VA 2VIWA 1G37A 3T25A 3ZZ4A 2UWPA 3SN8A 6CHAC 1S0RA 5FX6A 3KGPA 1O3PB 1LVOA 2VINA 1ZGVA 1ELFA 1NRPH 3A7YA 4HZHA 1K1PA 1T32A 1AKSB 2AMDA 1SFIA 1GI1A 1AZ8A 3FVFB 1NU7B 2QYIA 3NK8A 3MU4A 5A8YA 2OTVA 5GDSH 4X1QU 1Y3XA 1SVPA 4UFGH 3TK6A 3IWMA 1ZMJA 1W8BH 3A80A 3LONA 5L2YH 2A7JA 4ISNA 4I8LA 1FY3A 3ATKA 1NT1A 2JETC 4ZHMU 3DA9B 1SC8U 1TMUH 3BIUH 4GLYA 3SU6A 2GP9B 3DFLA 3M5LA 1GVLA 1HRTH 1XUGA 2SGAA 3BTME 2PHBA 1YYY1 4OS6A 5G4BA 3RXLA 1O37A 4AFZA 2BD4A 1N8OC 5CMXH 4VGCB 1Y3WA 2GT7A 2OQUA 3MI4A 4BAHB 1MTSA 1P09A 3H7OA 3LGWA 4KTSA 4ZMAH 1V2QT 3M35A 4SGBE 3RXHA 2CXVA 2FXRA 5T3HA 1HXFH 4DG4A 1UJ1A 1GG6B 4J1YA 4B74A 2Q6GA 2QAAA 3E8LA 1S5SA 1INCA 1BTPA 2A5IA 1D4PB 4AGJA 3A81A 3RXDA