4MPXA

Human beta-tryptase co-crystal structure with [(1,1,3,3-tetramethyldisiloxane-1,3-diyl)di-1-benzothiene-4,2-diyl]bis({4-[3-(aminomethyl)phenyl]piperidin-1-yl}methanone)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
242
structure length
242
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase alpha/beta-1
publication title Target-directed self-assembly of homodimeric drugs
rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 52
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2013-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mpxA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4mpxA01
3UR6A 3QO6A 1BMLA 1QRWA 1QY6A 1G3BA 2Y7XA 4I7YH 3UQVA 1UK2A 3EAJA 3KGPA 1HDTH 1ZTKA 1VZQH 1TGTA 1F5LA 3A86A 3ELAH 4CBNA 2JH5D 4I8GA 3L3TA 1O3AA 2O8TA 4X2YA 4IC6A 4CRAA 4B74A 2TBSA 3HK3B 4ESTE 5HYOA 1ESAA 1FPHH 5C67A 3LONA 5A2MH 2ANKH 2BHGA 1JMOH 1RIWB 5HM2A 1QJ1B 3ZZDA 3ZZ5A 3GY5A 1CBWB 1HB0B 2AS9A 2FM2A 3NCLA 1O2SA 4X1PU 2HOBA 2TPIZ 3SHCH 1O3GA 2ZFFH 1RJXB 1GHXH 1TWXB 1EAUA 1LHFH 1H4WA 3ZZ9A 1FPCH 1IHTH 4BAHB 2Z9GA 3A7TA 4KGAA 3M35A 1GMDG 3OX7U 1AVGH 2BDAA 4SGBE 3M3TA 2UWPA 3S9AA 1HAOH 1QGFA 1Y59T 1HBTH 1S85A 3DHKH 1VGCC 5FCRA 3TVJB 1VR1H 3ZVFA 1ETSH 2H5DA 4Y71A 2WPJS 5SGAE 1EUFA 2ZO3H 1TIOA 2AYWA 5FX6A 1CHGA 1KSNA 1TX8A 3SU1A 1GGDB 1T31A 3E3TA 2AMPA 3LC5A 3STJA 8ESTE 2ZHWH 1P2KA 3KCGH 5C20A 1ELAA 1ZHMA 1BIOA 2HPPH 1C2IA 1O31A 5HM9A 1TX6A 2BY5X 1H8DH 3EA7A 2Z9JA 4UD9H 5EG4A 4D7FA 4XBCA 1J9CH 2AGIX 2BMGB 1XKAC 1HAXB 3VEQB 1GVLA 1EJMA 1MH0A 1SGRE 2ZA5A 1IQFA 2GV6A 1LPZB 2A7CA 1TPOA 4MPXA 5EQQA 2B8OH 4U32A 1GCTB 4KTCA 2WPLS 4ABFA 3ZZ3A 2PTNA 2TGTA 2B7DH 2A2QH 1KXFA 1T8OA 1O5EH 1AQ7A 2A7HA 1YGCH 1GI6A 3LGVA 1QB9A 2R3YA 4JYUH 1A0JA 1YPEH 4WXIA 4A1VA 1C9TA 3STIA 1JIRA 1GI7B 3FP6E 1XXDA 2OP9A 4MPWA 1G3DA 3UR9A 2FPZA 3QWCH 1AO5A 6ESTA 3ZZBA 1Z8RA 1DXWA 2BY6X 1C1MA 3BG8A 4ABEA 1UTOA 2XBWA 2QA9E 1MKXH 1ZRBA 2PTCE 4AGJA 1PQ5A 1C9PA 1OX1A 4U30A 7LPRA 3B9FH 1O2QA 3RXCA 3SV2H 3D23A 1V2JT 1HJ8A 1P9UA 1WTHD 2ZHQH 2Z9IA 4AX9H 1LVOA 1HJAB 3FVFB 4CR9A 4AORA 5DP4A 1V2NT 1Z1JA 1PQ7A 1D3QB 1T32A 5B6OA 1BBRH 2WPKS 2GCHG 4ABDA 1K1JA 4AG1A 1C1WH 1MQ5A 3MO3A 4RN6A 1MKWK 5BRRE 2FOGA 4F4OC 2F83A 2C8ZB 1MUEB 1O3IA 1PPHE 3I77A 1SVPA 1T8NA 3VGCC 3SNBA 1P2IA 4AYYB 1HAYB 2FODA 2GV7A 2BD8A 3KL6A 2PLXA 1BJUA 2GCTC 1W8BH 1C5UA 3K6YA 2CHAC 3SUEA 4DY7B 1SLUB 4MG3A 1ELFA 2Y5GA 1C1TA 1HAIH 3RMOH 1YPHC 4Y8ZA 2FEQH 1O2NA 3E90B 1BRBE 3SU0A 1TNGA 1GI4A 1UCYE 1NRPH 1Z6EA 2BZ6H 2QXIA 3SZNA 3GCHB 5HMAA 2PHBA 2FMJA 1BMAA 1DWCH 1GJ7B 1C1UH 2ZG0H 1Z8GA 3L6PA 4OGYA 3SNAA 3RUOA 4IS5A 3A88A 4IMZA 4NFEA 1EP5A 1GI5A 3EGKH 2VJ1A 3RXSA 2QGRA 1FAXA 4AB8A 3RMLH 4X6OA 3NK8A 2G51A 4NZQA 1GI0A 4HI3A 1CGHA 1OWHA 3O8CA 1O5AB 2FYRA 2BOHB 1G2LA 3HGNA 2ANYA 5AFYH 2FYQA 1K1LA 3EYDA 4YT6H 2A1DB 3OTJE 1HAHH 1YPMH 1SL3A 3MH5A 1NFXA 3ATWA 1VCQA 2LNCA 1OP8A 3BN9A 1MD7A 3MO9A 1XX9A 4Y76A 1G3EA 1GI1A 2BLWA 1ZTJA 1UHBA 3QTOH 1HFDA 1KLIH 3M36A 1BB0B 3TK5A 1FUJA 1TB6H 3C1KA 1HAZB 2B5TB 2ZFSA 1ESBA 1DLKB 5A0CA 2SNWA 1C5TA 1QA0A 3S9CA 2OTVA 2PSXA 1AB9B 2AEIH 3BTHE 2FOMB 2C93B 1HUTH 5C5OA 2P8OB 2W3KA 2ZC9H 1L4ZA 1VITF 2GZ7A 4ZUHA 1GHWH 4NWLA 1ELCA 2DE8A 2NWNA 3KQBA 1B7XB 4O3TA 3GYMA 2C90B 1Q3XA 4UONA 3FZZA 2FTMA 4MNWA 4X0WU 2PR3A 1QJ7B 4DG4A 1NRQH 1T4UH 4AGKA 1CO7E 3Q00A 3O8BA 3EDXB 1W12U 6LPRA 3TH3H 2DE9A 1O30A 3PWCA 3E0PB 2BLOA 2CN0H 3GY4A 5DPAA 3EA9A 4GSOA 1C4V2 2V0BA 3RXOA 2C4FH 3HATH 1W3CA 3SNCA 3MI4A 3RXVA 5E0JA 1LPKB 1GJ6A 2VVUA 1TNLA 2G55A 3T27A 1NM6A 1NPMA 1MTVA 1P57B 1IOEA 3S7HB 1H1BA 1O5GH 5HXFA 1EPTA 1OXGA 4IN2A 3A8CA 3LJOA 2W7UA 4M7GA 3PROA 1ZMLA 3UUZA 4NIVA 3BEUA 4GHTA 3T26A 1KDQB 4Q7YA 2RA0A 1O33A 1W7XH 1MQ6A 4A5TS 1SFIA 1TRMA 5GJ4B 2PFEA 3P17H 4Y8XA 1HYLA 4HZHA 1EZQA 4KP0A 1QJ6B 1TGSZ 1PPZA 1FLEE 1E38B 3UFAA 1MTNC 1QBNA 4FUDA 1ZHPA 1SLWB 2BVXH 2HNTF 2TIOA 7GCHF 1GHZA 1KTTB 3P70B 3S9BA 2WPIS 2ZTXA 4ZAEA 2VGCC 1UVOA 1O3FA 3NXPA 1QBVH 8GCHF 1C1PA 1DX5M 1WTGH 3U9AH 4OS2A 3LGTA 1SLXB 2XBVA 1YM0A 1OYQA 3KHVA 3PO1C 4X2WA 3PMAB 1PPFE 1K1IA 1SFQB 2CJIA 2UUFB 1TA2A 4FUIA 1ESTA 1SGCA 2FS8A 1Y3YA 1GMCF 1BTXA 2J4IA 3QGJA 1FMGA 1C5QA 3B8JA 3M3VA 3GY6A 4Q7ZA 4E7RG 2FOEA 1C2EA 3GDUA 3D62A 3UQOA 2BVSH 3LGIA 4LK4A 3SHAH 5HGGA 4Y79A 3RXUA 4JYVH 3HGPA 3RM0H 3OYPA 1P2MA 3I78A 1FIWA 2C8YB 2WYJA 4I8KA 1GBAA 1TNHA 1SQOA 1GWAA 4OGXA 2GMTC 1C5LH 1CE5A 4R8TB 3TPIZ 3U8RH 3SJ8A 1C2LA 1S6HA 4NZLA 4CHAB 4CRDA 3P95A 1TABE 3TJUA 1ANEA 2BXUH 2A4GA 1GBHA 1NN6A 2AIQA 1QQUA 3MOCA 1GJ8B 1O36A 3MHWU 3EQ0H 5FCKA 4UE7H 1TYNA 1NTPA 2PKAA 1ZPBA 1PPBH 2D1JA 2FZZA 1G9IE 3LIWA 1O37A 2BDYA 2UWOA 3UOPA 3RMNH 2VIDA 1SGFG 1V2LT 2KAIB 3GCNA 3MH6A 5EXMA 5L2YH 2BDIA 1JRTA 1GBBA 1LHEH 1Y8TA 1OKXA 1NFWA 4D9QA 1J14A 3ZVBA 1HJ9A 1CGIE 2G4TA 5JB8S 1EZUC 1YCPM 3PM3A 4NG9H 2BB4A 2XC4A 2HPQH 3OSYA 1GG6C 4AFSA 4I32A 4X6MA 3RU4E 1P03A 5EPNA 1PQ8A 2P3TB 1HIAA 1C5VA 1EKBB 2Y81A 3QDZB 1QRXA 3Q3YA 1XUKA 4BAOB 9LPRA 5FXLA 2GZ9A 1W11U 3F9HA 3S7KB 1PQAA 1DOJA 3ODDA 1HAVA 4AYVB 1CA8B 4Y10E 4FU8A 1THPB 2G8TA 2QC2A 1N8OB 1UVTH 5EU8A 2SGQE 2OUAA 1OYTH 2ZU1A 3ZZ8A 3CS7A 2A5KA 1ZTLA 1Y3VA 1SHYA 1DE7H 5E0HA 3AW1A 4BAQB 1GBKA 3HPTB 3PWBA 2VWOA 3PLBA 1GDQA 3HKJB 2OCVB 4Y8YA 1FDPA 2BY7X 4MLFB 1P02A 2Y82A 4D8NA 2ZPSA 2O8MA 3KEEA 1BT7A 3ATKA 4AOQA 3SUDA 3QZRA 1B5GH 1W2KH 3RXJA 1ANDA 4ABIA 1O3EA 2FOBA 1FY5A 1JBUH 3RC5A 1K1OA 1AZZA 4E05H 3S0NA 2FESH 3GDSA 3DA9B 3KN2A 5ESBA 1C2GA 1FN8A 2ZHEH 3LGUA 1V2VT 4CR5A 2BD7A 5EQRA 2EEKA 3C27B 3PV4A 1QL9A 5TCCA 5IDKA 1YPLH 4INKA 4ZXYH 3TNSA 1TMBH 2HLCA 5ETXA 4JZIA 2IOTA 2P16A 2P95A 3R3GB 1UTLM 2ZFRH 1THSH 1SHHB 9ESTA 1AE5A 4ZMAH 2V3HH 1GMDF 1O3JA 1QBOA 1GGDC 5DP8A 3BV9B 2A32A 5F8ZA 4MTBA 3ZZ7A 2P93A 3A7ZA 5FAHA 1E35B 3TGKE 3Q76A 1LQEA 1OS8A 1Y3UA 2ASUB 4NWKA 3H5CB 3UREA 4IW4E 1S5SA 1O3DA 1O3MA 1O5BB 2BDHA 3GY2A 1XKBC 3N7OA 3OY6U 2Z3CA 3E0NB 3MH4A 2OINA 2A4QA 5FBIA 4DOQA 1AZ8A 4GHQA 2G5NA 1GJAB 3V0XA 3A7XA 2XBYA 1P8VC 1KIGH 1WCZA 1TGNA 2P94A 2CMYA 3ATMA 3UNRA 2WV4A 4ZKRU 4CRGA 1V3XA 1WV7H 3URDA 5I46H 1C5WB 2CXVA 5CMXH 4E06H 1O2KA 4NA9H 1DLEA 3V12A 3RXMA 3RP2A 3O8RA 1DSTA 1O2VA 2BY8X 2EC9H 2ZECA 2W26A 1DY9A 2O9QA 5GPIB 1WYKA 2ODQA 1FZZA 2D2DA 2FI3E 3GICB 4SGAE 1GMHG 1VCWA 1Y3WA 4IMQA 3LDXH 3RXKA 1F0UA 2HRVA 2VB0A 2V3OH 1F0TA 4K1SA 4DIHH 1UJ1A 1S82A 3TJNA 2JETB 2ZFPH 3FAOA 3RXEA 3PMBB 2R0LA 3BTQE 1HJAC 4ZHMU 5GCHG 1SOZA 2AGGX 1L1GA 1ANBA 1U6QA 2BD5A 2FXRA 5GWZA 1DVAH 3SBKA 1A3BH 2VVCA 4GPGA 2GDDA 2XBXA 1WQSA 1O5FH 3MU5A 1C1QA 2Z9LA 1YCPH 3RXGA 1MCTA 1HRTH 2ILNA 4B2BA 3B23B 3E6PH 2GCHF 1WSSH 2QF0A 2BLVA 4X6NA 3TH4H 1C2DA 1BHXF 5C2ZA 2W5EA 1EQ9A 2IPHA 4NGAH 1TALA 5DP6A 1Z71A 4XBBA 1K2I1 1N1LA 2P3FH 4UDWH 3ITIA 4XFQA 3TITA 1WUNH 3LPRA 3QLPH 1ELGA 1KXDA 3BTWE 2ZCLP 3QUMP 5GXPA 2I6SA 2NU1E 1A4WH 1BDAA 2OC1A 3GCHC 3SJ9A 2F9VA 2ZGBH 1RFNA 3NUMA 5EW1H 3AAVA 1ZRKA 1G3CA 1RD3B 1F0SA 1F0RA 3BTKE 3P6ZB 1V6DA 2FIRH 2FX4A 3U1IB 4J1YA 1IQKA 1DY8A 2CF8H 1GVKB 4VGCB 1LKBA 1P01A 3RLYH 4CH8B 4XDEA 1A2CH 4TY7A 1ORFA 1PPEE 2Z94A 4H4FA 1P05A 2XTTB 3A84A 3GDVA 4XOJA 1G36A 1ZGVA 3NPSA 1TLDA 1SLVB 1NZQH 3G01A 4GCHG 3TK6A 1AUJA 3OY5U 4WMFA 3BTGE 4KKDA 1TNKA 5GIBA 4B75A 1Q31A 1CHOG 1C1RA 2FI5E 3P8GA 2FP7B 3SW2B 1GJCB 5E8EH 1YF4A 3KQEA 7ESTE 1OWDA 3AASA 2ZU5A 4YM9A 3BTDE 2W3IA 3A7YA 5TCAA 2C8XB 2QF3A 3ZVEA 4B71A 1BITA 1BUIA 1AKSA 1DPOA 3PMJA 1V2ST 4JMYA 1SGEE 4JZ1A 1AB9C 1LTOA 3V7TA 4BTUB 2OC0A 2BDGA 1HLTH 1LDTT 1SGTA 4Y0ZE 1A5IA 2P3UB 4FXGH 4AZ2B 3MU1A 4B73A 1GI8B 1TA6A 1W0YH 2GD4B 1AWFH 1WQVH 4TPIZ 4RSPA 1W14U 2OC8A 4ZKNU 1O38A 1RTKA 1O2YA 1AUTC 1CA0B 2ZDAH 1TQ7B 1VGCB 2RG3A 5DP3A 2ANWA 1EJNA 3BG4B 5LH8A 1LPGB 2PV9B 1IQNA 4FUJA 2TGDA 5DP9A 3BTTE 4FUGA 3SV9A 2CV3A 3MMGA 2D26C 3NZIA 3MH7A 1ZJDA 1NFYA 2J9NA 1V2TT 8KME2 5JBAS 3RXHA 1RRKA 2ZHDA 2Y5HA 1P10A 2OQ5A 2PGQB 2BX4A 1O32A 2STBE 1BHXB 1J17T 1BTZA 1T8LA 4LOYH 3T29A 1C2HA 3RXIA 3GYLB 2ZU2A 3F68H 1QIXB 4ISIH 5AVDA 1DANH 3SV8A 5A8YA 2PKSB 2J38A 1RGQA 3TJVA 1C1NA 1LKAA 1IQGA 4IBLH 1ELDE 3F9FA 5F8XA 1SQAA 1GBFA 3QGNB 2XC0A 1NRSH 1SBWA 1N6YA 2J94A 4X8VH 4YT7H 1Y5AT 2YNAA 2J2UA 1Z1IA 2JKHA 1GDUA 2Z7FE 3TIUA 1W10U 2BD4A 3MU8A 1ELVA 1P2QA 2GP9B 2AGEX 3RC6A 4ABBA 4CBOA 3A8AA 1OWJA 2M5TA 5A0AE 4BAKB 2EI8A 5EODA 5CE1A 2P59A 2H6MA 1S0QA 1QRZA 4ZHLU 3RU4D 1UHBB 1YPKH 1P11E 2AERH 1EX3A 4DCDA 1W0ZU 3P92A 2G00A 1PJPA 1YKTA 1BBRE 3A7WA 1F7ZA 4DURA 3DD2H 3PYHA 3RXDA 5JB9S 2ZZUH 1EAIA 3SU6A 1C2KA 2FLBH 1GBTA 1GJBB 2GVFA 1FIZA 3TGJE 3E1XB 3GCTG 1V2PT 5ABWA 3BF6H 2QYIA 1P0SH 1H8IH 3GY8A 3VGCB 5C3NA 5JPMH 1UK3A 1OP2A 1MAXA 1AU8A 1P2OA 2B0FA 3LC3A 3FP7E 4CHAC 1GHBG 1ETTH 1D9IA 3VB3A 1A0LA 4K1EA 3KF2A 1D3TB 1SGQE 2Y6TA 1UCYK 1EAXA 1UMAH 1OP0A 1O3KA 3UOUA 5EXNA 3O8DA 4UFGH 3U8OH 3GISB 1AFQC 4FUHA 3UPEA 1C2MA 4X8UH 1C2FA 3A87A 3LGWA 3QX5H 1HXEH 5I25A 4ISOA 1NY22 1DUAA 1TQ0B 1O0DH 2AIPA 3SI3H 3LH3A 4ZKOU 1SGNE 2SGEE 2VIOA 1O3CA 2WV5A 2Q6GA 4X8TH 2ALPA 1C1VH 2ALVA 5L6NH 2GTBA 1AN1E 1ELEE 1EPTB 1QL7A 1LMWB 1SSXA 2A0QB 2GX4A 3A8DA 1BRCE 4U01A 4ASHA 2Q1JA 1W7GH 3BEIB 4BXWA 1HGTH 1TFXA 1TNJA 4GAWA 1S81A 3CP7A 3NKKA 3SU2A 2FI4E 2BLQA 3BTEE 1SG8B 3RXLA 2R3UA 1DT2A 5TJXA 2ZQ1A 1C5NH 2ZDNA 3M5NA 3H7TA 3F1SB 3Q77A 2ZGXH 1H9HE 4TPYA 2AMDA 1AY6H 3TK9A 2BD9A 1N8OC 1NRNH 1XUIA 1K1NA 4ZXXH 3SU3A 1MKXK 3T25A 1ZR0A 4UFDH 1T4VH 4YESB 3UNQA 3ZV8A 1L0ZA 2QAAA 3K6ZA 1BOQA 2BX3A 1ELTA 1A0HB 3VB7A 3ZZ6A 1E0FD 1S6FA 2H2ZA 2FS9A 2DUCA 2A4OA 1BBRK 3P8NA 1TNIA 2TRMA 1KY9A 5K0HA 2QXGA 2NU4E 2G5VA 4WXVA 1ZMNA 3LT3A 4O3UA 1XUFA 2FDAA 4K8BA 3KNXA 4HGCA 1CSOE 5FPTA 3URCA 1EZXC 1UO6A 1DWDH 2F9UA 3FFGA 1O2HA 4I33A 3FZDA 3M7UA 1FY4A 4X1NU 1EAWA 1V2KT 3H7OA 4CRFA 3A81A 3UY9A 5AFZH 4WMEA 2GT8A 4K8YA 6GCHG 1C5PA 2RCEA 3QTVH 1EOLA 3V3MA 3I29A 2V35A 4B76A 2Z3DA 5CHAC 1XUGA 5G4BA 1GBJA 4B2CA 4Z6AH 2ZCKP 3W95A 2PKAB 6CHAB 1GI3A 1AWHB 2ZFQH 1TOMH 3M7TA 2HWLB 3ODFA 3T5FH 3MO6A 3ZVAA 4TY6A 5FPSA 4X6PA 2CGAA 3V13A 2BXTH 1J8AA 4WY3A 4YZUA 3SJKA 5DK1A 3ESTA 1MBMA 3MFJA 4CRBA 2GDEH 2O8LA 4HFPB 4WJG2 2A5AA 2XWAA 4HTCH 3SNDA 1SC8U 3LGYA 4ISHH 1PFXC 4MNYA 1BTYA 2F9OA 4F49A 2EI7A 3HKIB 2BYAX 4TWYA 1HIAB 3U69H 1GPZA 1SGFA 5E0GA 1O39A 1O3LA 4O9VA 1ARCA 3ENSB 1O3PB 1ACBE 1GI2A 5H4IB 3VFEA 1HAVB 4NIWA 1VJAU 3LOXA 1JRSA 1GVZA 1S84A 2XRCA 4DT7B 2QXHA 1MBQA 1IQMA 1RIWC 2Z6BD 4ISLA 1AIXH 2VNTA 2RA3A 1CBWC 2JETC 1AFEH 4XBDA 3M61U 5T6GA 1GHYH 1GMHF 2HGTH 1XVMA 1MKWH 5DO4H 4YTAA 4Q7XA 3ZZ4A 1MU6B 4CRCA 2ODYB 2EI6A 4JZEH 1O2XA 3SU5A 4O03A 1K1MA 4YLQH 4ABGA 1XUJA 2F3CE 5GCHF 1KLJH 1OWKA 1KXAA 3RXAA 4DIIH 1PPCE 1TPAE 5BPEA 2GGVB 5JYIA 1DWEH 1UTJA 8LPRA 3GOVB 3F9GA 1YLCA 4INHA 1A5GH 4Y7AA 1TBQH 1KYNA 3T2NA 3E16B 3SGAE 4D9RA 4K5ZA 1TGCA 2J34A 1SGIB 1UTKA 4BTIB 1TRNA 1OPHB 2OLGA 2BOKA 1T8MA 1LQDB 1ZSJA 1S83A 1HAPH 1TONA 1QL8A 1ELBA 2FWWA 3D49H 4MVNA 1CGJE 3QZQA 3TU7H 2A5IA 3IG6B 1EP6A 1V2QT 2WPMS 3ATIA 1GHVH 1BRUP 1GCTC 4NCYA 2O8WA 1TPSA 5C1UA 1X7AC 1UVUH 1AMHA 3EA8A 5L30H 1H9LB 1O2JA 3RXFA 4AN7A 2GT7A 1O2MA 3M37A 4VGCC 3SQHE 3SUFA 1AI8H 5DG6A 1A5HA 2UUJB 1DXPA 4LZ1H 3RXTA 4B1TA 3R0FA 3UWIA 1BQYA 2BVRH 1LHDH 2PUQH 1AVXA 1O2WA 1MTWA 3M5LA 4Y11E 2F9BH 4WF8A 2UUYA 1O2UA 1RXPA 5EXLA 2SGDE 1E34B 2VIQA 5DP5A 2ESTE 3A85A 4MDSA 2QXJA 4YOIA 1CQQA 3HK6B 4ABJA 4K69A 1FONA 1MAYA 1WU1A 4GCHF 3GY3A 4KTSA 4RKJB 3UIRA 2C3SA 1HCGA 1QNJA 2ZNKH 1ZLRA 4XE4A 2GZ8A 1CHOF 1KXEA 1SQTA 2D8WA 2SFAA 1UTMA 4CREA 4WH8A 4JK5A 5JBCS 1RTLA 2J92A 1XUHA 2BDBA 4UFFH 2VINA 1DITH 4LZ4B 2JH0D 4NIXA 5C1YA 5A8ZA 1GBCA 3F6UH 1B0FA 1D3DB 3W94A 2ZTYA 3PTNA 4AFUA 1KXBA 1CA0C 1MTSA 4WH6A 5J4QA 2BZAA 3PLKA 3VB5A 4FUEA 1CT0E 1FQ3A 1QB1A 4R0IA 1ETRH 1RTFB 4FVDA 4Y0YE 3DFLA 1G37A 1UCYH 1ID5H 1TMTH 3BG4C 1YPJH 4K1TA 1L1JA 1JIMA 3RXRA 1SPJA 3BTFE 4XSKU 4BOHA 3VXFH 2QCYA 4JZDH 4YOJA 3QK1A 1QA7A 1C5OH 2FOHA 1UK4A 1IQEA 2C8WB 3ZYDA 3MNBA 1Z6JH 1MD8A 4NSVA 5K7RA 3UNSA 2XCNA 1P2NA 2O8UA 4GVUA 1C5ZB 3UWJH 3BEFB 1UVSH 2HNTE 1LVYA 1LO6A 4NFFA 2Q6FA 4DW2U 4X2XA 4BNRA 4X1RU 2WPHS 2VIPA 2PKSC 2PW8H 1CT2E 1V2RT 2Y7ZA 3SGQE 3VB4A 2ZQ2A 4FU7A 1GCDA 1S0RA 4QT8C 1BA8B 1PYTC 2ZI2H 5F8TA 1F5RA 3CS0A 1Q2WA 2BM2A 1P09A 5FPYA 3RLWH 3TGIE 1SMFE 2K1QA 2XNIA 2A31A 4YO9A 3RMMH 5JBBS 3RXQA 1A1RA 3TJOA 1BZXE 1ZSLA 1GBDA 3PMHB 1BTPA 2WINI 2ZKSA 1P12E 1JWTA 4PROA 1MU8B 4Y7BA 3RM2H 1BRAA 3ATLA 2UWLA 3A8BA 1QB6A 4H6TA 2ZU4A 1OWEA 1EASA 1IHSH 4I8HA 2Y80A 1TAWA 2R9PA 1C4U2 3MWIU 2P8OC 1LVBA 1GBIA 1IQIA 4RKOB 1ABJH 3K9XB 2F91A 4A7IB 4K60A 2R2WU 1TE0A 2R2MB 3BIVH 1FY1A 1AKSB 1O3OA 3DT0H 1EB2A 4FU9A 4INLA 3MNXA 1TPPA 1GDNA 4NIYA 2NU2E 4BTTB 2H1UA 2OQUA 1KXCA 2VU8E 3IITA 4A6LA 3M3SA 1FXYA 1O3NA 1ZSKA 3SV7A 3P8FA 5DGJA 5LPRA 1LCYA 5FX5A 2VH6A 1QTFA 2PSYA 1C5XB 1VJ9U 1K9OE 4IN1A 4JZFH 1A61H 3AVZA 3NWUA 4FUFA 4H42U 4OS6A 3GCTF 2ZEBA 2TGPZ 3BIUH 1NFUA 2GKVE 2VVVA 1JXPA 4A1XA 1QQ4A 3A80A 1MZAA 2BQ6B 2BQWB 1QFKH 1G30B 1P2JA 2BTCE 1DSUA 3SJOA 1GHBF 2ANMH 2Z9KA 4D7GA 4B2AA 3EE0B 1FJSA 2OD3B 5EGMA 2XCFA 4KTUA 1XXFA 3U8TH 4MNVA 1BCUH 3U98H 4BANB 4TYDA 5DJ7A 3VPKA 1A3EH 5JBTA 2WUBA 4X1SU 2QIQA 2STAE 3OU0A 1O5CB 4A92A 1NC6A 2VIWA 3SUGA 1EPTC 2ZCHP 2ZPRA 3F9EA 4FUCA 1O2IA 2ZFTA 1FY8E 4OS4A 4YOGA 1PPGE 4X2VA 3U1JB 1SGYE 2NU3E 1PYTD 2OBQA 1HAGE 1Y5UT 1ZMJA 3ZVGA 1KLTA 1N6XA 3FP8E 4DJZB 2CF9H 2RDLA 1GHAF 1NRRH 1A46H 1Z8IB 1WOFA 1CT4E 2G4UA 4D76A 1SI5H 1SGPE 3JZ1B 4WMDA 2A2XH 1DICA 1YLDA 2H9TH 1XM1A 3K65B 1Z7KA 3RXPA 5ESTE 1JOUB 1K1PA 2XYAA 5DP7A 1J16A 1DWBH 4WWYA 4ZKSU 4OS7A 3SV6A 4ZHAA 1DUEA 3IWMA 1MMJN 1P04A 3DUXH 3SOSA 2B9LA 1AE8H 2VWMA 1NU7B 2XW9A 5EQSA 2OXSA 4UFEH 1AD8H 4LXBH 1GJDB 4DGJA 5A8XA 5LPEA 2A4RA 3LH1A 2Z3EA 2XXLA 3M5OA 3JZ2B 5A0BA 3L33A 1K22H 1BMMH 2FOAA 1O35A 2ZDMA 1YPGH 1TGBA 2SGAA 3LJJA 1TBZH 1C4Y2 3Q3XA 5C5NA 1YCPK 1C5RA 5E2OA 5EW2H 2AFQB 2GCTB 2CHAB 5A09A 1CU1A 1NS3A 2OBOA 4MQAA 2VH0A 4NA8A 5J4SA 3LU9B 1A7SA 2FO9A 1KTSB 1DFPA 3T62A 1O3BA 4Y6DA 3SQEE 1D4PB 1Y5BT 3AW0A 2SGFE 4I8JA 1P3EA 2EA3A 5F03A 3ZZAA 2AMQA 2HALA 1YC0A 4Z0KA 1K28D 2PWXA 2H9HA 4X1QU 4CH2B 4X8SH 1KDQA 1SB1H 2A45B 3E91A 1ZJKA 4E7NA 1GHAG 2JH6D 5LGOA 6GCHF 1QR3E 6CHAC 2QY0B 4MPVA 4JK6A 1GBEA 1HXFH 2BY9X 2ULLA 3PB1E 1BTUA 5GDSH 3RDZA 1LHCH 1BJVA 3PLPA 4IGDA 3RXBA 1F2SE 1IQLA 4I31A 4U2WA 3UTUH 5E2PA 5C1XA 1AVWA 1O34A 1W13U 1G32B 1SGDE 4ZROA 2ZGJA 4Q2KA 2BQ7B 1ZZZA 1FAKH 1ANCA 2Q6DA 1MZDA 4AG2A 1IAUA 1VCPA 1TBRH 3K2UA 1C5MD 2ZWLH 1V2WT 5EPYA 1NO9H 1WBGB 1QHRB 2ZDKA 1OOKB 3VB6A 1F5KU 2IJOB 1HPGA 1VITG 5AF9H 3PTBA 3MYWA 1NESE 4BXSA 1UTPA 3A82A 1EZSC 3A7VA 4ABHA 1C1SA 1QCPA 2ZU3A 1LVMA 1DS2E 3E8LA 1G2MA 2F9NA 1D3PB 1L2EA 5PTPA 4FUBA 4O97A 1P06A 2BD3A 2J95A 2HNTC 2Y5FA 2ZF0H 1AHTH 1O2LA 2UUKB 2THFB 1ZHRA 2ZIQH 3DFJA 1RS0A 5LPFA 2FOCA 1WAYB 2QN5T 2IN2A 1EJAA 2QV1A 3SN8A 4YLUA 1L1NA 1D6RA 1FI8A 2VWNA 4BAMB 1MTUA 3MU4A 3A83A 1OSSA 1M9UA 2ZTZA 4ABAA 3KQCA 4TWWA 2ODPA 1TX7A 4GUXA 1T7CA 5F6MA 7KMEH 4OS1A 4DVAU 1ARBA 2BDCA 3LKWA 3RC4A 1OWIA 1P3CA 3ZV9A 2ZP0H 3SGBE 4A1TA 1GJ5H 2KAIA 2PGBB 1QURH 1EATA 4OS5A 4AFZA 2VWLA 4AB9A 3ZVCA 3ZVDA 1O2RA 2LPRA 4J2YB 5FBEA 1AFQB 1TOCB 1GJ4H 5FHTA 1C1OA 5DKMA 1FN6A 1YYY1 1BTHH 3M7QA 3FANA 1HV7A 1GI9B 5AHGH 3QN7A 1B0EA 1HNEE 4Q80A 4THNH 1C5YB 2WUCA 1AGJA 3ZYEA 3SJIA 1EB1H 3T28A 4FVBA 7GCHG 3GY7A 4K3JA 2FLRH 1SOTA 2VIVA 5T3HA 2H5CA 3RU4T 1MTNB 1BMNH 4NSYA 3SO3A 8GCHG 2YOLA 1C2JA 1GL1A 2AH4X 1TRYA 2FX6A 1O2ZA 4K2YA 1GL0E 2ZHFH 1GBMA 3A89A 1IQJA 3MTYA 2VGCB 3SORA 1UTNA 2FTLE 1O2OA 1GMCG 2H9EH 2XWBI 1ABIH 4KELA 3ZZCA 3MU0A 4JYTA 1P9SA 2XC5A 1DM4B 1NROH 4GLYA 3PO1B 1CVWH 2ZGCA 1GBLA 2PUXB 1VITH 3M5MA 1O3HA 1XMNB 3TNTA 2W7SA 5JDUB 1C5SA 1FV9A 1YPHE 3D65E 2TGAA 1XVOA 1L4DA 5IYTA 1F92A 4MNXA 3Q3KA 3MNCA 4MPUA 4I8LA 1EOJA 2A7JA 1GJ9B 4IC5A 1E37B 1ZPCA 2I6QA 3SNEA 4WVPE 2SGPE 2G52A 2WYGA 5L2ZH 3BSQA 2F9PA 1J15A 1V2MT 1IQHA 3GCOA 1YP9A 2GMTB 2R0KA 3KIDU 4NA7A 1SR5C 3VXEH 1NT1A 4ISNA 2ZGHA 2ZPQA 2FOFA 1DDJA 1UVPA 1TMUH 1ZYOA 5T6FA 1K21H 1ZPZA 3SU4A 1O2PA 4UEHH 1INCA 4H6SB 2G81E 5T6DA 2SNVA 3WY8A 2ZDLA 4ZH8A 4AFQA 1V2UT 1LHGH 1H9IE 1UTQA 4JCNA 3SI4H 1NU9A 3P8OA 1EXFA 1O5DH 1Z8JB 5CHAB 2BD2A 1ZGIA 1FNIA 1O2TA 3KQDA 2HVXA 3BTME 5EOKA 1YBWA 1THRH 1V2OT 3TLOA 1FY3A 2NU0E 2ZDVH 3S69A 1GG6B 1ZOMA 1O2GH 1MCVA 3AAUA 2V6NA 1BTWA 3MNSA 3TH2H 2OC7A 1D6WA 3CENA 2YNBA 1E36B 1Y3XA
chains in the Genus database with same CATH superfamily
3UR6A 3QO6A 1BMLA 1QRWA 1QY6A 1G3BA 2Y7XA 4I7YH 3UQVA 1UK2A 3EAJA 3KGPA 1HDTH 4B6FA 1ZTKA 1VZQH 1TGTA 1F5LA 3A86A 3ELAH 4CBNA 2AHME 2JH5D 4I8GA 3L3TA 1O3AA 2O8TA 4X2YA 4IC6A 4CRAA 4B74A 2TBSA 3HK3B 4ESTE 5HYOA 1ESAA 1FPHH 5C67A 3LONA 5A2MH 2ANKH 2BHGA 1JMOH 1RIWB 5HM2A 1QJ1B 3ZZDA 3ZZ5A 3GY5A 1CBWB 1HB0B 2AS9A 2FM2A 3NCLA 1O2SA 4X1PU 2HOBA 2TPIZ 3SHCH 1O3GA 2ZFFH 1RJXB 1GHXH 4FETA 1TWXB 1EAUA 1LHFH 1H4WA 3ZZ9A 1FPCH 1IHTH 4BAHB 2Z9GA 3A7TA 4KGAA 3M35A 1GMDG 3OX7U 2KX4A 1AVGH 2BDAA 4SGBE 3M3TA 4Q4LA 2UWPA 3S9AA 1HAOH 1QGFA 1Y59T 4HG6A 1HBTH 1S85A 3DHKH 1VGCC 5FCRA 3TVJB 1VR1H 3ZVFA 1ETSH 2H5DA 4Y71A 2WPJS 5SGAE 1EUFA 2ZO3H 1TIOA 2AYWA 5FX6A 1CHGA 1KSNA 1TX8A 3SU1A 1GGDB 1T31A 3E3TA 2AMPA 3LC5A 3STJA 8ESTE 2ZHWH 1P2KA 3KCGH 5C20A 1ELAA 1ZHMA 1BIOA 2HPPH 1C2IA 1O31A 5HM9A 1TX6A 2BY5X 1H8DH 3EA7A 2Z9JA 4UD9H 5EG4A 4D7FA 4XBCA 1J9CH 2AGIX 2BMGB 1XKAC 2KCOA 1HAXB 3VEQB 1GVLA 1EJMA 1MH0A 1SGRE 2ZA5A 1IQFA 2GV6A 1LPZB 2A7CA 1TPOA 4MPXA 5EQQA 2B8OH 4U32A 1GCTB 4KTCA 2WPLS 4ABFA 3ZZ3A 2PTNA 2TGTA 2B7DH 2A2QH 1KXFA 4ACAA 1T8OA 1O5EH 1AQ7A 2A7HA 1YGCH 1GI6A 3LGVA 1QB9A 2R3YA 4JYUH 1A0JA 1YPEH 4WXIA 4A1VA 1C9TA 3STIA 1JIRA 1GI7B 3FP6E 5B6LA 1XXDA 2OP9A 4MPWA 1G3DA 3UR9A 2FPZA 3QWCH 1AO5A 6ESTA 3ZZBA 1Z8RA 1DXWA 2BY6X 1C1MA 3BG8A 4ABEA 1UTOA 2XBWA 2QA9E 1MKXH 1ZRBA 2PTCE 4AGJA 1PQ5A 1C9PA 1OX1A 4U30A 5EJZA 7LPRA 3B9FH 1O2QA 3RXCA 3SV2H 1UW7A 2KM0A 3D23A 1V2JT 1HJ8A 1P9UA 1WTHD 2ZHQH 1E1RD 2Z9IA 4AX9H 1LVOA 1HJAB 3FVFB 4CR9A 4AORA 5DP4A 1V2NT 1Z1JA 1PQ7A 1D3QB 1T32A 5B6OA 1BBRH 2WPKS 2GCHG 4ABDA 1K1JA 4AG1A 5C0UA 1C1WH 1MQ5A 3MO3A 4RN6A 1MKWK 5BRRE 2FOGA 4F4OC 2F83A 2C8ZB 1MUEB 1O3IA 1PPHE 3I77A 1SVPA 1T8NA 3VGCC 3SNBA 1P2IA 4AYYB 1HAYB 2FODA 2GV7A 2BD8A 3KL6A 2PLXA 1BJUA 2GCTC 1W8BH 1C5UA 3K6YA 2CHAC 4XD7D 3SUEA 4DY7B 1SLUB 4MG3A 1ELFA 2Y5GA 1C1TA 2J98B 1HAIH 3RMOH 2KCYA 1YPHC 4Y8ZA 2FEQH 1O2NA 3E90B 1BRBE 3SU0A 1TNGA 2XNDD 1GI4A 1UCYE 1NRPH 1Z6EA 2BZ6H 2QXIA 3SZNA 3GCHB 4AC9A 5HMAA 2PHBA 2FMJA 1BMAA 1DWCH 1GJ7B 1C1UH 2ZG0H 1Z8GA 3L6PA 4OGYA 3SNAA 3RUOA 4IS5A 3A88A 4IMZA 4NFEA 4TSFD 1EP5A 1GI5A 3EGKH 2VJ1A 5CDFE 2RDEA 3RXSA 2QGRA 1FAXA 4AB8A 3RMLH 2JIZD 1COWD 4X6OA 3NK8A 2G51A 4NZQA 1GI0A 4HI3A 1CGHA 1OWHA 3O8CA 1O5AB 5EJ1A 2FYRA 2BOHB 1G2LA 3HGNA 2ANYA 5AFYH 2FYQA 1K1LA 3EYDA 4YT6H 2A1DB 3OTJE 1HAHH 1YPMH 1SL3A 3MH5A 1NFXA 3ATWA 1VCQA 2WHXA 2LNCA 1OP8A 3BN9A 1MD7A 3MO9A 1XX9A 4Y76A 1G3EA 1GI1A 2BLWA 1ZTJA 1UHBA 3QTOH 1HFDA 1KLIH 3M36A 1BB0B 3TK5A 1FUJA 1TB6H 3C1KA 1HAZB 2B5TB 2ZFSA 1ESBA 1DLKB 5A0CA 2SNWA 1C5TA 2YMSB 1QA0A 3S9CA 2OTVA 2PSXA 1AB9B 2AEIH 3BTHE 2FOMB 2C93B 1HUTH 5C5OA 2P8OB 2W3KA 2ZC9H 1L4ZA 1VITF 2GZ7A 4ZUHA 1GHWH 4NWLA 1ELCA 2DE8A 2NWNA 3KQBA 1B7XB 4O3TA 3GYMA 2C90B 1Q3XA 3PRBA 4UONA 3FZZA 2FTMA 4MNWA 5KECA 4X0WU 2PR3A 1QJ7B 4DG4A 1NRQH 1T4UH 4AGKA 1CO7E 3Q00A 3O8BA 3EDXB 1W12U 3CNRA 3TH3H 2DE9A 6LPRA 1O30A 3PWCA 3E0PB 2BLOA 2CN0H 3GY4A 5DPAA 1E79D 3EA9A 4GSOA 1C4V2 2V0BA 3RXOA 2C4FH 2WSSD 3HATH 1W3CA 3SNCA 3MI4A 3RXVA 5E0JA 1LPKB 2RFKC 1GJ6A 2VVUA 1TNLA 2G55A 3T27A 1NM6A 1NPMA 1MTVA 1P57B 1IOEA 3S7HB 1H1BA 1O5GH 5HXFA 1EPTA 1OXGA 4IN2A 3A8CA 3LJOA 2W7UA 4M7GA 3PROA 1ZMLA 3UUZA 4XRNA 4NIVA 3BEUA 4GHTA 3T26A 1KDQB 4Q7YA 2RA0A 1O33A 1W7XH 1MQ6A 4A5TS 1SFIA 1TRMA 5GJ4B 2PFEA 3P17H 4Y8XA 1HYLA 4HZHA 5EJLA 1EZQA 4KP0A 1QJ6B 1TGSZ 1PPZA 1FLEE 1E38B 3UFAA 4RT0A 1MTNC 1QBNA 4FUDA 1ZHPA 1SLWB 2BVXH 2HNTF 2TIOA 7GCHF 1GHZA 1KTTB 3P70B 3S9BA 2WPIS 2ZTXA 1VKYA 4ZAEA 2VGCC 1UVOA 1O3FA 3NXPA 4BAMB 1QBVH 8GCHF 1C1PA 1DX5M 1WTGH 3U9AH 4OS2A 3LGTA 1SLXB 2XBVA 1YM0A 1OYQA 3KHVA 3PO1C 4X2WA 3PMAB 1PPFE 1K1IA 1SFQB 2CJIA 2UUFB 1TA2A 4FUIA 1ESTA 1SGCA 2FS8A 1Y3YA 1GMCF 1BTXA 3F0PA 1W0JD 2J4IA 3QGJA 1FMGA 1C5QA 3B8JA 3M3VA 3GY6A 4Q7ZA 4E7RG 5C17A 2FOEA 1C2EA 3GDUA 3D62A 3UQOA 2BVSH 3LGIA 4LK4A 3SHAH 5HGGA 4Y79A 3RXUA 4JYVH 3HGPA 3RM0H 3OYPA 1P2MA 3I78A 1FIWA 2C8YB 2WYJA 4I8KA 1GBAA 1TNHA 1SQOA 1GWAA 3PRDA 4OGXA 2GMTC 1C5LH 1CE5A 4R8TB 3TPIZ 3U8RH 3SJ8A 1C2LA 1S6HA 4NZLA 4CHAB 4CRDA 3P95A 1TABE 3TJUA 1ANEA 2BXUH 1FX0B 2A4GA 1GBHA 1NN6A 2AIQA 1QQUA 2L74A 5EIYA 3MOCA 3PV2A 1GJ8B 1O36A 3MHWU 3EQ0H 5FCKA 4UE7H 1TYNA 1NTPA 2PKAA 1ZPBA 1PPBH 3F2HA 2D1JA 2FZZA 1G9IE 3LIWA 1O37A 2BDYA 2UWOA 3UOPA 3RMNH 2VIDA 1SGFG 1V2LT 2KAIB 3GCNA 3MH6A 5EXMA 5L2YH 4P02A 2BDIA 1JRTA 1GBBA 1LHEH 1Y8TA 1OKXA 1NFWA 4D9QA 1J14A 3ZVBA 1HJ9A 1CGIE 2G4TA 5JB8S 1EZUC 4TT3D 1YCPM 3PM3A 4NG9H 2BB4A 2XC4A 2JDID 2HPQH 3OSYA 1GG6C 4AFSA 4I32A 4X6MA 3RU4E 1P03A 5EPNA 1PQ8A 2P3TB 1HIAA 1C5VA 1EKBB 2Y81A 3QDZB 1QRXA 3Q3YA 1XUKA 4BAOB 9LPRA 5FXLA 2GZ9A 1W11U 3F9HA 3S7KB 1PQAA 1DOJA 3ODDA 5CHBA 1HAVA 4AYVB 1CA8B 4Y10E 4FU8A 1THPB 2G8TA 2QC2A 1N8OB 1UVTH 5EU8A 2SGQE 2OUAA 1OYTH 2ZU1A 3ZZ8A 3CS7A 2A5KA 1ZTLA 1Y3VA 1SHYA 1NBMD 2WV9A 1DE7H 3PV5A 3AW1A 5E0HA 4BAQB 1GBKA 2K0QA 3HPTB 3PWBA 2VWOA 3PLBA 1GDQA 3HKJB 2OCVB 2PP6A 4Y8YA 1FDPA 2BY7X 4MLFB 1P02A 2Y82A 4D8NA 2ZPSA 2O8MA 2V7QD 3KEEA 1BT7A 3ATKA 4AOQA 3SUDA 3QZRA 1B5GH 1W2KH 3RXJA 1ANDA 4ABIA 2KCPA 1O3EA 2FOBA 1FY5A 1JBUH 3RC5A 1K1OA 1AZZA 4E05H 3S0NA 2FESH 3GDSA 3DA9B 4Z1MD 3F3BA 3KN2A 5ESBA 1C2GA 1FN8A 2ZHEH 3LGUA 1V2VT 4CR5A 2BD7A 5EQRA 2EEKA 3C27B 3PV4A 1QL9A 5TCCA 5IDKA 1YPLH 2JJ2D 4INKA 4ZXYH 3TNSA 1TMBH 2HLCA 2OK5A 5ETXA 4JZIA 2IOTA 2P16A 2P95A 3R3GB 3DSOA 1UTLM 2ZFRH 1THSH 1SHHB 9ESTA 1AE5A 4ZMAH 2V3HH 1GMDF 1O3JA 3VG8A 1QBOA 3SZEA 1GGDC 5DP8A 3BV9B 2A32A 5F8ZA 4MTBA 3ZZ7A 2P93A 3FN8A 3A7ZA 5FAHA 1E35B 3TGKE 3Q76A 1LQEA 1OS8A 1Y3UA 2ASUB 4NWKA 3H5CB 3UREA 4IW4E 1S5SA 1O3DA 1O3MA 1O5BB 2BDHA 3GY2A 1XKBC 3N7OA 3OY6U 2Z3CA 3E0NB 3MH4A 2OINA 2A4QA 5FBIA 4DOQA 1AZ8A 4GHQA 2G5NA 1GJAB 4Q63A 3A7XA 3V0XA 2XBYA 1P8VC 1KIGH 1WCZA 1TGNA 2P94A 2CMYA 3ATMA 3WW7A 3N7EA 3UNRA 2WV4A 4ZKRU 1E1QD 4CRGA 1V3XA 1WV7H 3URDA 5I46H 1C5WB 2CXVA 5CMXH 4E06H 1O2KA 4NA9H 1DLEA 3V12A 3RXMA 3RP2A 3WWFA 3O8RA 1DSTA 1O2VA 1K0HA 2BY8X 2EC9H 2ZECA 4FOUC 2W26A 1DY9A 2O9QA 5GPIB 1WYKA 2ODQA 1FZZA 2D2DA 2FI3E 3GICB 4SGAE 1GMHG 1VCWA 1Y3WA 4IMQA 3LDXH 3RXKA 1BMFD 1F0UA 2HRVA 2VB0A 2V3OH 1F0TA 4K1SA 4DIHH 1UJ1A 1S82A 3TJNA 2JETB 2ZFPH 3FAOA 3RXEA 3PMBB 2R0LA 3BTQE 1HJAC 4ZHMU 5GCHG 1SOZA 2AGGX 1L1GA 1ANBA 1U6QA 2BD5A 2FXRA 5GWZA 1DVAH 3SBKA 1A3BH 2VVCA 4GPGA 2GDDA 2XBXA 1WQSA 1O5FH 3MU5A 1C1QA 2Z9LA 1YCPH 2K8IA 3RXGA 1MCTA 1HRTH 3DSPA 2ILNA 4B2BA 3B23B 4B6EA 3E6PH 3DCLA 2GCHF 1WSSH 2QF0A 2BLVA 4X6NA 3TH4H 1C2DA 1BHXF 5C2ZA 2W5EA 1EQ9A 2IPHA 4NGAH 1TALA 5DP6A 1Z71A 4XBBA 1K2I1 1N1LA 2P3FH 4UDWH 3WWBA 3ITIA 4XFQA 3TITA 1WUNH 3AK5A 3LPRA 3QLPH 2F43B 1ELGA 1KXDA 3BTWE 2ZCLP 3QUMP 5GXPA 2I6SA 2NU1E 1A4WH 2JJ1D 1BDAA 2OC1A 3GCHC 3F2GA 3SJ9A 2F9VA 2ZGBH 1RFNA 3DSGA 3NUMA 5EW1H 5DSFA 3AAVA 1ZRKA 1G3CA 1RD3B 1F0SA 1F0RA 3BTKE 3P6ZB 1V6DA 2FIRH 2FX4A 3U1IB 4J1YA 1IQKA 1DY8A 2CF8H 1GVKB 4VGCB 1LKBA 1P01A 3RLYH 4CH8B 4XDEA 1A2CH 4TY7A 1ORFA 3OE7D 1PPEE 2Z94A 4H4FA 1P05A 2XTTB 3A84A 3GDVA 4XOJA 1G36A 1ZGVA 3NPSA 1TLDA 1SLVB 1NZQH 3G01A 4GCHG 3TK6A 1AUJA 3OY5U 4WMFA 3BTGE 4KKDA 1TNKA 5GIBA 4B75A 1Q31A 2CK3D 1CHOG 1C1RA 2FI5E 3P8GA 2FP7B 3SW2B 1GJCB 5E8EH 1YF4A 3KQEA 7ESTE 1OWDA 3AASA 2ZU5A 4YM9A 3BTDE 2W3IA 3A7YA 5TCAA 2C8XB 2QF3A 3ZVEA 4B71A 1BITA 1BUIA 1AKSA 1DPOA 1W0KD 2LP6A 3PMJA 1V2ST 4JMYA 4RT1A 2YMSC 1SGEE 4JZ1A 1AB9C 1LTOA 3V7TA 4BTUB 2OC0A 2BDGA 1HLTH 1LDTT 1SGTA 3W1EA 4Y0ZE 1A5IA 2P3UB 4FXGH 4AZ2B 3MU1A 2EQNA 1GI8B 1TA6A 2LELA 4B73A 2W6JD 1W0YH 2GD4B 1AWFH 1WQVH 4TPIZ 4RSPA 1W14U 2OC8A 4ZKNU 1O38A 1RTKA 1O2YA 1AUTC 1CA0B 2ZDAH 2EY4C 1TQ7B 2F4LA 1VGCB 2RG3A 5DP3A 2ANWA 1EJNA 3BG4B 5LH8A 1LPGB 2PV9B 1IQNA 4FUJA 2TGDA 5DP9A 3BTTE 4FUGA 2IJD1 3SV9A 2CV3A 3MMGA 2D26C 3NZIA 3MH7A 1ZJDA 1NFYA 2J9NA 1V2TT 3UAIC 8KME2 5JBAS 3RXHA 1RRKA 2ZHDA 2Y5HA 1QZ8A 1H8ED 1P10A 2OQ5A 2PGQB 2BX4A 1O32A 2STBE 1BHXB 1J17T 1BTZA 3N7DA 1T8LA 4LOYH 3T29A 1C2HA 3RXIA 3GYLB 2ZU2A 3F68H 1QIXB 4ISIH 5AVDA 1DANH 3SV8A 5A8YA 2PKSB 2J38A 1RGQA 3KYFA 3TJVA 1C1NA 1LKAA 1IQGA 4IBLH 1ELDE 3F9FA 5F8XA 1SQAA 1GBFA 3QGNB 2XC0A 1NRSH 1SBWA 1N6YA 2J94A 4X8VH 4YT7H 1Y5AT 2YNAA 2J2UA 1Z1IA 2JKHA 1EFRD 1GDUA 2Z7FE 3TIUA 1W10U 2BD4A 3MU8A 1ELVA 1P2QA 2GP9B 2AGEX 3RC6A 4ABBA 4CBOA 3A8AA 1OWJA 2M5TA 5A0AE 4BAKB 2EI8A 5EODA 5CE1A 2P59A 2YMSD 2H6MA 1S0QA 1QRZA 4ZHLU 3RU4D 1UHBB 1YPKH 1P11E 2AERH 1EX3A 4DCDA 1W0ZU 3P92A 2G00A 1PJPA 1YKTA 1BBRE 3A7WA 1F7ZA 4DURA 3DD2H 3PYHA 3RXDA 5JB9S 2ZZUH 1EAIA 3SU6A 1C2KA 2FLBH 1GBTA 1GJBB 2GVFA 1FIZA 3TGJE 3E1XB 3GCTG 4M9FA 1V2PT 5ABWA 3BF6H 2QYIA 1P0SH 1H8IH 4ACBA 3GY8A 3VGCB 5C3NA 5JPMH 1UK3A 1OP2A 1MAXA 2J97A 1AU8A 1P2OA 2B0FA 3LC3A 2WZQA 3FP7E 4CHAC 1GHBG 1ETTH 1D9IA 3VB3A 1A0LA 4K1EA 3KF2A 1D3TB 1SGQE 2Y6TA 3SYJA 1UCYK 1EAXA 1UMAH 1OP0A 1O3KA 3UOUA 5EXNA 3O8DA 4UFGH 3U8OH 3GISB 1AFQC 4FUHA 3UPEA 1C2MA 4X8UH 1C2FA 3A87A 3LGWA 3QX5H 1HXEH 5I25A 4ISOA 1NY22 1DUAA 1TQ0B 1O0DH 2AIPA 3SI3H 2L6OA 3LH3A 4ZKOU 1SGNE 2SGEE 2VIOA 1O3CA 2WV5A 2Q6GA 4X8TH 2ALPA 1C1VH 2ALVA 5L6NH 2GTBA 1AN1E 1ELEE 1EPTB 1QL7A 1LMWB 1SSXA 2A0QB 2GX4A 3A8DA 1BRCE 4U01A 4ASHA 2Q1JA 1W7GH 3BEIB 4BXWA 1HGTH 1TFXA 1TNJA 4GAWA 1S81A 3CP7A 1YY3A 3NKKA 3SU2A 2FI4E 2BLQA 3BTEE 1SG8B 3RXLA 2R3UA 1DT2A 5TJXA 2ZQ1A 1C5NH 2ZDNA 3M5NA 3H7TA 3F1SB 3Q77A 2ZGXH 1H9HE 4TPYA 2KR7A 2AMDA 1AY6H 3TK9A 2BD9A 1N8OC 1NRNH 1XUIA 1K1NA 4ZXXH 3SU3A 1MKXK 3T25A 1ZR0A 4UFDH 1T4VH 3GS9A 4YESB 3UNQA 3ZV8A 1L0ZA 2QAAA 3K6ZA 1BOQA 2BX3A 1WXRA 1ELTA 1A0HB 3VB7A 3ZZ6A 1E0FD 1S6FA 2H2ZA 2FS9A 2DUCA 2A4OA 1BBRK 3P8NA 1TNIA 2TRMA 1KY9A 5K0HA 2QXGA 2NU4E 2G5VA 4WXVA 1ZMNA 3LT3A 4O3UA 1XUFA 2FDAA 4K8BA 3KNXA 4HGCA 1CSOE 5FPTA 3URCA 1EZXC 1UO6A 1DWDH 2F9UA 3FFGA 1O2HA 4I33A 5T1VA 3FZDA 3M7UA 1FY4A 4X1NU 3OEED 1EAWA 1V2KT 3H7OA 4CRFA 3A81A 3UY9A 5AFZH 4WMEA 2GT8A 4K8YA 6GCHG 1C5PA 2RCEA 3QTVH 1EOLA 3V3MA 3I29A 2V35A 4B76A 1MABB 2Z3DA 5CHAC 1XUGA 5G4BA 1GBJA 3N99A 4B2CA 4Z6AH 2ZCKP 3W95A 2PKAB 6CHAB 1GI3A 1AWHB 2ZFQH 1TOMH 3M7TA 2HWLB 3ODFA 3T5FH 3MO6A 3ZVAA 4TY6A 5FPSA 4X6PA 2CGAA 3V13A 2BXTH 1J8AA 4WY3A 4YZUA 3SJKA 5DK1A 3ESTA 1MBMA 3MFJA 4CRBA 2GDEH 2O8LA 4HFPB 4WJG2 2A5AA 2XWAA 4HTCH 3SNDA 1SC8U 3LGYA 4ISHH 3FO8D 5DN6D 1PFXC 4MNYA 1BTYA 2F9OA 4F49A 2EI7A 3HKIB 2BYAX 4TWYA 1HIAB 3U69H 1GPZA 1SGFA 5E0GA 1O39A 1O3LA 4O9VA 1ARCA 3ENSB 1O3PB 1ACBE 1GI2A 5H4IB 3VFEA 1HAVB 4NIWA 1VJAU 3LOXA 1JRSA 1GVZA 1S84A 2XRCA 4DT7B 2QXHA 1MBQA 1IQMA 1RIWC 2Z6BD 3OAAD 4ISLA 1AIXH 2VNTA 2RA3A 1CBWC 2JETC 1AFEH 5KEDA 4XBDA 3M61U 5T6GA 1GHYH 1GMHF 2HGTH 1XVMA 1MKWH 2QE7D 5DO4H 4YTAA 4Q7XA 3ZZ4A 1MU6B 4CRCA 2ODYB 2EI6A 4JZEH 1O2XA 3SU5A 4O03A 1K1MA 4YLQH 4ABGA 1XUJA 2F3CE 5GCHF 1KLJH 1OWKA 1KXAA 3RXAA 4DIIH 1PPCE 1TPAE 5BPEA 2GGVB 5JYIA 1DWEH 1UTJA 8LPRA 3GOVB 3F9GA 3NRLA 1YLCA 4INHA 4F55A 1A5GH 5HIZA 4Y7AA 1TBQH 3H09A 1KYNA 3T2NA 3E16B 3SGAE 4D9RA 4K5ZA 1TGCA 2J34A 2M2AA 1SGIB 1UTKA 4BTIB 1TRNA 1OPHB 2OLGA 2BOKA 1T8MA 1LQDB 4YXWD 1ZSJA 1S83A 1HAPH 1TONA 1QL8A 1ELBA 4F48B 2FWWA 3D49H 4MVNA 1CGJE 3QZQA 5GNDA 3TU7H 2A5IA 3IG6B 1EP6A 4DT4A 1V2QT 4ZCNA 2WPMS 3ATIA 1GHVH 1H8HD 1BRUP 1GCTC 4NCYA 2O8WA 1TPSA 5C1UA 1X7AC 1UVUH 1AMHA 3EA8A 5L30H 1H9LB 1O2JA 3RXFA 4AN7A 2GT7A 1O2MA 3M37A 4VGCC 3SQHE 3SUFA 1AI8H 5DG6A 1A5HA 2UUJB 1DXPA 4LZ1H 3RXTA 4B1TA 3R0FA 3UWIA 1BQYA 2BVRH 1LHDH 2PUQH 1AVXA 1O2WA 1MTWA 3M5LA 4Y11E 2F9BH 4WF8A 2UUYA 1O2UA 5HKKD 1RXPA 5EXLA 2SGDE 1E34B 2VIQA 5DP5A 2ESTE 3A85A 4MDSA 2QXJA 4YOIA 1CQQA 3HK6B 4ABJA 4K69A 1FONA 1MAYA 1WU1A 4GCHF 3GY3A 4KTSA 4RKJB 3UIRA 2C3SA 1HCGA 1QNJA 2ZNKH 1ZLRA 4XE4A 5FL7D 2GZ8A 1CHOF 1KXEA 1SQTA 2D8WA 2SFAA 1UTMA 4CREA 4WH8A 4JK5A 5JBCS 1RTLA 2J92A 1XUHA 2BDBA 4UFFH 2VINA 1DITH 4LZ4B 2JH0D 4NIXA 5C1YA 5A8ZA 1GBCA 3F6UH 1B0FA 1D3DB 3W94A 1SQRA 2ZTYA 3PTNA 4AFUA 1KXBA 1CA0C 1MTSA 4WH6A 5J4QA 2BZAA 3PLKA 3EE7A 3VB5A 2J5UA 4FUEA 1CT0E 1FQ3A 1QB1A 4R0IA 1ETRH 1RTFB 4FVDA 4Y0YE 3DFLA 1G37A 1UCYH 1ID5H 1TMTH 3BG4C 1YPJH 4K1TA 3F0OA 1L1JA 1JIMA 3RXRA 1SPJA 3BTFE 4XSKU 4BOHA 3VXFH 2QCYA 4JZDH 4YOJA 3QK1A 1QA7A 3OFND 1C5OH 2FOHA 1UK4A 1IQEA 2C8WB 3ZYDA 3MNBA 1Z6JH 1MD8A 1NBME 4NSVA 5K7RA 3UNSA 2XCNA 1P2NA 2KFWA 2O8UA 4GVUA 1C5ZB 3UWJH 3BEFB 1UVSH 2HNTE 1LVYA 1LO6A 4NFFA 2Q6FA 4DW2U 4X2XA 4BNRA 3U28C 4X1RU 2WPHS 2VIPA 2PKSC 2PW8H 1CT2E 1V2RT 2Y7ZA 3SGQE 3VB4A 2ZQ2A 4FU7A 1GCDA 1S0RA 4QT8C 1BA8B 1PYTC 2ZI2H 5F8TA 1F5RA 3CS0A 1Q2WA 2BM2A 1P09A 5FPYA 3RLWH 3TGIE 2K1QA 1SMFE 2XNIA 2A31A 4YO9A 3RMMH 5JBBS 3RXQA 1A1RA 3TJOA 1BZXE 1ZSLA 1GBDA 3PMHB 1BTPA 2WINI 2ZKSA 1P12E 1JWTA 4PROA 1MU8B 4Y7BA 3RM2H 1BRAA 3ATLA 2UWLA 3A8BA 1QB6A 4H6TA 2ZU4A 1OWEA 1EASA 1IHSH 4I8HA 2Y80A 1TAWA 2R9PA 1C4U2 3MWIU 2P8OC 1LVBA 1GBIA 1IQIA 4RKOB 1S6LA 1ABJH 3K9XB 2F91A 4A7IB 4K60A 2R2WU 1TE0A 2R2MB 3BIVH 1FY1A 1AKSB 1O3OA 3DT0H 1EB2A 4FU9A 4INLA 1YLNA 3MNXA 1TPPA 1GDNA 4RI0A 4NIYA 2NU2E 4BTTB 2H1UA 2OQUA 1KXCA 2VU8E 3IITA 4A6LA 3M3SA 5IK2D 1FXYA 1O3NA 1ZSKA 3SV7A 3P8FA 2J98A 5DGJA 5LPRA 1LCYA 5FX5A 2VH6A 1QTFA 2PSYA 3KQ5A 1C5XB 1VJ9U 1K9OE 4IN1A 4JZFH 1A61H 3AVZA 3NWUA 4FUFA 4H42U 4OS6A 3GCTF 2ZEBA 2TGPZ 3BIUH 1NFUA 2GKVE 2VVVA 1JXPA 4OM9A 4A1XA 1QQ4A 3A80A 1MZAA 2BQ6B 2HLDD 2BQWB 1QFKH 1G30B 1P2JA 2BTCE 1DSUA 3SJOA 1GHBF 2ANMH 2Z9KA 4D7GA 4B2AA 3EE0B 1FJSA 2OD3B 5EGMA 2XCFA 4KTUA 1XXFA 3U8TH 4MNVA 1BCUH 3U98H 5C94A 4BANB 4TYDA 5DJ7A 3VPKA 1A3EH 5JBTA 2WUBA 4X1SU 2QIQA 2STAE 3OU0A 1O5CB 4A92A 1NC6A 2VIWA 3SUGA 1EPTC 2ZCHP 2ZPRA 3F9EA 4FUCA 1O2IA 2ZFTA 1FY8E 4OS4A 4YOGA 1PPGE 4X2VA 3U1JB 3FKSD 1SGYE 2NU3E 1PYTD 2OBQA 1HAGE 1Y5UT 1ZMJA 3ZVGA 1KLTA 1N6XA 3FP8E 4DJZB 2CF9H 2RDLA 1GHAF 1NRRH 1A46H 1Z8IB 1WOFA 1CT4E 2G4UA 4D76A 1SI5H 1SGPE 3JZ1B 2KCAA 4WMDA 2A2XH 3OTPA 1DICA 1YLDA 2H9TH 1XM1A 5HIYA 3K65B 1Z7KA 3RXPA 5ESTE 1JOUB 1K1PA 2XYAA 5DP7A 1J16A 1DWBH 4WWYA 4ZKSU 4OS7A 3SV6A 4ZHAA 1DUEA 3IWMA 1MMJN 1P04A 3DUXH 3SOSA 5KGOA 2B9LA 1AE8H 2VWMA 1NU7B 2XW9A 5EQSA 2OXSA 4UFEH 1AD8H 4LXBH 1GJDB 4DGJA 5A8XA 5LPEA 2A4RA 3LH1A 2Z3EA 2XXLA 3M5OA 3JZ2B 5A0BA 3L33A 1K22H 1BMMH 2FOAA 1O35A 2ZDMA 1YPGH 1TGBA 2SGAA 3MQKC 3LJJA 1TBZH 1C4Y2 3Q3XA 5C5NA 1YCPK 1C5RA 5E2OA 5EW2H 2AFQB 2GCTB 2CHAB 5A09A 1CU1A 1NS3A 2OBOA 4MQAA 2VH0A 2V3MA 4NA8A 5J4SA 2QF4A 3LU9B 1A7SA 2FO9A 1KTSB 1DFPA 3OEHD 3T62A 1O3BA 4Y6DA 3SQEE 1D4PB 1Y5BT 3AW0A 3KYGA 4ASUD 2SGFE 4I8JA 1P3EA 2EA3A 5F03A 3ZZAA 2AMQA 2HALA 1YC0A 4Z0KA 1K28D 2PWXA 2H9HA 4X1QU 4CH2B 4X8SH 1KDQA 1SB1H 2A45B 3E91A 1ZJKA 4E7NA 1GHAG 2JH6D 5LGOA 6GCHF 1QR3E 6CHAC 2QY0B 4MPVA 4JK6A 1GBEA 1HXFH 2BY9X 2ULLA 3PB1E 1BTUA 5GDSH 3RDZA 1LHCH 1BJVA 3PLPA 4IGDA 3RXBA 1F2SE 2VBCA 1IQLA 4I31A 4U2WA 3UTUH 5E2PA 5C1XA 1AVWA 1O34A 1W13U 1G32B 1SGDE 4ZROA 2ZGJA 4Q2KA 2BQ7B 1ZZZA 1FAKH 1ANCA 2Q6DA 1MZDA 4AG2A 1IAUA 1VCPA 1TBRH 3K2UA 1C5MD 2ZWLH 1V2WT 5EPYA 1NO9H 1WBGB 1QHRB 2ZDKA 1OOKB 3VB6A 1F5KU 2IJOB 1HPGA 1VITG 5AF9H 2IPQX 3PTBA 3MYWA 1NESE 4BXSA 1UTPA 3A82A 1EZSC 3A7VA 4ABHA 1C1SA 1QCPA 2ZU3A 1LVMA 1DS2E 3E8LA 1G2MA 2F9NA 1D3PB 1L2EA 5PTPA 4FUBA 4O97A 1P06A 2BD3A 2J95A 2HNTC 2Y5FA 2ZF0H 1AHTH 1O2LA 2UUKB 2THFB 1ZHRA 2ZIQH 3DFJA 1RS0A 5LPFA 2FOCA 1WAYB 2QN5T 4I86A 2IN2A 1EJAA 2QV1A 3SN8A 4YLUA 1L1NA 1D6RA 1FI8A 2VWNA 3ZIAD 1MTUA 3MU4A 3A83A 1OSSA 1M9UA 2ZTZA 4ABAA 3KQCA 4TWWA 2ODPA 1TX7A 4GUXA 1T7CA 5F6MA 5C0TA 7KMEH 4OS1A 4DVAU 1ARBA 2BDCA 3LKWA 3RC4A 1OWIA 1P3CA 3ZV9A 2ZP0H 3SGBE 4A1TA 1GJ5H 2KAIA 2PGBB 1QURH 1EATA 4OS5A 4AFZA 2VWLA 4AB9A 3ZVCA 3ZVDA 1O2RA 2LPRA 2QF5A 4J2YB 5FBEA 1AFQB 1TOCB 1GJ4H 5FHTA 1C1OA 5DKMA 1FN6A 1YYY1 1BTHH 3M7QA 3FANA 1HV7A 1GI9B 5AHGH 3QN7A 1B0EA 1HNEE 4Q80A 4THNH 1C5YB 2WUCA 1AGJA 3ZYEA 3SJIA 1EB1H 3T28A 4FVBA 7GCHG 3F2FA 3GY7A 4K3JA 2FLRH 1SOTA 2VIVA 5T3HA 2H5CA 3RU4T 4P00A 1MTNB 1BMNH 4NSYA 3SO3A 8GCHG 1OHHD 2YOLA 1C2JA 3UB0A 1GL1A 2AH4X 1TRYA 2FX6A 1O2ZA 4K2YA 1GL0E 2ZHFH 1GBMA 3A89A 1IQJA 2XOKD 3MTYA 2VGCB 3SORA 1UTNA 2FTLE 1O2OA 1GMCG 2H9EH 2XWBI 1ABIH 4KELA 3ZZCA 3MU0A 4JYTA 1P9SA 2XC5A 1DM4B 1NROH 4GLYA 3PO1B 1CVWH 2ZGCA 1GBLA 3FOAA 2PUXB 1VITH 3M5MA 1O3HA 1XMNB 3TNTA 2W7SA 5JDUB 1C5SA 1FV9A 1SKYE 1WDIA 1YPHE 2WPDD 3D65E 5F53A 2TGAA 1XVOA 1L4DA 5IYTA 1F92A 4MNXA 3Q3KA 3MNCA 1YWUA 4MPUA 4I8LA 1EOJA 2A7JA 1GJ9B 4IC5A 1E37B 2W6ID 1ZPCA 2I6QA 3SNEA 4WVPE 2SGPE 2G52A 2WYGA 5L2ZH 3BSQA 2F9PA 1J15A 1V2MT 1IQHA 3GCOA 1YP9A 2GMTB 2R0KA 2KZ4A 3KIDU 4NA7A 1SR5C 3VXEH 1NT1A 4ISNA 2ZGHA 2ZPQA 2FOFA 1DDJA 1UVPA 1TMUH 1ZYOA 5T6FA 1K21H 1ZPZA 3SU4A 1O2PA 4UEHH 1INCA 4H6SB 1KMHB 2G81E 5T6DA 2SNVA 3WY8A 2ZDLA 4ZH8A 4AFQA 1V2UT 1LHGH 1H9IE 1UTQA 4JCNA 3SI4H 1NU9A 3P8OA 1EXFA 1O5DH 1Z8JB 5CHAB 2BD2A 1ZGIA 1FNIA 1O2TA 3KQDA 2HVXA 3BTME 5EOKA 1YBWA 1THRH 1V2OT 3TLOA 1FY3A 2NU0E 2ZDVH 3S69A 1GG6B 2GJGA 1ZOMA 1O2GH 1MCVA 3AAUA 2V6NA 1BTWA 3MNSA 3TH2H 2OC7A 1D6WA 3CENA 2HVYB 2YNBA 1E36B 1Y3XA
chains in the Genus database with same CATH topology
3UR6A 3QO6A 1BMLA 1QRWA 1QY6A 1G3BA 2Y7XA 4I7YH 3UQVA 1UK2A 3EAJA 3KGPA 1HDTH 1ZTKA 1VZQH 1TGTA 1F5LA 3A86A 3ELAH 4CBNA 2JH5D 4I8GA 3L3TA 1O3AA 2O8TA 4X2YA 4IC6A 4CRAA 4B74A 2TBSA 3HK3B 4ESTE 5HYOA 1ESAA 1FPHH 5C67A 3LONA 5A2MH 2ANKH 2BHGA 1JMOH 1RIWB 5HM2A 1QJ1B 3ZZDA 3ZZ5A 3GY5A 1CBWB 1HB0B 2AS9A 2FM2A 3NCLA 1O2SA 4X1PU 2HOBA 2TPIZ 3SHCH 1O3GA 2ZFFH 1RJXB 1GHXH 1TWXB 1EAUA 1LHFH 1H4WA 3ZZ9A 1FPCH 1IHTH 4BAHB 2Z9GA 3A7TA 4KGAA 3M35A 1GMDG 3OX7U 1AVGH 2BDAA 4SGBE 3M3TA 2UWPA 3S9AA 1HAOH 1QGFA 1Y59T 1HBTH 1S85A 3DHKH 1VGCC 5FCRA 3TVJB 1VR1H 3ZVFA 1ETSH 2H5DA 4Y71A 2WPJS 5SGAE 1EUFA 2ZO3H 1TIOA 2AYWA 5FX6A 1CHGA 1KSNA 1TX8A 3SU1A 1GGDB 1T31A 3E3TA 2AMPA 3LC5A 3STJA 8ESTE 2ZHWH 1P2KA 3KCGH 5C20A 1ELAA 1ZHMA 1BIOA 2HPPH 1C2IA 1O31A 5HM9A 1TX6A 2BY5X 1H8DH 3EA7A 2Z9JA 4UD9H 5EG4A 4D7FA 4XBCA 1J9CH 2AGIX 2BMGB 1XKAC 1HAXB 3VEQB 1GVLA 1EJMA 1MH0A 1SGRE 2ZA5A 1IQFA 2GV6A 1LPZB 2A7CA 1TPOA 4MPXA 5EQQA 2B8OH 4U32A 1GCTB 4KTCA 2WPLS 4ABFA 3ZZ3A 2PTNA 2TGTA 2B7DH 2A2QH 1KXFA 1T8OA 1O5EH 1AQ7A 2A7HA 1YGCH 1GI6A 3LGVA 1QB9A 2R3YA 4JYUH 1A0JA 1YPEH 4WXIA 4A1VA 1C9TA 3STIA 1JIRA 1GI7B 3FP6E 1XXDA 2OP9A 4MPWA 1G3DA 3UR9A 2FPZA 3QWCH 1AO5A 6ESTA 3ZZBA 1Z8RA 1DXWA 2BY6X 1C1MA 3BG8A 4ABEA 1UTOA 2XBWA 2QA9E 1MKXH 1ZRBA 2PTCE 4AGJA 1PQ5A 1C9PA 1OX1A 4U30A 7LPRA 3B9FH 1O2QA 3RXCA 3SV2H 3D23A 1V2JT 1HJ8A 1P9UA 1WTHD 2ZHQH 2Z9IA 4AX9H 1LVOA 1HJAB 3FVFB 4CR9A 4AORA 5DP4A 1V2NT 1Z1JA 1PQ7A 1D3QB 1T32A 5B6OA 1BBRH 2WPKS 2GCHG 4ABDA 1K1JA 4AG1A 1C1WH 1MQ5A 3MO3A 4RN6A 1MKWK 5BRRE 2FOGA 4F4OC 2F83A 2C8ZB 1MUEB 1O3IA 1PPHE 3I77A 1SVPA 1T8NA 3VGCC 3SNBA 1P2IA 4AYYB 1HAYB 2FODA 2GV7A 2BD8A 3KL6A 2PLXA 1BJUA 2GCTC 1W8BH 1C5UA 3K6YA 2CHAC 3SUEA 4DY7B 1SLUB 4MG3A 1ELFA 2Y5GA 1C1TA 1HAIH 3RMOH 1YPHC 4Y8ZA 2FEQH 1O2NA 3E90B 1BRBE 3SU0A 1TNGA 1GI4A 1UCYE 1NRPH 1Z6EA 2BZ6H 2QXIA 3SZNA 3GCHB 5HMAA 2PHBA 2FMJA 1BMAA 1DWCH 1GJ7B 1C1UH 2ZG0H 1Z8GA 3L6PA 4OGYA 3SNAA 3RUOA 4IS5A 3A88A 4IMZA 4NFEA 1EP5A 1GI5A 3EGKH 2VJ1A 3RXSA 2QGRA 1FAXA 4AB8A 3RMLH 4X6OA 3NK8A 2G51A 4NZQA 1GI0A 4HI3A 1CGHA 1OWHA 3O8CA 1O5AB 2FYRA 2BOHB 1G2LA 3HGNA 2ANYA 5AFYH 2FYQA 1K1LA 3EYDA 4YT6H 2A1DB 3OTJE 1HAHH 1YPMH 1SL3A 3MH5A 1NFXA 3ATWA 1VCQA 2LNCA 1OP8A 3BN9A 1MD7A 3MO9A 1XX9A 4Y76A 1G3EA 1GI1A 2BLWA 1ZTJA 1UHBA 3QTOH 1HFDA 1KLIH 3M36A 1BB0B 3TK5A 1FUJA 1TB6H 3C1KA 1HAZB 2B5TB 2ZFSA 1ESBA 1DLKB 5A0CA 2SNWA 1C5TA 1QA0A 3S9CA 2OTVA 2PSXA 1AB9B 2AEIH 3BTHE 2FOMB 2C93B 1HUTH 5C5OA 2P8OB 2W3KA 2ZC9H 1L4ZA 1VITF 2GZ7A 4ZUHA 1GHWH 4NWLA 1ELCA 2DE8A 2NWNA 3KQBA 1B7XB 4O3TA 3GYMA 2C90B 1Q3XA 4UONA 3FZZA 2FTMA 4MNWA 4X0WU 2PR3A 1QJ7B 4DG4A 1NRQH 1T4UH 4AGKA 1CO7E 3Q00A 3O8BA 3EDXB 1W12U 6LPRA 3TH3H 2DE9A 1O30A 3PWCA 3E0PB 2BLOA 2CN0H 3GY4A 5DPAA 3EA9A 4GSOA 1C4V2 2V0BA 3RXOA 2C4FH 3HATH 1W3CA 3SNCA 3MI4A 3RXVA 5E0JA 1LPKB 1GJ6A 2VVUA 1TNLA 2G55A 3T27A 1NM6A 1NPMA 1MTVA 1P57B 1IOEA 3S7HB 1H1BA 1O5GH 5HXFA 1EPTA 1OXGA 4IN2A 3A8CA 3LJOA 2W7UA 4M7GA 3PROA 1ZMLA 3UUZA 4NIVA 3BEUA 4GHTA 3T26A 1KDQB 4Q7YA 2RA0A 1O33A 1W7XH 1MQ6A 4A5TS 1SFIA 1TRMA 5GJ4B 2PFEA 3P17H 4Y8XA 1HYLA 4HZHA 1EZQA 4KP0A 1QJ6B 1TGSZ 1PPZA 1FLEE 1E38B 3UFAA 1MTNC 1QBNA 4FUDA 1ZHPA 1SLWB 2BVXH 2HNTF 2TIOA 7GCHF 1GHZA 1KTTB 3P70B 3S9BA 2WPIS 2ZTXA 4ZAEA 2VGCC 1UVOA 1O3FA 3NXPA 1QBVH 8GCHF 1C1PA 1DX5M 1WTGH 3U9AH 4OS2A 3LGTA 1SLXB 2XBVA 1YM0A 1OYQA 3KHVA 3PO1C 4X2WA 3PMAB 1PPFE 1K1IA 1SFQB 2CJIA 2UUFB 1TA2A 4FUIA 1ESTA 1SGCA 2FS8A 1Y3YA 1GMCF 1BTXA 2J4IA 3QGJA 1FMGA 1C5QA 3B8JA 3M3VA 3GY6A 4Q7ZA 4E7RG 2FOEA 1C2EA 3GDUA 3D62A 3UQOA 2BVSH 3LGIA 4LK4A 3SHAH 5HGGA 4Y79A 3RXUA 4JYVH 3HGPA 3RM0H 3OYPA 1P2MA 3I78A 1FIWA 2C8YB 2WYJA 4I8KA 1GBAA 1TNHA 1SQOA 1GWAA 4OGXA 2GMTC 1C5LH 1CE5A 4R8TB 3TPIZ 3U8RH 3SJ8A 1C2LA 1S6HA 4NZLA 4CHAB 4CRDA 3P95A 1TABE 3TJUA 1ANEA 2BXUH 2A4GA 1GBHA 1NN6A 2AIQA 1QQUA 3MOCA 1GJ8B 1O36A 3MHWU 3EQ0H 5FCKA 4UE7H 1TYNA 1NTPA 2PKAA 1ZPBA 1PPBH 2D1JA 2FZZA 1G9IE 3LIWA 1O37A 2BDYA 2UWOA 3UOPA 3RMNH 2VIDA 1SGFG 1V2LT 2KAIB 3GCNA 3MH6A 5EXMA 5L2YH 2BDIA 1JRTA 1GBBA 1LHEH 1Y8TA 1OKXA 1NFWA 4D9QA 1J14A 3ZVBA 1HJ9A 1CGIE 2G4TA 5JB8S 1EZUC 1YCPM 3PM3A 4NG9H 2BB4A 2XC4A 2HPQH 3OSYA 1GG6C 4AFSA 4I32A 4X6MA 3RU4E 1P03A 5EPNA 1PQ8A 2P3TB 1HIAA 1C5VA 1EKBB 2Y81A 3QDZB 1QRXA 3Q3YA 1XUKA 4BAOB 9LPRA 5FXLA 2GZ9A 1W11U 3F9HA 3S7KB 1PQAA 1DOJA 3ODDA 1HAVA 4AYVB 1CA8B 4Y10E 4FU8A 1THPB 2G8TA 2QC2A 1N8OB 1UVTH 5EU8A 2SGQE 2OUAA 1OYTH 2ZU1A 3ZZ8A 3CS7A 2A5KA 1ZTLA 1Y3VA 1SHYA 1DE7H 5E0HA 3AW1A 4BAQB 1GBKA 3HPTB 3PWBA 2VWOA 3PLBA 1GDQA 3HKJB 2OCVB 4Y8YA 1FDPA 2BY7X 4MLFB 1P02A 2Y82A 4D8NA 2ZPSA 2O8MA 3KEEA 1BT7A 3ATKA 4AOQA 3SUDA 3QZRA 1B5GH 1W2KH 3RXJA 1ANDA 4ABIA 1O3EA 2FOBA 1FY5A 1JBUH 3RC5A 1K1OA 1AZZA 4E05H 3S0NA 2FESH 3GDSA 3DA9B 3KN2A 5ESBA 1C2GA 1FN8A 2ZHEH 3LGUA 1V2VT 4CR5A 2BD7A 5EQRA 2EEKA 3C27B 3PV4A 1QL9A 5TCCA 5IDKA 1YPLH 4INKA 4ZXYH 3TNSA 1TMBH 2HLCA 5ETXA 4JZIA 2IOTA 2P16A 2P95A 3R3GB 1UTLM 2ZFRH 1THSH 1SHHB 9ESTA 1AE5A 4ZMAH 2V3HH 1GMDF 1O3JA 1QBOA 1GGDC 5DP8A 3BV9B 2A32A 5F8ZA 4MTBA 3ZZ7A 2P93A 3A7ZA 5FAHA 1E35B 3TGKE 3Q76A 1LQEA 1OS8A 1Y3UA 2ASUB 4NWKA 3H5CB 3UREA 4IW4E 1S5SA 1O3DA 1O3MA 1O5BB 2BDHA 3GY2A 1XKBC 3N7OA 3OY6U 2Z3CA 3E0NB 3MH4A 2OINA 2A4QA 5FBIA 4DOQA 1AZ8A 4GHQA 2G5NA 1GJAB 3V0XA 3A7XA 2XBYA 1P8VC 1KIGH 1WCZA 1TGNA 2P94A 2CMYA 3ATMA 3UNRA 2WV4A 4ZKRU 4CRGA 1V3XA 1WV7H 3URDA 5I46H 1C5WB 2CXVA 5CMXH 4E06H 1O2KA 4NA9H 1DLEA 3V12A 3RXMA 3RP2A 3O8RA 1DSTA 1O2VA 2BY8X 2EC9H 2ZECA 2W26A 1DY9A 2O9QA 5GPIB 1WYKA 2ODQA 1FZZA 2D2DA 2FI3E 3GICB 4SGAE 1GMHG 1VCWA 1Y3WA 4IMQA 3LDXH 3RXKA 1F0UA 2HRVA 2VB0A 2V3OH 1F0TA 4K1SA 4DIHH 1UJ1A 1S82A 3TJNA 2JETB 2ZFPH 3FAOA 3RXEA 3PMBB 2R0LA 3BTQE 1HJAC 4ZHMU 5GCHG 1SOZA 2AGGX 1L1GA 1ANBA 1U6QA 2BD5A 2FXRA 5GWZA 1DVAH 3SBKA 1A3BH 2VVCA 4GPGA 2GDDA 2XBXA 1WQSA 1O5FH 3MU5A 1C1QA 2Z9LA 1YCPH 3RXGA 1MCTA 1HRTH 2ILNA 4B2BA 3B23B 3E6PH 2GCHF 1WSSH 2QF0A 2BLVA 4X6NA 3TH4H 1C2DA 1BHXF 5C2ZA 2W5EA 1EQ9A 2IPHA 4NGAH 1TALA 5DP6A 1Z71A 4XBBA 1K2I1 1N1LA 2P3FH 4UDWH 3ITIA 4XFQA 3TITA 1WUNH 3LPRA 3QLPH 1ELGA 1KXDA 3BTWE 2ZCLP 3QUMP 5GXPA 2I6SA 2NU1E 1A4WH 1BDAA 2OC1A 3GCHC 3SJ9A 2F9VA 2ZGBH 1RFNA 3NUMA 5EW1H 3AAVA 1ZRKA 1G3CA 1RD3B 1F0SA 1F0RA 3BTKE 3P6ZB 1V6DA 2FIRH 2FX4A 3U1IB 4J1YA 1IQKA 1DY8A 2CF8H 1GVKB 4VGCB 1LKBA 1P01A 3RLYH 4CH8B 4XDEA 1A2CH 4TY7A 1ORFA 1PPEE 2Z94A 4H4FA 1P05A 2XTTB 3A84A 3GDVA 4XOJA 1G36A 1ZGVA 3NPSA 1TLDA 1SLVB 1NZQH 3G01A 4GCHG 3TK6A 1AUJA 3OY5U 4WMFA 3BTGE 4KKDA 1TNKA 5GIBA 4B75A 1Q31A 1CHOG 1C1RA 2FI5E 3P8GA 2FP7B 3SW2B 1GJCB 5E8EH 1YF4A 3KQEA 7ESTE 1OWDA 3AASA 2ZU5A 4YM9A 3BTDE 2W3IA 3A7YA 5TCAA 2C8XB 2QF3A 3ZVEA 4B71A 1BITA 1BUIA 1AKSA 1DPOA 3PMJA 1V2ST 4JMYA 1SGEE 4JZ1A 1AB9C 1LTOA 3V7TA 4BTUB 2OC0A 2BDGA 1HLTH 1LDTT 1SGTA 4Y0ZE 1A5IA 2P3UB 4FXGH 4AZ2B 3MU1A 4B73A 1GI8B 1TA6A 1W0YH 2GD4B 1AWFH 1WQVH 4TPIZ 4RSPA 1W14U 2OC8A 4ZKNU 1O38A 1RTKA 1O2YA 1AUTC 1CA0B 2ZDAH 1TQ7B 1VGCB 2RG3A 5DP3A 2ANWA 1EJNA 3BG4B 5LH8A 1LPGB 2PV9B 1IQNA 4FUJA 2TGDA 5DP9A 3BTTE 4FUGA 3SV9A 2CV3A 3MMGA 2D26C 3NZIA 3MH7A 1ZJDA 1NFYA 2J9NA 1V2TT 8KME2 5JBAS 3RXHA 1RRKA 2ZHDA 2Y5HA 1P10A 2OQ5A 2PGQB 2BX4A 1O32A 2STBE 1BHXB 1J17T 1BTZA 1T8LA 4LOYH 3T29A 1C2HA 3RXIA 3GYLB 2ZU2A 3F68H 1QIXB 4ISIH 5AVDA 1DANH 3SV8A 5A8YA 2PKSB 2J38A 1RGQA 3TJVA 1C1NA 1LKAA 1IQGA 4IBLH 1ELDE 3F9FA 5F8XA 1SQAA 1GBFA 3QGNB 2XC0A 1NRSH 1SBWA 1N6YA 2J94A 4X8VH 4YT7H 1Y5AT 2YNAA 2J2UA 1Z1IA 2JKHA 1GDUA 2Z7FE 3TIUA 1W10U 2BD4A 3MU8A 1ELVA 1P2QA 2GP9B 2AGEX 3RC6A 4ABBA 4CBOA 3A8AA 1OWJA 2M5TA 5A0AE 4BAKB 2EI8A 5EODA 5CE1A 2P59A 2H6MA 1S0QA 1QRZA 4ZHLU 3RU4D 1UHBB 1YPKH 1P11E 2AERH 1EX3A 4DCDA 1W0ZU 3P92A 2G00A 1PJPA 1YKTA 1BBRE 3A7WA 1F7ZA 4DURA 3DD2H 3PYHA 3RXDA 5JB9S 2ZZUH 1EAIA 3SU6A 1C2KA 2FLBH 1GBTA 1GJBB 2GVFA 1FIZA 3TGJE 3E1XB 3GCTG 1V2PT 5ABWA 3BF6H 2QYIA 1P0SH 1H8IH 3GY8A 3VGCB 5C3NA 5JPMH 1UK3A 1OP2A 1MAXA 1AU8A 1P2OA 2B0FA 3LC3A 3FP7E